F495685

General Info

Members Datasets Scaffolds Average Seq Length
1783 637 3566 124

Family's Representative Sequence

Representative Sequence 3300005467|Ga0070706_100001187|Ga0070706_10000118715
Length 128
Sequence MARIAGVDIPREKRVEIALTYIYGIGLTTSQKVLTATRIDPDTRVKNLTEEETARLREYIDRNPDIQVEGDLRRIVDLNIKRLMEINCYRGIRHRRNLPVHGQRTRTNARTRRGAKKTVAGKKKATKK

Samples

Sample ID Description Type Environment
1 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
6 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
7 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
8 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
9 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
10 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
11 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
12 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
13 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
14 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
15 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
16 3300003162 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
17 3300003163 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
18 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
19 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
20 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
21 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
22 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
23 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
24 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
25 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
26 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
27 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
28 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
29 3300004785 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-1 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
30 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
31 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
32 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
33 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
34 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
35 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
36 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
37 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
38 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
39 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
40 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
41 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
42 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
43 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
44 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
45 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
46 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
47 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
48 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
49 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
50 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
51 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
52 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
53 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
54 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
55 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
56 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
57 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
58 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
59 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
60 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
61 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
62 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
63 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
64 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
65 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
66 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
67 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
68 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
69 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
70 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
71 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
72 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
73 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
74 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
75 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
76 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
77 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
78 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
79 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
80 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
81 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
82 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
83 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
84 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
85 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
86 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
87 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
88 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
89 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
90 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
91 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
92 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
93 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
94 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
95 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
96 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
97 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
98 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
99 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
100 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
101 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
102 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
103 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
104 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
105 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
106 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
107 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
108 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
109 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
110 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
111 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
112 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
113 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
114 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
115 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
116 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
117 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
118 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
119 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
120 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
121 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
122 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
123 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
124 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
125 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
126 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
127 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
128 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
129 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
130 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
131 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
132 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
133 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
134 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
135 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
136 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
137 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
138 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
139 3300009984 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_127 metaG Metagenome Rhizosphere
140 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
141 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
142 3300012494 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 Metagenome Rhizosphere
143 3300013044 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
144 3300013045 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
145 3300013052 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
146 3300013059 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
147 3300013062 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
148 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
149 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
150 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
151 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
152 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
153 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
154 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
155 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
156 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
157 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
158 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
159 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
160 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
161 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
162 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
163 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
164 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
165 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
166 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
167 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
168 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
169 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
170 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
171 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
172 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
173 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
174 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
175 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
176 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
177 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
178 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
179 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
180 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
181 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
182 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
183 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
184 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
185 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
186 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
240 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
241 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
242 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
244 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
245 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
246 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
247 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
248 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
249 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
250 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
251 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
252 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
253 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
254 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
255 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
256 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
257 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
258 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
259 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
260 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
261 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
262 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
263 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
264 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
265 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
266 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
267 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
268 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
269 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
270 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
271 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
272 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
273 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
274 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
275 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
276 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
277 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
278 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
279 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
280 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
281 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
282 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
283 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
284 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
285 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
286 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
287 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
288 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
289 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
290 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
291 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
292 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
293 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
294 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
295 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
296 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
297 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
298 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
299 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
300 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
301 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
302 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
303 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
304 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
305 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
306 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
307 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
308 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
309 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
310 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
311 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
312 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
313 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
314 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
315 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
316 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
317 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
318 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
319 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
320 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
321 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
322 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
323 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
324 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
325 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
326 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
327 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
328 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
329 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
330 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
331 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
332 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
333 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
334 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
335 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
336 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
337 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
338 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
339 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
340 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
341 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
342 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
343 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
344 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
345 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
346 3300036457 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
347 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
348 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
349 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
350 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
351 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
352 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
353 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
354 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
355 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
356 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
357 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
358 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
359 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
360 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
361 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
362 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
363 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
364 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
365 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
366 3300041461 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaT Metatranscriptome Rhizoplane
367 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
368 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
369 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
370 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
371 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
372 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
373 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
374 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
375 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
376 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
377 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
378 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
379 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
380 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
381 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
382 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
383 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
384 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
385 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
386 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
387 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
388 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
389 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
390 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
391 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
392 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
393 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
394 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
395 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
396 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
397 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
398 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
399 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
400 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
401 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
