F495685
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1783 | 637 | 3566 | 124 |
Family's Representative Sequence
| Representative Sequence | 3300005467|Ga0070706_100001187|Ga0070706_10000118715 |
| Length | 128 |
| Sequence | MARIAGVDIPREKRVEIALTYIYGIGLTTSQKVLTATRIDPDTRVKNLTEEETARLREYIDRNPDIQVEGDLRRIVDLNIKRLMEINCYRGIRHRRNLPVHGQRTRTNARTRRGAKKTVAGKKKATKK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 2 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 3 | 3300001978 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 | Metagenome | Rhizosphere |
| 4 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 5 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 6 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 7 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 8 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 9 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 10 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 11 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 12 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 13 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 14 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 15 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 16 | 3300003162 | Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 17 | 3300003163 | Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 18 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 19 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 20 | 3300003577 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 21 | 3300003579 | Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 22 | 3300003693 | Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 23 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 24 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 25 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 26 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 27 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 28 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 29 | 3300004785 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-1 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 30 | 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 31 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 32 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 33 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 34 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 35 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 36 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 40 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 43 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 44 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 46 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 48 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 59 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 62 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 63 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 65 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 66 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 67 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 70 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 71 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 76 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 77 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 78 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 79 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 80 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 82 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 83 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 84 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 85 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 87 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 88 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 91 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 92 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 93 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 94 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 95 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 96 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 97 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 98 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 99 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 100 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 101 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 102 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 103 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 104 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 105 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 106 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 107 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 108 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 109 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 110 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 111 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 112 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 113 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 114 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 115 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 116 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 118 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 119 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 120 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 121 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 122 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 123 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 124 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 125 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 127 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 135 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 136 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 137 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 138 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 139 | 3300009984 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_127 metaG | Metagenome | Rhizosphere |
| 140 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 141 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 142 | 3300012494 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 | Metagenome | Rhizosphere |
| 143 | 3300013044 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 144 | 3300013045 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 145 | 3300013052 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 146 | 3300013059 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 147 | 3300013062 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 148 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 150 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 151 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 152 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 153 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 154 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 155 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 156 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 157 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 158 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 159 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 160 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 161 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 162 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 163 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 164 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 165 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 166 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 167 