402 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
403 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
404 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
405 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
406 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
407 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
408 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
409 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
410 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
411 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
412 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
413 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
414 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
415 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
416 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
417 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
418 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
419 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
420 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
421 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
422 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
423 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
424 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
425 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
426 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
427 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
428 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
429 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
430 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
431 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
432 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
433 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
434 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
435 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
436 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
437 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
438 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
439 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
440 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
441 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
442 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
443 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
444 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
445 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
446 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
447 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
448 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
449 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
450 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
451 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
452 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
453 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
454 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
455 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
456 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
457 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
458 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
459 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
460 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
461 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
462 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
463 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
464 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
465 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
466 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
467 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
468 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
469 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
470 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
471 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
472 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
473 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
474 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
475 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
476 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
477 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
478 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
479 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
480 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
481 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
482 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
483 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
484 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
485 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
486 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
487 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
488 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
489 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
490 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
491 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
492 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
493 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
494 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
495 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
496 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
497 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
498 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
499 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
500 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
501 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
502 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
503 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
504 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
505 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
506 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
507 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
508 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
509 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
510 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
511 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
512 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
513 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
514 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
515 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
516 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
517 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
518 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
519 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
520 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
521 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
522 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
523 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
524 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
525 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
526 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
527 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
528 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
529 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
530 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
531 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
532 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
533 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
534 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
535 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
536 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
537 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
538 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
539 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
540 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
541 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
542 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
543 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
544 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
545 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
546 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
547 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
548 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
549 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
550 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
551 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
552 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
553 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
554 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
555 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
556 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
557 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
558 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
559 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
560 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
561 3300059478 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
562 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
563 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
564 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
565 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
566 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
567 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
568 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
569 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
570 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
571 3300059509 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
572 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
573 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
574 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
575 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
576 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
577 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
578 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
579 3300059628 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 160R_AD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
580 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
581 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
582 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
583 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
584 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
585 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
586 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
587 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
588 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
589 3300059649 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
590 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
591 3300059654 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 148R_CW_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
592 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
593 3300059659 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 157R_AD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
594 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
595 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
596 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
597 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
598 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
599 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
600 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
601 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
602 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
603 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
604 2643221714 Streptomyces sp. Root264 Isolate Unclassified
605 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
606 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
607 2808606448 Streptomyces sp. 193411 Isolate Unclassified
608 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
609 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
610 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
611 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
612 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
613 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
614 2867428634 Streptomyces sp. RP5T Isolate Unclassified
615 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
616 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
617 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
618 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
619 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
620 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
621 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
622 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
623 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
624 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
625 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
626 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
627 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
628 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
629 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
630 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
631 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
632 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
633 8002784119 Frankia sp. AgB1.9 Isolate Nodule
634 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
635 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
636 8033684223 Streptomyces phytophilus PIP175 Isolate Unclassified
637 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 86.03
Metatranscriptomes 11.78
Isolates 2.19

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.85
Nodule 0.06
Rhizoplane 7.12
Rhizosphere 88.5
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070706_100001187 3300005467 Bacteria 27899
2 JGI24746J21847_1010606 3300001977 Bacteria 1362
3 JGI24747J21853_1004561 3300001978 Bacteria 1249
4 JGI24740J21852_10074867 3300001979 Bacteria 898
5 JGI24739J22299_10014218 3300001989 Bacteria 2896
6 JGI24739J22299_10031467 3300001989 Bacteria 1834
7 JGI24737J22298_10014055 3300001990 Bacteria 2600
8 JGI24737J22298_10255683 3300001990 Bacteria 518
9 JGI24750J21931_1025217 3300002070 Bacteria 852
10 JGI24745J21846_1002378 3300002073 Bacteria 1921
11 JGI24738J21930_10026481 3300002075 Bacteria 1190
12 JGI24744J21845_10009983 3300002077 Bacteria 1947
13 JGI24034J26672_10019434 3300002239 Bacteria 1060
14 JGI24742J22300_10008900 3300002244 Bacteria 1655
15 JGI24751J29686_10064209 3300002459 Bacteria 756
16 JGI25162J39368_1003458 3300002737 Bacteria 4543
17 JGI25164J39214_1000679 3300002772 Bacteria 13579
18 Ga0006778J45830_1037313 3300003162 Bacteria 794
19 Ga0006759J45824_1035239 3300003163 Bacteria 815
20 JGI25406J46586_10006196 3300003203 Bacteria 5524
21 JGI25406J46586_10008605 3300003203 Bacteria 4610
22 JGI25165J46597_1000061 3300003214 Bacteria 208362
23 Ga0007416J51690_1057683 3300003577 Bacteria 1204
24 Ga0007429J51699_1088480 3300003579 Bacteria 742
25 Ga0007429J51699_1088481 3300003579 Bacteria 776
26 Ga0032354_1022066 3300003693 Bacteria 1153
27 Ga0055539_1000808 3300003752 Bacteria 7414
28 Ga0055533_1000001 3300003756 Bacteria 1863437
29 Ga0055527_1000017 3300003760 Bacteria 242362
30 Ga0055542_1000044 3300003762 Bacteria 206982
31 Ga0055529_1000279 3300003763 Bacteria 60946
32 Ga0055529_1039149 3300003763 Bacteria 575
33 Ga0055541_1009606 3300003841 Bacteria 1486
34 Ga0058858_1434606 3300004785 Bacteria 717
35 Ga0058859_10032894 3300004798 Bacteria 546
36 Ga0058863_10079837 3300004799 Bacteria 692
37 Ga0058863_10092482 3300004799 Bacteria 1125
38 Ga0058863_11902506 3300004799 Bacteria 1252
39 Ga0058863_11911031 3300004799 Bacteria 689
40 Ga0058861_10002618 3300004800 Bacteria 723
41 Ga0058861_10039056 3300004800 Bacteria 1500
42 Ga0058861_10046230 3300004800 Bacteria 559
43 Ga0058861_10088000 3300004800 Bacteria 1031
44 Ga0058861_11840072 3300004800 Bacteria 735
45 Ga0058861_12025964 3300004800 Bacteria 832
46 Ga0058860_10225518 3300004801 Bacteria 1295
47 Ga0058860_12169112 3300004801 Bacteria 1029
48 Ga0058860_12198917 3300004801 Bacteria 692
49 Ga0058862_10139641 3300004803 Bacteria 1053
50 Ga0058862_10153948 3300004803 Bacteria 600
51 Ga0058862_10202782 3300004803 Bacteria 1521
52 Ga0058862_10277273 3300004803 Bacteria 545
53 Ga0058862_12205953 3300004803 Bacteria 985
54 Ga0058862_12730137 3300004803 Bacteria 1272
55 Ga0065714_10021838 3300005288 Bacteria 1673
56 Ga0070658_10028535 3300005327 Bacteria 4481
57 Ga0070658_10028947 3300005327 Bacteria 4448
58 Ga0070658_10258464 3300005327 Bacteria 1479
59 Ga0070658_10271826 3300005327 Bacteria 1441
60 Ga0070658_11038680 3300005327 Bacteria 713
61 Ga0070676_10224730 3300005328 Bacteria 1242
62 Ga0070676_10414025 3300005328 Bacteria 940
63 Ga0070683_100029975 3300005329 Bacteria 4933
64 Ga0070683_100274263 3300005329 Bacteria 1604
65 Ga0070683_100285358 3300005329 Bacteria 1570
66 Ga0070683_100306297 3300005329 Bacteria 1511
67 Ga0070683_100332725 3300005329 Bacteria 1446
68 Ga0070683_100346506 3300005329 Bacteria 1415
69 Ga0070683_100481930 3300005329 Bacteria 1184
70 Ga0070690_100194908 3300005330 Bacteria 1407
71 Ga0070690_100396542 3300005330 Bacteria 1012
72 Ga0070690_100523026 3300005330 Bacteria 891
73 Ga0070690_100645872 3300005330 Bacteria 808
74 Ga0070690_100835503 3300005330 Bacteria 716
75 Ga0070670_100568059 3300005331 Bacteria 1013
76 Ga0070670_101091103 3300005331 Bacteria 728
77 Ga0070677_10336382 3300005333 Bacteria 778
78 Ga0068869_100012691 3300005334 Bacteria 5573
79 Ga0068869_100062239 3300005334 Bacteria 2739
80 Ga0068869_100168006 3300005334 Bacteria 1712
81 Ga0068869_100509726 3300005334 Bacteria 1006
82 Ga0068869_101838502 3300005334 Bacteria 542
83 Ga0070680_100000015 3300005336 Bacteria 93646
84 Ga0070680_100033020 3300005336 Bacteria 4168
85 Ga0070680_100093789 3300005336 Bacteria 2487
86 Ga0070680_100153032 3300005336 Bacteria 1937
87 Ga0070680_100356170 3300005336 Bacteria 1244
88 Ga0070680_100432224 3300005336 Bacteria 1124
89 Ga0070680_100834179 3300005336 Bacteria 795
90 Ga0070682_100011705 3300005337 Bacteria 5016
91 Ga0070682_100203653 3300005337 Bacteria 1398
92 Ga0070682_100236792 3300005337 Bacteria 1308
93 Ga0070682_100246860 3300005337 Bacteria 1285
94 Ga0068868_100005144 3300005338 Bacteria 9183
95 Ga0068868_100122450 3300005338 Bacteria 2122
96 Ga0068868_100382455 3300005338 Bacteria 1211
97 Ga0068868_100459711 3300005338 Bacteria 1108
98 Ga0070660_100059135 3300005339 Bacteria 2972
99 Ga0070660_100128075 3300005339 Bacteria 2030
100 Ga0070660_100134654 3300005339 Bacteria 1979
101 Ga0070660_100329375 3300005339 Bacteria 1255
102 Ga0070689_100029463 3300005340 Bacteria 4155
103 Ga0070689_100158604 3300005340 Bacteria 1828
104 Ga0070689_100818584 3300005340 Bacteria 820
105 Ga0070691_10003867 3300005341 Bacteria 6767
106 Ga0070691_10024314 3300005341 Bacteria 2816
107 Ga0070691_10043635 3300005341 Bacteria 2125
108 Ga0070691_10206936 3300005341 Bacteria 1033
109 Ga0070687_100127109 3300005343 Bacteria 1467
110 Ga0070687_100232399 3300005343 Bacteria 1135
111 Ga0070687_101369961 3300005343 Bacteria 528
112 Ga0070661_101478697 3300005344 Bacteria 573
113 Ga0070692_10102432 3300005345 Bacteria 1571
114 Ga0070692_10510609 3300005345 Bacteria 781
115 Ga0070692_10621542 3300005345 Bacteria 717
116 Ga0070668_100646667 3300005347 Bacteria 929
117 Ga0070668_100713017 3300005347 Bacteria 885
118 Ga0070668_100729157 3300005347 Bacteria 876
119 Ga0070669_100478705 3300005353 Bacteria 1030
120 Ga0070669_101260253 3300005353 Bacteria 640
121 Ga0070675_100082776 3300005354 Bacteria 2678
122 Ga0070675_100095801 3300005354 Bacteria 2492
123 Ga0070675_100253957 3300005354 Bacteria 1539
124 Ga0070675_100417906 3300005354 Bacteria 1199
125 Ga0070675_100760983 3300005354 Bacteria 884
126 Ga0070675_101504990 3300005354 Bacteria 621
127 Ga0070671_100060488 3300005355 Bacteria 3154
128 Ga0070671_100151685 3300005355 Bacteria 1957
129 Ga0070671_100341891 3300005355 Bacteria 1277
130 Ga0070671_100385131 3300005355 Bacteria 1199
131 Ga0070671_100455397 3300005355 Bacteria 1098
132 Ga0070674_100041590 3300005356 Bacteria 3116