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 168 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 169 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 170 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 171 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 172 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 173 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 174 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 175 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 176 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 177 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 178 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 179 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 180 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 181 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 182 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 183 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 184 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 185 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 186 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300027252 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 254 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 255 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 256 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 257 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 258 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 259 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 260 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 261 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 262 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 263 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 264 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 265 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 266 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 267 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 268 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 269 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 270 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 271 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 272 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 273 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 274 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 275 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 276 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 277 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 278 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 279 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 280 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 281 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 282 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 283 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 284 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 285 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 286 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 287 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 288 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 289 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 290 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 291 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 292 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 293 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 294 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 295 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 296 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 297 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 298 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 299 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 300 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 301 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 302 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 303 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 304 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 305 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 306 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 307 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 308 | 3300033527 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 309 | 3300033529 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 310 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 311 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 312 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 313 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 314 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 315 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 316 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 317 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 318 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 319 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 320 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 321 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 322 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 323 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 324 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 325 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 326 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 327 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 328 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 329 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 330 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 331 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 332 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 333 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 334 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 335 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 336 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 337 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 338 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 339 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 340 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 341 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 342 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 343 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 344 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 345 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 346 | 3300036457 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 347 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 348 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 349 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 350 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 351 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 352 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 353 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 354 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 355 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 356 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 357 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 358 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 359 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 360 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 361 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 362 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 363 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 364 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 365 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 366 | 3300041461 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaT | Metatranscriptome | Rhizoplane |