133 Ga0070674_100238837 3300005356 Bacteria 1421
134 Ga0070674_100305444 3300005356 Bacteria 1270
135 Ga0070674_101879946 3300005356 Bacteria 544
136 Ga0070673_100019981 3300005364 Bacteria 4821
137 Ga0070673_100296296 3300005364 Bacteria 1423
138 Ga0070688_100043252 3300005365 Bacteria 2774
139 Ga0070688_100123596 3300005365 Bacteria 1736
140 Ga0070659_100012148 3300005366 Bacteria 6380
141 Ga0070659_100018706 3300005366 Bacteria 5230
142 Ga0070659_100126270 3300005366 Bacteria 2075
143 Ga0070659_100179838 3300005366 Bacteria 1735
144 Ga0070667_100644816 3300005367 Bacteria 978
145 Ga0070667_100882763 3300005367 Bacteria 832
146 Ga0070703_10026297 3300005406 Bacteria 1730
147 Ga0070709_10186968 3300005434 Bacteria 1459
148 Ga0070714_100005269 3300005435 Bacteria 9852
149 Ga0070714_101557988 3300005435 Bacteria 645
150 Ga0070713_100081990 3300005436 Bacteria 2753
151 Ga0070710_10029185 3300005437 Bacteria 2957
152 Ga0070710_10090852 3300005437 Bacteria 1801
153 Ga0070710_10233310 3300005437 Bacteria 1176
154 Ga0070701_10014791 3300005438 Bacteria 3587
155 Ga0070701_10218853 3300005438 Bacteria 1134
156 Ga0070701_10751579 3300005438 Bacteria 661
157 Ga0070711_100019741 3300005439 Bacteria 4329
158 Ga0070711_100030873 3300005439 Bacteria 3552
159 Ga0070705_100012679 3300005440 Bacteria 4292
160 Ga0070705_100064677 3300005440 Bacteria 2186
161 Ga0070705_100117451 3300005440 Bacteria 1711
162 Ga0070705_100212079 3300005440 Bacteria 1335
163 Ga0070705_100856494 3300005440 Bacteria 728
164 Ga0070700_100014624 3300005441 Bacteria 4434
165 Ga0070700_100117428 3300005441 Bacteria 1777
166 Ga0070700_100181285 3300005441 Bacteria 1466
167 Ga0070700_100409710 3300005441 Bacteria 1021
168 Ga0070700_101440306 3300005441 Bacteria 584
169 Ga0070694_100072132 3300005444 Bacteria 2382
170 Ga0070694_100213642 3300005444 Bacteria 1444
171 Ga0070694_100330046 3300005444 Bacteria 1176
172 Ga0070694_100648214 3300005444 Bacteria 854
173 Ga0070708_100015734 3300005445 Bacteria 6252
174 Ga0070708_100127832 3300005445 Bacteria 2350
175 Ga0070708_100737148 3300005445 Bacteria 927
176 Ga0070708_100770417 3300005445 Bacteria 905
177 Ga0070663_100177563 3300005455 Bacteria 1649
178 Ga0070663_100288192 3300005455 Bacteria 1311
179 Ga0070663_100405282 3300005455 Bacteria 1115
180 Ga0070663_100721741 3300005455 Bacteria 849
181 Ga0070663_100739854 3300005455 Bacteria 839
182 Ga0070663_101787956 3300005455 Bacteria 551
183 Ga0070678_100058968 3300005456 Bacteria 2819
184 Ga0070678_100068279 3300005456 Bacteria 2649
185 Ga0070678_100524499 3300005456 Bacteria 1048
186 Ga0070678_100550805 3300005456 Bacteria 1024
187 Ga0070662_100494365 3300005457 Bacteria 1020
188 Ga0070662_100565695 3300005457 Bacteria 954
189 Ga0070681_10128448 3300005458 Bacteria 2467
190 Ga0070681_10166145 3300005458 Bacteria 2129
191 Ga0070681_10377690 3300005458 Bacteria 1328
192 Ga0070681_10471198 3300005458 Bacteria 1168
193 Ga0070681_11316024 3300005458 Bacteria 645
194 Ga0068867_100049389 3300005459 Bacteria 3097
195 Ga0068867_100261733 3300005459 Bacteria 1410
196 Ga0068867_100470533 3300005459 Bacteria 1075
197 Ga0070685_10030710 3300005466 Bacteria 2996
198 Ga0070685_10067598 3300005466 Bacteria 2108
199 Ga0070706_100011787 3300005467 Bacteria 8115
200 Ga0070706_100531095 3300005467 Bacteria 1094
201 Ga0070707_100005867 3300005468 Bacteria 11451
202 Ga0070707_100038225 3300005468 Bacteria 4583
203 Ga0070707_100064600 3300005468 Bacteria 3514
204 Ga0070707_100223342 3300005468 Bacteria 1834
205 Ga0070707_101013754 3300005468 Bacteria 796
206 Ga0070698_100094301 3300005471 Bacteria 2972
207 Ga0070698_100104288 3300005471 Bacteria 2805
208 Ga0070698_102076193 3300005471 Bacteria 522
209 Ga0070699_100058035 3300005518 Bacteria 3352
210 Ga0070679_100025472 3300005530 Bacteria 5805
211 Ga0070679_100038792 3300005530 Bacteria 4736
212 Ga0070679_100575647 3300005530 Bacteria 1070
213 Ga0070679_101455700 3300005530 Bacteria 632
214 Ga0070679_101882188 3300005530 Bacteria 547
215 Ga0070684_100051018 3300005535 Bacteria 3594
216 Ga0070684_100076715 3300005535 Bacteria 2950
217 Ga0070684_100092545 3300005535 Bacteria 2690
218 Ga0070684_100114067 3300005535 Bacteria 2425
219 Ga0070684_100308206 3300005535 Bacteria 1453
220 Ga0070684_100454164 3300005535 Bacteria 1184
221 Ga0070684_100520389 3300005535 Bacteria 1102
222 Ga0070684_100721633 3300005535 Bacteria 930
223 Ga0070697_100025528 3300005536 Bacteria 4713
224 Ga0070697_100055682 3300005536 Bacteria 3216
225 Ga0070697_100098342 3300005536 Bacteria 2428
226 Ga0070697_100316355 3300005536 Bacteria 1344
227 Ga0070697_100758674 3300005536 Bacteria 857
228 Ga0070697_102107727 3300005536 Bacteria 505
229 Ga0068853_100047078 3300005539 Bacteria 3701
230 Ga0068853_100167867 3300005539 Bacteria 1984
231 Ga0068853_100353953 3300005539 Bacteria 1366
232 Ga0068853_101812360 3300005539 Bacteria 592
233 Ga0068853_102263871 3300005539 Bacteria 527
234 Ga0070672_100130525 3300005543 Bacteria 2064
235 Ga0070672_100823102 3300005543 Bacteria 818
236 Ga0070686_100008884 3300005544 Bacteria 5633
237 Ga0070686_100042639 3300005544 Bacteria 2843
238 Ga0070686_100200306 3300005544 Bacteria 1431
239 Ga0070686_100814129 3300005544 Bacteria 754
240 Ga0070695_100156634 3300005545 Bacteria 1595
241 Ga0070695_100206721 3300005545 Bacteria 1406
242 Ga0070695_100577631 3300005545 Bacteria 879
243 Ga0070696_100006963 3300005546 Bacteria 7545
244 Ga0070696_100082401 3300005546 Bacteria 2280
245 Ga0070696_100082497 3300005546 Bacteria 2279
246 Ga0070696_100116381 3300005546 Bacteria 1930
247 Ga0070696_100260895 3300005546 Bacteria 1314
248 Ga0070696_100288614 3300005546 Bacteria 1253
249 Ga0070696_100318727 3300005546 Bacteria 1196
250 Ga0070696_100534091 3300005546 Bacteria 937
251 Ga0070696_100617234 3300005546 Bacteria 876
252 Ga0070696_100885697 3300005546 Bacteria 740
253 Ga0070696_101576902 3300005546 Bacteria 563
254 Ga0070693_100011341 3300005547 Bacteria 4488
255 Ga0070693_100045839 3300005547 Bacteria 2480
256 Ga0070693_100139888 3300005547 Bacteria 1522
257 Ga0070693_100353398 3300005547 Bacteria 1006
258 Ga0070693_100355640 3300005547 Bacteria 1004
259 Ga0070693_100598675 3300005547 Bacteria 795
260 Ga0070665_100355567 3300005548 Bacteria 1470
261 Ga0070665_100360118 3300005548 Bacteria 1460
262 Ga0070704_100016174 3300005549 Bacteria 4709
263 Ga0070704_100866435 3300005549 Bacteria 810
264 Ga0070704_100879611 3300005549 Bacteria 805
265 Ga0068855_100026947 3300005563 Bacteria 6877
266 Ga0068855_100052631 3300005563 Bacteria 4792
267 Ga0068855_100066868 3300005563 Bacteria 4189
268 Ga0068855_101539999 3300005563 Bacteria 682
269 Ga0068855_102164059 3300005563 Bacteria 559
270 Ga0070664_100010033 3300005564 Bacteria 7675
271 Ga0070664_100100347 3300005564 Bacteria 2517
272 Ga0070664_100217308 3300005564 Bacteria 1709
273 Ga0070664_101278998 3300005564 Bacteria 693
274 Ga0070664_101783163 3300005564 Bacteria 584
275 Ga0068857_100129395 3300005577 Bacteria 2276
276 Ga0068857_100481910 3300005577 Bacteria 1162
277 Ga0068857_100670337 3300005577 Bacteria 984
278 Ga0068857_101846732 3300005577 Bacteria 592
279 Ga0068854_100030804 3300005578 Bacteria 3724
280 Ga0068854_101577851 3300005578 Bacteria 598
281 Ga0068856_100048606 3300005614 Bacteria 4181
282 Ga0068856_100061274 3300005614 Bacteria 3716
283 Ga0068856_100102656 3300005614 Bacteria 2853
284 Ga0068856_100230255 3300005614 Bacteria 1868
285 Ga0068856_100290876 3300005614 Bacteria 1650
286 Ga0068856_100366475 3300005614 Bacteria 1459
287 Ga0070702_100016072 3300005615 Bacteria 3833
288 Ga0070702_100161541 3300005615 Bacteria 1449
289 Ga0070702_100234700 3300005615 Bacteria 1234
290 Ga0068852_100082296 3300005616 Bacteria 2860
291 Ga0068852_100132206 3300005616 Bacteria 2299
292 Ga0068852_100302958 3300005616 Bacteria 1547
293 Ga0068852_101304543 3300005616 Bacteria 748
294 Ga0068852_102847750 3300005616 Bacteria 502
295 Ga0068859_100038389 3300005617 Bacteria 4805
296 Ga0068859_101887037 3300005617 Bacteria 660
297 Ga0068864_100083353 3300005618 Bacteria 2808
298 Ga0068864_100571654 3300005618 Bacteria 1094
299 Ga0068866_10036626 3300005718 Bacteria 2404
300 Ga0068866_10136583 3300005718 Bacteria 1402
301 Ga0068866_10712135 3300005718 Bacteria 690
302 Ga0068861_100105850 3300005719 Bacteria 2246
303 Ga0068861_100316610 3300005719 Bacteria 1358
304 Ga0068861_100482997 3300005719 Bacteria 1116
305 Ga0068861_100893563 3300005719 Bacteria 841
306 Ga0068861_101168994 3300005719 Bacteria 742
307 Ga0068861_102551714 3300005719 Bacteria 515
308 Ga0068851_10282940 3300005834 Bacteria 949
309 Ga0068870_10084742 3300005840 Bacteria 1760
310 Ga0068870_10934948 3300005840 Bacteria 614
311 Ga0068863_100260616 3300005841 Bacteria 1676
312 Ga0068863_100344654 3300005841 Bacteria 1450
313 Ga0068858_100046786 3300005842 Bacteria 4010
314 Ga0068858_100161047 3300005842 Bacteria 2113
315 Ga0068858_100693419 3300005842 Bacteria 991
316 Ga0068860_100027971 3300005843 Bacteria 5429
317 Ga0068860_100344499 3300005843 Bacteria 1466
318 Ga0068860_100505616 3300005843 Bacteria 1207
319 Ga0068860_100928713 3300005843 Bacteria 887
320 Ga0068862_100395989 3300005844 Bacteria 1291
321 Ga0068862_100556312 3300005844 Bacteria 1096
322 Ga0068862_101352363 3300005844 Bacteria 715
323 Ga0081455_10047065 3300005937 Bacteria 3738
324 Ga0081455_10236082 3300005937 Bacteria 1346
325 Ga0081539_10003252 3300005985 Bacteria 20412
326 Ga0081539_10012303 3300005985 Bacteria 6619
327 Ga0070717_10033904 3300006028 Bacteria 4122
328 Ga0070717_10047424 3300006028 Bacteria 3520
329 Ga0070717_10241231 3300006028 Bacteria 1594
330 Ga0075364_10055931 3300006051 Bacteria 2582
331 Ga0075432_10015139 3300006058 Bacteria 2629
332 Ga0070716_100545422 3300006173 Bacteria 863
333 Ga0070716_101271164 3300006173 Bacteria 594
334 Ga0070712_100012347 3300006175 Bacteria 5428
335 Ga0070712_100266878 3300006175 Bacteria 1374
336 Ga0097621_100013802 3300006237 Bacteria 6030
337 Ga0097621_100024219 3300006237 Bacteria 4737
338 Ga0097621_100355537 3300006237 Bacteria 1304
339 Ga0097621_100587813 3300006237 Bacteria 1016
340 Ga0097621_100810564 3300006237 Bacteria 868
341 Ga0075370_10264234 3300006353 Bacteria 1021
342 Ga0068871_100027934 3300006358 Bacteria 4418
343 Ga0075428_100000694 3300006844 Bacteria 34739
344 Ga0075428_100004768 3300006844 Bacteria 15015
345 Ga0075428_100294355 3300006844 Bacteria 1746
346 Ga0075428_100587336 3300006844 Bacteria 1190
347 Ga0075433_10043437 3300006852 Bacteria 3901
348 Ga0075433_10080542 3300006852 Bacteria 2871
349 Ga0075433_10178155 3300006852 Bacteria 1891
350 Ga0075433_10210759 3300006852 Bacteria 1727
351 Ga0075433_10345789 3300006852 Bacteria 1314
352 Ga0075434_100007021 3300006871 Bacteria 10385
353 Ga0075434_100233167 3300006871 Bacteria 1860
354 Ga0075434_100260368 3300006871 Bacteria 1754
355 Ga0075434_100261099 3300006871 Bacteria 1751
356 Ga0075434_100268762 3300006871 Bacteria 1725
357 Ga0075434_100278696 3300006871 Bacteria 1692
358 Ga0075434_100438986 3300006871 Bacteria 1327
359 Ga0075434_101034808 3300006871 Bacteria 835
360 Ga0075429_100411179 3300006880 Bacteria 1185
361 Ga0075429_100626261 3300006880 Bacteria 942
362 Ga0068865_100031053 3300006881 Bacteria 3559
363 Ga0068865_100064080 3300006881 Bacteria 2586
364 Ga0068865_100140491 3300006881 Bacteria 1820
365 Ga0068865_100163955 3300006881 Bacteria 1698
366 Ga0068865_102057633 3300006881 Bacteria 519
367 Ga0075436_100073498 3300006914 Bacteria 2366
368 Ga0097620_100038389 3300006931 Bacteria 4805
369 Ga0097620_101887085 3300006931 Bacteria 660
370 Ga0075435_100013055 3300007076 Bacteria 6169
371 Ga0075435_100167058 3300007076 Bacteria 1855
372 Ga0075435_100621124 3300007076 Bacteria 937
373 Ga0075435_100730755 3300007076 Bacteria 861
374 Ga0105240_10142595 3300009093 Bacteria 2863
375 Ga0105240_10535128 3300009093 Bacteria 1298
376 Ga0111539_10008690 3300009094 Bacteria 12890
377 Ga0111539_10148167 3300009094 Bacteria 2748
378 Ga0111539_11913215 3300009094 Bacteria 688
379 Ga0111539_12017782 3300009094 Bacteria 669
380 Ga0105245_10036956 3300009098 Bacteria 4340
381 Ga0105245_10048434 3300009098 Bacteria 3802
382 Ga0105245_10091660 3300009098 Bacteria 2797
383 Ga0105245_10251918 3300009098 Bacteria 1716
384 Ga0105245_10484083 3300009098 Bacteria 1251
385 Ga0105245_10778720 3300009098 Bacteria 994
386 Ga0105245_10874176 3300009098 Bacteria 940
387 Ga0105247_10046136 3300009101 Bacteria 2674
388 Ga0105247_10907461 3300009101 Bacteria 681
389 Ga0114129_10009938 3300009147 Bacteria 13563
390 Ga0114129_10015434 3300009147 Bacteria 10865
391 Ga0114129_10022103 3300009147 Bacteria 9026
392 Ga0105243_10035607 3300009148 Bacteria 3860
393 Ga0105243_10152057 3300009148 Bacteria 1986
394 Ga0105243_10422171 3300009148 Bacteria 1244
395 Ga0105243_10718801 3300009148 Bacteria 976
396 Ga0105243_10955436 3300009148 Bacteria 856
397 Ga0105243_10997357 3300009148 Bacteria 840
398 Ga0105241_10023878 3300009174 Bacteria 4538
399 Ga0105241_10189650 3300009174 Bacteria 1711
400 Ga0105241_10382493 3300009174 Bacteria 1230
401 Ga0105241_10411926 3300009174 Bacteria 1188
402 Ga0105242_10081594 3300009176 Bacteria 2705
403 Ga0105242_10104555 3300009176 Bacteria 2404
404 Ga0105242_10106171 3300009176 Bacteria 2386
405 Ga0105242_10117748 3300009176 Bacteria 2275
406 Ga0105242_10254553 3300009176 Bacteria 1583
407 Ga0105242_10843581 3300009176 Bacteria 911
408 Ga0105242_11392689 3300009176 Bacteria 728
409 Ga0105248_10105254 3300009177 Bacteria 3181
410 Ga0105248_10421419 3300009177 Bacteria 1503
411 Ga0105248_10556440 3300009177 Bacteria 1294
412 Ga0105248_10621293 3300009177 Bacteria 1219
413 Ga0105237_10037185 3300009545 Bacteria 4922
414 Ga0105237_10358146 3300009545 Bacteria 1463
415 Ga0105237_11194597 3300009545 Bacteria 767
416 Ga0105238_10017104 3300009551 Bacteria 7360
417 Ga0105238_10069677 3300009551 Bacteria 3517
418 Ga0105238_10366945 3300009551 Bacteria 1430
419 Ga0105238_10369097 3300009551 Bacteria 1425
420 Ga0105238_10450806 3300009551 Bacteria 1283
421 Ga0105249_10283460 3300009553 Bacteria 1655
422 Ga0105249_10689710 3300009553 Bacteria 1081
423 Ga0105249_10772853 3300009553 Bacteria 1023
424 Ga0105249_11107463 3300009553 Bacteria 862
425 Ga0105249_11995395 3300009553 Bacteria 653
426 Ga0105029_112195 3300009984 Bacteria 666
427 Ga0105239_10226875 3300010375 Bacteria 2095
428 Ga0105239_10389075 3300010375 Bacteria 1577
429 Ga0105239_10427946 3300010375 Bacteria 1500
430 Ga0105239_10442962 3300010375 Bacteria 1473
431 Ga0105239_10466363 3300010375 Bacteria 1434
432 Ga0105239_10557683 3300010375 Bacteria 1305
433 Ga0105239_11495136 3300010375 Bacteria 780
434 Ga0105246_10049177 3300011119 Bacteria 2886
435 Ga0105246_10057920 3300011119 Bacteria 2683
436 Ga0105246_10177519 3300011119 Bacteria 1637
437 Ga0105246_10182799 3300011119 Bacteria 1616
438 Ga0105246_10287073 3300011119 Bacteria 1323
439 Ga0105246_11105564 3300011119 Bacteria 724
440 Ga0157341_1023156 3300012494 Bacteria 626
441 Ga0154019_108401 3300013044 Bacteria 1138
442 Ga0154016_109853 3300013045 Bacteria 723
443 Ga0154014_155088 3300013052 Bacteria 1086
444 Ga0154012_174592 3300013059 Bacteria 1223
445 Ga0154010_169846 3300013062 Bacteria 1093
446 Ga0157373_10129520 3300013100 Bacteria 1774
447 Ga0157373_10252116 3300013100 Bacteria 1248
448 Ga0157373_10269428 3300013100 Bacteria 1205
449 Ga0157371_10917546 3300013102 Bacteria 665
450 Ga0157371_11319145 3300013102 Bacteria 559
451 Ga0157370_10288553 3300013104 Bacteria 1516
452 Ga0157370_10472846 3300013104 Bacteria 1152
453 Ga0157370_10645810 3300013104 Bacteria 967
454 Ga0157370_10868953 3300013104 Bacteria 819
455 Ga0157369_10040784 3300013105 Bacteria 5068
456 Ga0157369_10054751 3300013105 Bacteria 4307
457 Ga0157369_10160525 3300013105 Bacteria 2373
458 Ga0157369_10368741 3300013105 Bacteria 1491
459 Ga0157369_10490498 3300013105 Bacteria 1271
460 Ga0157369_11135253 3300013105 Bacteria 798
461 Ga0157369_11734600 3300013105 Bacteria 634
462 Ga0157374_10524581 3300013296 Bacteria 1190
463 Ga0157374_10959560 3300013296 Bacteria 874
464 Ga0157374_11907935 3300013296 Bacteria 620
465 Ga0157378_10151859 3300013297 Bacteria 2159
466 Ga0157378_10266849 3300013297 Bacteria 1644
467 Ga0157378_10284059 3300013297 Bacteria 1596
468 Ga0157378_10428887 3300013297 Bacteria 1308
469 Ga0157378_10724113 3300013297 Bacteria 1016
470 Ga0157378_11885732 3300013297 Bacteria 647
471 Ga0157378_13075037 3300013297 Bacteria 518
472 Ga0163162_10046453 3300013306 Bacteria 4353
473 Ga0163162_10099425 3300013306 Bacteria 3000
474 Ga0163162_10414718 3300013306 Bacteria 1479
475 Ga0163162_10415409 3300013306 Bacteria 1478
476 Ga0163162_10415666 3300013306 Bacteria 1477
477 Ga0163162_10432833 3300013306 Bacteria 1448
478 Ga0163162_11026675 3300013306 Bacteria 933
479 Ga0163162_11356503 3300013306 Bacteria 809
480 Ga0163162_11863438 3300013306 Bacteria 688
481 Ga0157372_10046776 3300013307 Bacteria 4804
482 Ga0157372_10060128 3300013307 Bacteria 4251
483 Ga0157372_10079691 3300013307 Bacteria 3704
484 Ga0157372_10418862 3300013307 Bacteria 1561
485 Ga0157372_10555161 3300013307 Bacteria 1339
486 Ga0157372_10743218 3300013307 Bacteria 1141
487 Ga0157372_10883289 3300013307 Bacteria 1037
488 Ga0157372_11425747 3300013307 Bacteria 798
489 Ga0157372_11487203 3300013307 Bacteria 780
490 Ga0157372_11630064 3300013307 Bacteria 743
491 Ga0157375_10064914 3300013308 Bacteria 3637
492 Ga0157375_10139200 3300013308 Bacteria 2553
493 Ga0157375_10316555 3300013308 Bacteria 1725
494 Ga0157375_10525836 3300013308 Bacteria 1346
495 Ga0157375_10724968 3300013308 Bacteria 1147
496 Ga0157375_11946183 3300013308 Bacteria 698
497 Ga0163163_10096702 3300014325 Bacteria 2974
498 Ga0163163_10176943 3300014325 Bacteria 2180
499 Ga0163163_10208613 3300014325 Bacteria 2002
500 Ga0163163_10268245 3300014325 Bacteria 1758
501 Ga0163163_10339457 3300014325 Bacteria 1557
502 Ga0163163_11371723 3300014325 Bacteria 769
503 Ga0163163_13039115 3300014325 Bacteria 523
504 Ga0157380_10047519 3300014326 Bacteria 3377
505 Ga0157380_10288228 3300014326 Bacteria 1506
506 Ga0157380_10376954 3300014326 Bacteria 1337
507 Ga0157380_10400833 3300014326 Bacteria 1302
508 Ga0157380_10572893 3300014326 Bacteria 1112
509 Ga0157380_11516359 3300014326 Bacteria 724
510 Ga0157380_11524265 3300014326 Bacteria 722
511 Ga0157380_12711699 3300014326 Bacteria 562
512 Ga0157377_10026594 3300014745 Bacteria 3098
513 Ga0157377_10314041 3300014745 Bacteria 1039
514 Ga0157377_10356594 3300014745 Bacteria 983
515 Ga0157377_10592670 3300014745 Bacteria 789
516 Ga0157377_10928095 3300014745 Bacteria 653
517 Ga0157377_11023182 3300014745 Bacteria 627
518 Ga0157379_10147410 3300014968 Bacteria 2122
519 Ga0157379_10325637 3300014968 Bacteria 1403
520 Ga0157379_10431168 3300014968 Bacteria 1215
521 Ga0157379_10531124 3300014968 Bacteria 1093
522 Ga0157379_11248177 3300014968 Bacteria 716
523 Ga0157379_11739537 3300014968 Bacteria 611
524 Ga0157379_12341885 3300014968 Bacteria 532
525 Ga0157376_10045570 3300014969 Bacteria 3612
526 Ga0157376_10046239 3300014969 Bacteria 3588
527 Ga0157376_10087652 3300014969 Bacteria 2687
528 Ga0157376_10570685 3300014969 Bacteria 1122
529 Ga0157376_11387150 3300014969 Bacteria 734
530 Ga0157376_11728483 3300014969 Bacteria 661
531 Ga0157376_12257065 3300014969 Bacteria 583
532 Ga0163161_10081962 3300017792 Bacteria 2376
533 Ga0163161_10105842 3300017792 Bacteria 2099
534 Ga0163161_12029694 3300017792 Bacteria 511
535 Ga0197907_10050194 3300020069 Bacteria 1325
536 Ga0197907_10086159 3300020069 Bacteria 1008
537 Ga0197907_10212903 3300020069 Bacteria 772
538 Ga0197907_10268076 3300020069 Bacteria 952
539 Ga0197907_10378803 3300020069 Bacteria 1042
540 Ga0197907_10533934 3300020069 Bacteria 1607
541 Ga0197907_10881670 3300020069 Bacteria 764
542 Ga0197907_11286071 3300020069 Bacteria 1575
543 Ga0197907_11298433 3300020069 Bacteria 709
544 Ga0197907_11482061 3300020069 Bacteria 807
545 Ga0206356_10124042 3300020070 Bacteria 611
546 Ga0206356_10200830 3300020070 Bacteria 593
547 Ga0206356_10361125 3300020070 Bacteria 1257
548 Ga0206356_10509057 3300020070 Bacteria 916
549 Ga0206356_10516737 3300020070 Bacteria 5046
550 Ga0206356_10824910 3300020070 Bacteria 2830
551 Ga0206356_10913331 3300020070 Bacteria 1383
552 Ga0206356_11044350 3300020070 Bacteria 657
553 Ga0206356_11156669 3300020070 Bacteria 1263
554 Ga0206356_11286683 3300020070 Bacteria 874
555 Ga0206349_1386548 3300020075 Bacteria 1246
556 Ga0206349_1530271 3300020075 Bacteria 614
557 Ga0206349_1613375 3300020075 Bacteria 1472
558 Ga0206355_1018340 3300020076 Bacteria 583