| 367 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 368 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 369 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 370 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 371 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 372 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 373 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 374 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 375 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 376 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 377 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 378 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 379 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 380 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 381 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 382 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 383 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 384 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 385 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 386 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 387 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 388 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 389 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 390 | 3300042530 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 | Metagenome | Rhizosphere |
| 391 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 392 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 393 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 394 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 395 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 396 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 397 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 398 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 399 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 400 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 401 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 402 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 403 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 404 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 405 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 406 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 407 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 408 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 409 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 410 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 411 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 412 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 420 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 421 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 422 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 423 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 424 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 425 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 426 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 427 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 428 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 429 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 430 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 431 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 432 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 433 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 434 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 435 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 436 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 437 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 438 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 439 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 440 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 441 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 442 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 443 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 444 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 445 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 446 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 447 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 448 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 449 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 450 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 451 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 452 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 453 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 454 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 455 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 456 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 457 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 458 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 459 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 460 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 461 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 462 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 463 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 464 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 465 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 466 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 467 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 468 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 469 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 470 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 471 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 472 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 473 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 474 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 475 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 476 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 477 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 478 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 479 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 480 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 481 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 482 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 483 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 484 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 485 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 486 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 487 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 488 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 489 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 490 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 491 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 492 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 493 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 494 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 495 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 496 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 497 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 498 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 499 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 500 | 3300049128 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 501 | 3300049129 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 502 | 3300049130 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 503 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 504 | 3300049162 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 505 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 506 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 507 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 508 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 509 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 510 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 511 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 512 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 513 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 514 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 515 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 516 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 517 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 518 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 519 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 520 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 521 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 522 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 523 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 524 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 525 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 526 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 527 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 528 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 529 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 530 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 531 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 532 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 533 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 534 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 535 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 536 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 537 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 538 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 539 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 540 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 541 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 542 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 543 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 544 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 545 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 546 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 547 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 548 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 549 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 550 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 551 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 552 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 553 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 554 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 555 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 556 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 557 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 558 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 559 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 560 | 3300059477 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 561 | 3300059478 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 562 | 3300059490 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 563 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 564 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 565 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 566 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 567 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 568 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 569 | 3300059506 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 570 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 571 | 3300059509 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 572 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 573 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 574 | 3300059512 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 575 | 3300059513 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 576 | 3300059604 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 577 | 3300059605 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 578 | 3300059623 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 579 | 3300059628 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 160R_AD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 580 | 3300059630 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 581 | 3300059639 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 582 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 583 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 584 | 3300059642 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 585 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 586 | 3300059644 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 587 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 588 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 589 | 3300059649 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 590 | 3300059652 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 591 | 3300059654 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 148R_CW_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 592 | 3300059655 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 593 | 3300059659 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 157R_AD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 594 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 595 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 596 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 597 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 598 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 599 | 2547132111 | Streptomyces sp. TOR3209 | Isolate | Rhizosphere |
| 600 | 2554235005 | Streptomyces violaceusniger SPC6 | Isolate | Rhizosphere |
| 601 | 2616644814 | Streptomyces mirabilis OK461 | Isolate | Rhizosphere |
| 602 | 2616644941 | Streptomyces atratus OK807 | Isolate | Rhizosphere |
| 603 | 2643221678 | Streptomyces sp. Root1310 | Isolate | Unclassified |
| 604 | 2643221714 | Streptomyces sp. Root264 | Isolate | Unclassified |
| 605 | 2784132148 | Streptomyces sp. E5N91 SAI-083 | Isolate | Unclassified |
| 606 | 2808606359 | Streptomyces sp. RJA2910 | Isolate | Unclassified |
| 607 | 2808606448 | Streptomyces sp. 193411 | Isolate | Unclassified |
| 608 | 2811994879 | Streptomyces sp. 4-17 | Isolate | Unclassified |
| 609 | 2811994917 | Streptomyces sp. SLBN-134 | Isolate | Unclassified |
| 610 | 2852635781 | Streptomyces sp. AK010 | Isolate | Rhizosphere |
| 611 | 2862178590 | Streptomyces sp. SDr-06 | Isolate | Rhizosphere |
| 612 | 2862290372 | Streptomyces triticagri NEAU-YY421 | Isolate | Rhizosphere |
| 613 | 2862507626 | Streptomyces sp. NWU339 | Isolate | Unclassified |
| 614 | 2867428634 | Streptomyces sp. RP5T | Isolate | Unclassified |
| 615 | 2912715099 | Streptomyces sp. Z423-1 | Isolate | Rhizosphere |
| 616 | 2912723979 | Streptomyces sp. NEAU-sy36 | Isolate | Rhizosphere |
| 617 | 2919468124 | Streptomyces sp. 3330 | Isolate | Rhizosphere |
| 618 | 2935390628 | Streptomyces sp. PvR034 | Isolate | Rhizosphere |
| 619 | 2946064051 | Streptomyces luteogriseus W4I19-1 | Isolate | Rhizosphere |
| 620 | 2946072368 | Streptomyces achromogenes W4I19-2 | Isolate | Rhizosphere |
| 621 | 2947224130 | Streptomyces afghaniensis W1I20 | Isolate | Rhizosphere |
| 622 | 2954691527 | Streptomyces sp. SAI-127 | Isolate | Rhizosphere |
| 623 | 2954701450 | Streptomyces sp. SAI-144 | Isolate | Rhizosphere |
| 624 | 2954711539 | Streptomyces sp. SAI-090 | Isolate | Rhizosphere |
| 625 | 2954721474 | Streptomyces sp. SAI-117 | Isolate | Rhizosphere |
| 626 | 2954731030 | Streptomyces sp. SAI-133 | Isolate | Rhizosphere |
| 627 | 2954740390 | Streptomyces sp. SAI-041 | Isolate | Rhizosphere |
| 628 | 2954749733 | Streptomyces sp. SAI-135 | Isolate | Rhizosphere |
| 629 | 2954759201 | Streptomyces sp. SAI-208 | Isolate | Rhizosphere |
| 630 | 3006393351 | Streptomyces sp. SID4985 | Isolate | Unclassified |
| 631 | 3006486233 | Streptomyces sp. BR123 | Isolate | Rhizosphere |