559 Ga0206355_1035334 3300020076 Bacteria 2191
560 Ga0206355_1055070 3300020076 Bacteria 877
561 Ga0206355_1328705 3300020076 Bacteria 1923
562 Ga0206355_1630452 3300020076 Bacteria 526
563 Ga0206351_10072365 3300020077 Bacteria 2191
564 Ga0206351_10093131 3300020077 Bacteria 1078
565 Ga0206351_10468617 3300020077 Bacteria 1652
566 Ga0206351_10495414 3300020077 Bacteria 1010
567 Ga0206351_10796045 3300020077 Bacteria 952
568 Ga0206351_10858444 3300020077 Bacteria 1021
569 Ga0206352_10254721 3300020078 Bacteria 837
570 Ga0206352_10314452 3300020078 Bacteria 856
571 Ga0206352_10341291 3300020078 Bacteria 602
572 Ga0206352_10408147 3300020078 Bacteria 984
573 Ga0206352_10649957 3300020078 Bacteria 959
574 Ga0206352_10815645 3300020078 Bacteria 1286
575 Ga0206352_10939620 3300020078 Bacteria 793
576 Ga0206352_11168067 3300020078 Bacteria 999
577 Ga0206352_11295788 3300020078 Bacteria 658
578 Ga0206350_10430818 3300020080 Bacteria 1907
579 Ga0206350_10432378 3300020080 Bacteria 1085
580 Ga0206350_10544636 3300020080 Bacteria 3726
581 Ga0206350_11196555 3300020080 Bacteria 1542
582 Ga0206350_11654020 3300020080 Bacteria 1018
583 Ga0206354_10074904 3300020081 Bacteria 569
584 Ga0206354_10208883 3300020081 Bacteria 628
585 Ga0206354_10331979 3300020081 Bacteria 1229
586 Ga0206354_11017939 3300020081 Bacteria 836
587 Ga0206354_11068226 3300020081 Bacteria 586
588 Ga0206354_11172408 3300020081 Bacteria 1283
589 Ga0206354_11291340 3300020081 Bacteria 746
590 Ga0206354_11520797 3300020081 Bacteria 669
591 Ga0206354_11614879 3300020081 Bacteria 605
592 Ga0206353_10014677 3300020082 Bacteria 3231
593 Ga0206353_10282636 3300020082 Bacteria 1565
594 Ga0206353_10330275 3300020082 Bacteria 528
595 Ga0206353_10591683 3300020082 Bacteria 754
596 Ga0206353_10790039 3300020082 Bacteria 511
597 Ga0206353_11192759 3300020082 Bacteria 2000
598 Ga0206353_11631527 3300020082 Bacteria 521
599 Ga0206353_11688786 3300020082 Bacteria 1043
600 Ga0206353_11996101 3300020082 Bacteria 607
601 Ga0154015_1068933 3300020610 Bacteria 884
602 Ga0154015_1105291 3300020610 Bacteria 867
603 Ga0154015_1142575 3300020610 Bacteria 1155
604 Ga0154015_1285479 3300020610 Bacteria 1538
605 Ga0154015_1417016 3300020610 Bacteria 703
606 Ga0154015_1538444 3300020610 Bacteria 734
607 Ga0224712_10001495 3300022467 Bacteria 5409
608 Ga0224712_10011859 3300022467 Bacteria 2720
609 Ga0224712_10015890 3300022467 Bacteria 2459
610 Ga0224712_10024023 3300022467 Bacteria 2124
611 Ga0224712_10038926 3300022467 Bacteria 1779
612 Ga0224712_10101446 3300022467 Bacteria 1221
613 Ga0209566_100066 3300025225 Bacteria 186951
614 Ga0209674_100001 3300025226 Bacteria 4013750
615 Ga0209672_100039 3300025228 Bacteria 283064
616 Ga0209147_100954 3300025229 Bacteria 12700
617 Ga0209563_100001 3300025230 Bacteria 4013775
618 Ga0207427_100042 3300025231 Bacteria 254170
619 Ga0209437_100538 3300025233 Bacteria 26230
620 Ga0209258_101761 3300025242 Bacteria 6673
621 Ga0209677_100001 3300025253 Bacteria 4013787
622 Ga0209677_102161 3300025253 Bacteria 7674
623 Ga0209148_1000004 3300025254 Bacteria 1844481
624 Ga0209233_1000001 3300025261 Bacteria 2992747
625 Ga0209455_1000117 3300025272 Bacteria 176940
626 Ga0209455_1003952 3300025272 Bacteria 5035
627 Ga0207697_10119287 3300025315 Bacteria 1134
628 Ga0207656_10013795 3300025321 Bacteria 3098
629 Ga0207653_10047439 3300025885 Bacteria 1422
630 Ga0207692_10007776 3300025898 Bacteria 4407
631 Ga0207692_10288443 3300025898 Bacteria 995
632 Ga0207642_10204023 3300025899 Bacteria 1094
633 Ga0207642_10773310 3300025899 Bacteria 609
634 Ga0207642_10836266 3300025899 Bacteria 587
635 Ga0207710_10436641 3300025900 Bacteria 675
636 Ga0207688_10003165 3300025901 Bacteria 8975
637 Ga0207688_10016881 3300025901 Bacteria 3965
638 Ga0207688_10036391 3300025901 Bacteria 2728
639 Ga0207688_10167179 3300025901 Bacteria 1306
640 Ga0207680_10598528 3300025903 Bacteria 788
641 Ga0207647_10021889 3300025904 Bacteria 4256
642 Ga0207647_10028990 3300025904 Bacteria 3588
643 Ga0207647_10090838 3300025904 Bacteria 1821
644 Ga0207685_10619191 3300025905 Bacteria 582
645 Ga0207699_10099923 3300025906 Bacteria 1839
646 Ga0207645_10064369 3300025907 Bacteria 2343
647 Ga0207645_10137521 3300025907 Bacteria 1591
648 Ga0207645_10149679 3300025907 Bacteria 1523
649 Ga0207643_10011474 3300025908 Bacteria 4785
650 Ga0207643_10048389 3300025908 Bacteria 2408
651 Ga0207643_10050065 3300025908 Bacteria 2368
652 Ga0207643_10199074 3300025908 Bacteria 1219
653 Ga0207643_10202123 3300025908 Bacteria 1210
654 Ga0207705_10013197 3300025909 Bacteria 5964
655 Ga0207705_10120089 3300025909 Bacteria 1950
656 Ga0207705_10202859 3300025909 Bacteria 1503
657 Ga0207684_10002793 3300025910 Bacteria 17346
658 Ga0207684_10018534 3300025910 Bacteria 5958
659 Ga0207684_10116254 3300025910 Bacteria 2291
660 Ga0207684_10745082 3300025910 Bacteria 831
661 Ga0207684_10830059 3300025910 Bacteria 780
662 Ga0207684_10897040 3300025910 Bacteria 745
663 Ga0207654_10060489 3300025911 Bacteria 2213
664 Ga0207654_10081460 3300025911 Bacteria 1949
665 Ga0207654_10873031 3300025911 Bacteria 651
666 Ga0207707_10112966 3300025912 Bacteria 2374
667 Ga0207707_10115185 3300025912 Bacteria 2349
668 Ga0207707_10471034 3300025912 Bacteria 1073
669 Ga0207707_10547397 3300025912 Bacteria 983
670 Ga0207707_10689187 3300025912 Bacteria 859
671 Ga0207695_10129689 3300025913 Bacteria 2480
672 Ga0207671_10080469 3300025914 Bacteria 2442
673 Ga0207671_10508695 3300025914 Bacteria 960
674 Ga0207693_10022846 3300025915 Bacteria 4966
675 Ga0207693_10258912 3300025915 Bacteria 1364
676 Ga0207693_10900110 3300025915 Bacteria 679
677 Ga0207693_10910752 3300025915 Bacteria 674
678 Ga0207663_10011677 3300025916 Bacteria 4727
679 Ga0207663_11442947 3300025916 Bacteria 554
680 Ga0207660_10000002 3300025917 Bacteria 883566
681 Ga0207660_10117448 3300025917 Bacteria 2011
682 Ga0207660_10197986 3300025917 Bacteria 1568
683 Ga0207660_10318694 3300025917 Bacteria 1241
684 Ga0207660_11056144 3300025917 Bacteria 662
685 Ga0207662_10397766 3300025918 Bacteria 933
686 Ga0207657_10001055 3300025919 Bacteria 29226
687 Ga0207657_10031572 3300025919 Bacteria 4797
688 Ga0207657_10044718 3300025919 Bacteria 3891
689 Ga0207657_10171230 3300025919 Bacteria 1759
690 Ga0207657_10404575 3300025919 Bacteria 1073
691 Ga0207649_10730382 3300025920 Bacteria 769
692 Ga0207649_10978365 3300025920 Bacteria 665
693 Ga0207652_10015058 3300025921 Bacteria 6274
694 Ga0207652_10079196 3300025921 Bacteria 2870
695 Ga0207652_10447665 3300025921 Bacteria 1164
696 Ga0207652_10542269 3300025921 Bacteria 1046
697 Ga0207646_10028575 3300025922 Bacteria 5073
698 Ga0207646_10037146 3300025922 Bacteria 4392
699 Ga0207646_10048634 3300025922 Bacteria 3801
700 Ga0207646_10067220 3300025922 Bacteria 3200
701 Ga0207681_10357039 3300025923 Bacteria 1171
702 Ga0207681_10982571 3300025923 Bacteria 708
703 Ga0207694_10006100 3300025924 Bacteria 9215
704 Ga0207694_10010017 3300025924 Bacteria 7144
705 Ga0207694_10079437 3300025924 Bacteria 2573
706 Ga0207694_10261073 3300025924 Bacteria 1419
707 Ga0207694_10321104 3300025924 Bacteria 1278
708 Ga0207650_10263591 3300025925 Bacteria 1398
709 Ga0207650_10358983 3300025925 Bacteria 1200
710 Ga0207659_10083284 3300025926 Bacteria 2371
711 Ga0207659_10100407 3300025926 Bacteria 2180
712 Ga0207659_10659337 3300025926 Bacteria 895
713 Ga0207687_10000332 3300025927 Bacteria 31692
714 Ga0207687_10068636 3300025927 Bacteria 2526
715 Ga0207687_10076469 3300025927 Bacteria 2405
716 Ga0207687_10486464 3300025927 Bacteria 1028
717 Ga0207687_11125178 3300025927 Bacteria 675
718 Ga0207687_11342338 3300025927 Bacteria 615
719 Ga0207687_11533538 3300025927 Bacteria 572
720 Ga0207700_10199007 3300025928 Bacteria 1687
721 Ga0207700_11333167 3300025928 Bacteria 639
722 Ga0207664_10004696 3300025929 Bacteria 9271
723 Ga0207664_10106499 3300025929 Bacteria 2325
724 Ga0207644_10862613 3300025931 Bacteria 758
725 Ga0207644_10987685 3300025931 Bacteria 706
726 Ga0207690_10043139 3300025932 Bacteria 2967
727 Ga0207690_10096274 3300025932 Bacteria 2104
728 Ga0207690_10623211 3300025932 Bacteria 882
729 Ga0207690_11518080 3300025932 Bacteria 560
730 Ga0207706_10012543 3300025933 Bacteria 7718
731 Ga0207706_10196299 3300025933 Bacteria 1771
732 Ga0207706_10199972 3300025933 Bacteria 1753
733 Ga0207706_10482472 3300025933 Bacteria 1071
734 Ga0207706_10603301 3300025933 Bacteria 943
735 Ga0207686_10020647 3300025934 Bacteria 3766
736 Ga0207686_10059068 3300025934 Bacteria 2421
737 Ga0207686_10465798 3300025934 Bacteria 975
738 Ga0207686_10991413 3300025934 Bacteria 681
739 Ga0207686_11206580 3300025934 Bacteria 619
740 Ga0207709_10020150 3300025935 Bacteria 3759
741 Ga0207709_10136935 3300025935 Bacteria 1678
742 Ga0207709_10179787 3300025935 Bacteria 1493
743 Ga0207709_10254716 3300025935 Bacteria 1284
744 Ga0207709_10554129 3300025935 Bacteria 905
745 Ga0207709_10575743 3300025935 Bacteria 889
746 Ga0207709_10593553 3300025935 Bacteria 876
747 Ga0207670_10055965 3300025936 Bacteria 2668
748 Ga0207670_10225281 3300025936 Bacteria 1437
749 Ga0207669_10039257 3300025937 Bacteria 2734
750 Ga0207669_10101044 3300025937 Bacteria 1907
751 Ga0207669_10174457 3300025937 Bacteria 1534
752 Ga0207669_10194744 3300025937 Bacteria 1465
753 Ga0207704_10061699 3300025938 Bacteria 2327
754 Ga0207704_10111612 3300025938 Bacteria 1849
755 Ga0207704_10412076 3300025938 Bacteria 1069
756 Ga0207704_10521277 3300025938 Bacteria 961
757 Ga0207665_10159641 3300025939 Bacteria 1621
758 Ga0207665_11145254 3300025939 Bacteria 620
759 Ga0207691_10138961 3300025940 Bacteria 2141
760 Ga0207691_10221557 3300025940 Bacteria 1640
761 Ga0207691_10527891 3300025940 Bacteria 1001
762 Ga0207691_11386318 3300025940 Bacteria 578
763 Ga0207711_10110582 3300025941 Bacteria 2443
764 Ga0207711_10113217 3300025941 Bacteria 2415
765 Ga0207711_10325705 3300025941 Bacteria 1420
766 Ga0207711_10488048 3300025941 Bacteria 1148
767 Ga0207689_10021685 3300025942 Bacteria 5403
768 Ga0207689_10029116 3300025942 Bacteria 4615
769 Ga0207689_10095522 3300025942 Bacteria 2441
770 Ga0207661_10000189 3300025944 Bacteria 40034
771 Ga0207661_10016251 3300025944 Bacteria 5489
772 Ga0207661_10030780 3300025944 Bacteria 4137
773 Ga0207661_10283621 3300025944 Bacteria 1481
774 Ga0207661_10508833 3300025944 Bacteria 1100
775 Ga0207661_10529277 3300025944 Bacteria 1078
776 Ga0207661_10772628 3300025944 Bacteria 884
777 Ga0207661_10966456 3300025944 Bacteria 784
778 Ga0207661_11445882 3300025944 Bacteria 630
779 Ga0207679_10216472 3300025945 Bacteria 1609
780 Ga0207679_10246993 3300025945 Bacteria 1515
781 Ga0207679_10673327 3300025945 Bacteria 937
782 Ga0207679_10700184 3300025945 Bacteria 919
783 Ga0207667_10011493 3300025949 Bacteria 10284
784 Ga0207667_10266250 3300025949 Bacteria 1752
785 Ga0207667_11307650 3300025949 Bacteria 701
786 Ga0207651_10602306 3300025960 Bacteria 960
787 Ga0207651_10793014 3300025960 Bacteria 839
788 Ga0207651_11378465 3300025960 Bacteria 634
789 Ga0207651_11583715 3300025960 Bacteria 590
790 Ga0207712_10153966 3300025961 Bacteria 1779
791 Ga0207712_10653681 3300025961 Bacteria 914
792 Ga0207712_10671211 3300025961 Bacteria 902
793 Ga0207712_11326639 3300025961 Bacteria 643
794 Ga0207640_10018900 3300025981 Bacteria 4059
795 Ga0207640_10063865 3300025981 Bacteria 2449
796 Ga0207640_10266741 3300025981 Bacteria 1337
797 Ga0207640_10616263 3300025981 Bacteria 921
798 Ga0207658_10125019 3300025986 Bacteria 2057
799 Ga0207658_10691348 3300025986 Bacteria 921
800 Ga0207677_10063649 3300026023 Bacteria 2565
801 Ga0207677_10114794 3300026023 Bacteria 2013
802 Ga0207677_10542254 3300026023 Bacteria 1012
803 Ga0207677_10566713 3300026023 Bacteria 992
804 Ga0207677_10696072 3300026023 Bacteria 901
805 Ga0207677_10723305 3300026023 Bacteria 885
806 Ga0207703_10074488 3300026035 Bacteria 2811
807 Ga0207703_11458167 3300026035 Bacteria 658
808 Ga0207639_10430698 3300026041 Bacteria 1194
809 Ga0207639_10764363 3300026041 Bacteria 899
810 Ga0207678_10112985 3300026067 Bacteria 2317
811 Ga0207678_10146870 3300026067 Bacteria 2013
812 Ga0207678_10330038 3300026067 Bacteria 1313
813 Ga0207678_10353523 3300026067 Bacteria 1267
814 Ga0207678_10509204 3300026067 Bacteria 1050
815 Ga0207678_10587647 3300026067 Bacteria 976
816 Ga0207678_10993361 3300026067 Bacteria 743
817 Ga0207708_10026038 3300026075 Bacteria 4425
818 Ga0207708_10090013 3300026075 Bacteria 2365
819 Ga0207708_10118012 3300026075 Bacteria 2065
820 Ga0207708_10153468 3300026075 Bacteria 1815
821 Ga0207708_10213965 3300026075 Bacteria 1542
822 Ga0207708_10321121 3300026075 Bacteria 1264
823 Ga0207708_10324981 3300026075 Bacteria 1256
824 Ga0207708_10568282 3300026075 Bacteria 958
825 Ga0207702_10033880 3300026078 Bacteria 4268
826 Ga0207702_10042541 3300026078 Bacteria 3811
827 Ga0207702_10149288 3300026078 Bacteria 2125
828 Ga0207702_10158054 3300026078 Bacteria 2068
829 Ga0207702_10503454 3300026078 Bacteria 1181
830 Ga0207702_10846700 3300026078 Bacteria 905
831 Ga0207702_11296370 3300026078 Bacteria 722
832 Ga0207641_10049012 3300026088 Bacteria 3568
833 Ga0207641_10308358 3300026088 Bacteria 1497
834 Ga0207648_10078065 3300026089 Bacteria 2888
835 Ga0207648_10151012 3300026089 Bacteria 2050
836 Ga0207648_10228692 3300026089 Bacteria 1654
837 Ga0207648_10334264 3300026089 Bacteria 1363
838 Ga0207676_10065702 3300026095 Bacteria 2889
839 Ga0207676_10140024 3300026095 Bacteria 2070
840 Ga0207676_10851219 3300026095 Bacteria 892
841 Ga0207674_10134020 3300026116 Bacteria 2440
842 Ga0207674_10162985 3300026116 Bacteria 2184
843 Ga0207674_10168198 3300026116 Bacteria 2146
844 Ga0207674_10455687 3300026116 Bacteria 1236
845 Ga0207674_10532577 3300026116 Bacteria 1135
846 Ga0207675_100082898 3300026118 Bacteria 3007
847 Ga0207675_100166279 3300026118 Bacteria 2107
848 Ga0207675_100195629 3300026118 Bacteria 1941
849 Ga0207675_101470333 3300026118 Bacteria 702
850 Ga0207683_10008575 3300026121 Bacteria 8749
851 Ga0207683_10067303 3300026121 Bacteria 3159
852 Ga0207683_10154003 3300026121 Bacteria 2076
853 Ga0207683_10358518 3300026121 Bacteria 1339
854 Ga0207683_10427335 3300026121 Bacteria 1220
855 Ga0207683_10461075 3300026121 Bacteria 1172
856 Ga0207683_10515193 3300026121 Bacteria 1105
857 Ga0207683_10740649 3300026121 Bacteria 912
858 Ga0207683_10957018 3300026121 Bacteria 795
859 Ga0207683_12149743 3300026121 Bacteria 506
860 Ga0207698_10020583 3300026142 Bacteria 4544
861 Ga0207698_10324013 3300026142 Bacteria 1444
862 Ga0209973_1020452 3300027252 Bacteria 874
863 Ga0209969_1032723 3300027360 Bacteria 797
864 Ga0209967_1013822 3300027364 Bacteria 1147
865 Ga0209996_1031334 3300027395 Bacteria 774
866 Ga0209995_1064474 3300027471 Bacteria 625
867 Ga0209968_1014896 3300027526 Bacteria 1226
868 Ga0209999_1010955 3300027543 Bacteria 1639
869 Ga0209982_1034364 3300027552 Bacteria 802
870 Ga0210002_1018339 3300027617 Bacteria 1118
871 Ga0209983_1058714 3300027665 Bacteria 848
872 Ga0209971_1007217 3300027682 Bacteria 2636
873 Ga0209966_1025954 3300027695 Bacteria 1165
874 Ga0209998_10007811 3300027717 Bacteria 2220
875 Ga0209998_10024310 3300027717 Bacteria 1314
876 Ga0209974_10019832 3300027876 Bacteria 2229
877 Ga0207428_10000181 3300027907 Bacteria 88299
878 Ga0268266_10338848 3300028379 Bacteria 1411
879 Ga0268266_10958393 3300028379 Bacteria 828
880 Ga0268265_10321086 3300028380 Bacteria 1402
881 Ga0268265_10997499 3300028380 Bacteria 827
882 Ga0268264_10102520 3300028381 Bacteria 2490
883 Ga0268264_10569197 3300028381 Bacteria 1113
884 Ga0268264_10591831 3300028381 Bacteria 1092
885 Ga0268264_10756906 3300028381 Bacteria 968
886 Ga0268264_11401749 3300028381 Bacteria 709
887 Ga0265337_1016621 3300028556 Bacteria 2373
888 Ga0265337_1035179 3300028556 Bacteria 1469
889 Ga0265326_10014445 3300028558 Bacteria 2300
890 Ga0265319_1000855 3300028563 Bacteria 19414
891 Ga0265319_1101346 3300028563 Bacteria 904
892 Ga0265334_10030082 3300028573 Bacteria 2175
893 Ga0265318_10033646 3300028577 Bacteria 1977
894 Ga0265323_10078944 3300028653 Bacteria 1114
895 Ga0265322_10010856 3300028654 Bacteria 2644
896 Ga0265336_10167246 3300028666 Bacteria 654
897 Ga0265338_10030239 3300028800 Bacteria 5344
898 Ga0265338_10739638 3300028800 Bacteria 677
899 Ga0265324_10006460 3300029957 Bacteria 4886
900 Ga0265324_10017063 3300029957 Bacteria 2642
901 Ga0265330_10010314 3300031235 Bacteria 4409
902 Ga0265330_10013785 3300031235 Bacteria 3761
903 Ga0265332_10023897 3300031238 Bacteria 2693
904 Ga0265332_10030283 3300031238 Bacteria 2364
905 Ga0265332_10153172 3300031238 Bacteria 964
906 Ga0265320_10002674 3300031240 Bacteria 12328
907 Ga0265320_10004554 3300031240 Bacteria 9068
908 Ga0265325_10004083 3300031241 Bacteria 9300
909 Ga0265329_10003710 3300031242 Bacteria 6583
910 Ga0265329_10004401 3300031242 Bacteria 5872
911 Ga0265340_10004482 3300031247 Bacteria 7797
912 Ga0265339_10098430 3300031249 Bacteria 1525
913 Ga0265327_10003480 3300031251 Bacteria 14979
914 Ga0265327_10075274 3300031251 Bacteria 1679
915 Ga0265316_10007887 3300031344 Bacteria 9962
916 Ga0265316_10023310 3300031344 Bacteria 5201
917 Ga0265316_10059571 3300031344 Bacteria 2969
918 Ga0265313_10053419 3300031595 Bacteria 1923
919 Ga0307514_10020272 3300031649 Bacteria 5427
920 Ga0316575_10006117 3300031665 Bacteria 4320
921 Ga0316575_10317684 3300031665 Bacteria 660
922 Ga0316579_10023159 3300031691 Bacteria 2784
923 Ga0316579_10066726 3300031691 Bacteria 1699
924 Ga0316579_10130380 3300031691 Bacteria 1211
925 Ga0316579_10145130 3300031691 Bacteria 1144
926 Ga0316579_10219317 3300031691 Bacteria 920
927 Ga0316579_10503885 3300031691 Bacteria 586
928 Ga0265314_10016170 3300031711 Bacteria 5907
929 Ga0265314_10116285 3300031711 Bacteria 1691
930 Ga0265342_10001795 3300031712 Bacteria 19520
931 Ga0265342_10034561 3300031712 Bacteria 3101
932 Ga0316576_10037846 3300031727 Bacteria 3456
933 Ga0316576_10043431 3300031727 Bacteria 3243
934 Ga0316576_10074501 3300031727 Bacteria 2510
935 Ga0316576_10076538 3300031727 Bacteria 2476
936 Ga0316576_10240448 3300031727 Bacteria 1360
937 Ga0316576_10689990 3300031727 Bacteria 740
938 Ga0316578_10100243 3300031728 Bacteria 1736
939 Ga0316578_10132551 3300031728 Bacteria 1500
940 Ga0316578_10445361 3300031728 Bacteria 765
941 Ga0307405_11648287 3300031731 Bacteria 567
942 Ga0316577_10017827 3300031733 Bacteria 3924
943 Ga0316577_10083780 3300031733 Bacteria 1783
944 Ga0316577_10092089 3300031733 Bacteria 1697
945 Ga0316577_10224268 3300031733 Bacteria 1063
946 Ga0316577_10232320 3300031733 Bacteria 1043
947 Ga0316577_10249295 3300031733 Bacteria 1005
948 Ga0316577_10305216 3300031733 Bacteria 902
949 Ga0316577_10520103 3300031733 Bacteria 676
950 Ga0307410_10454535 3300031852 Bacteria 1045
951 Ga0307412_11506679 3300031911 Bacteria 612
952 Ga0307409_100096715 3300031995 Bacteria 2437
953 Ga0307409_100548092 3300031995 Bacteria 1135
954 Ga0307409_101808684 3300031995 Bacteria 640
955 Ga0307416_100613719 3300032002 Bacteria 1169
956 Ga0307416_100855774 3300032002 Bacteria 1007
957 Ga0307415_100625789 3300032126 Bacteria 961
958 Ga0316583_10023673 3300032133 Bacteria 2192
959 Ga0316583_10061258 3300032133 Bacteria 1319
960 Ga0316585_10004351 3300032137 Bacteria 3939
961 Ga0316585_10091378 3300032137 Bacteria 995
962 Ga0316585_10181001 3300032137 Bacteria 696
963 Ga0316593_10053135 3300032168 Bacteria 1372
964 Ga0316593_10120476 3300032168 Bacteria 942
965 Ga0316593_10250320 3300032168 Bacteria 663
966 Ga0316593_10367576 3300032168 Bacteria 552
967 Ga0316592_1013793 3300033524 Bacteria 1671
968 Ga0316592_1021646 3300033524 Bacteria 1370
969 Ga0316592_1026831 3300033524 Bacteria 1244
970 Ga0316592_1096925 3300033524 Bacteria 677
971 Ga0316586_1058871 3300033527 Bacteria 696
972 Ga0316587_1081568 3300033529 Bacteria 612
973 Ga0316596_1025941 3300033541 Bacteria 1509
974 Ga0316596_1040913 3300033541 Bacteria 1218
975 Ga0316596_1058524 3300033541 Bacteria 1026
976 Ga0316596_1130116 3300033541 Bacteria 687
977 Ga0316596_1146706 3300033541 Bacteria 647
978 Ga0373948_0133675 3300034817 Bacteria 609
979 Ga0373959_0036141 3300034820 Bacteria 1018
980 Ga0373959_0037465 3300034820 Bacteria 1005
981 Ga0373959_0117360 3300034820 Bacteria 648
982 Ga0373938_0029372 3300034957 Bacteria 1167
983 Ga0373926_0098922 3300035083 Bacteria 1089
984 Ga0373929_0133040 3300035085 Bacteria 654
985 Ga0373934_0069319 3300035086 Bacteria 1409
986 Ga0373940_0077785 3300035088 Bacteria 976
987 Ga0373944_0317673 3300035089 Bacteria 587
988 Ga0373949_0048275 3300035090 Bacteria 1066
989 Ga0373949_0076228 3300035090 Bacteria 886
990 Ga0373951_0017339 3300035091 Bacteria 1629
991 Ga0373952_0009679 3300035092 Bacteria 1851
992 Ga0373952_0029204 3300035092 Bacteria 1214
993 Ga0373952_0089127 3300035092 Bacteria 799
994 Ga0373952_0110733 3300035092 Bacteria 735
995 Ga0373923_0007437 3300035111 Bacteria 3851
996 Ga0373932_0013656 3300035112 Bacteria 2026
997 Ga0373932_0075009 3300035112 Bacteria 1057
998 Ga0373936_0273187 3300035113 Bacteria 759
999 Ga0373941_0043255 3300035115 Bacteria 1401
1000 Ga0373941_0068497 3300035115 Bacteria 1172
1001 Ga0373941_0148827 3300035115 Bacteria 857
1002 Ga0373945_0092711 3300035116 Bacteria 1171
1003 Ga0373945_0157657 3300035116 Bacteria 924
1004 Ga0373953_0038654 3300035117 Bacteria 1889
1005 Ga0373953_0091225 3300035117 Bacteria 1275
1006 Ga0373954_0023325 3300035118 Bacteria 2813
1007 Ga0373956_0264297 3300035119 Bacteria 818
1008 Ga0373956_0525352 3300035119 Bacteria 565
1009 Ga0373957_0010245 3300035120 Bacteria 3092
1010 Ga0373957_0134599 3300035120 Bacteria 1008
1011 Ga0373957_0152183 3300035120 Bacteria 950
1012 Ga0373960_0125435 3300035121 Bacteria 856
1013 Ga0373943_0004020 3300035170 Bacteria 6689
1014 Ga0373943_0416805 3300035170 Bacteria 777
1015 Ga0373943_0761783 3300035170 Bacteria 575
1016 Ga0373946_0028376 3300035171 Bacteria 2219
1017 Ga0373955_0106446 3300035172 Bacteria 1617
1018 Ga0373955_0575158 3300035172 Bacteria 689
1019 Ga0373942_0006705 3300035207 Bacteria 2660
1020 Ga0373942_0276851 3300035207 Bacteria 577
1021 Ga0373961_0032995 3300035241 Bacteria 1456
1022 Ga0373961_0197210 3300035241 Bacteria 708
1023 Ga0373962_0057119 3300035242 Bacteria 1138
1024 Ga0373962_0083237 3300035242 Bacteria 975
1025 Ga0373962_0148661 3300035242 Bacteria 766
1026 Ga0316574_0071591 3300035398 Bacteria 2190
1027 Ga0316574_0098761 3300035398 Bacteria 1867
1028 Ga0316574_0172997 3300035398 Bacteria 1390
1029 Ga0316574_0224946 3300035398 Bacteria 1202
1030 Ga0316574_0232470 3300035398 Bacteria 1179
1031 Ga0316574_0392708 3300035398 Bacteria 874
1032 Ga0316574_0427029 3300035398 Bacteria 832
1033 Ga0373924_0037789 3300035410 Bacteria 1967
1034 Ga0373924_0231086 3300035410 Bacteria 818
1035 Ga0373931_0029997 3300035691 Bacteria 2797
1036 Ga0373931_0116969 3300035691 Bacteria 1519
1037 Ga0373931_0126812 3300035691 Bacteria 1465
1038 Ga0373931_1135771 3300035691 Bacteria 533
1039 Ga0373935_0012638 3300035692 Bacteria 5079
1040 Ga0373927_0308574 3300035695 Bacteria 1041
1041 Ga0373933_0181960 3300035724 Bacteria 1341
1042 Ga0373933_0412599 3300035724 Bacteria 882
1043 Ga0373947_0015474 3300035725 Bacteria 4380
1044 Ga0373947_0101636 3300035725 Bacteria 1808
1045 Ga0373947_0245579 3300035725 Bacteria 1182
1046 Ga0373937_0278938 3300036401 Bacteria 1578
1047 Ga0373937_0445807 3300036401 Bacteria 1229
1048 Ga0373937_0516876 3300036401 Bacteria 1134
1049 Ga0373937_0708534 3300036401 Bacteria 953
1050 Ga0373937_0744223 3300036401 Bacteria 928
1051 Ga0265778_022895 3300036457 Bacteria 780
1052 Ga0316582_0016976 3300036647 Bacteria 4199
1053 Ga0316582_0019246 3300036647 Bacteria 3992
1054 Ga0316582_0180659 3300036647 Bacteria 1435
1055 Ga0316582_0240395 3300036647 Bacteria 1240
1056 Ga0316582_0435598 3300036647 Bacteria 903
1057 Ga0316582_0493860 3300036647 Bacteria 843
1058 Ga0316582_0790219 3300036647 Bacteria 650
1059 Ga0316584_0003848 3300036712 Bacteria 9841
1060 Ga0316584_0008456 3300036712 Bacteria 7094
1061 Ga0316584_0032481 3300036712 Bacteria 3864
1062 Ga0316584_0122179 3300036712 Bacteria 1946
1063 Ga0316584_0225132 3300036712 Bacteria 1376
1064 Ga0316584_0229218 3300036712 Bacteria 1362
1065 Ga0316584_0278001 3300036712 Bacteria 1217
1066 Ga0316584_0359630 3300036712 Bacteria 1044
1067 Ga0316584_0361671 3300036712 Bacteria 1040
1068 Ga0316584_0863698 3300036712 Bacteria 611
1069 Ga0373925_0013236 3300037068 Bacteria 5970
1070 Ga0373925_1026623 3300037068 Bacteria 679
1071 Ga0395899_0166028 3300037312 Bacteria 1557
1072 Ga0395900_0061899 3300037418 Bacteria 3847
1073 Ga0395900_0078136 3300037418 Bacteria 3401
1074 Ga0395900_0103562 3300037418 Bacteria 2923
1075 Ga0395900_0113402 3300037418 Bacteria 2782
1076 Ga0395898_0000381 3300037466 Bacteria 97274
1077 Ga0395898_0240350 3300037466 Bacteria 1727
1078 Ga0395905_0518375 3300037471 Bacteria 1093
1079 Ga0395905_0822163 3300037471 Bacteria 832
1080 Ga0316581_0002334 3300037588 Bacteria 4514
1081 Ga0316581_0030105 3300037588 Bacteria 1632
1082 Ga0316581_0060460 3300037588 Bacteria 1162
1083 Ga0395901_0150442 3300038443 Bacteria 2446
1084 Ga0395901_0172994 3300038443 Bacteria 2266
1085 Ga0395901_0233292 3300038443 Bacteria 1921
1086 Ga0395901_0492651 3300038443 Bacteria 1249
1087 Ga0242420_122642 3300038996 Bacteria 568
1088 Ga0242420_165300 3300038996 Bacteria 503
1089 Ga0400489_12849 3300039093 Bacteria 1605
1090 Ga0436365_0144673 3300039437 Bacteria 1603
1091 Ga0436365_1046517 3300039437 Bacteria 847
1092 Ga0436361_0793921 3300039447 Bacteria 537
1093 Ga0436363_0126624 3300039450 Bacteria 569
1094 Ga0436362_0739222 3300039453 Bacteria 621
1095 Ga0439465_0020112 3300041413 Bacteria 2089
1096 Ga0451789_0724155 3300041443 Bacteria 657
1097 Ga0451793_1457874 3300041452 Bacteria 1382
1098 Ga0451798_0847145 3300041458 Bacteria 1307
1099 Ga0451805_017166 3300041461 Bacteria 776
1100 Ga0451807_2770562 3300041486 Bacteria 703
1101 Ga0451833_0697339 3300041491 Bacteria 628
1102 Ga0451839_1230110 3300041496 Bacteria 1062
1103 Ga0451845_0305454 3300041501 Bacteria 515
1104 Ga0451845_0608312 3300041501 Bacteria 794
1105 Ga0451849_0000801 3300041505 Bacteria 675
1106 Ga0451851_0422564 3300041507 Bacteria 644
1107 Ga0451843_0725649 3300041509 Bacteria 545
1108 Ga0451855_1617624 3300041511 Bacteria 869
1109 Ga0451853_0600829 3300041512 Bacteria 775
1110 Ga0451853_1418465 3300041512 Bacteria 1213
1111 Ga0439448_0011384 3300042005 Bacteria 2651
1112 Ga0439448_0202695 3300042005 Bacteria 696
1113 Ga0439450_122795 3300042008 Bacteria 670
1114 Ga0439450_227377 3300042008 Bacteria 503
1115 Ga0439455_0104539 3300042012 Bacteria 784
1116 Ga0439456_043915 3300042013 Bacteria 972
1117 Ga0450920_007738 3300042122 Bacteria 1950
1118 Ga0450923_014865 3300042125 Bacteria 1448
1119 Ga0450906_008981 3300042145 Bacteria 1918
1120 Ga0450907_037255 3300042146 Bacteria 831
1121 Ga0439458_0148677 3300042157 Bacteria 627
1122 Ga0439434_0060393 3300042435 Bacteria 1184
1123 Ga0439435_0070056 3300042436 Bacteria 1037
1124 Ga0439444_0050696 3300042437 Bacteria 843
1125 Ga0439464_0165014 3300042439 Bacteria 697
1126 Ga0439460_0311138 3300042461 Bacteria 551
1127 Ga0450916_022216 3300042530 Bacteria 878
1128 Ga0450918_013050 3300042531 Bacteria 1445
1129 Ga0451577_0016881 3300042876 Bacteria 6752
1130 Ga0451577_0117036 3300042876 Bacteria 2387
1131 Ga0451577_0143807 3300042876 Bacteria 2144
1132 Ga0451577_0276905 3300042876 Bacteria 1520
1133 Ga0451577_0314814 3300042876 Bacteria 1419
1134 Ga0439440_0115149 3300042993 Bacteria 743
1135 Ga0466969_0103990 3300044656 Bacteria 1334
1136 Ga0466972_0005615 3300044658 Bacteria 6284
1137 Ga0466972_0234463 3300044658 Bacteria 858
1138 Ga0453683_0036050 3300044673 Bacteria 3114
1139 Ga0453683_0154124 3300044673 Bacteria 1452
1140 Ga0453683_0466537 3300044673 Bacteria 818
1141 Ga0466965_0006167 3300044683 Bacteria 5423
1142 Ga0466965_0014387 3300044683 Bacteria 3743
1143 Ga0466965_0107260 3300044683 Bacteria 1433
1144 Ga0466966_0010977 3300044684 Bacteria 6011
1145 Ga0466961_0087743 3300044693 Bacteria 1965
1146 Ga0466961_0201841 3300044693 Bacteria 1229
1147 Ga0466961_0204689 3300044693 Bacteria 1220
1148 Ga0466963_0083412 3300044694 Bacteria 2168
1149 Ga0466963_1016940 3300044694 Bacteria 583
1150 Ga0466964_0180154 3300044706 Bacteria 1001
1151 Ga0466964_0224970 3300044706 Bacteria 913
1152 Ga0453684_0060759 3300044712 Bacteria 4857
1153 Ga0453684_0088810 3300044712 Bacteria 3826
1154 Ga0453684_0456657 3300044712 Bacteria 1421
1155 Ga0453684_0491965 3300044712 Bacteria 1359
1156 Ga0453684_0526506 3300044712 Bacteria 1305
1157 Ga0453684_0627939 3300044712 Bacteria 1174
1158 Ga0453684_1134237 3300044712 Bacteria 824
1159 Ga0453684_2424098 3300044712 Bacteria 519
1160 Ga0466971_0059038 3300044719 Bacteria 1732
1161 Ga0466971_0183400 3300044719 Bacteria 984
1162 Ga0466971_0608400 3300044719 Bacteria 545
1163 Ga0466968_0354300 3300044735 Bacteria 713
1164 Ga0466968_0381720 3300044735 Bacteria 688
1165 Ga0466968_0491539 3300044735 Bacteria 610
1166 Ga0466970_0033983 3300044765 Bacteria 2697
1167 Ga0466970_0072211 3300044765 Bacteria 1856
1168 Ga0466957_0038195 3300044842 Bacteria 2892
1169 Ga0466957_0052384 3300044842 Bacteria 2485
1170 Ga0466957_0070960 3300044842 Bacteria 2153
1171 Ga0466957_0196793 3300044842 Bacteria 1322
1172 Ga0466957_0224728 3300044842 Bacteria 1241
1173 Ga0466957_0247951 3300044842 Bacteria 1183
1174 Ga0466960_0019581 3300044901 Bacteria 2985
1175 Ga0466960_0057834 3300044901 Bacteria 1892
1176 Ga0466960_0059399 3300044901 Bacteria 1870
1177 Ga0466959_0004261 3300045049 Bacteria 9543
1178 Ga0466959_0039513 3300045049 Bacteria 3486
1179 Ga0451576_0034109 3300045051 Bacteria 5406
1180 Ga0451576_0185581 3300045051 Bacteria 2172
1181 Ga0466958_0002151 3300045836 Bacteria 9809
1182 Ga0466958_0018252 3300045836 Bacteria 4068
1183 Ga0466958_0031221 3300045836 Bacteria 3166
1184 Ga0466958_0087216 3300045836 Bacteria 1927
1185 Ga0466958_0399398 3300045836 Bacteria 887
1186 Ga0466967_0266913 3300045976 Bacteria 1639
1187 Ga0466967_0903807 3300045976 Bacteria 878
1188 Ga0466967_1299685 3300045976 Bacteria 724
1189 Ga0466967_2311786 3300045976 Bacteria 533
1190 Ga0495592_0065934 3300046454 Bacteria 2650
1191 Ga0495592_0233423 3300046454 Bacteria 1224
1192 Ga0495592_0286511 3300046454 Bacteria 1075
1193 Ga0495592_0685808 3300046454 Bacteria 617
1194 Ga0495603_0009479 3300046455 Bacteria 5882
1195 Ga0495603_0097528 3300046455 Bacteria 1716
1196 Ga0495603_0191092 3300046455 Bacteria 1184
1197 Ga0495629_0124017 3300046459 Bacteria 1799
1198 Ga0495629_0161553 3300046459 Bacteria 1556
1199 Ga0495641_0006189 3300046461 Bacteria 7821
1200 Ga0495641_0055802 3300046461 Bacteria 1792
1201 Ga0495641_0060859 3300046461 Bacteria 1705
1202 Ga0495651_0041297 3300046462 Bacteria 3583
1203 Ga0495653_0011794 3300046463 Bacteria 7137
1204 Ga0495653_0025679 3300046463 Bacteria 4729
1205 Ga0495653_0308089 3300046463 Bacteria 1031
1206 Ga0495650_0040933 3300046471 Bacteria 1985
1207 Ga0495650_0048271 3300046471 Bacteria 1775
1208 Ga0495650_0111255 3300046471 Bacteria 1017
1209 Ga0495580_0120527 3300046472 Bacteria 1821
1210 Ga0495582_0031758 3300046473 Bacteria 2903
1211 Ga0495582_0080740 3300046473 Bacteria 1806
1212 Ga0495582_0233016 3300046473 Bacteria 1054
1213 Ga0495639_0172417 3300046475 Bacteria 1050
1214 Ga0495639_0373464 3300046475 Bacteria 718
1215 Ga0495662_0019242 3300046476 Bacteria 3302
1216 Ga0495662_0180519 3300046476 Bacteria 1040
1217 Ga0495664_0145839 3300046477 Bacteria 1435
1218 Ga0495664_0226434 3300046477 Bacteria 1132
1219 Ga0495664_0949774 3300046477 Bacteria 502
1220 Ga0495584_0228811 3300046491 Bacteria 945
1221 Ga0495584_0337063 3300046491 Bacteria 766
1222 Ga0495584_0385238 3300046491 Bacteria 712
1223 Ga0495594_0367075 3300046499 Bacteria 819
1224 Ga0495594_0423396 3300046499 Bacteria 757
1225 Ga0495596_0087503 3300046500 Bacteria 1209
1226 Ga0495606_0259492 3300046507 Bacteria 960
1227 Ga0495608_0060429 3300046511 Bacteria 2493
1228 Ga0495608_0127238 3300046511 Bacteria 1632
1229 Ga0495616_0228237 3300046513 Bacteria 808
1230 Ga0495618_0029382 3300046514 Bacteria 3430
1231 Ga0495618_0060714 3300046514 Bacteria 2397
1232 Ga0495618_0238478 3300046514 Bacteria 1144
1233 Ga0495620_0263375 3300046515 Bacteria 657
1234 Ga0495628_0043996 3300046516 Bacteria 3554
1235 Ga0495628_0867295 3300046516 Bacteria 628
1236 Ga0495630_0035741 3300046517 Bacteria 3712
1237 Ga0495630_0170906 3300046517 Bacteria 1656
1238 Ga0495637_0254397 3300046520 Bacteria 632
1239 Ga0495644_0187506 3300046523 Bacteria 796
1240 Ga0495648_0033982 3300046524 Bacteria 3325
1241 Ga0495663_0125873 3300046525 Bacteria 861
1242 Ga0495663_0224886 3300046525 Bacteria 661
1243 Ga0495666_0031409 3300046526 Bacteria 2602
1244 Ga0495666_0545796 3300046526 Bacteria 517
1245 Ga0495652_0127724 3300046529 Bacteria 2017
1246 Ga0495652_0333093 3300046529 Bacteria 1093
1247 Ga0495652_0787729 3300046529 Bacteria 634
1248 Ga0495652_1016440 3300046529 Bacteria 542
1249 Ga0495665_0018361 3300046531 Bacteria 3758
1250 Ga0495640_0021538 3300046533 Bacteria 4729
1251 Ga0495640_0302808 3300046533 Bacteria 992
1252 Ga0495587_0223807 3300046536 Bacteria 1061
1253 Ga0495598_0165374 3300046537 Bacteria 781
1254 Ga0495609_0151753 3300046538 Bacteria 985
1255 Ga0495645_0071267 3300046543 Bacteria 2506
1256 Ga0495645_0316647 3300046543 Bacteria 1014
1257 Ga0495645_0495045 3300046543 Bacteria 765
1258 Ga0495667_0077476 3300046559 Bacteria 2162
1259 Ga0495667_0516058 3300046559 Bacteria 748
1260 Ga0495656_0019032 3300046615 Bacteria 2645
1261 Ga0495656_0410222 3300046615 Bacteria 710
1262 Ga0495634_0008932 3300046642 Bacteria 7419
1263 Ga0495634_0132568 3300046642 Bacteria 1587
1264 Ga0495635_0063284 3300046663 Bacteria 2540
1265 Ga0495635_0206729 3300046663 Bacteria 1330
1266 Ga0495635_0788357 3300046663 Bacteria 613
1267 Ga0495588_0006175 3300046674 Bacteria 5381
1268 Ga0495657_0003110 3300046675 Bacteria 13700
1269 Ga0495599_0151254 3300046678 Bacteria 1437
1270 Ga0495599_0735957 3300046678 Bacteria 567
1271 Ga0495623_0296175 3300046679 Bacteria 895
1272 Ga0495646_0093243 3300046680 Bacteria 1735
1273 Ga0495646_0168405 3300046680 Bacteria 1209
1274 Ga0495647_0003870 3300046681 Bacteria 4826
1275 Ga0495647_0004692 3300046681 Bacteria 4456
1276 Ga0495647_0432965 3300046681 Bacteria 607
1277 Ga0495647_0507820 3300046681 Bacteria 561
1278 Ga0495658_0064282 3300046683 Bacteria 2113
1279 Ga0495658_0070216 3300046683 Bacteria 2032
1280 Ga0495658_0081948 3300046683 Bacteria 1895
1281 Ga0495658_0133954 3300046683 Bacteria 1511
1282 Ga0495658_0692567 3300046683 Bacteria 653
1283 Ga0495669_0117319 3300046684 Bacteria 1246
1284 Ga0495613_0026405 3300046689 Bacteria 4326
1285 Ga0495613_0030825 3300046689 Bacteria 3984
1286 Ga0495613_0306163 3300046689 Bacteria 1099
1287 Ga0495624_0156737 3300046690 Bacteria 1391
1288 Ga0495624_0440497 3300046690 Bacteria 781
1289 Ga0495589_0031760 3300046794 Bacteria 2658
1290 Ga0495600_0003596 3300046809 Bacteria 9135
1291 Ga0495600_0183782 3300046809 Bacteria 1347
1292 Ga0495581_0004186 3300047315 Bacteria 8314
1293 Ga0495581_0217471 3300047315 Bacteria 1117
1294 Ga0495604_0016907 3300047317 Bacteria 5832
1295 Ga0495604_0288647 3300047317 Bacteria 1106
1296 Ga0495604_0337907 3300047317 Bacteria 1003
1297 Ga0495674_0012859 3300047319 Bacteria 7883
1298 Ga0495674_0023760 3300047319 Bacteria 5644
1299 Ga0495674_0238423 3300047319 Bacteria 1499
1300 Ga0495672_0004778 3300047320 Bacteria 10928
1301 Ga0495676_0251165 3300047321 Bacteria 1206
1302 Ga0495676_0435511 3300047321 Bacteria 866
1303 Ga0495676_0474316 3300047321 Bacteria 823
1304 Ga0495680_0018449 3300047322 Bacteria 5924
1305 Ga0495680_0074503 3300047322 Bacteria 2578
1306 Ga0495680_0281901 3300047322 Bacteria 1171
1307 Ga0495680_0445908 3300047322 Bacteria 886
1308 Ga0495675_0035654 3300047444 Bacteria 3176
1309 Ga0495677_0172211 3300047445 Bacteria 838
1310 Ga0495684_0014399 3300047471 Bacteria 6085
1311 Ga0495684_0014428 3300047471 Bacteria 6079
1312 Ga0495686_0155677 3300047472 Bacteria 1339
1313 Ga0495593_0010386 3300047673 Bacteria 5382
1314 Ga0495593_0499110 3300047673 Bacteria 610
1315 Ga0495602_0048098 3300048088 Bacteria 3837
1316 Ga0495602_0598083 3300048088 Bacteria 759
1317 Ga0495614_0002806 3300048089 Bacteria 7750
1318 Ga0496100_0020442 3300048903 Bacteria 3969
1319 Ga0496100_0037424 3300048903 Bacteria 3067
1320 Ga0496100_0046263 3300048903 Bacteria 2797
1321 Ga0496100_0129847 3300048903 Bacteria 1773
1322 Ga0496100_0156060 3300048903 Bacteria 1632
1323 Ga0496100_0263667 3300048903 Bacteria 1278
1324 Ga0496100_0275060 3300048903 Bacteria 1253
1325 Ga0496100_0532940 3300048903 Bacteria 907
1326 Ga0496100_0798570 3300048903 Bacteria 739
1327 Ga0496101_0029830 3300048904 Bacteria 3816
1328 Ga0496101_0064090 3300048904 Bacteria 2676
1329 Ga0496101_0156944 3300048904 Bacteria 1743
1330 Ga0496101_0331525 3300048904 Bacteria 1194
1331 Ga0496101_0415467 3300048904 Bacteria 1060
1332 Ga0496101_0475184 3300048904 Bacteria 987
1333 Ga0496101_1526072 3300048904 Bacteria 520
1334 Ga0496102_0008426 3300048905 Bacteria 8836
1335 Ga0496102_0039336 3300048905 Bacteria 4273
1336 Ga0496102_0256404 3300048905 Bacteria 1649
1337 Ga0496102_0355090 3300048905 Bacteria 1380
1338 Ga0496102_0520129 3300048905 Bacteria 1112
1339 Ga0496102_0596746 3300048905 Bacteria 1027
1340 Ga0496102_0782946 3300048905 Bacteria 876
1341 Ga0496102_0816894 3300048905 Bacteria 854
1342 Ga0496102_1254518 3300048905 Bacteria 660
1343 Ga0496103_0019667 3300048906 Bacteria 4053
1344 Ga0496103_0039276 3300048906 Bacteria 2908
1345 Ga0496103_0185811 3300048906 Bacteria 1336
1346 Ga0496103_0377231 3300048906 Bacteria 911
1347 Ga0496103_0458330 3300048906 Bacteria 817
1348 Ga0496103_0663379 3300048906 Bacteria 662
1349 Ga0496104_0008605 3300048907 Bacteria 9075
1350 Ga0496104_0045348 3300048907 Bacteria 4134
1351 Ga0496104_0054378 3300048907 Bacteria 3783
1352 Ga0496104_0106807 3300048907 Bacteria 2683
1353 Ga0496104_0136994 3300048907 Bacteria 2352
1354 Ga0496104_0181317 3300048907 Bacteria 2016
1355 Ga0496104_0958994 3300048907 Bacteria 760
1356 Ga0496105_0034806 3300048908 Bacteria 4144
1357 Ga0496105_0036308 3300048908 Bacteria 4059
1358 Ga0496105_0054080 3300048908 Bacteria 3316
1359 Ga0496105_0069692 3300048908 Bacteria 2906
1360 Ga0496105_0070961 3300048908 Bacteria 2879
1361 Ga0496105_0115593 3300048908 Bacteria 2213
1362 Ga0496105_0204619 3300048908 Bacteria 1610
1363 Ga0496105_0839121 3300048908 Bacteria 696
1364 Ga0496105_1279356 3300048908 Bacteria 536
1365 Ga0496106_0019758 3300048909 Bacteria 4995
1366 Ga0496106_0077650 3300048909 Bacteria 2546
1367 Ga0496106_0169102 3300048909 Bacteria 1732
1368 Ga0496106_0245166 3300048909 Bacteria 1432
1369 Ga0496106_0284688 3300048909 Bacteria 1324
1370 Ga0496106_0433338 3300048909 Bacteria 1056
1371 Ga0496106_0625231 3300048909 Bacteria 861
1372 Ga0496106_0742049 3300048909 Bacteria 781
1373 Ga0496106_1279327 3300048909 Bacteria 570
1374 Ga0496107_0018477 3300048910 Bacteria 4909
1375 Ga0496107_0023742 3300048910 Bacteria 4334
1376 Ga0496107_0033346 3300048910 Bacteria 3684
1377 Ga0496107_0053046 3300048910 Bacteria 2925
1378 Ga0496107_0140243 3300048910 Bacteria 1787
1379 Ga0496107_0480403 3300048910 Bacteria 922
1380 Ga0496108_0009320 3300048911 Bacteria 7947
1381 Ga0496108_0010462 3300048911 Bacteria 7536
1382 Ga0496108_0277693 3300048911 Bacteria 1458
1383 Ga0496108_0574227 3300048911 Bacteria 983
1384 Ga0496108_0719853 3300048911 Bacteria 865
1385 Ga0496109_0000445 3300048912 Bacteria 35570
1386 Ga0496109_0003257 3300048912 Bacteria 13535
1387 Ga0496109_0082254 3300048912 Bacteria 2967
1388 Ga0496109_0161488 3300048912 Bacteria 2099
1389 Ga0496109_0169101 3300048912 Bacteria 2050
1390 Ga0496109_0190345 3300048912 Bacteria 1928
1391 Ga0496109_0217162 3300048912 Bacteria 1798
1392 Ga0496109_0225976 3300048912 Bacteria 1760
1393 Ga0496109_0775071 3300048912 Bacteria 897
1394 Ga0496109_1874503 3300048912 Bacteria 532
1395 Ga0496110_0000079 3300048913 Bacteria 50026
1396 Ga0496110_0000983 3300048913 Bacteria 19971
1397 Ga0496110_0017812 3300048913 Bacteria 5945
1398 Ga0496110_0032177 3300048913 Bacteria 4528
1399 Ga0496110_0207399 3300048913 Bacteria 1781
1400 Ga0496110_0915272 3300048913 Bacteria 783
1401 Ga0496110_0940903 3300048913 Bacteria 771
1402 Ga0496111_0000557 3300048914 Bacteria 19378
1403 Ga0496111_0001267 3300048914 Bacteria 14151
1404 Ga0496111_0096517 3300048914 Bacteria 2169
1405 Ga0496111_0204837 3300048914 Bacteria 1466
1406 Ga0496111_0647267 3300048914 Bacteria 771
1407 Ga0496111_0954755 3300048914 Bacteria 616
1408 Ga0496112_0000007 3300048915 Bacteria 338850
1409 Ga0496112_0008451 3300048915 Bacteria 9223
1410 Ga0496112_0017728 3300048915 Bacteria 6701
1411 Ga0496112_0055603 3300048915 Bacteria 3892
1412 Ga0496112_0078197 3300048915 Bacteria 3272
1413 Ga0496112_1011175 3300048915 Bacteria 751
1414 Ga0496112_1397289 3300048915 Bacteria 615
1415 Ga0496112_1623170 3300048915 Bacteria 560
1416 Ga0496113_0017092 3300048916 Bacteria 5029
1417 Ga0496113_0020455 3300048916 Bacteria 4652
1418 Ga0496113_0061383 3300048916 Bacteria 2836