| 632 | 3006493962 | Streptomyces grisecoloratus TRM S81-3 | Isolate | Rhizosphere |
| 633 | 8002784119 | Frankia sp. AgB1.9 | Isolate | Nodule |
| 634 | 8023623736 | Streptomyces sp. 111WW2 | Isolate | Unclassified |
| 635 | 8025413630 | Streptomyces sp. CAI-17 | Isolate | Rhizosphere |
| 636 | 8033684223 | Streptomyces phytophilus PIP175 | Isolate | Unclassified |
| 637 | 8056829672 | Streptomyces barringtoniae JA03 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 86.03 |
| Metatranscriptomes | 11.78 |
| Isolates | 2.19 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.85 |
| Nodule | 0.06 |
| Rhizoplane | 7.12 |
| Rhizosphere | 88.5 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070706_100001187 | 3300005467 | Bacteria | 27899 |
| 2 | JGI24746J21847_1010606 | 3300001977 | Bacteria | 1362 |
| 3 | JGI24747J21853_1004561 | 3300001978 | Bacteria | 1249 |
| 4 | JGI24740J21852_10074867 | 3300001979 | Bacteria | 898 |
| 5 | JGI24739J22299_10014218 | 3300001989 | Bacteria | 2896 |
| 6 | JGI24739J22299_10031467 | 3300001989 | Bacteria | 1834 |
| 7 | JGI24737J22298_10014055 | 3300001990 | Bacteria | 2600 |
| 8 | JGI24737J22298_10255683 | 3300001990 | Bacteria | 518 |
| 9 | JGI24750J21931_1025217 | 3300002070 | Bacteria | 852 |
| 10 | JGI24745J21846_1002378 | 3300002073 | Bacteria | 1921 |
| 11 | JGI24738J21930_10026481 | 3300002075 | Bacteria | 1190 |
| 12 | JGI24744J21845_10009983 | 3300002077 | Bacteria | 1947 |
| 13 | JGI24034J26672_10019434 | 3300002239 | Bacteria | 1060 |
| 14 | JGI24742J22300_10008900 | 3300002244 | Bacteria | 1655 |
| 15 | JGI24751J29686_10064209 | 3300002459 | Bacteria | 756 |
| 16 | JGI25162J39368_1003458 | 3300002737 | Bacteria | 4543 |
| 17 | JGI25164J39214_1000679 | 3300002772 | Bacteria | 13579 |
| 18 | Ga0006778J45830_1037313 | 3300003162 | Bacteria | 794 |
| 19 | Ga0006759J45824_1035239 | 3300003163 | Bacteria | 815 |
| 20 | JGI25406J46586_10006196 | 3300003203 | Bacteria | 5524 |
| 21 | JGI25406J46586_10008605 | 3300003203 | Bacteria | 4610 |
| 22 | JGI25165J46597_1000061 | 3300003214 | Bacteria | 208362 |
| 23 | Ga0007416J51690_1057683 | 3300003577 | Bacteria | 1204 |
| 24 | Ga0007429J51699_1088480 | 3300003579 | Bacteria | 742 |
| 25 | Ga0007429J51699_1088481 | 3300003579 | Bacteria | 776 |
| 26 | Ga0032354_1022066 | 3300003693 | Bacteria | 1153 |
| 27 | Ga0055539_1000808 | 3300003752 | Bacteria | 7414 |
| 28 | Ga0055533_1000001 | 3300003756 | Bacteria | 1863437 |
| 29 | Ga0055527_1000017 | 3300003760 | Bacteria | 242362 |
| 30 | Ga0055542_1000044 | 3300003762 | Bacteria | 206982 |
| 31 | Ga0055529_1000279 | 3300003763 | Bacteria | 60946 |
| 32 | Ga0055529_1039149 | 3300003763 | Bacteria | 575 |
| 33 | Ga0055541_1009606 | 3300003841 | Bacteria | 1486 |
| 34 | Ga0058858_1434606 | 3300004785 | Bacteria | 717 |
| 35 | Ga0058859_10032894 | 3300004798 | Bacteria | 546 |
| 36 | Ga0058863_10079837 | 3300004799 | Bacteria | 692 |
| 37 | Ga0058863_10092482 | 3300004799 | Bacteria | 1125 |
| 38 | Ga0058863_11902506 | 3300004799 | Bacteria | 1252 |
| 39 | Ga0058863_11911031 | 3300004799 | Bacteria | 689 |
| 40 | Ga0058861_10002618 | 3300004800 | Bacteria | 723 |
| 41 | Ga0058861_10039056 | 3300004800 | Bacteria | 1500 |
| 42 | Ga0058861_10046230 | 3300004800 | Bacteria | 559 |
| 43 | Ga0058861_10088000 | 3300004800 | Bacteria | 1031 |
| 44 | Ga0058861_11840072 | 3300004800 | Bacteria | 735 |
| 45 | Ga0058861_12025964 | 3300004800 | Bacteria | 832 |
| 46 | Ga0058860_10225518 | 3300004801 | Bacteria | 1295 |
| 47 | Ga0058860_12169112 | 3300004801 | Bacteria | 1029 |
| 48 | Ga0058860_12198917 | 3300004801 | Bacteria | 692 |
| 49 | Ga0058862_10139641 | 3300004803 | Bacteria | 1053 |
| 50 | Ga0058862_10153948 | 3300004803 | Bacteria | 600 |
| 51 | Ga0058862_10202782 | 3300004803 | Bacteria | 1521 |
| 52 | Ga0058862_10277273 | 3300004803 | Bacteria | 545 |
| 53 | Ga0058862_12205953 | 3300004803 | Bacteria | 985 |
| 54 | Ga0058862_12730137 | 3300004803 | Bacteria | 1272 |
| 55 | Ga0065714_10021838 | 3300005288 | Bacteria | 1673 |
| 56 | Ga0070658_10028535 | 3300005327 | Bacteria | 4481 |
| 57 | Ga0070658_10028947 | 3300005327 | Bacteria | 4448 |
| 58 | Ga0070658_10258464 | 3300005327 | Bacteria | 1479 |
| 59 | Ga0070658_10271826 | 3300005327 | Bacteria | 1441 |
| 60 | Ga0070658_11038680 | 3300005327 | Bacteria | 713 |
| 61 | Ga0070676_10224730 | 3300005328 | Bacteria | 1242 |
| 62 | Ga0070676_10414025 | 3300005328 | Bacteria | 940 |
| 63 | Ga0070683_100029975 | 3300005329 | Bacteria | 4933 |
| 64 | Ga0070683_100274263 | 3300005329 | Bacteria | 1604 |
| 65 | Ga0070683_100285358 | 3300005329 | Bacteria | 1570 |
| 66 | Ga0070683_100306297 | 3300005329 | Bacteria | 1511 |
| 67 | Ga0070683_100332725 | 3300005329 | Bacteria | 1446 |
| 68 | Ga0070683_100346506 | 3300005329 | Bacteria | 1415 |
| 69 | Ga0070683_100481930 | 3300005329 | Bacteria | 1184 |
| 70 | Ga0070690_100194908 | 3300005330 | Bacteria | 1407 |
| 71 | Ga0070690_100396542 | 3300005330 | Bacteria | 1012 |
| 72 | Ga0070690_100523026 | 3300005330 | Bacteria | 891 |
| 73 | Ga0070690_100645872 | 3300005330 | Bacteria | 808 |
| 74 | Ga0070690_100835503 | 3300005330 | Bacteria | 716 |
| 75 | Ga0070670_100568059 | 3300005331 | Bacteria | 1013 |
| 76 | Ga0070670_101091103 | 3300005331 | Bacteria | 728 |
| 77 | Ga0070677_10336382 | 3300005333 | Bacteria | 778 |
| 78 | Ga0068869_100012691 | 3300005334 | Bacteria | 5573 |
| 79 | Ga0068869_100062239 | 3300005334 | Bacteria | 2739 |
| 80 | Ga0068869_100168006 | 3300005334 | Bacteria | 1712 |
| 81 | Ga0068869_100509726 | 3300005334 | Bacteria | 1006 |
| 82 | Ga0068869_101838502 | 3300005334 | Bacteria | 542 |
| 83 | Ga0070680_100000015 | 3300005336 | Bacteria | 93646 |
| 84 | Ga0070680_100033020 | 3300005336 | Bacteria | 4168 |
| 85 | Ga0070680_100093789 | 3300005336 | Bacteria | 2487 |
| 86 | Ga0070680_100153032 | 3300005336 | Bacteria | 1937 |
| 87 | Ga0070680_100356170 | 3300005336 | Bacteria | 1244 |
| 88 | Ga0070680_100432224 | 3300005336 | Bacteria | 1124 |
| 89 | Ga0070680_100834179 | 3300005336 | Bacteria | 795 |
| 90 | Ga0070682_100011705 | 3300005337 | Bacteria | 5016 |
| 91 | Ga0070682_100203653 | 3300005337 | Bacteria | 1398 |
| 92 | Ga0070682_100236792 | 3300005337 | Bacteria | 1308 |
| 93 | Ga0070682_100246860 | 3300005337 | Bacteria | 1285 |
| 94 | Ga0068868_100005144 | 3300005338 | Bacteria | 9183 |
| 95 | Ga0068868_100122450 | 3300005338 | Bacteria | 2122 |
| 96 | Ga0068868_100382455 | 3300005338 | Bacteria | 1211 |
| 97 | Ga0068868_100459711 | 3300005338 | Bacteria | 1108 |
| 98 | Ga0070660_100059135 | 3300005339 | Bacteria | 2972 |
| 99 | Ga0070660_100128075 | 3300005339 | Bacteria | 2030 |
| 100 | Ga0070660_100134654 | 3300005339 | Bacteria | 1979 |
| 101 | Ga0070660_100329375 | 3300005339 | Bacteria | 1255 |
| 102 | Ga0070689_100029463 | 3300005340 | Bacteria | 4155 |
| 103 | Ga0070689_100158604 | 3300005340 | Bacteria | 1828 |
| 104 | Ga0070689_100818584 | 3300005340 | Bacteria | 820 |
| 105 | Ga0070691_10003867 | 3300005341 | Bacteria | 6767 |
| 106 | Ga0070691_10024314 | 3300005341 | Bacteria | 2816 |
| 107 | Ga0070691_10043635 | 3300005341 | Bacteria | 2125 |
| 108 | Ga0070691_10206936 | 3300005341 | Bacteria | 1033 |
| 109 | Ga0070687_100127109 | 3300005343 | Bacteria | 1467 |
| 110 | Ga0070687_100232399 | 3300005343 | Bacteria | 1135 |
| 111 | Ga0070687_101369961 | 3300005343 | Bacteria | 528 |
| 112 | Ga0070661_101478697 | 3300005344 | Bacteria | 573 |
| 113 | Ga0070692_10102432 | 3300005345 | Bacteria | 1571 |
| 114 | Ga0070692_10510609 | 3300005345 | Bacteria | 781 |
| 115 | Ga0070692_10621542 | 3300005345 | Bacteria | 717 |
| 116 | Ga0070668_100646667 | 3300005347 | Bacteria | 929 |
| 117 | Ga0070668_100713017 | 3300005347 | Bacteria | 885 |
| 118 | Ga0070668_100729157 | 3300005347 | Bacteria | 876 |
| 119 | Ga0070669_100478705 | 3300005353 | Bacteria | 1030 |
| 120 | Ga0070669_101260253 | 3300005353 | Bacteria | 640 |
| 121 | Ga0070675_100082776 | 3300005354 | Bacteria | 2678 |