1419 Ga0496113_1519630 3300048916 Bacteria 516
1420 Ga0496114_0004840 3300048917 Bacteria 10491
1421 Ga0496114_0006753 3300048917 Bacteria 9038
1422 Ga0496114_0037031 3300048917 Bacteria 4034
1423 Ga0496114_0046560 3300048917 Bacteria 3604
1424 Ga0496114_0056294 3300048917 Bacteria 3281
1425 Ga0496114_0064981 3300048917 Bacteria 3056
1426 Ga0496114_0117309 3300048917 Bacteria 2286
1427 Ga0496114_0241471 3300048917 Bacteria 1588
1428 Ga0496114_0623169 3300048917 Bacteria 950
1429 Ga0496114_1089561 3300048917 Bacteria 683
1430 Ga0496115_0010379 3300048918 Bacteria 6958
1431 Ga0496115_0012343 3300048918 Bacteria 6424
1432 Ga0496115_0027891 3300048918 Bacteria 4420
1433 Ga0496115_0037851 3300048918 Bacteria 3824
1434 Ga0496115_0056073 3300048918 Bacteria 3166
1435 Ga0496115_0073003 3300048918 Bacteria 2784
1436 Ga0496115_0094650 3300048918 Bacteria 2444
1437 Ga0496115_0153982 3300048918 Bacteria 1899
1438 Ga0496115_0173105 3300048918 Bacteria 1785
1439 Ga0496115_0783581 3300048918 Bacteria 743
1440 Ga0496116_0073590 3300048919 Bacteria 2153
1441 Ga0496117_0085314 3300048920 Bacteria 2056
1442 Ga0496117_0294273 3300048920 Bacteria 863
1443 Ga0496118_0005764 3300048921 Bacteria 13915
1444 Ga0496118_0194341 3300048921 Bacteria 1210
1445 Ga0496119_0012846 3300048922 Bacteria 6753
1446 Ga0496120_0033281 3300048923 Bacteria 3098
1447 Ga0496121_0267441 3300048924 Bacteria 1177
1448 Ga0496122_0313017 3300048925 Bacteria 839
1449 Ga0496126_0016860 3300048929 Bacteria 7291
1450 Ga0496126_0023859 3300048929 Bacteria 5919
1451 Ga0496126_0093794 3300048929 Bacteria 2635
1452 Ga0501306_015803 3300049127 Bacteria 1008
1453 Ga0501308_008067 3300049128 Bacteria 1118
1454 Ga0501309_033628 3300049129 Bacteria 764
1455 Ga0501310_007316 3300049130 Bacteria 1177
1456 Ga0501305_018823 3300049161 Bacteria 1003
1457 Ga0501307_059577 3300049162 Bacteria 590
1458 Ga0501317_013459 3300049533 Bacteria 1023
1459 Ga0501031_0205302 3300049568 Bacteria 1285
1460 Ga0501031_0303543 3300049568 Bacteria 1034
1461 Ga0501031_0370991 3300049568 Bacteria 926
1462 Ga0501031_0441178 3300049568 Bacteria 841
1463 Ga0501031_0877668 3300049568 Bacteria 574
1464 Ga0501032_0243871 3300049569 Bacteria 1167
1465 Ga0501032_0267891 3300049569 Bacteria 1107
1466 Ga0501032_0318392 3300049569 Bacteria 1004
1467 Ga0501032_1025586 3300049569 Bacteria 518
1468 Ga0501033_0335291 3300049570 Bacteria 1061
1469 Ga0501033_0450220 3300049570 Bacteria 894
1470 Ga0501033_0780734 3300049570 Bacteria 647
1471 Ga0501034_0012529 3300049571 Bacteria 8754
1472 Ga0501034_0371459 3300049571 Bacteria 1356
1473 Ga0501034_0694229 3300049571 Bacteria 917
1474 Ga0501036_0036626 3300049572 Bacteria 4152
1475 Ga0501036_0084524 3300049572 Bacteria 2683
1476 Ga0501036_0530272 3300049572 Bacteria 979
1477 Ga0501037_0295303 3300049573 Bacteria 1126
1478 Ga0501037_0389098 3300049573 Bacteria 957
1479 Ga0501038_0041796 3300049574 Bacteria 3997
1480 Ga0501039_0007709 3300049575 Bacteria 8218
1481 Ga0501039_0012581 3300049575 Bacteria 6466
1482 Ga0501039_0332426 3300049575 Bacteria 1194
1483 Ga0501039_0947982 3300049575 Bacteria 669
1484 Ga0501039_1363484 3300049575 Bacteria 546
1485 Ga0501040_0004923 3300049576 Bacteria 8643
1486 Ga0501040_0079281 3300049576 Bacteria 2273
1487 Ga0501040_0264550 3300049576 Bacteria 1227
1488 Ga0501040_0334470 3300049576 Bacteria 1084
1489 Ga0501040_0473144 3300049576 Bacteria 902
1490 Ga0501040_0541266 3300049576 Bacteria 840
1491 Ga0501041_0038812 3300049577 Bacteria 2888
1492 Ga0501041_0071912 3300049577 Bacteria 2124
1493 Ga0501041_0222709 3300049577 Bacteria 1184
1494 Ga0501041_0470904 3300049577 Bacteria 798
1495 Ga0501041_0512440 3300049577 Bacteria 763
1496 Ga0501042_0027184 3300049578 Bacteria 4022
1497 Ga0501042_0326457 3300049578 Bacteria 1109
1498 Ga0501042_0514206 3300049578 Bacteria 870
1499 Ga0501042_0612620 3300049578 Bacteria 792
1500 Ga0501043_0022634 3300049579 Bacteria 4927
1501 Ga0501043_0361287 3300049579 Bacteria 1102
1502 Ga0501043_0386469 3300049579 Bacteria 1059
1503 Ga0501046_0134747 3300049580 Bacteria 1871
1504 Ga0501046_0820294 3300049580 Bacteria 651
1505 Ga0501047_0099339 3300049581 Bacteria 2789
1506 Ga0501047_0583711 3300049581 Bacteria 940
1507 Ga0501048_0010287 3300049582 Bacteria 6994
1508 Ga0501048_0132559 3300049582 Bacteria 1761
1509 Ga0501048_0307824 3300049582 Bacteria 1128
1510 Ga0501067_0003078 3300049583 Bacteria 9202
1511 Ga0501067_0042917 3300049583 Bacteria 2512
1512 Ga0501067_0265468 3300049583 Bacteria 956
1513 Ga0501067_0379170 3300049583 Bacteria 788
1514 Ga0501068_0002322 3300049584 Bacteria 10142
1515 Ga0501068_0033823 3300049584 Bacteria 3046
1516 Ga0501068_0400123 3300049584 Bacteria 885
1517 Ga0501068_0441565 3300049584 Bacteria 841
1518 Ga0501069_0000453 3300049585 Bacteria 18732
1519 Ga0501069_0023498 3300049585 Bacteria 3362
1520 Ga0501069_0063145 3300049585 Bacteria 2068
1521 Ga0501069_0120939 3300049585 Bacteria 1495
1522 Ga0501069_0625440 3300049585 Bacteria 647
1523 Ga0501070_0003383 3300049586 Bacteria 13839
1524 Ga0501070_0005689 3300049586 Bacteria 10626
1525 Ga0501070_0078845 3300049586 Bacteria 2725
1526 Ga0501070_0082198 3300049586 Bacteria 2666
1527 Ga0501070_0824638 3300049586 Bacteria 727
1528 Ga0501071_0000119 3300049587 Bacteria 31338
1529 Ga0501071_0001083 3300049587 Bacteria 15121
1530 Ga0501071_0003597 3300049587 Bacteria 9710
1531 Ga0501071_0013395 3300049587 Bacteria 5587
1532 Ga0501071_0035692 3300049587 Bacteria 3543
1533 Ga0501071_0079974 3300049587 Bacteria 2390
1534 Ga0501071_0093200 3300049587 Bacteria 2215
1535 Ga0501071_0186402 3300049587 Bacteria 1555
1536 Ga0501071_0232425 3300049587 Bacteria 1389
1537 Ga0501071_0325563 3300049587 Bacteria 1167
1538 Ga0501071_0594473 3300049587 Bacteria 851
1539 Ga0501071_0649097 3300049587 Bacteria 812
1540 Ga0501072_0003791 3300049588 Bacteria 11412
1541 Ga0501072_0196150 3300049588 Bacteria 1610
1542 Ga0501072_0391552 3300049588 Bacteria 1102
1543 Ga0501072_0838180 3300049588 Bacteria 719
1544 Ga0501073_0050481 3300049589 Bacteria 2915
1545 Ga0501073_0348598 3300049589 Bacteria 1022
1546 Ga0501073_0397229 3300049589 Bacteria 952
1547 Ga0501074_0080636 3300049590 Bacteria 2334
1548 Ga0501074_0201833 3300049590 Bacteria 1417
1549 Ga0501074_0219858 3300049590 Bacteria 1352
1550 Ga0501074_0460017 3300049590 Bacteria 902
1551 Ga0501075_0003018 3300049591 Bacteria 11243
1552 Ga0501075_0017924 3300049591 Bacteria 5116
1553 Ga0501075_0065727 3300049591 Bacteria 2737
1554 Ga0501075_0417306 3300049591 Bacteria 1023
1555 Ga0501075_0724896 3300049591 Bacteria 757
1556 Ga0501076_0011794 3300049592 Bacteria 6526
1557 Ga0501076_0018028 3300049592 Bacteria 5372
1558 Ga0501076_0025886 3300049592 Bacteria 4542
1559 Ga0501076_0235600 3300049592 Bacteria 1497
1560 Ga0501076_0395260 3300049592 Bacteria 1137
1561 Ga0501076_0626588 3300049592 Bacteria 887
1562 Ga0501076_0969926 3300049592 Bacteria 700
1563 Ga0501077_0001393 3300049593 Bacteria 14562
1564 Ga0501077_0013176 3300049593 Bacteria 5181
1565 Ga0501077_0341118 3300049593 Bacteria 956
1566 Ga0501077_0547376 3300049593 Bacteria 743
1567 Ga0501079_0001191 3300049741 Bacteria 18223
1568 Ga0501079_0008393 3300049741 Bacteria 7829
1569 Ga0501079_0294174 3300049741 Bacteria 1270
1570 Ga0501079_0296414 3300049741 Bacteria 1265
1571 Ga0501079_0369740 3300049741 Bacteria 1124
1572 Ga0501079_0721627 3300049741 Bacteria 784
1573 Ga0501080_0058666 3300049742 Bacteria 3582
1574 Ga0501080_0208610 3300049742 Bacteria 1791
1575 Ga0501080_0621568 3300049742 Bacteria 958
1576 Ga0501080_0715172 3300049742 Bacteria 883
1577 Ga0501080_0931016 3300049742 Bacteria 756
1578 Ga0501080_1081449 3300049742 Bacteria 693
1579 Ga0501081_0000266 3300049743 Bacteria 27345
1580 Ga0501081_0016532 3300049743 Bacteria 4877
1581 Ga0501081_0536745 3300049743 Bacteria 873
1582 Ga0501081_1153071 3300049743 Bacteria 587
1583 Ga0501083_0058547 3300049744 Bacteria 2578
1584 Ga0501083_0111389 3300049744 Bacteria 1799
1585 Ga0501083_0539371 3300049744 Bacteria 759
1586 Ga0501083_0655407 3300049744 Bacteria 683
1587 Ga0501083_0761909 3300049744 Bacteria 630
1588 Ga0501035_0834418 3300049822 Bacteria 734
1589 Ga0501044_0553545 3300049823 Bacteria 1047
1590 Ga0501045_0010860 3300049824 Bacteria 6381
1591 Ga0501045_0031322 3300049824 Bacteria 3852
1592 Ga0501045_0159456 3300049824 Bacteria 1679
1593 Ga0501045_0165912 3300049824 Bacteria 1645
1594 Ga0501045_0284278 3300049824 Bacteria 1231
1595 Ga0501045_0918306 3300049824 Bacteria 643
1596 nmdc:mga00v17_41757_c1 3300050491 Bacteria 2756
1597 nmdc:mga0yw44_18369_c1 3300050492 Bacteria 3828
1598 nmdc:mga0yw44_310776_c1 3300050492 Bacteria 1057
1599 nmdc:mga0yw44_47549_c1 3300050492 Bacteria 2583
1600 nmdc:mga06z11_349474_c1 3300050494 Bacteria 885
1601 nmdc:mga07m45_108234_c1 3300050496 Bacteria 1599
1602 nmdc:mga05p37_24103_c1 3300050507 Bacteria 7391
1603 nmdc:mga05p37_33875_c1 3300050507 Bacteria 6257
1604 nmdc:mga05p37_3540_c1 3300050507 Bacteria 18225
1605 nmdc:mga09592_208420_c2 3300050508 Bacteria 939
1606 nmdc:mga09592_51891_c1 3300050508 Bacteria 3460
1607 nmdc:mga0qj67_418401_c1 3300050509 Bacteria 1080
1608 nmdc:mga06r32_134251_c1 3300050510 Bacteria 2449
1609 nmdc:mga08y16_1246015_c1 3300050511 Bacteria 713
1610 nmdc:mga08y16_266255_c1 3300050511 Bacteria 1769
1611 nmdc:mga08y16_433649_c1 3300050511 Bacteria 1342
1612 nmdc:mga08y16_82947_c1 3300050511 Bacteria 3342
1613 nmdc:mga0n895_1104575_c1 3300050512 Bacteria 770
1614 nmdc:mga0n895_21002_c1 3300050512 Bacteria 6100
1615 nmdc:mga0n895_279161_c1 3300050512 Bacteria 1694
1616 nmdc:mga0n895_363286_c1 3300050512 Bacteria 1466
1617 nmdc:mga0n895_479689_c1 3300050512 Bacteria 1254
1618 nmdc:mga0n895_489885_c1 3300050512 Bacteria 1239
1619 nmdc:mga0n895_56580_c1 3300050512 Bacteria 3864
1620 nmdc:mga0n895_719278_c1 3300050512 Bacteria 993
1621 nmdc:mga0rr50_179533_c1 3300050513 Bacteria 1730
1622 nmdc:mga0rr50_199265_c1 3300050513 Bacteria 1644
1623 nmdc:mga0rr50_368092_c1 3300050513 Bacteria 1211
1624 nmdc:mga0rr50_67644_c1 3300050513 Bacteria 2714
1625 nmdc:mga08x19_338891_c1 3300050514 Bacteria 1048
1626 nmdc:mga08x19_367925_c1 3300050514 Bacteria 1005
1627 nmdc:mga08x19_425770_c1 3300050514 Bacteria 933
1628 nmdc:mga0a205_1468245_c1 3300050515 Bacteria 530
1629 nmdc:mga0a205_2010_c1 3300050515 Bacteria 17745
1630 nmdc:mga0a205_252371_c1 3300050515 Bacteria 1643
1631 nmdc:mga0a205_25674_c1 3300050515 Bacteria 5615
1632 nmdc:mga0a205_271456_c1 3300050515 Bacteria 1573
1633 nmdc:mga0a205_327973_c1 3300050515 Bacteria 1401
1634 Ga0495601_0016271 3300053077 Bacteria 4506
1635 Ga0495601_0045561 3300053077 Bacteria 2758
1636 Ga0495601_0050354 3300053077 Bacteria 2627
1637 Ga0495601_0073549 3300053077 Bacteria 2185
1638 Ga0495601_0157372 3300053077 Bacteria 1484
1639 Ga0495601_0459998 3300053077 Bacteria 822
1640 Ga0495601_0598805 3300053077 Bacteria 707
1641 Ga0495612_0109786 3300053078 Bacteria 1179
1642 Ga0495612_0125030 3300053078 Bacteria 1108
1643 Ga0500635_0000204 3300053080 Bacteria 29368
1644 Ga0495655_0079213 3300053083 Bacteria 936
1645 Ga0495595_0046669 3300053084 Bacteria 1996
1646 Ga0495595_0088470 3300053084 Bacteria 1483
1647 Ga0495619_0007866 3300053085 Bacteria 6745
1648 Ga0495619_0026075 3300053085 Bacteria 3758
1649 Ga0495619_0067168 3300053085 Bacteria 2393
1650 Ga0495619_0250509 3300053085 Bacteria 1227
1651 Ga0495619_0550580 3300053085 Bacteria 791
1652 Ga0501084_0006409 3300054114 Bacteria 9674
1653 Ga0501084_0015419 3300054114 Bacteria 6336
1654 Ga0501084_0162417 3300054114 Bacteria 1885
1655 Ga0501084_0179330 3300054114 Bacteria 1788
1656 Ga0590071_046949 3300059421 Bacteria 1044
1657 Ga0587084_008557 3300059477 Bacteria 1299
1658 Ga0587084_093124 3300059477 Bacteria 600
1659 Ga0587093_032545 3300059478 Bacteria 757
1660 Ga0587066_105217 3300059490 Bacteria 647
1661 Ga0587070_026154 3300059491 Bacteria 1023
1662 Ga0587070_056270 3300059491 Bacteria 800
1663 Ga0587070_057172 3300059491 Bacteria 796
1664 Ga0587070_101553 3300059491 Bacteria 662
1665 Ga0587073_0070967 3300059492 Bacteria 841
1666 Ga0587073_0217606 3300059492 Bacteria 582
1667 Ga0587077_077231 3300059493 Bacteria 756
1668 Ga0587077_132746 3300059493 Bacteria 633
1669 Ga0587077_261026 3300059493 Bacteria 505
1670 Ga0587080_028007 3300059503 Bacteria 965
1671 Ga0587080_029121 3300059503 Bacteria 952
1672 Ga0587080_033122 3300059503 Bacteria 910
1673 Ga0587080_078742 3300059503 Bacteria 672
1674 Ga0587080_153072 3300059503 Bacteria 535
1675 Ga0587082_108034 3300059504 Bacteria 615
1676 Ga0587083_0003623 3300059505 Bacteria 2071
1677 Ga0587083_0097976 3300059505 Bacteria 726
1678 Ga0587083_0122413 3300059505 Bacteria 673
1679 Ga0587083_0258639 3300059505 Bacteria 522
1680 Ga0587085_009458 3300059506 Bacteria 1270
1681 Ga0587088_003103 3300059508 Bacteria 1972
1682 Ga0587088_061741 3300059508 Bacteria 761
1683 Ga0587089_015017 3300059509 Bacteria 1018
1684 Ga0587090_021586 3300059510 Bacteria 1011
1685 Ga0587090_034598 3300059510 Bacteria 862
1686 Ga0587091_018726 3300059511 Bacteria 1182
1687 Ga0587091_018976 3300059511 Bacteria 1177
1688 Ga0587091_041792 3300059511 Bacteria 907
1689 Ga0587091_068825 3300059511 Bacteria 770
1690 Ga0587091_080519 3300059511 Bacteria 730
1691 Ga0587092_043274 3300059512 Bacteria 792
1692 Ga0587094_126096 3300059513 Bacteria 517
1693 Ga0587098_037316 3300059604 Bacteria 694
1694 Ga0587098_088197 3300059604 Bacteria 526
1695 Ga0587106_135570 3300059605 Bacteria 535
1696 Ga0587101_045628 3300059623 Bacteria 738
1697 Ga0587122_000616 3300059628 Bacteria 1976
1698 Ga0587122_045407 3300059628 Bacteria 557
1699 Ga0587128_000395 3300059630 Bacteria 3139
1700 Ga0587128_022020 3300059630 Bacteria 988
1701 Ga0587128_045034 3300059630 Bacteria 786
1702 Ga0587128_046109 3300059630 Bacteria 780
1703 Ga0587062_075427 3300059639 Bacteria 617
1704 Ga0587067_058027 3300059640 Bacteria 803
1705 Ga0587067_130653 3300059640 Bacteria 612
1706 Ga0587067_152189 3300059640 Bacteria 582
1707 Ga0587068_008623 3300059641 Bacteria 1483
1708 Ga0587069_014182 3300059642 Bacteria 1108
1709 Ga0587069_061781 3300059642 Bacteria 692
1710 Ga0587072_126320 3300059643 Bacteria 598
1711 Ga0587075_018259 3300059644 Bacteria 1016
1712 Ga0587075_053703 3300059644 Bacteria 710
1713 Ga0587076_014556 3300059645 Bacteria 1213
1714 Ga0587076_035987 3300059645 Bacteria 903
1715 Ga0587079_050510 3300059647 Bacteria 871
1716 Ga0587079_063562 3300059647 Bacteria 806
1717 Ga0587102_001277 3300059649 Bacteria 1726
1718 Ga0587107_068402 3300059652 Bacteria 643
1719 Ga0587107_104737 3300059652 Bacteria 564
1720 Ga0587110_016957 3300059654 Bacteria 793
1721 Ga0587110_038518 3300059654 Bacteria 607
1722 Ga0587114_009697 3300059655 Bacteria 1160
1723 Ga0587114_070143 3300059655 Bacteria 633
1724 Ga0587120_026200 3300059659 Bacteria 578
1725 Ga0587071_063222 3300060344 Bacteria 791
1726 Ga0587071_074609 3300060344 Bacteria 745
1727 Ga0587071_088613 3300060344 Bacteria 700
1728 Ga0587071_089239 3300060344 Bacteria 698
1729 Ga0587071_102775 3300060344 Bacteria 663
1730 Ga0587111_0081325 3300060346 Bacteria 775
1731 Ga0587111_0119404 3300060346 Bacteria 677
1732 Ga0587111_0178622 3300060346 Bacteria 588
1733 Ga0501082_0014508 3300060353 Bacteria 6784
1734 Ga0501082_0020323 3300060353 Bacteria 5724
1735 Ga0501082_0410999 3300060353 Bacteria 1181
1736 Ga0501082_0521707 3300060353 Bacteria 1038
1737 Ga0501082_1212715 3300060353 Bacteria 659
1738 Ga0501082_1991016 3300060353 Bacteria 506
1739 Ga0466962_0032211 3300061719 Bacteria 2509
1740 Ga0530510_0042730 3300061734 Bacteria 3274
1741 Ga0530510_0061548 3300061734 Bacteria 2717
1742 Ga0530510_0126308 3300061734 Bacteria 1880
1743 Ga0530510_0641936 3300061734 Bacteria 808
1744 Ga0530510_1078602 3300061734 Bacteria 615
1745 2547411357 2547132111 Bacteria 8013147
1746 2554256760 2554235005 Bacteria 6457341
1747 2616696762 2616644814 Bacteria 11555299
1748 2616901906 2616644941 Bacteria 8510691
1749 2644439365 2643221678 Bacteria 9540101
1750 2644633261 2643221714 Bacteria 9015452
1751 2784589770 2784132148 Bacteria 8627943
1752 2808843366 2808606359 Bacteria 9866990
1753 2809233440 2808606448 Bacteria 8656184
1754 2812356679 2811994879 Bacteria 9313447
1755 2812479392 2811994917 Bacteria 7761064
1756 2852643123 2852635781 Bacteria 8251373
1757 2862185297 2862178590 Bacteria 8583590
1758 2862292094 2862290372 Bacteria 7471434
1759 2862516757 2862507626 Bacteria 9425308
1760 2867429963 2867428634 Bacteria 9590268
1761 2912718428 2912715099 Bacteria 9460473
1762 2912730754 2912723979 Bacteria 8557534
1763 2919470265 2919468124 Bacteria 9133025
1764 2935395234 2935390628 Bacteria 7043367
1765 2946069192 2946064051 Bacteria 8957905
1766 2946077140 2946072368 Bacteria 8999607
1767 2947227742 2947224130 Bacteria 9938529
1768 2954695554 2954691527 Bacteria 10720516
1769 2954710748 2954701450 Bacteria 10834262
1770 2954714977 2954711539 Bacteria 10867210
1771 2954724919 2954721474 Bacteria 10456478
1772 2954736899 2954731030 Bacteria 10243860
1773 2954743845 2954740390 Bacteria 10229294
1774 2954755747 2954749733 Bacteria 10366972
1775 2954762798 2954759201 Bacteria 9358192
1776 3006398680 3006393351 Bacteria 6615579
1777 3006490571 3006486233 Bacteria 8157040
1778 3006498854 3006493962 Bacteria 8825450
1779 8002784650 8002784119 Bacteria 9788632
1780 8023626963 8023623736 Bacteria 8593882
1781 8025417220 8025413630 Bacteria 7014048
1782 8033691144 8033684223 Bacteria 6906479
1783 8056837587 8056829672 Bacteria 9045328
1784 Ga0070706_100001187
1785 JGI24746J21847_1010606
1786 JGI24747J21853_1004561
1787 JGI24740J21852_10074867
1788 JGI24739J22299_10014218
1789 JGI24739J22299_10031467
1790 JGI24737J22298_10014055
1791 JGI24737J22298_10255683
1792 JGI24750J21931_1025217
1793 JGI24745J21846_1002378
1794 JGI24738J21930_10026481
1795 JGI24744J21845_10009983
1796 JGI24034J26672_10019434
1797 JGI24742J22300_10008900
1798 JGI24751J29686_10064209
1799 JGI25162J39368_1003458
1800 JGI25164J39214_1000679
1801 Ga0006778J45830_1037313
1802 Ga0006759J45824_1035239
1803 JGI25406J46586_10006196
1804 JGI25406J46586_10008605
1805 JGI25165J46597_1000061
1806 Ga0007416J51690_1057683
1807 Ga0007429J51699_1088480
1808 Ga0007429J51699_1088481
1809 Ga0032354_1022066
1810 Ga0055539_1000808
1811 Ga0055533_1000001
1812 Ga0055527_1000017
1813 Ga0055542_1000044
1814 Ga0055529_1000279
1815 Ga0055529_1039149
1816 Ga0055541_1009606
1817 Ga0058858_1434606
1818 Ga0058859_10032894
1819 Ga0058863_10079837
1820 Ga0058863_10092482
1821 Ga0058863_11902506
1822 Ga0058863_11911031
1823 Ga0058861_10002618
1824 Ga0058861_10039056
1825 Ga0058861_10046230
1826 Ga0058861_10088000
1827 Ga0058861_11840072
1828 Ga0058861_12025964
1829 Ga0058860_10225518
1830 Ga0058860_12169112
1831 Ga0058860_12198917
1832 Ga0058862_10139641
1833 Ga0058862_10153948
1834 Ga0058862_10202782
1835 Ga0058862_10277273
1836 Ga0058862_12205953
1837 Ga0058862_12730137
1838 Ga0065714_10021838
1839 Ga0070658_10028535
1840 Ga0070658_10028947
1841 Ga0070658_10258464
1842 Ga0070658_10271826
1843 Ga0070658_11038680
1844 Ga0070676_10224730
1845 Ga0070676_10414025
1846 Ga0070683_100029975
1847 Ga0070683_100274263
1848 Ga0070683_100285358
1849 Ga0070683_100306297
1850 Ga0070683_100332725
1851 Ga0070683_100346506
1852 Ga0070683_100481930
1853 Ga0070690_100194908
1854 Ga0070690_100396542
1855 Ga0070690_100523026
1856 Ga0070690_100645872
1857 Ga0070690_100835503
1858 Ga0070670_100568059
1859 Ga0070670_101091103
1860 Ga0070677_10336382
1861 Ga0068869_100012691
1862 Ga0068869_100062239
1863 Ga0068869_100168006
1864 Ga0068869_100509726
1865 Ga0068869_101838502
1866 Ga0070680_100000015
1867 Ga0070680_100033020
1868 Ga0070680_100093789
1869 Ga0070680_100153032
1870 Ga0070680_100356170
1871 Ga0070680_100432224
1872 Ga0070680_100834179
1873 Ga0070682_100011705
1874 Ga0070682_100203653
1875 Ga0070682_100236792
1876 Ga0070682_100246860
1877 Ga0068868_100005144
1878 Ga0068868_100122450
1879 Ga0068868_100382455
1880 Ga0068868_100459711
1881 Ga0070660_100059135
1882 Ga0070660_100128075
1883 Ga0070660_100134654
1884 Ga0070660_100329375
1885 Ga0070689_100029463
1886 Ga0070689_100158604
1887 Ga0070689_100818584
1888 Ga0070691_10003867
1889 Ga0070691_10024314
1890 Ga0070691_10043635
1891 Ga0070691_10206936
1892 Ga0070687_100127109
1893 Ga0070687_100232399
1894 Ga0070687_101369961
1895 Ga0070661_101478697
1896 Ga0070692_10102432
1897 Ga0070692_10510609
1898 Ga0070692_10621542
1899 Ga0070668_100646667
1900 Ga0070668_100713017
1901 Ga0070668_100729157
1902 Ga0070669_100478705
1903 Ga0070669_101260253
1904 Ga0070675_100082776
1905 Ga0070675_100095801