| 122 | Ga0070675_100095801 | 3300005354 | Bacteria | 2492 |
| 123 | Ga0070675_100253957 | 3300005354 | Bacteria | 1539 |
| 124 | Ga0070675_100417906 | 3300005354 | Bacteria | 1199 |
| 125 | Ga0070675_100760983 | 3300005354 | Bacteria | 884 |
| 126 | Ga0070675_101504990 | 3300005354 | Bacteria | 621 |
| 127 | Ga0070671_100060488 | 3300005355 | Bacteria | 3154 |
| 128 | Ga0070671_100151685 | 3300005355 | Bacteria | 1957 |
| 129 | Ga0070671_100341891 | 3300005355 | Bacteria | 1277 |
| 130 | Ga0070671_100385131 | 3300005355 | Bacteria | 1199 |
| 131 | Ga0070671_100455397 | 3300005355 | Bacteria | 1098 |
| 132 | Ga0070674_100041590 | 3300005356 | Bacteria | 3116 |
| 133 | Ga0070674_100238837 | 3300005356 | Bacteria | 1421 |
| 134 | Ga0070674_100305444 | 3300005356 | Bacteria | 1270 |
| 135 | Ga0070674_101879946 | 3300005356 | Bacteria | 544 |
| 136 | Ga0070673_100019981 | 3300005364 | Bacteria | 4821 |
| 137 | Ga0070673_100296296 | 3300005364 | Bacteria | 1423 |
| 138 | Ga0070688_100043252 | 3300005365 | Bacteria | 2774 |
| 139 | Ga0070688_100123596 | 3300005365 | Bacteria | 1736 |
| 140 | Ga0070659_100012148 | 3300005366 | Bacteria | 6380 |
| 141 | Ga0070659_100018706 | 3300005366 | Bacteria | 5230 |
| 142 | Ga0070659_100126270 | 3300005366 | Bacteria | 2075 |
| 143 | Ga0070659_100179838 | 3300005366 | Bacteria | 1735 |
| 144 | Ga0070667_100644816 | 3300005367 | Bacteria | 978 |
| 145 | Ga0070667_100882763 | 3300005367 | Bacteria | 832 |
| 146 | Ga0070703_10026297 | 3300005406 | Bacteria | 1730 |
| 147 | Ga0070709_10186968 | 3300005434 | Bacteria | 1459 |
| 148 | Ga0070714_100005269 | 3300005435 | Bacteria | 9852 |
| 149 | Ga0070714_101557988 | 3300005435 | Bacteria | 645 |
| 150 | Ga0070713_100081990 | 3300005436 | Bacteria | 2753 |
| 151 | Ga0070710_10029185 | 3300005437 | Bacteria | 2957 |
| 152 | Ga0070710_10090852 | 3300005437 | Bacteria | 1801 |
| 153 | Ga0070710_10233310 | 3300005437 | Bacteria | 1176 |
| 154 | Ga0070701_10014791 | 3300005438 | Bacteria | 3587 |
| 155 | Ga0070701_10218853 | 3300005438 | Bacteria | 1134 |
| 156 | Ga0070701_10751579 | 3300005438 | Bacteria | 661 |
| 157 | Ga0070711_100019741 | 3300005439 | Bacteria | 4329 |
| 158 | Ga0070711_100030873 | 3300005439 | Bacteria | 3552 |
| 159 | Ga0070705_100012679 | 3300005440 | Bacteria | 4292 |
| 160 | Ga0070705_100064677 | 3300005440 | Bacteria | 2186 |
| 161 | Ga0070705_100117451 | 3300005440 | Bacteria | 1711 |
| 162 | Ga0070705_100212079 | 3300005440 | Bacteria | 1335 |
| 163 | Ga0070705_100856494 | 3300005440 | Bacteria | 728 |
| 164 | Ga0070700_100014624 | 3300005441 | Bacteria | 4434 |
| 165 | Ga0070700_100117428 | 3300005441 | Bacteria | 1777 |
| 166 | Ga0070700_100181285 | 3300005441 | Bacteria | 1466 |
| 167 | Ga0070700_100409710 | 3300005441 | Bacteria | 1021 |
| 168 | Ga0070700_101440306 | 3300005441 | Bacteria | 584 |
| 169 | Ga0070694_100072132 | 3300005444 | Bacteria | 2382 |
| 170 | Ga0070694_100213642 | 3300005444 | Bacteria | 1444 |
| 171 | Ga0070694_100330046 | 3300005444 | Bacteria | 1176 |
| 172 | Ga0070694_100648214 | 3300005444 | Bacteria | 854 |
| 173 | Ga0070708_100015734 | 3300005445 | Bacteria | 6252 |
| 174 | Ga0070708_100127832 | 3300005445 | Bacteria | 2350 |
| 175 | Ga0070708_100737148 | 3300005445 | Bacteria | 927 |
| 176 | Ga0070708_100770417 | 3300005445 | Bacteria | 905 |
| 177 | Ga0070663_100177563 | 3300005455 | Bacteria | 1649 |
| 178 | Ga0070663_100288192 | 3300005455 | Bacteria | 1311 |
| 179 | Ga0070663_100405282 | 3300005455 | Bacteria | 1115 |
| 180 | Ga0070663_100721741 | 3300005455 | Bacteria | 849 |
| 181 | Ga0070663_100739854 | 3300005455 | Bacteria | 839 |
| 182 | Ga0070663_101787956 | 3300005455 | Bacteria | 551 |
| 183 | Ga0070678_100058968 | 3300005456 | Bacteria | 2819 |
| 184 | Ga0070678_100068279 | 3300005456 | Bacteria | 2649 |
| 185 | Ga0070678_100524499 | 3300005456 | Bacteria | 1048 |
| 186 | Ga0070678_100550805 | 3300005456 | Bacteria | 1024 |
| 187 | Ga0070662_100494365 | 3300005457 | Bacteria | 1020 |
| 188 | Ga0070662_100565695 | 3300005457 | Bacteria | 954 |
| 189 | Ga0070681_10128448 | 3300005458 | Bacteria | 2467 |
| 190 | Ga0070681_10166145 | 3300005458 | Bacteria | 2129 |
| 191 | Ga0070681_10377690 | 3300005458 | Bacteria | 1328 |
| 192 | Ga0070681_10471198 | 3300005458 | Bacteria | 1168 |
| 193 | Ga0070681_11316024 | 3300005458 | Bacteria | 645 |
| 194 | Ga0068867_100049389 | 3300005459 | Bacteria | 3097 |
| 195 | Ga0068867_100261733 | 3300005459 | Bacteria | 1410 |
| 196 | Ga0068867_100470533 | 3300005459 | Bacteria | 1075 |
| 197 | Ga0070685_10030710 | 3300005466 | Bacteria | 2996 |
| 198 | Ga0070685_10067598 | 3300005466 | Bacteria | 2108 |
| 199 | Ga0070706_100011787 | 3300005467 | Bacteria | 8115 |
| 200 | Ga0070706_100531095 | 3300005467 | Bacteria | 1094 |
| 201 | Ga0070707_100005867 | 3300005468 | Bacteria | 11451 |
| 202 | Ga0070707_100038225 | 3300005468 | Bacteria | 4583 |
| 203 | Ga0070707_100064600 | 3300005468 | Bacteria | 3514 |
| 204 | Ga0070707_100223342 | 3300005468 | Bacteria | 1834 |
| 205 | Ga0070707_101013754 | 3300005468 | Bacteria | 796 |
| 206 | Ga0070698_100094301 | 3300005471 | Bacteria | 2972 |
| 207 | Ga0070698_100104288 | 3300005471 | Bacteria | 2805 |
| 208 | Ga0070698_102076193 | 3300005471 | Bacteria | 522 |
| 209 | Ga0070699_100058035 | 3300005518 | Bacteria | 3352 |
| 210 | Ga0070679_100025472 | 3300005530 | Bacteria | 5805 |
| 211 | Ga0070679_100038792 | 3300005530 | Bacteria | 4736 |
| 212 | Ga0070679_100575647 | 3300005530 | Bacteria | 1070 |
| 213 | Ga0070679_101455700 | 3300005530 | Bacteria | 632 |
| 214 | Ga0070679_101882188 | 3300005530 | Bacteria | 547 |
| 215 | Ga0070684_100051018 | 3300005535 | Bacteria | 3594 |
| 216 | Ga0070684_100076715 | 3300005535 | Bacteria | 2950 |
| 217 | Ga0070684_100092545 | 3300005535 | Bacteria | 2690 |
| 218 | Ga0070684_100114067 | 3300005535 | Bacteria | 2425 |
| 219 | Ga0070684_100308206 | 3300005535 | Bacteria | 1453 |
| 220 | Ga0070684_100454164 | 3300005535 | Bacteria | 1184 |
| 221 | Ga0070684_100520389 | 3300005535 | Bacteria | 1102 |
| 222 | Ga0070684_100721633 | 3300005535 | Bacteria | 930 |
| 223 | Ga0070697_100025528 | 3300005536 | Bacteria | 4713 |
| 224 | Ga0070697_100055682 | 3300005536 | Bacteria | 3216 |
| 225 | Ga0070697_100098342 | 3300005536 | Bacteria | 2428 |
| 226 | Ga0070697_100316355 | 3300005536 | Bacteria | 1344 |
| 227 | Ga0070697_100758674 | 3300005536 | Bacteria | 857 |
| 228 | Ga0070697_102107727 | 3300005536 | Bacteria | 505 |
| 229 | Ga0068853_100047078 | 3300005539 | Bacteria | 3701 |
| 230 | Ga0068853_100167867 | 3300005539 | Bacteria | 1984 |
| 231 | Ga0068853_100353953 | 3300005539 | Bacteria | 1366 |
| 232 | Ga0068853_101812360 | 3300005539 | Bacteria | 592 |
| 233 | Ga0068853_102263871 | 3300005539 | Bacteria | 527 |
| 234 | Ga0070672_100130525 | 3300005543 | Bacteria | 2064 |
| 235 | Ga0070672_100823102 | 3300005543 | Bacteria | 818 |
| 236 | Ga0070686_100008884 | 3300005544 | Bacteria | 5633 |
| 237 | Ga0070686_100042639 | 3300005544 | Bacteria | 2843 |
| 238 | Ga0070686_100200306 | 3300005544 | Bacteria | 1431 |
| 239 | Ga0070686_100814129 | 3300005544 | Bacteria | 754 |
| 240 | Ga0070695_100156634 | 3300005545 | Bacteria | 1595 |
| 241 | Ga0070695_100206721 | 3300005545 | Bacteria | 1406 |
| 242 | Ga0070695_100577631 | 3300005545 | Bacteria | 879 |
| 243 | Ga0070696_100006963 | 3300005546 | Bacteria | 7545 |
| 244 | Ga0070696_100082401 | 3300005546 | Bacteria | 2280 |
| 245 | Ga0070696_100082497 | 3300005546 | Bacteria | 2279 |
| 246 | Ga0070696_100116381 | 3300005546 | Bacteria | 1930 |
| 247 | Ga0070696_100260895 | 3300005546 | Bacteria | 1314 |
| 248 | Ga0070696_100288614 | 3300005546 | Bacteria | 1253 |
| 249 | Ga0070696_100318727 | 3300005546 | Bacteria | 1196 |
| 250 | Ga0070696_100534091 | 3300005546 | Bacteria | 937 |
| 251 | Ga0070696_100617234 | 3300005546 | Bacteria | 876 |
| 252 | Ga0070696_100885697 | 3300005546 | Bacteria | 740 |