1906 Ga0070675_100253957
1907 Ga0070675_100417906
1908 Ga0070675_100760983
1909 Ga0070675_101504990
1910 Ga0070671_100060488
1911 Ga0070671_100151685
1912 Ga0070671_100341891
1913 Ga0070671_100385131
1914 Ga0070671_100455397
1915 Ga0070674_100041590
1916 Ga0070674_100238837
1917 Ga0070674_100305444
1918 Ga0070674_101879946
1919 Ga0070673_100019981
1920 Ga0070673_100296296
1921 Ga0070688_100043252
1922 Ga0070688_100123596
1923 Ga0070659_100012148
1924 Ga0070659_100018706
1925 Ga0070659_100126270
1926 Ga0070659_100179838
1927 Ga0070667_100644816
1928 Ga0070667_100882763
1929 Ga0070703_10026297
1930 Ga0070709_10186968
1931 Ga0070714_100005269
1932 Ga0070714_101557988
1933 Ga0070713_100081990
1934 Ga0070710_10029185
1935 Ga0070710_10090852
1936 Ga0070710_10233310
1937 Ga0070701_10014791
1938 Ga0070701_10218853
1939 Ga0070701_10751579
1940 Ga0070711_100019741
1941 Ga0070711_100030873
1942 Ga0070705_100012679
1943 Ga0070705_100064677
1944 Ga0070705_100117451
1945 Ga0070705_100212079
1946 Ga0070705_100856494
1947 Ga0070700_100014624
1948 Ga0070700_100117428
1949 Ga0070700_100181285
1950 Ga0070700_100409710
1951 Ga0070700_101440306
1952 Ga0070694_100072132
1953 Ga0070694_100213642
1954 Ga0070694_100330046
1955 Ga0070694_100648214
1956 Ga0070708_100015734
1957 Ga0070708_100127832
1958 Ga0070708_100737148
1959 Ga0070708_100770417
1960 Ga0070663_100177563
1961 Ga0070663_100288192
1962 Ga0070663_100405282
1963 Ga0070663_100721741
1964 Ga0070663_100739854
1965 Ga0070663_101787956
1966 Ga0070678_100058968
1967 Ga0070678_100068279
1968 Ga0070678_100524499
1969 Ga0070678_100550805
1970 Ga0070662_100494365
1971 Ga0070662_100565695
1972 Ga0070681_10128448
1973 Ga0070681_10166145
1974 Ga0070681_10377690
1975 Ga0070681_10471198
1976 Ga0070681_11316024
1977 Ga0068867_100049389
1978 Ga0068867_100261733
1979 Ga0068867_100470533
1980 Ga0070685_10030710
1981 Ga0070685_10067598
1982 Ga0070706_100011787
1983 Ga0070706_100531095
1984 Ga0070707_100005867
1985 Ga0070707_100038225
1986 Ga0070707_100064600
1987 Ga0070707_100223342
1988 Ga0070707_101013754
1989 Ga0070698_100094301
1990 Ga0070698_100104288
1991 Ga0070698_102076193
1992 Ga0070699_100058035
1993 Ga0070679_100025472
1994 Ga0070679_100038792
1995 Ga0070679_100575647
1996 Ga0070679_101455700
1997 Ga0070679_101882188
1998 Ga0070684_100051018
1999 Ga0070684_100076715
2000 Ga0070684_100092545
2001 Ga0070684_100114067
2002 Ga0070684_100308206
2003 Ga0070684_100454164
2004 Ga0070684_100520389
2005 Ga0070684_100721633
2006 Ga0070697_100025528
2007 Ga0070697_100055682
2008 Ga0070697_100098342
2009 Ga0070697_100316355
2010 Ga0070697_100758674
2011 Ga0070697_102107727
2012 Ga0068853_100047078
2013 Ga0068853_100167867
2014 Ga0068853_100353953
2015 Ga0068853_101812360
2016 Ga0068853_102263871
2017 Ga0070672_100130525
2018 Ga0070672_100823102
2019 Ga0070686_100008884
2020 Ga0070686_100042639
2021 Ga0070686_100200306
2022 Ga0070686_100814129
2023 Ga0070695_100156634
2024 Ga0070695_100206721
2025 Ga0070695_100577631
2026 Ga0070696_100006963
2027 Ga0070696_100082401
2028 Ga0070696_100082497
2029 Ga0070696_100116381
2030 Ga0070696_100260895
2031 Ga0070696_100288614
2032 Ga0070696_100318727
2033 Ga0070696_100534091
2034 Ga0070696_100617234
2035 Ga0070696_100885697
2036 Ga0070696_101576902
2037 Ga0070693_100011341
2038 Ga0070693_100045839
2039 Ga0070693_100139888
2040 Ga0070693_100353398
2041 Ga0070693_100355640
2042 Ga0070693_100598675
2043 Ga0070665_100355567
2044 Ga0070665_100360118
2045 Ga0070704_100016174
2046 Ga0070704_100866435
2047 Ga0070704_100879611
2048 Ga0068855_100026947
2049 Ga0068855_100052631
2050 Ga0068855_100066868
2051 Ga0068855_101539999
2052 Ga0068855_102164059
2053 Ga0070664_100010033
2054 Ga0070664_100100347
2055 Ga0070664_100217308
2056 Ga0070664_101278998
2057 Ga0070664_101783163
2058 Ga0068857_100129395
2059 Ga0068857_100481910
2060 Ga0068857_100670337
2061 Ga0068857_101846732
2062 Ga0068854_100030804
2063 Ga0068854_101577851
2064 Ga0068856_100048606
2065 Ga0068856_100061274
2066 Ga0068856_100102656
2067 Ga0068856_100230255
2068 Ga0068856_100290876
2069 Ga0068856_100366475
2070 Ga0070702_100016072
2071 Ga0070702_100161541
2072 Ga0070702_100234700
2073 Ga0068852_100082296
2074 Ga0068852_100132206
2075 Ga0068852_100302958
2076 Ga0068852_101304543
2077 Ga0068852_102847750
2078 Ga0068859_100038389
2079 Ga0068859_101887037
2080 Ga0068864_100083353
2081 Ga0068864_100571654
2082 Ga0068866_10036626
2083 Ga0068866_10136583
2084 Ga0068866_10712135
2085 Ga0068861_100105850
2086 Ga0068861_100316610
2087 Ga0068861_100482997
2088 Ga0068861_100893563
2089 Ga0068861_101168994
2090 Ga0068861_102551714
2091 Ga0068851_10282940
2092 Ga0068870_10084742
2093 Ga0068870_10934948
2094 Ga0068863_100260616
2095 Ga0068863_100344654
2096 Ga0068858_100046786
2097 Ga0068858_100161047
2098 Ga0068858_100693419
2099 Ga0068860_100027971
2100 Ga0068860_100344499
2101 Ga0068860_100505616
2102 Ga0068860_100928713
2103 Ga0068862_100395989
2104 Ga0068862_100556312
2105 Ga0068862_101352363
2106 Ga0081455_10047065
2107 Ga0081455_10236082
2108 Ga0081539_10003252
2109 Ga0081539_10012303
2110 Ga0070717_10033904
2111 Ga0070717_10047424
2112 Ga0070717_10241231
2113 Ga0075364_10055931
2114 Ga0075432_10015139
2115 Ga0070716_100545422
2116 Ga0070716_101271164
2117 Ga0070712_100012347
2118 Ga0070712_100266878
2119 Ga0097621_100013802
2120 Ga0097621_100024219
2121 Ga0097621_100355537
2122 Ga0097621_100587813
2123 Ga0097621_100810564
2124 Ga0075370_10264234
2125 Ga0068871_100027934
2126 Ga0075428_100000694
2127 Ga0075428_100004768
2128 Ga0075428_100294355
2129 Ga0075428_100587336
2130 Ga0075433_10043437
2131 Ga0075433_10080542
2132 Ga0075433_10178155
2133 Ga0075433_10210759
2134 Ga0075433_10345789
2135 Ga0075434_100007021
2136 Ga0075434_100233167
2137 Ga0075434_100260368
2138 Ga0075434_100261099
2139 Ga0075434_100268762
2140 Ga0075434_100278696
2141 Ga0075434_100438986
2142 Ga0075434_101034808
2143 Ga0075429_100411179
2144 Ga0075429_100626261
2145 Ga0068865_100031053
2146 Ga0068865_100064080
2147 Ga0068865_100140491
2148 Ga0068865_100163955
2149 Ga0068865_102057633
2150 Ga0075436_100073498
2151 Ga0097620_100038389
2152 Ga0097620_101887085
2153 Ga0075435_100013055
2154 Ga0075435_100167058
2155 Ga0075435_100621124
2156 Ga0075435_100730755
2157 Ga0105240_10142595
2158 Ga0105240_10535128
2159 Ga0111539_10008690
2160 Ga0111539_10148167
2161 Ga0111539_11913215
2162 Ga0111539_12017782
2163 Ga0105245_10036956
2164 Ga0105245_10048434
2165 Ga0105245_10091660
2166 Ga0105245_10251918
2167 Ga0105245_10484083
2168 Ga0105245_10778720
2169 Ga0105245_10874176
2170 Ga0105247_10046136
2171 Ga0105247_10907461
2172 Ga0114129_10009938
2173 Ga0114129_10015434
2174 Ga0114129_10022103
2175 Ga0105243_10035607
2176 Ga0105243_10152057
2177 Ga0105243_10422171
2178 Ga0105243_10718801
2179 Ga0105243_10955436
2180 Ga0105243_10997357
2181 Ga0105241_10023878
2182 Ga0105241_10189650
2183 Ga0105241_10382493
2184 Ga0105241_10411926
2185 Ga0105242_10081594
2186 Ga0105242_10104555
2187 Ga0105242_10106171
2188 Ga0105242_10117748
2189 Ga0105242_10254553
2190 Ga0105242_10843581
2191 Ga0105242_11392689
2192 Ga0105248_10105254
2193 Ga0105248_10421419
2194 Ga0105248_10556440
2195 Ga0105248_10621293
2196 Ga0105237_10037185
2197 Ga0105237_10358146
2198 Ga0105237_11194597
2199 Ga0105238_10017104
2200 Ga0105238_10069677
2201 Ga0105238_10366945
2202 Ga0105238_10369097
2203 Ga0105238_10450806
2204 Ga0105249_10283460
2205 Ga0105249_10689710
2206 Ga0105249_10772853
2207 Ga0105249_11107463
2208 Ga0105249_11995395
2209 Ga0105029_112195
2210 Ga0105239_10226875
2211 Ga0105239_10389075
2212 Ga0105239_10427946
2213 Ga0105239_10442962
2214 Ga0105239_10466363
2215 Ga0105239_10557683
2216 Ga0105239_11495136
2217 Ga0105246_10049177
2218 Ga0105246_10057920
2219 Ga0105246_10177519
2220 Ga0105246_10182799
2221 Ga0105246_10287073
2222 Ga0105246_11105564
2223 Ga0157341_1023156
2224 Ga0154019_108401
2225 Ga0154016_109853
2226 Ga0154014_155088
2227 Ga0154012_174592
2228 Ga0154010_169846
2229 Ga0157373_10129520
2230 Ga0157373_10252116
2231 Ga0157373_10269428
2232 Ga0157371_10917546
2233 Ga0157371_11319145
2234 Ga0157370_10288553
2235 Ga0157370_10472846
2236 Ga0157370_10645810
2237 Ga0157370_10868953
2238 Ga0157369_10040784
2239 Ga0157369_10054751
2240 Ga0157369_10160525
2241 Ga0157369_10368741
2242 Ga0157369_10490498
2243 Ga0157369_11135253
2244 Ga0157369_11734600
2245 Ga0157374_10524581
2246 Ga0157374_10959560
2247 Ga0157374_11907935
2248 Ga0157378_10151859
2249 Ga0157378_10266849
2250 Ga0157378_10284059
2251 Ga0157378_10428887
2252 Ga0157378_10724113
2253 Ga0157378_11885732
2254 Ga0157378_13075037
2255 Ga0163162_10046453
2256 Ga0163162_10099425
2257 Ga0163162_10414718
2258 Ga0163162_10415409
2259 Ga0163162_10415666
2260 Ga0163162_10432833
2261 Ga0163162_11026675
2262 Ga0163162_11356503
2263 Ga0163162_11863438
2264 Ga0157372_10046776
2265 Ga0157372_10060128
2266 Ga0157372_10079691
2267 Ga0157372_10418862
2268 Ga0157372_10555161
2269 Ga0157372_10743218
2270 Ga0157372_10883289
2271 Ga0157372_11425747
2272 Ga0157372_11487203
2273 Ga0157372_11630064
2274 Ga0157375_10064914
2275 Ga0157375_10139200
2276 Ga0157375_10316555
2277 Ga0157375_10525836
2278 Ga0157375_10724968
2279 Ga0157375_11946183
2280 Ga0163163_10096702
2281 Ga0163163_10176943
2282 Ga0163163_10208613
2283 Ga0163163_10268245
2284 Ga0163163_10339457
2285 Ga0163163_11371723
2286 Ga0163163_13039115
2287 Ga0157380_10047519
2288 Ga0157380_10288228
2289 Ga0157380_10376954
2290 Ga0157380_10400833
2291 Ga0157380_10572893
2292 Ga0157380_11516359
2293 Ga0157380_11524265
2294 Ga0157380_12711699
2295 Ga0157377_10026594
2296 Ga0157377_10314041
2297 Ga0157377_10356594
2298 Ga0157377_10592670
2299 Ga0157377_10928095
2300 Ga0157377_11023182
2301 Ga0157379_10147410
2302 Ga0157379_10325637
2303 Ga0157379_10431168
2304 Ga0157379_10531124
2305 Ga0157379_11248177
2306 Ga0157379_11739537
2307 Ga0157379_12341885
2308 Ga0157376_10045570
2309 Ga0157376_10046239
2310 Ga0157376_10087652
2311 Ga0157376_10570685
2312 Ga0157376_11387150
2313 Ga0157376_11728483
2314 Ga0157376_12257065
2315 Ga0163161_10081962
2316 Ga0163161_10105842
2317 Ga0163161_12029694
2318 Ga0197907_10050194
2319 Ga0197907_10086159
2320 Ga0197907_10212903
2321 Ga0197907_10268076
2322 Ga0197907_10378803
2323 Ga0197907_10533934
2324 Ga0197907_10881670
2325 Ga0197907_11286071
2326 Ga0197907_11298433
2327 Ga0197907_11482061
2328 Ga0206356_10124042
2329 Ga0206356_10200830
2330 Ga0206356_10361125
2331 Ga0206356_10509057
2332 Ga0206356_10516737
2333 Ga0206356_10824910
2334 Ga0206356_10913331
2335 Ga0206356_11044350
2336 Ga0206356_11156669
2337 Ga0206356_11286683
2338 Ga0206349_1386548
2339 Ga0206349_1530271
2340 Ga0206349_1613375
2341 Ga0206355_1018340
2342 Ga0206355_1035334
2343 Ga0206355_1055070
2344 Ga0206355_1328705
2345 Ga0206355_1630452
2346 Ga0206351_10072365
2347 Ga0206351_10093131
2348 Ga0206351_10468617
2349 Ga0206351_10495414
2350 Ga0206351_10796045
2351 Ga0206351_10858444
2352 Ga0206352_10254721
2353 Ga0206352_10314452
2354 Ga0206352_10341291
2355 Ga0206352_10408147
2356 Ga0206352_10649957
2357 Ga0206352_10815645
2358 Ga0206352_10939620
2359 Ga0206352_11168067
2360 Ga0206352_11295788
2361 Ga0206350_10430818
2362 Ga0206350_10432378
2363 Ga0206350_10544636
2364 Ga0206350_11196555
2365 Ga0206350_11654020
2366 Ga0206354_10074904
2367 Ga0206354_10208883
2368 Ga0206354_10331979
2369 Ga0206354_11017939
2370 Ga0206354_11068226
2371 Ga0206354_11172408
2372 Ga0206354_11291340
2373 Ga0206354_11520797
2374 Ga0206354_11614879
2375 Ga0206353_10014677
2376 Ga0206353_10282636
2377 Ga0206353_10330275
2378 Ga0206353_10591683
2379 Ga0206353_10790039
2380 Ga0206353_11192759
2381 Ga0206353_11631527
2382 Ga0206353_11688786
2383 Ga0206353_11996101
2384 Ga0154015_1068933
2385 Ga0154015_1105291
2386 Ga0154015_1142575
2387 Ga0154015_1285479
2388 Ga0154015_1417016
2389 Ga0154015_1538444
2390 Ga0224712_10001495
2391 Ga0224712_10011859
2392 Ga0224712_10015890
2393 Ga0224712_10024023
2394 Ga0224712_10038926
2395 Ga0224712_10101446
2396 Ga0209566_100066
2397 Ga0209674_100001
2398 Ga0209672_100039
2399 Ga0209147_100954
2400 Ga0209563_100001
2401 Ga0207427_100042
2402 Ga0209437_100538
2403 Ga0209258_101761
2404 Ga0209677_100001
2405 Ga0209677_102161
2406 Ga0209148_1000004
2407 Ga0209233_1000001
2408 Ga0209455_1000117
2409 Ga0209455_1003952
2410 Ga0207697_10119287
2411 Ga0207656_10013795
2412 Ga0207653_10047439
2413 Ga0207692_10007776
2414 Ga0207692_10288443
2415 Ga0207642_10204023
2416 Ga0207642_10773310
2417 Ga0207642_10836266
2418 Ga0207710_10436641
2419 Ga0207688_10003165
2420 Ga0207688_10016881
2421 Ga0207688_10036391
2422 Ga0207688_10167179
2423 Ga0207680_10598528
2424 Ga0207647_10021889
2425 Ga0207647_10028990
2426 Ga0207647_10090838
2427 Ga0207685_10619191
2428 Ga0207699_10099923
2429 Ga0207645_10064369
2430 Ga0207645_10137521
2431 Ga0207645_10149679
2432 Ga0207643_10011474
2433 Ga0207643_10048389
2434 Ga0207643_10050065
2435 Ga0207643_10199074
2436 Ga0207643_10202123
2437 Ga0207705_10013197
2438 Ga0207705_10120089
2439 Ga0207705_10202859
2440 Ga0207684_10002793
2441 Ga0207684_10018534
2442 Ga0207684_10116254
2443 Ga0207684_10745082
2444 Ga0207684_10830059
2445 Ga0207684_10897040
2446 Ga0207654_10060489
2447 Ga0207654_10081460
2448 Ga0207654_10873031
2449 Ga0207707_10112966
2450 Ga0207707_10115185
2451 Ga0207707_10471034
2452 Ga0207707_10547397
2453 Ga0207707_10689187
2454 Ga0207695_10129689
2455 Ga0207671_10080469
2456 Ga0207671_10508695
2457 Ga0207693_10022846
2458 Ga0207693_10258912
2459 Ga0207693_10900110
2460 Ga0207693_10910752
2461 Ga0207663_10011677
2462 Ga0207663_11442947
2463 Ga0207660_10000002
2464 Ga0207660_10117448
2465 Ga0207660_10197986
2466 Ga0207660_10318694
2467 Ga0207660_11056144
2468 Ga0207662_10397766
2469 Ga0207657_10001055
2470 Ga0207657_10031572
2471 Ga0207657_10044718
2472 Ga0207657_10171230
2473 Ga0207657_10404575
2474 Ga0207649_10730382
2475 Ga0207649_10978365
2476 Ga0207652_10015058
2477 Ga0207652_10079196
2478 Ga0207652_10447665
2479 Ga0207652_10542269
2480 Ga0207646_10028575
2481 Ga0207646_10037146
2482 Ga0207646_10048634
2483 Ga0207646_10067220
2484 Ga0207681_10357039
2485 Ga0207681_10982571
2486 Ga0207694_10006100
2487 Ga0207694_10010017
2488 Ga0207694_10079437
2489 Ga0207694_10261073
2490 Ga0207694_10321104
2491 Ga0207650_10263591
2492 Ga0207650_10358983
2493 Ga0207659_10083284
2494 Ga0207659_10100407
2495 Ga0207659_10659337
2496 Ga0207687_10000332
2497 Ga0207687_10068636
2498 Ga0207687_10076469
2499 Ga0207687_10486464
2500 Ga0207687_11125178
2501 Ga0207687_11342338
2502 Ga0207687_11533538
2503 Ga0207700_10199007
2504 Ga0207700_11333167
2505 Ga0207664_10004696
2506 Ga0207664_10106499
2507 Ga0207644_10862613
2508 Ga0207644_10987685
2509 Ga0207690_10043139
2510 Ga0207690_10096274
2511 Ga0207690_10623211
2512 Ga0207690_11518080
2513 Ga0207706_10012543
2514 Ga0207706_10196299
2515 Ga0207706_10199972
2516 Ga0207706_10482472
2517 Ga0207706_10603301
2518 Ga0207686_10020647
2519 Ga0207686_10059068
2520 Ga0207686_10465798
2521 Ga0207686_10991413
2522 Ga0207686_11206580
2523 Ga0207709_10020150
2524 Ga0207709_10136935
2525 Ga0207709_10179787
2526 Ga0207709_10254716
2527 Ga0207709_10554129
2528 Ga0207709_10575743
2529 Ga0207709_10593553
2530 Ga0207670_10055965
2531 Ga0207670_10225281
2532 Ga0207669_10039257
2533 Ga0207669_10101044
2534 Ga0207669_10174457
2535 Ga0207669_10194744
2536 Ga0207704_10061699
2537 Ga0207704_10111612
2538 Ga0207704_10412076
2539 Ga0207704_10521277
2540 Ga0207665_10159641
2541 Ga0207665_11145254
2542 Ga0207691_10138961
2543 Ga0207691_10221557
2544 Ga0207691_10527891
2545 Ga0207691_11386318
2546 Ga0207711_10110582
2547 Ga0207711_10113217
2548 Ga0207711_10325705
2549 Ga0207711_10488048
2550 Ga0207689_10021685
2551 Ga0207689_10029116
2552 Ga0207689_10095522
2553 Ga0207661_10000189
2554 Ga0207661_10016251
2555 Ga0207661_10030780
2556 Ga0207661_10283621
2557 Ga0207661_10508833
2558 Ga0207661_10529277
2559 Ga0207661_10772628
2560 Ga0207661_10966456
2561 Ga0207661_11445882
2562 Ga0207679_10216472
2563 Ga0207679_10246993
2564 Ga0207679_10673327
2565 Ga0207679_10700184
2566 Ga0207667_10011493
2567 Ga0207667_10266250
2568 Ga0207667_11307650
2569 Ga0207651_10602306
2570 Ga0207651_10793014
2571 Ga0207651_11378465
2572 Ga0207651_11583715
2573 Ga0207712_10153966
2574 Ga0207712_10653681
2575 Ga0207712_10671211
2576 Ga0207712_11326639
2577 Ga0207640_10018900
2578 Ga0207640_10063865
2579 Ga0207640_10266741
2580 Ga0207640_10616263
2581 Ga0207658_10125019
2582 Ga0207658_10691348
2583 Ga0207677_10063649
2584 Ga0207677_10114794
2585 Ga0207677_10542254
2586 Ga0207677_10566713
2587 Ga0207677_10696072
2588 Ga0207677_10723305
2589 Ga0207703_10074488
2590 Ga0207703_11458167
2591 Ga0207639_10430698
2592 Ga0207639_10764363
2593 Ga0207678_10112985
2594 Ga0207678_10146870
2595 Ga0207678_10330038
2596 Ga0207678_10353523
2597 Ga0207678_10509204
2598 Ga0207678_10587647
2599 Ga0207678_10993361
2600 Ga0207708_10026038
2601 Ga0207708_10090013
2602 Ga0207708_10118012
2603 Ga0207708_10153468
2604 Ga0207708_10213965
2605 Ga0207708_10321121
2606 Ga0207708_10324981
2607 Ga0207708_10568282
2608 Ga0207702_10033880
2609 Ga0207702_10042541
2610 Ga0207702_10149288
2611 Ga0207702_10158054
2612 Ga0207702_10503454
2613 Ga0207702_10846700
2614 Ga0207702_11296370
2615 Ga0207641_10049012
2616 Ga0207641_10308358
2617 Ga0207648_10078065
2618 Ga0207648_10151012
2619 Ga0207648_10228692
2620 Ga0207648_10334264
2621 Ga0207676_10065702
2622 Ga0207676_10140024
2623 Ga0207676_10851219
2624 Ga0207674_10134020
2625 Ga0207674_10162985
2626 Ga0207674_10168198
2627 Ga0207674_10455687
2628 Ga0207674_10532577
2629 Ga0207675_100082898
2630 Ga0207675_100166279
2631 Ga0207675_100195629
2632 Ga0207675_101470333
2633 Ga0207683_10008575
2634 Ga0207683_10067303
2635 Ga0207683_10154003
2636 Ga0207683_10358518
2637 Ga0207683_10427335
2638 Ga0207683_10461075
2639 Ga0207683_10515193
2640 Ga0207683_10740649
2641 Ga0207683_10957018
2642 Ga0207683_12149743
2643 Ga0207698_10020583
2644 Ga0207698_10324013
2645 Ga0209973_1020452
2646 Ga0209969_1032723
2647 Ga0209967_1013822
2648 Ga0209996_1031334
2649 Ga0209995_1064474
2650 Ga0209968_1014896
2651 Ga0209999_1010955
2652 Ga0209982_1034364
2653 Ga0210002_1018339
2654 Ga0209983_1058714
2655 Ga0209971_1007217
2656 Ga0209966_1025954
2657 Ga0209998_10007811
2658 Ga0209998_10024310
2659 Ga0209974_10019832
2660 Ga0207428_10000181
2661 Ga0268266_10338848
2662 Ga0268266_10958393
2663 Ga0268265_10321086
2664 Ga0268265_10997499
2665 Ga0268264_10102520
2666 Ga0268264_10569197
2667 Ga0268264_10591831
2668 Ga0268264_10756906
2669 Ga0268264_11401749
2670 Ga0265337_1016621
2671 Ga0265337_1035179
2672 Ga0265326_10014445
2673 Ga0265319_1000855
2674 Ga0265319_1101346
2675 Ga0265334_10030082
2676 Ga0265318_10033646
2677 Ga0265323_10078944
2678 Ga0265322_10010856
2679 Ga0265336_10167246
2680 Ga0265338_10030239
2681 Ga0265338_10739638
2682 Ga0265324_10006460
2683 Ga0265324_10017063
2684 Ga0265330_10010314
2685 Ga0265330_10013785
2686 Ga0265332_10023897
2687 Ga0265332_10030283
2688 Ga0265332_10153172
2689 Ga0265320_10002674
2690 Ga0265320_10004554
2691 Ga0265325_10004083
2692 Ga0265329_10003710
2693 Ga0265329_10004401
2694 Ga0265340_10004482
2695 Ga0265339_10098430
2696 Ga0265327_10003480
2697 Ga0265327_10075274
2698 Ga0265316_10007887
2699 Ga0265316_10023310
2700 Ga0265316_10059571
2701 Ga0265313_10053419
2702 Ga0307514_10020272
2703 Ga0316575_10006117
2704 Ga0316575_10317684
2705 Ga0316579_10023159
2706 Ga0316579_10066726
2707 Ga0316579_10130380
2708 Ga0316579_10145130
2709 Ga0316579_10219317
2710 Ga0316579_10503885
2711 Ga0265314_10016170
2712 Ga0265314_10116285
2713 Ga0265342_10001795
2714 Ga0265342_10034561
2715 Ga0316576_10037846
2716 Ga0316576_10043431
2717 Ga0316576_10074501
2718 Ga0316576_10076538
2719 Ga0316576_10240448
2720 Ga0316576_10689990
2721 Ga0316578_10100243
2722 Ga0316578_10132551
2723 Ga0316578_10445361
2724 Ga0307405_11648287
2725 Ga0316577_10017827
2726 Ga0316577_10083780
2727 Ga0316577_10092089
2728 Ga0316577_10224268
2729 Ga0316577_10232320
2730 Ga0316577_10249295
2731 Ga0316577_10305216
2732 Ga0316577_10520103
2733 Ga0307410_10454535
2734 Ga0307412_11506679
2735 Ga0307409_100096715
2736 Ga0307409_100548092
2737 Ga0307409_101808684
2738 Ga0307416_100613719
2739 Ga0307416_100855774
2740 Ga0307415_100625789
2741 Ga0316583_10023673
2742 Ga0316583_10061258
2743 Ga0316585_10004351
2744 Ga0316585_10091378
2745 Ga0316585_10181001
2746 Ga0316593_10053135
2747 Ga0316593_10120476
2748 Ga0316593_10250320
2749 Ga0316593_10367576
2750 Ga0316592_1013793
2751 Ga0316592_1021646
2752 Ga0316592_1026831