| 253 | Ga0070696_101576902 | 3300005546 | Bacteria | 563 |
| 254 | Ga0070693_100011341 | 3300005547 | Bacteria | 4488 |
| 255 | Ga0070693_100045839 | 3300005547 | Bacteria | 2480 |
| 256 | Ga0070693_100139888 | 3300005547 | Bacteria | 1522 |
| 257 | Ga0070693_100353398 | 3300005547 | Bacteria | 1006 |
| 258 | Ga0070693_100355640 | 3300005547 | Bacteria | 1004 |
| 259 | Ga0070693_100598675 | 3300005547 | Bacteria | 795 |
| 260 | Ga0070665_100355567 | 3300005548 | Bacteria | 1470 |
| 261 | Ga0070665_100360118 | 3300005548 | Bacteria | 1460 |
| 262 | Ga0070704_100016174 | 3300005549 | Bacteria | 4709 |
| 263 | Ga0070704_100866435 | 3300005549 | Bacteria | 810 |
| 264 | Ga0070704_100879611 | 3300005549 | Bacteria | 805 |
| 265 | Ga0068855_100026947 | 3300005563 | Bacteria | 6877 |
| 266 | Ga0068855_100052631 | 3300005563 | Bacteria | 4792 |
| 267 | Ga0068855_100066868 | 3300005563 | Bacteria | 4189 |
| 268 | Ga0068855_101539999 | 3300005563 | Bacteria | 682 |
| 269 | Ga0068855_102164059 | 3300005563 | Bacteria | 559 |
| 270 | Ga0070664_100010033 | 3300005564 | Bacteria | 7675 |
| 271 | Ga0070664_100100347 | 3300005564 | Bacteria | 2517 |
| 272 | Ga0070664_100217308 | 3300005564 | Bacteria | 1709 |
| 273 | Ga0070664_101278998 | 3300005564 | Bacteria | 693 |
| 274 | Ga0070664_101783163 | 3300005564 | Bacteria | 584 |
| 275 | Ga0068857_100129395 | 3300005577 | Bacteria | 2276 |
| 276 | Ga0068857_100481910 | 3300005577 | Bacteria | 1162 |
| 277 | Ga0068857_100670337 | 3300005577 | Bacteria | 984 |
| 278 | Ga0068857_101846732 | 3300005577 | Bacteria | 592 |
| 279 | Ga0068854_100030804 | 3300005578 | Bacteria | 3724 |
| 280 | Ga0068854_101577851 | 3300005578 | Bacteria | 598 |
| 281 | Ga0068856_100048606 | 3300005614 | Bacteria | 4181 |
| 282 | Ga0068856_100061274 | 3300005614 | Bacteria | 3716 |
| 283 | Ga0068856_100102656 | 3300005614 | Bacteria | 2853 |
| 284 | Ga0068856_100230255 | 3300005614 | Bacteria | 1868 |
| 285 | Ga0068856_100290876 | 3300005614 | Bacteria | 1650 |
| 286 | Ga0068856_100366475 | 3300005614 | Bacteria | 1459 |
| 287 | Ga0070702_100016072 | 3300005615 | Bacteria | 3833 |
| 288 | Ga0070702_100161541 | 3300005615 | Bacteria | 1449 |
| 289 | Ga0070702_100234700 | 3300005615 | Bacteria | 1234 |
| 290 | Ga0068852_100082296 | 3300005616 | Bacteria | 2860 |
| 291 | Ga0068852_100132206 | 3300005616 | Bacteria | 2299 |
| 292 | Ga0068852_100302958 | 3300005616 | Bacteria | 1547 |
| 293 | Ga0068852_101304543 | 3300005616 | Bacteria | 748 |
| 294 | Ga0068852_102847750 | 3300005616 | Bacteria | 502 |
| 295 | Ga0068859_100038389 | 3300005617 | Bacteria | 4805 |
| 296 | Ga0068859_101887037 | 3300005617 | Bacteria | 660 |
| 297 | Ga0068864_100083353 | 3300005618 | Bacteria | 2808 |
| 298 | Ga0068864_100571654 | 3300005618 | Bacteria | 1094 |
| 299 | Ga0068866_10036626 | 3300005718 | Bacteria | 2404 |
| 300 | Ga0068866_10136583 | 3300005718 | Bacteria | 1402 |
| 301 | Ga0068866_10712135 | 3300005718 | Bacteria | 690 |
| 302 | Ga0068861_100105850 | 3300005719 | Bacteria | 2246 |
| 303 | Ga0068861_100316610 | 3300005719 | Bacteria | 1358 |
| 304 | Ga0068861_100482997 | 3300005719 | Bacteria | 1116 |
| 305 | Ga0068861_100893563 | 3300005719 | Bacteria | 841 |
| 306 | Ga0068861_101168994 | 3300005719 | Bacteria | 742 |
| 307 | Ga0068861_102551714 | 3300005719 | Bacteria | 515 |
| 308 | Ga0068851_10282940 | 3300005834 | Bacteria | 949 |
| 309 | Ga0068870_10084742 | 3300005840 | Bacteria | 1760 |
| 310 | Ga0068870_10934948 | 3300005840 | Bacteria | 614 |
| 311 | Ga0068863_100260616 | 3300005841 | Bacteria | 1676 |
| 312 | Ga0068863_100344654 | 3300005841 | Bacteria | 1450 |
| 313 | Ga0068858_100046786 | 3300005842 | Bacteria | 4010 |
| 314 | Ga0068858_100161047 | 3300005842 | Bacteria | 2113 |
| 315 | Ga0068858_100693419 | 3300005842 | Bacteria | 991 |
| 316 | Ga0068860_100027971 | 3300005843 | Bacteria | 5429 |
| 317 | Ga0068860_100344499 | 3300005843 | Bacteria | 1466 |
| 318 | Ga0068860_100505616 | 3300005843 | Bacteria | 1207 |
| 319 | Ga0068860_100928713 | 3300005843 | Bacteria | 887 |
| 320 | Ga0068862_100395989 | 3300005844 | Bacteria | 1291 |
| 321 | Ga0068862_100556312 | 3300005844 | Bacteria | 1096 |
| 322 | Ga0068862_101352363 | 3300005844 | Bacteria | 715 |
| 323 | Ga0081455_10047065 | 3300005937 | Bacteria | 3738 |
| 324 | Ga0081455_10236082 | 3300005937 | Bacteria | 1346 |
| 325 | Ga0081539_10003252 | 3300005985 | Bacteria | 20412 |
| 326 | Ga0081539_10012303 | 3300005985 | Bacteria | 6619 |
| 327 | Ga0070717_10033904 | 3300006028 | Bacteria | 4122 |
| 328 | Ga0070717_10047424 | 3300006028 | Bacteria | 3520 |
| 329 | Ga0070717_10241231 | 3300006028 | Bacteria | 1594 |
| 330 | Ga0075364_10055931 | 3300006051 | Bacteria | 2582 |
| 331 | Ga0075432_10015139 | 3300006058 | Bacteria | 2629 |
| 332 | Ga0070716_100545422 | 3300006173 | Bacteria | 863 |
| 333 | Ga0070716_101271164 | 3300006173 | Bacteria | 594 |
| 334 | Ga0070712_100012347 | 3300006175 | Bacteria | 5428 |
| 335 | Ga0070712_100266878 | 3300006175 | Bacteria | 1374 |
| 336 | Ga0097621_100013802 | 3300006237 | Bacteria | 6030 |
| 337 | Ga0097621_100024219 | 3300006237 | Bacteria | 4737 |
| 338 | Ga0097621_100355537 | 3300006237 | Bacteria | 1304 |
| 339 | Ga0097621_100587813 | 3300006237 | Bacteria | 1016 |
| 340 | Ga0097621_100810564 | 3300006237 | Bacteria | 868 |
| 341 | Ga0075370_10264234 | 3300006353 | Bacteria | 1021 |
| 342 | Ga0068871_100027934 | 3300006358 | Bacteria | 4418 |
| 343 | Ga0075428_100000694 | 3300006844 | Bacteria | 34739 |
| 344 | Ga0075428_100004768 | 3300006844 | Bacteria | 15015 |
| 345 | Ga0075428_100294355 | 3300006844 | Bacteria | 1746 |
| 346 | Ga0075428_100587336 | 3300006844 | Bacteria | 1190 |
| 347 | Ga0075433_10043437 | 3300006852 | Bacteria | 3901 |
| 348 | Ga0075433_10080542 | 3300006852 | Bacteria | 2871 |
| 349 | Ga0075433_10178155 | 3300006852 | Bacteria | 1891 |
| 350 | Ga0075433_10210759 | 3300006852 | Bacteria | 1727 |
| 351 | Ga0075433_10345789 | 3300006852 | Bacteria | 1314 |
| 352 | Ga0075434_100007021 | 3300006871 | Bacteria | 10385 |
| 353 | Ga0075434_100233167 | 3300006871 | Bacteria | 1860 |
| 354 | Ga0075434_100260368 | 3300006871 | Bacteria | 1754 |
| 355 | Ga0075434_100261099 | 3300006871 | Bacteria | 1751 |
| 356 | Ga0075434_100268762 | 3300006871 | Bacteria | 1725 |
| 357 | Ga0075434_100278696 | 3300006871 | Bacteria | 1692 |
| 358 | Ga0075434_100438986 | 3300006871 | Bacteria | 1327 |
| 359 | Ga0075434_101034808 | 3300006871 | Bacteria | 835 |
| 360 | Ga0075429_100411179 | 3300006880 | Bacteria | 1185 |
| 361 | Ga0075429_100626261 | 3300006880 | Bacteria | 942 |
| 362 | Ga0068865_100031053 | 3300006881 | Bacteria | 3559 |
| 363 | Ga0068865_100064080 | 3300006881 | Bacteria | 2586 |
| 364 | Ga0068865_100140491 | 3300006881 | Bacteria | 1820 |
| 365 | Ga0068865_100163955 | 3300006881 | Bacteria | 1698 |
| 366 | Ga0068865_102057633 | 3300006881 | Bacteria | 519 |
| 367 | Ga0075436_100073498 | 3300006914 | Bacteria | 2366 |
| 368 | Ga0097620_100038389 | 3300006931 | Bacteria | 4805 |
| 369 | Ga0097620_101887085 | 3300006931 | Bacteria | 660 |
| 370 | Ga0075435_100013055 | 3300007076 | Bacteria | 6169 |
| 371 | Ga0075435_100167058 | 3300007076 | Bacteria | 1855 |
| 372 | Ga0075435_100621124 | 3300007076 | Bacteria | 937 |
| 373 | Ga0075435_100730755 | 3300007076 | Bacteria | 861 |
| 374 | Ga0105240_10142595 | 3300009093 | Bacteria | 2863 |
| 375 | Ga0105240_10535128 | 3300009093 | Bacteria | 1298 |
| 376 | Ga0111539_10008690 | 3300009094 | Bacteria | 12890 |
| 377 | Ga0111539_10148167 | 3300009094 | Bacteria | 2748 |
| 378 | Ga0111539_11913215 | 3300009094 | Bacteria | 688 |
| 379 | Ga0111539_12017782 | 3300009094 | Bacteria | 669 |
| 380 | Ga0105245_10036956 | 3300009098 | Bacteria | 4340 |
| 381 | Ga0105245_10048434 | 3300009098 | Bacteria | 3802 |
| 382 | Ga0105245_10091660 | 3300009098 | Bacteria | 2797 |
| 383 | Ga0105245_10251918 | 3300009098 | Bacteria | 1716 |