2753 Ga0316592_1096925
2754 Ga0316586_1058871
2755 Ga0316587_1081568
2756 Ga0316596_1025941
2757 Ga0316596_1040913
2758 Ga0316596_1058524
2759 Ga0316596_1130116
2760 Ga0316596_1146706
2761 Ga0373948_0133675
2762 Ga0373959_0036141
2763 Ga0373959_0037465
2764 Ga0373959_0117360
2765 Ga0373938_0029372
2766 Ga0373926_0098922
2767 Ga0373929_0133040
2768 Ga0373934_0069319
2769 Ga0373940_0077785
2770 Ga0373944_0317673
2771 Ga0373949_0048275
2772 Ga0373949_0076228
2773 Ga0373951_0017339
2774 Ga0373952_0009679
2775 Ga0373952_0029204
2776 Ga0373952_0089127
2777 Ga0373952_0110733
2778 Ga0373923_0007437
2779 Ga0373932_0013656
2780 Ga0373932_0075009
2781 Ga0373936_0273187
2782 Ga0373941_0043255
2783 Ga0373941_0068497
2784 Ga0373941_0148827
2785 Ga0373945_0092711
2786 Ga0373945_0157657
2787 Ga0373953_0038654
2788 Ga0373953_0091225
2789 Ga0373954_0023325
2790 Ga0373956_0264297
2791 Ga0373956_0525352
2792 Ga0373957_0010245
2793 Ga0373957_0134599
2794 Ga0373957_0152183
2795 Ga0373960_0125435
2796 Ga0373943_0004020
2797 Ga0373943_0416805
2798 Ga0373943_0761783
2799 Ga0373946_0028376
2800 Ga0373955_0106446
2801 Ga0373955_0575158
2802 Ga0373942_0006705
2803 Ga0373942_0276851
2804 Ga0373961_0032995
2805 Ga0373961_0197210
2806 Ga0373962_0057119
2807 Ga0373962_0083237
2808 Ga0373962_0148661
2809 Ga0316574_0071591
2810 Ga0316574_0098761
2811 Ga0316574_0172997
2812 Ga0316574_0224946
2813 Ga0316574_0232470
2814 Ga0316574_0392708
2815 Ga0316574_0427029
2816 Ga0373924_0037789
2817 Ga0373924_0231086
2818 Ga0373931_0029997
2819 Ga0373931_0116969
2820 Ga0373931_0126812
2821 Ga0373931_1135771
2822 Ga0373935_0012638
2823 Ga0373927_0308574
2824 Ga0373933_0181960
2825 Ga0373933_0412599
2826 Ga0373947_0015474
2827 Ga0373947_0101636
2828 Ga0373947_0245579
2829 Ga0373937_0278938
2830 Ga0373937_0445807
2831 Ga0373937_0516876
2832 Ga0373937_0708534
2833 Ga0373937_0744223
2834 Ga0265778_022895
2835 Ga0316582_0016976
2836 Ga0316582_0019246
2837 Ga0316582_0180659
2838 Ga0316582_0240395
2839 Ga0316582_0435598
2840 Ga0316582_0493860
2841 Ga0316582_0790219
2842 Ga0316584_0003848
2843 Ga0316584_0008456
2844 Ga0316584_0032481
2845 Ga0316584_0122179
2846 Ga0316584_0225132
2847 Ga0316584_0229218
2848 Ga0316584_0278001
2849 Ga0316584_0359630
2850 Ga0316584_0361671
2851 Ga0316584_0863698
2852 Ga0373925_0013236
2853 Ga0373925_1026623
2854 Ga0395899_0166028
2855 Ga0395900_0061899
2856 Ga0395900_0078136
2857 Ga0395900_0103562
2858 Ga0395900_0113402
2859 Ga0395898_0000381
2860 Ga0395898_0240350
2861 Ga0395905_0518375
2862 Ga0395905_0822163
2863 Ga0316581_0002334
2864 Ga0316581_0030105
2865 Ga0316581_0060460
2866 Ga0395901_0150442
2867 Ga0395901_0172994
2868 Ga0395901_0233292
2869 Ga0395901_0492651
2870 Ga0242420_122642
2871 Ga0242420_165300
2872 Ga0400489_12849
2873 Ga0436365_0144673
2874 Ga0436365_1046517
2875 Ga0436361_0793921
2876 Ga0436363_0126624
2877 Ga0436362_0739222
2878 Ga0439465_0020112
2879 Ga0451789_0724155
2880 Ga0451793_1457874
2881 Ga0451798_0847145
2882 Ga0451805_017166
2883 Ga0451807_2770562
2884 Ga0451833_0697339
2885 Ga0451839_1230110
2886 Ga0451845_0305454
2887 Ga0451845_0608312
2888 Ga0451849_0000801
2889 Ga0451851_0422564
2890 Ga0451843_0725649
2891 Ga0451855_1617624
2892 Ga0451853_0600829
2893 Ga0451853_1418465
2894 Ga0439448_0011384
2895 Ga0439448_0202695
2896 Ga0439450_122795
2897 Ga0439450_227377
2898 Ga0439455_0104539
2899 Ga0439456_043915
2900 Ga0450920_007738
2901 Ga0450923_014865
2902 Ga0450906_008981
2903 Ga0450907_037255
2904 Ga0439458_0148677
2905 Ga0439434_0060393
2906 Ga0439435_0070056
2907 Ga0439444_0050696
2908 Ga0439464_0165014
2909 Ga0439460_0311138
2910 Ga0450916_022216
2911 Ga0450918_013050
2912 Ga0451577_0016881
2913 Ga0451577_0117036
2914 Ga0451577_0143807
2915 Ga0451577_0276905
2916 Ga0451577_0314814
2917 Ga0439440_0115149
2918 Ga0466969_0103990
2919 Ga0466972_0005615
2920 Ga0466972_0234463
2921 Ga0453683_0036050
2922 Ga0453683_0154124
2923 Ga0453683_0466537
2924 Ga0466965_0006167
2925 Ga0466965_0014387
2926 Ga0466965_0107260
2927 Ga0466966_0010977
2928 Ga0466961_0087743
2929 Ga0466961_0201841
2930 Ga0466961_0204689
2931 Ga0466963_0083412
2932 Ga0466963_1016940
2933 Ga0466964_0180154
2934 Ga0466964_0224970
2935 Ga0453684_0060759
2936 Ga0453684_0088810
2937 Ga0453684_0456657
2938 Ga0453684_0491965
2939 Ga0453684_0526506
2940 Ga0453684_0627939
2941 Ga0453684_1134237
2942 Ga0453684_2424098
2943 Ga0466971_0059038
2944 Ga0466971_0183400
2945 Ga0466971_0608400
2946 Ga0466968_0354300
2947 Ga0466968_0381720
2948 Ga0466968_0491539
2949 Ga0466970_0033983
2950 Ga0466970_0072211
2951 Ga0466957_0038195
2952 Ga0466957_0052384
2953 Ga0466957_0070960
2954 Ga0466957_0196793
2955 Ga0466957_0224728
2956 Ga0466957_0247951
2957 Ga0466960_0019581
2958 Ga0466960_0057834
2959 Ga0466960_0059399
2960 Ga0466959_0004261
2961 Ga0466959_0039513
2962 Ga0451576_0034109
2963 Ga0451576_0185581
2964 Ga0466958_0002151
2965 Ga0466958_0018252
2966 Ga0466958_0031221
2967 Ga0466958_0087216
2968 Ga0466958_0399398
2969 Ga0466967_0266913
2970 Ga0466967_0903807
2971 Ga0466967_1299685
2972 Ga0466967_2311786
2973 Ga0495592_0065934
2974 Ga0495592_0233423
2975 Ga0495592_0286511
2976 Ga0495592_0685808
2977 Ga0495603_0009479
2978 Ga0495603_0097528
2979 Ga0495603_0191092
2980 Ga0495629_0124017
2981 Ga0495629_0161553
2982 Ga0495641_0006189
2983 Ga0495641_0055802
2984 Ga0495641_0060859
2985 Ga0495651_0041297
2986 Ga0495653_0011794
2987 Ga0495653_0025679
2988 Ga0495653_0308089
2989 Ga0495650_0040933
2990 Ga0495650_0048271
2991 Ga0495650_0111255
2992 Ga0495580_0120527
2993 Ga0495582_0031758
2994 Ga0495582_0080740
2995 Ga0495582_0233016
2996 Ga0495639_0172417
2997 Ga0495639_0373464
2998 Ga0495662_0019242
2999 Ga0495662_0180519
3000 Ga0495664_0145839
3001 Ga0495664_0226434
3002 Ga0495664_0949774
3003 Ga0495584_0228811
3004 Ga0495584_0337063
3005 Ga0495584_0385238
3006 Ga0495594_0367075
3007 Ga0495594_0423396
3008 Ga0495596_0087503
3009 Ga0495606_0259492
3010 Ga0495608_0060429
3011 Ga0495608_0127238
3012 Ga0495616_0228237
3013 Ga0495618_0029382
3014 Ga0495618_0060714
3015 Ga0495618_0238478
3016 Ga0495620_0263375
3017 Ga0495628_0043996
3018 Ga0495628_0867295
3019 Ga0495630_0035741
3020 Ga0495630_0170906
3021 Ga0495637_0254397
3022 Ga0495644_0187506
3023 Ga0495648_0033982
3024 Ga0495663_0125873
3025 Ga0495663_0224886
3026 Ga0495666_0031409
3027 Ga0495666_0545796
3028 Ga0495652_0127724
3029 Ga0495652_0333093
3030 Ga0495652_0787729
3031 Ga0495652_1016440
3032 Ga0495665_0018361
3033 Ga0495640_0021538
3034 Ga0495640_0302808
3035 Ga0495587_0223807
3036 Ga0495598_0165374
3037 Ga0495609_0151753
3038 Ga0495645_0071267
3039 Ga0495645_0316647
3040 Ga0495645_0495045
3041 Ga0495667_0077476
3042 Ga0495667_0516058
3043 Ga0495656_0019032
3044 Ga0495656_0410222
3045 Ga0495634_0008932
3046 Ga0495634_0132568
3047 Ga0495635_0063284
3048 Ga0495635_0206729
3049 Ga0495635_0788357
3050 Ga0495588_0006175
3051 Ga0495657_0003110
3052 Ga0495599_0151254
3053 Ga0495599_0735957
3054 Ga0495623_0296175
3055 Ga0495646_0093243
3056 Ga0495646_0168405
3057 Ga0495647_0003870
3058 Ga0495647_0004692
3059 Ga0495647_0432965
3060 Ga0495647_0507820
3061 Ga0495658_0064282
3062 Ga0495658_0070216
3063 Ga0495658_0081948
3064 Ga0495658_0133954
3065 Ga0495658_0692567
3066 Ga0495669_0117319
3067 Ga0495613_0026405
3068 Ga0495613_0030825
3069 Ga0495613_0306163
3070 Ga0495624_0156737
3071 Ga0495624_0440497
3072 Ga0495589_0031760
3073 Ga0495600_0003596
3074 Ga0495600_0183782
3075 Ga0495581_0004186
3076 Ga0495581_0217471
3077 Ga0495604_0016907
3078 Ga0495604_0288647
3079 Ga0495604_0337907
3080 Ga0495674_0012859
3081 Ga0495674_0023760
3082 Ga0495674_0238423
3083 Ga0495672_0004778
3084 Ga0495676_0251165
3085 Ga0495676_0435511
3086 Ga0495676_0474316
3087 Ga0495680_0018449
3088 Ga0495680_0074503
3089 Ga0495680_0281901
3090 Ga0495680_0445908
3091 Ga0495675_0035654
3092 Ga0495677_0172211
3093 Ga0495684_0014399
3094 Ga0495684_0014428
3095 Ga0495686_0155677
3096 Ga0495593_0010386
3097 Ga0495593_0499110
3098 Ga0495602_0048098
3099 Ga0495602_0598083
3100 Ga0495614_0002806
3101 Ga0496100_0020442
3102 Ga0496100_0037424
3103 Ga0496100_0046263
3104 Ga0496100_0129847
3105 Ga0496100_0156060
3106 Ga0496100_0263667
3107 Ga0496100_0275060
3108 Ga0496100_0532940
3109 Ga0496100_0798570
3110 Ga0496101_0029830
3111 Ga0496101_0064090
3112 Ga0496101_0156944
3113 Ga0496101_0331525
3114 Ga0496101_0415467
3115 Ga0496101_0475184
3116 Ga0496101_1526072
3117 Ga0496102_0008426
3118 Ga0496102_0039336
3119 Ga0496102_0256404
3120 Ga0496102_0355090
3121 Ga0496102_0520129
3122 Ga0496102_0596746
3123 Ga0496102_0782946
3124 Ga0496102_0816894
3125 Ga0496102_1254518
3126 Ga0496103_0019667
3127 Ga0496103_0039276
3128 Ga0496103_0185811
3129 Ga0496103_0377231
3130 Ga0496103_0458330
3131 Ga0496103_0663379
3132 Ga0496104_0008605
3133 Ga0496104_0045348
3134 Ga0496104_0054378
3135 Ga0496104_0106807
3136 Ga0496104_0136994
3137 Ga0496104_0181317
3138 Ga0496104_0958994
3139 Ga0496105_0034806
3140 Ga0496105_0036308
3141 Ga0496105_0054080
3142 Ga0496105_0069692
3143 Ga0496105_0070961
3144 Ga0496105_0115593
3145 Ga0496105_0204619
3146 Ga0496105_0839121
3147 Ga0496105_1279356
3148 Ga0496106_0019758
3149 Ga0496106_0077650
3150 Ga0496106_0169102
3151 Ga0496106_0245166
3152 Ga0496106_0284688
3153 Ga0496106_0433338
3154 Ga0496106_0625231
3155 Ga0496106_0742049
3156 Ga0496106_1279327
3157 Ga0496107_0018477
3158 Ga0496107_0023742
3159 Ga0496107_0033346
3160 Ga0496107_0053046
3161 Ga0496107_0140243
3162 Ga0496107_0480403
3163 Ga0496108_0009320
3164 Ga0496108_0010462
3165 Ga0496108_0277693
3166 Ga0496108_0574227
3167 Ga0496108_0719853
3168 Ga0496109_0000445
3169 Ga0496109_0003257
3170 Ga0496109_0082254
3171 Ga0496109_0161488
3172 Ga0496109_0169101
3173 Ga0496109_0190345
3174 Ga0496109_0217162
3175 Ga0496109_0225976
3176 Ga0496109_0775071
3177 Ga0496109_1874503
3178 Ga0496110_0000079
3179 Ga0496110_0000983
3180 Ga0496110_0017812
3181 Ga0496110_0032177
3182 Ga0496110_0207399
3183 Ga0496110_0915272
3184 Ga0496110_0940903
3185 Ga0496111_0000557
3186 Ga0496111_0001267
3187 Ga0496111_0096517
3188 Ga0496111_0204837
3189 Ga0496111_0647267
3190 Ga0496111_0954755
3191 Ga0496112_0000007
3192 Ga0496112_0008451
3193 Ga0496112_0017728
3194 Ga0496112_0055603
3195 Ga0496112_0078197
3196 Ga0496112_1011175
3197 Ga0496112_1397289
3198 Ga0496112_1623170
3199 Ga0496113_0017092
3200 Ga0496113_0020455
3201 Ga0496113_0061383
3202 Ga0496113_1519630
3203 Ga0496114_0004840
3204 Ga0496114_0006753
3205 Ga0496114_0037031
3206 Ga0496114_0046560
3207 Ga0496114_0056294
3208 Ga0496114_0064981
3209 Ga0496114_0117309
3210 Ga0496114_0241471
3211 Ga0496114_0623169
3212 Ga0496114_1089561
3213 Ga0496115_0010379
3214 Ga0496115_0012343
3215 Ga0496115_0027891
3216 Ga0496115_0037851
3217 Ga0496115_0056073
3218 Ga0496115_0073003
3219 Ga0496115_0094650
3220 Ga0496115_0153982
3221 Ga0496115_0173105
3222 Ga0496115_0783581
3223 Ga0496116_0073590
3224 Ga0496117_0085314
3225 Ga0496117_0294273
3226 Ga0496118_0005764
3227 Ga0496118_0194341
3228 Ga0496119_0012846
3229 Ga0496120_0033281
3230 Ga0496121_0267441
3231 Ga0496122_0313017
3232 Ga0496126_0016860
3233 Ga0496126_0023859
3234 Ga0496126_0093794
3235 Ga0501306_015803
3236 Ga0501308_008067
3237 Ga0501309_033628
3238 Ga0501310_007316
3239 Ga0501305_018823
3240 Ga0501307_059577
3241 Ga0501317_013459
3242 Ga0501031_0205302
3243 Ga0501031_0303543
3244 Ga0501031_0370991
3245 Ga0501031_0441178
3246 Ga0501031_0877668
3247 Ga0501032_0243871
3248 Ga0501032_0267891
3249 Ga0501032_0318392
3250 Ga0501032_1025586
3251 Ga0501033_0335291
3252 Ga0501033_0450220
3253 Ga0501033_0780734
3254 Ga0501034_0012529
3255 Ga0501034_0371459
3256 Ga0501034_0694229
3257 Ga0501036_0036626
3258 Ga0501036_0084524
3259 Ga0501036_0530272
3260 Ga0501037_0295303
3261 Ga0501037_0389098
3262 Ga0501038_0041796
3263 Ga0501039_0007709
3264 Ga0501039_0012581
3265 Ga0501039_0332426
3266 Ga0501039_0947982
3267 Ga0501039_1363484
3268 Ga0501040_0004923
3269 Ga0501040_0079281
3270 Ga0501040_0264550
3271 Ga0501040_0334470
3272 Ga0501040_0473144
3273 Ga0501040_0541266
3274 Ga0501041_0038812
3275 Ga0501041_0071912
3276 Ga0501041_0222709
3277 Ga0501041_0470904
3278 Ga0501041_0512440
3279 Ga0501042_0027184
3280 Ga0501042_0326457
3281 Ga0501042_0514206
3282 Ga0501042_0612620
3283 Ga0501043_0022634
3284 Ga0501043_0361287
3285 Ga0501043_0386469
3286 Ga0501046_0134747
3287 Ga0501046_0820294
3288 Ga0501047_0099339
3289 Ga0501047_0583711
3290 Ga0501048_0010287
3291 Ga0501048_0132559
3292 Ga0501048_0307824
3293 Ga0501067_0003078
3294 Ga0501067_0042917
3295 Ga0501067_0265468
3296 Ga0501067_0379170
3297 Ga0501068_0002322
3298 Ga0501068_0033823
3299 Ga0501068_0400123
3300 Ga0501068_0441565
3301 Ga0501069_0000453
3302 Ga0501069_0023498
3303 Ga0501069_0063145
3304 Ga0501069_0120939
3305 Ga0501069_0625440
3306 Ga0501070_0003383
3307 Ga0501070_0005689
3308 Ga0501070_0078845
3309 Ga0501070_0082198
3310 Ga0501070_0824638
3311 Ga0501071_0000119
3312 Ga0501071_0001083
3313 Ga0501071_0003597
3314 Ga0501071_0013395
3315 Ga0501071_0035692
3316 Ga0501071_0079974
3317 Ga0501071_0093200
3318 Ga0501071_0186402
3319 Ga0501071_0232425
3320 Ga0501071_0325563
3321 Ga0501071_0594473
3322 Ga0501071_0649097
3323 Ga0501072_0003791
3324 Ga0501072_0196150
3325 Ga0501072_0391552
3326 Ga0501072_0838180
3327 Ga0501073_0050481
3328 Ga0501073_0348598
3329 Ga0501073_0397229
3330 Ga0501074_0080636
3331 Ga0501074_0201833
3332 Ga0501074_0219858
3333 Ga0501074_0460017
3334 Ga0501075_0003018
3335 Ga0501075_0017924
3336 Ga0501075_0065727
3337 Ga0501075_0417306
3338 Ga0501075_0724896
3339 Ga0501076_0011794
3340 Ga0501076_0018028
3341 Ga0501076_0025886
3342 Ga0501076_0235600
3343 Ga0501076_0395260
3344 Ga0501076_0626588
3345 Ga0501076_0969926
3346 Ga0501077_0001393
3347 Ga0501077_0013176
3348 Ga0501077_0341118
3349 Ga0501077_0547376
3350 Ga0501079_0001191
3351 Ga0501079_0008393
3352 Ga0501079_0294174
3353 Ga0501079_0296414
3354 Ga0501079_0369740
3355 Ga0501079_0721627
3356 Ga0501080_0058666
3357 Ga0501080_0208610
3358 Ga0501080_0621568
3359 Ga0501080_0715172
3360 Ga0501080_0931016
3361 Ga0501080_1081449
3362 Ga0501081_0000266
3363 Ga0501081_0016532
3364 Ga0501081_0536745
3365 Ga0501081_1153071
3366 Ga0501083_0058547
3367 Ga0501083_0111389
3368 Ga0501083_0539371
3369 Ga0501083_0655407
3370 Ga0501083_0761909
3371 Ga0501035_0834418
3372 Ga0501044_0553545
3373 Ga0501045_0010860
3374 Ga0501045_0031322
3375 Ga0501045_0159456
3376 Ga0501045_0165912
3377 Ga0501045_0284278
3378 Ga0501045_0918306
3379 nmdc:mga00v17_41757_c1
3380 nmdc:mga0yw44_18369_c1
3381 nmdc:mga0yw44_310776_c1
3382 nmdc:mga0yw44_47549_c1
3383 nmdc:mga06z11_349474_c1
3384 nmdc:mga07m45_108234_c1
3385 nmdc:mga05p37_24103_c1
3386 nmdc:mga05p37_33875_c1
3387 nmdc:mga05p37_3540_c1
3388 nmdc:mga09592_208420_c2
3389 nmdc:mga09592_51891_c1
3390 nmdc:mga0qj67_418401_c1
3391 nmdc:mga06r32_134251_c1
3392 nmdc:mga08y16_1246015_c1
3393 nmdc:mga08y16_266255_c1
3394 nmdc:mga08y16_433649_c1
3395 nmdc:mga08y16_82947_c1
3396 nmdc:mga0n895_1104575_c1
3397 nmdc:mga0n895_21002_c1
3398 nmdc:mga0n895_279161_c1
3399 nmdc:mga0n895_363286_c1
3400 nmdc:mga0n895_479689_c1
3401 nmdc:mga0n895_489885_c1
3402 nmdc:mga0n895_56580_c1
3403 nmdc:mga0n895_719278_c1
3404 nmdc:mga0rr50_179533_c1
3405 nmdc:mga0rr50_199265_c1
3406 nmdc:mga0rr50_368092_c1
3407 nmdc:mga0rr50_67644_c1
3408 nmdc:mga08x19_338891_c1
3409 nmdc:mga08x19_367925_c1
3410 nmdc:mga08x19_425770_c1
3411 nmdc:mga0a205_1468245_c1
3412 nmdc:mga0a205_2010_c1
3413 nmdc:mga0a205_252371_c1
3414 nmdc:mga0a205_25674_c1
3415 nmdc:mga0a205_271456_c1
3416 nmdc:mga0a205_327973_c1
3417 Ga0495601_0016271
3418 Ga0495601_0045561
3419 Ga0495601_0050354
3420 Ga0495601_0073549
3421 Ga0495601_0157372
3422 Ga0495601_0459998
3423 Ga0495601_0598805
3424 Ga0495612_0109786
3425 Ga0495612_0125030
3426 Ga0500635_0000204
3427 Ga0495655_0079213
3428 Ga0495595_0046669
3429 Ga0495595_0088470
3430 Ga0495619_0007866
3431 Ga0495619_0026075
3432 Ga0495619_0067168
3433 Ga0495619_0250509
3434 Ga0495619_0550580
3435 Ga0501084_0006409
3436 Ga0501084_0015419
3437 Ga0501084_0162417
3438 Ga0501084_0179330
3439 Ga0590071_046949
3440 Ga0587084_008557
3441 Ga0587084_093124
3442 Ga0587093_032545
3443 Ga0587066_105217
3444 Ga0587070_026154
3445 Ga0587070_056270
3446 Ga0587070_057172
3447 Ga0587070_101553
3448 Ga0587073_0070967
3449 Ga0587073_0217606
3450 Ga0587077_077231
3451 Ga0587077_132746
3452 Ga0587077_261026
3453 Ga0587080_028007
3454 Ga0587080_029121
3455 Ga0587080_033122
3456 Ga0587080_078742
3457 Ga0587080_153072
3458 Ga0587082_108034
3459 Ga0587083_0003623
3460 Ga0587083_0097976
3461 Ga0587083_0122413
3462 Ga0587083_0258639
3463 Ga0587085_009458
3464 Ga0587088_003103
3465 Ga0587088_061741
3466 Ga0587089_015017
3467 Ga0587090_021586
3468 Ga0587090_034598
3469 Ga0587091_018726
3470 Ga0587091_018976
3471 Ga0587091_041792
3472 Ga0587091_068825
3473 Ga0587091_080519
3474 Ga0587092_043274
3475 Ga0587094_126096
3476 Ga0587098_037316
3477 Ga0587098_088197
3478 Ga0587106_135570
3479 Ga0587101_045628
3480 Ga0587122_000616
3481 Ga0587122_045407
3482 Ga0587128_000395
3483 Ga0587128_022020
3484 Ga0587128_045034
3485 Ga0587128_046109
3486 Ga0587062_075427
3487 Ga0587067_058027
3488 Ga0587067_130653
3489 Ga0587067_152189
3490 Ga0587068_008623
3491 Ga0587069_014182
3492 Ga0587069_061781
3493 Ga0587072_126320
3494 Ga0587075_018259
3495 Ga0587075_053703
3496 Ga0587076_014556
3497 Ga0587076_035987
3498 Ga0587079_050510
3499 Ga0587079_063562
3500 Ga0587102_001277
3501 Ga0587107_068402
3502 Ga0587107_104737
3503 Ga0587110_016957
3504 Ga0587110_038518
3505 Ga0587114_009697
3506 Ga0587114_070143
3507 Ga0587120_026200
3508 Ga0587071_063222
3509 Ga0587071_074609
3510 Ga0587071_088613
3511 Ga0587071_089239
3512 Ga0587071_102775
3513 Ga0587111_0081325
3514 Ga0587111_0119404
3515 Ga0587111_0178622
3516 Ga0501082_0014508
3517 Ga0501082_0020323
3518 Ga0501082_0410999
3519 Ga0501082_0521707
3520 Ga0501082_1212715
3521 Ga0501082_1991016
3522 Ga0466962_0032211
3523 Ga0530510_0042730
3524 Ga0530510_0061548
3525 Ga0530510_0126308
3526 Ga0530510_0641936
3527 Ga0530510_1078602
3528 2547411357
3529 2554256760
3530 2616696762
3531 2616901906
3532 2644439365
3533 2644633261
3534 2784589770
3535 2808843366
3536 2809233440
3537 2812356679
3538 2812479392
3539 2852643123
3540 2862185297
3541 2862292094
3542 2862516757
3543 2867429963
3544 2912718428
3545 2912730754
3546 2919470265
3547 2935395234
3548 2946069192
3549 2946077140
3550 2947227742
3551 2954695554
3552 2954710748
3553 2954714977
3554 2954724919
3555 2954736899
3556 2954743845
3557 2954755747
3558 2954762798
3559 3006398680
3560 3006490571
3561 3006498854
3562 8002784650
3563 8023626963
3564 8025417220
3565 8033691144
3566 8056837587

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00416

Ribosomal_S13

Ribosomal protein S13/S18

3

111

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
1l2b-assembly1.cif.gz_A mutm (fpg) dna end-product structure 0.9115 25 58
3vk7-assembly2.cif.gz_B crystal structure of dna-glycosylase bound to dna containing 5-hydroxyuracil 0.9038 25 60
3a46-assembly2.cif.gz_B crystal structure of mvnei1/thf complex 0.9022 25 60
1l1z-assembly1.cif.gz_A mutm (fpg) covalent-dna intermediate 0.902 25 58
4nrw-assembly2.cif.gz_B mvnei1-g86d 0.9017 25 60
ID Description Score Start End Superfamily
1i94M01 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; 0.9273 14 63 1.10.8.50
af_Q8HCP0_1_71_1.10.8.50 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; 0.903 1 70 1.10.8.50
af_P54019_1_77_1.10.8.50 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; 0.9012 2 60 1.10.8.50
af_A0A1D8PQQ5_1_82_1.10.8.50 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; 0.8966 2 61 1.10.8.50
af_P9WH61_1_72_1.10.8.50 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; 0.8963 1 71 1.10.8.50
ID Description Score Start End GO Terms
AF-A0A6A6K1H1-F1-model_v4 DNA-directed RNA polymerase (EC 2.7.7.6) (Plastid-encoded RNA polymerase subunit alpha) 0.9206 2 67 GO:0000428
GO:0001054
GO:0001055
GO:0001056
GO:0001057
GO:0001058
GO:0001065
GO:0001066
GO:0003677
GO:0003735
GO:0005737
GO:0005840
GO:0006412
GO:0019843
GO:0046983
GO:1990904
AF-M2S144-F1-model_v4 40S ribosomal protein S18 0.9139 1 61 GO:0003723
GO:0003735
GO:0005829
GO:0006412
GO:0015935
AF-A0A7C0UWM7-F1-model_v4 30S ribosomal protein S13 0.9136 2 60 GO:0003723
GO:0003735
GO:0005829
GO:0006412
GO:0015935
AF-A0A1J3D8M4-F1-model_v4 40S ribosomal protein S18 0.9114 2 62 GO:0003723
GO:0003735
GO:0005829
GO:0006412
GO:0015935
AF-A0A7I9XLN3-F1-model_v4 Small ribosomal subunit protein uS11 0.9052 3 67 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904

Map