| 384 | Ga0105245_10484083 | 3300009098 | Bacteria | 1251 |
| 385 | Ga0105245_10778720 | 3300009098 | Bacteria | 994 |
| 386 | Ga0105245_10874176 | 3300009098 | Bacteria | 940 |
| 387 | Ga0105247_10046136 | 3300009101 | Bacteria | 2674 |
| 388 | Ga0105247_10907461 | 3300009101 | Bacteria | 681 |
| 389 | Ga0114129_10009938 | 3300009147 | Bacteria | 13563 |
| 390 | Ga0114129_10015434 | 3300009147 | Bacteria | 10865 |
| 391 | Ga0114129_10022103 | 3300009147 | Bacteria | 9026 |
| 392 | Ga0105243_10035607 | 3300009148 | Bacteria | 3860 |
| 393 | Ga0105243_10152057 | 3300009148 | Bacteria | 1986 |
| 394 | Ga0105243_10422171 | 3300009148 | Bacteria | 1244 |
| 395 | Ga0105243_10718801 | 3300009148 | Bacteria | 976 |
| 396 | Ga0105243_10955436 | 3300009148 | Bacteria | 856 |
| 397 | Ga0105243_10997357 | 3300009148 | Bacteria | 840 |
| 398 | Ga0105241_10023878 | 3300009174 | Bacteria | 4538 |
| 399 | Ga0105241_10189650 | 3300009174 | Bacteria | 1711 |
| 400 | Ga0105241_10382493 | 3300009174 | Bacteria | 1230 |
| 401 | Ga0105241_10411926 | 3300009174 | Bacteria | 1188 |
| 402 | Ga0105242_10081594 | 3300009176 | Bacteria | 2705 |
| 403 | Ga0105242_10104555 | 3300009176 | Bacteria | 2404 |
| 404 | Ga0105242_10106171 | 3300009176 | Bacteria | 2386 |
| 405 | Ga0105242_10117748 | 3300009176 | Bacteria | 2275 |
| 406 | Ga0105242_10254553 | 3300009176 | Bacteria | 1583 |
| 407 | Ga0105242_10843581 | 3300009176 | Bacteria | 911 |
| 408 | Ga0105242_11392689 | 3300009176 | Bacteria | 728 |
| 409 | Ga0105248_10105254 | 3300009177 | Bacteria | 3181 |
| 410 | Ga0105248_10421419 | 3300009177 | Bacteria | 1503 |
| 411 | Ga0105248_10556440 | 3300009177 | Bacteria | 1294 |
| 412 | Ga0105248_10621293 | 3300009177 | Bacteria | 1219 |
| 413 | Ga0105237_10037185 | 3300009545 | Bacteria | 4922 |
| 414 | Ga0105237_10358146 | 3300009545 | Bacteria | 1463 |
| 415 | Ga0105237_11194597 | 3300009545 | Bacteria | 767 |
| 416 | Ga0105238_10017104 | 3300009551 | Bacteria | 7360 |
| 417 | Ga0105238_10069677 | 3300009551 | Bacteria | 3517 |
| 418 | Ga0105238_10366945 | 3300009551 | Bacteria | 1430 |
| 419 | Ga0105238_10369097 | 3300009551 | Bacteria | 1425 |
| 420 | Ga0105238_10450806 | 3300009551 | Bacteria | 1283 |
| 421 | Ga0105249_10283460 | 3300009553 | Bacteria | 1655 |
| 422 | Ga0105249_10689710 | 3300009553 | Bacteria | 1081 |
| 423 | Ga0105249_10772853 | 3300009553 | Bacteria | 1023 |
| 424 | Ga0105249_11107463 | 3300009553 | Bacteria | 862 |
| 425 | Ga0105249_11995395 | 3300009553 | Bacteria | 653 |
| 426 | Ga0105029_112195 | 3300009984 | Bacteria | 666 |
| 427 | Ga0105239_10226875 | 3300010375 | Bacteria | 2095 |
| 428 | Ga0105239_10389075 | 3300010375 | Bacteria | 1577 |
| 429 | Ga0105239_10427946 | 3300010375 | Bacteria | 1500 |
| 430 | Ga0105239_10442962 | 3300010375 | Bacteria | 1473 |
| 431 | Ga0105239_10466363 | 3300010375 | Bacteria | 1434 |
| 432 | Ga0105239_10557683 | 3300010375 | Bacteria | 1305 |
| 433 | Ga0105239_11495136 | 3300010375 | Bacteria | 780 |
| 434 | Ga0105246_10049177 | 3300011119 | Bacteria | 2886 |
| 435 | Ga0105246_10057920 | 3300011119 | Bacteria | 2683 |
| 436 | Ga0105246_10177519 | 3300011119 | Bacteria | 1637 |
| 437 | Ga0105246_10182799 | 3300011119 | Bacteria | 1616 |
| 438 | Ga0105246_10287073 | 3300011119 | Bacteria | 1323 |
| 439 | Ga0105246_11105564 | 3300011119 | Bacteria | 724 |
| 440 | Ga0157341_1023156 | 3300012494 | Bacteria | 626 |
| 441 | Ga0154019_108401 | 3300013044 | Bacteria | 1138 |
| 442 | Ga0154016_109853 | 3300013045 | Bacteria | 723 |
| 443 | Ga0154014_155088 | 3300013052 | Bacteria | 1086 |
| 444 | Ga0154012_174592 | 3300013059 | Bacteria | 1223 |
| 445 | Ga0154010_169846 | 3300013062 | Bacteria | 1093 |
| 446 | Ga0157373_10129520 | 3300013100 | Bacteria | 1774 |
| 447 | Ga0157373_10252116 | 3300013100 | Bacteria | 1248 |
| 448 | Ga0157373_10269428 | 3300013100 | Bacteria | 1205 |
| 449 | Ga0157371_10917546 | 3300013102 | Bacteria | 665 |
| 450 | Ga0157371_11319145 | 3300013102 | Bacteria | 559 |
| 451 | Ga0157370_10288553 | 3300013104 | Bacteria | 1516 |
| 452 | Ga0157370_10472846 | 3300013104 | Bacteria | 1152 |
| 453 | Ga0157370_10645810 | 3300013104 | Bacteria | 967 |
| 454 | Ga0157370_10868953 | 3300013104 | Bacteria | 819 |
| 455 | Ga0157369_10040784 | 3300013105 | Bacteria | 5068 |
| 456 | Ga0157369_10054751 | 3300013105 | Bacteria | 4307 |
| 457 | Ga0157369_10160525 | 3300013105 | Bacteria | 2373 |
| 458 | Ga0157369_10368741 | 3300013105 | Bacteria | 1491 |
| 459 | Ga0157369_10490498 | 3300013105 | Bacteria | 1271 |
| 460 | Ga0157369_11135253 | 3300013105 | Bacteria | 798 |
| 461 | Ga0157369_11734600 | 3300013105 | Bacteria | 634 |
| 462 | Ga0157374_10524581 | 3300013296 | Bacteria | 1190 |
| 463 | Ga0157374_10959560 | 3300013296 | Bacteria | 874 |
| 464 | Ga0157374_11907935 | 3300013296 | Bacteria | 620 |
| 465 | Ga0157378_10151859 | 3300013297 | Bacteria | 2159 |
| 466 | Ga0157378_10266849 | 3300013297 | Bacteria | 1644 |
| 467 | Ga0157378_10284059 | 3300013297 | Bacteria | 1596 |
| 468 | Ga0157378_10428887 | 3300013297 | Bacteria | 1308 |
| 469 | Ga0157378_10724113 | 3300013297 | Bacteria | 1016 |
| 470 | Ga0157378_11885732 | 3300013297 | Bacteria | 647 |
| 471 | Ga0157378_13075037 | 3300013297 | Bacteria | 518 |
| 472 | Ga0163162_10046453 | 3300013306 | Bacteria | 4353 |
| 473 | Ga0163162_10099425 | 3300013306 | Bacteria | 3000 |
| 474 | Ga0163162_10414718 | 3300013306 | Bacteria | 1479 |
| 475 | Ga0163162_10415409 | 3300013306 | Bacteria | 1478 |
| 476 | Ga0163162_10415666 | 3300013306 | Bacteria | 1477 |
| 477 | Ga0163162_10432833 | 3300013306 | Bacteria | 1448 |
| 478 | Ga0163162_11026675 | 3300013306 | Bacteria | 933 |
| 479 | Ga0163162_11356503 | 3300013306 | Bacteria | 809 |
| 480 | Ga0163162_11863438 | 3300013306 | Bacteria | 688 |
| 481 | Ga0157372_10046776 | 3300013307 | Bacteria | 4804 |
| 482 | Ga0157372_10060128 | 3300013307 | Bacteria | 4251 |
| 483 | Ga0157372_10079691 | 3300013307 | Bacteria | 3704 |
| 484 | Ga0157372_10418862 | 3300013307 | Bacteria | 1561 |
| 485 | Ga0157372_10555161 | 3300013307 | Bacteria | 1339 |
| 486 | Ga0157372_10743218 | 3300013307 | Bacteria | 1141 |
| 487 | Ga0157372_10883289 | 3300013307 | Bacteria | 1037 |
| 488 | Ga0157372_11425747 | 3300013307 | Bacteria | 798 |
| 489 | Ga0157372_11487203 | 3300013307 | Bacteria | 780 |
| 490 | Ga0157372_11630064 | 3300013307 | Bacteria | 743 |
| 491 | Ga0157375_10064914 | 3300013308 | Bacteria | 3637 |
| 492 | Ga0157375_10139200 | 3300013308 | Bacteria | 2553 |
| 493 | Ga0157375_10316555 | 3300013308 | Bacteria | 1725 |
| 494 | Ga0157375_10525836 | 3300013308 | Bacteria | 1346 |
| 495 | Ga0157375_10724968 | 3300013308 | Bacteria | 1147 |
| 496 | Ga0157375_11946183 | 3300013308 | Bacteria | 698 |
| 497 | Ga0163163_10096702 | 3300014325 | Bacteria | 2974 |
| 498 | Ga0163163_10176943 | 3300014325 | Bacteria | 2180 |
| 499 | Ga0163163_10208613 | 3300014325 | Bacteria | 2002 |
| 500 | Ga0163163_10268245 | 3300014325 | Bacteria | 1758 |
| 501 | Ga0163163_10339457 | 3300014325 | Bacteria | 1557 |
| 502 | Ga0163163_11371723 | 3300014325 | Bacteria | 769 |
| 503 | Ga0163163_13039115 | 3300014325 | Bacteria | 523 |
| 504 | Ga0157380_10047519 | 3300014326 | Bacteria | 3377 |
| 505 | Ga0157380_10288228 | 3300014326 | Bacteria | 1506 |
| 506 | Ga0157380_10376954 | 3300014326 | Bacteria | 1337 |
| 507 | Ga0157380_10400833 | 3300014326 | Bacteria | 1302 |
| 508 | Ga0157380_10572893 | 3300014326 | Bacteria | 1112 |
| 509 | Ga0157380_11516359 | 3300014326 | Bacteria | 724 |
| 510 | Ga0157380_11524265 | 3300014326 | Bacteria | 722 |
| 511 | Ga0157380_12711699 | 3300014326 | Bacteria | 562 |
| 512 | Ga0157377_10026594 | 3300014745 | Bacteria | 3098 |
| 513 | Ga0157377_10314041 | 3300014745 | Bacteria | 1039 |
| 514 | Ga0157377_10356594 | 3300014745 | Bacteria | 983 |
| 515 | Ga0157377_10592670 | 3300014745 | Bacteria | 789 |
| 516 | Ga0157377_10928095 | 3300014745 | Bacteria | 653 |
| 517 | Ga0157377_11023182 | 3300014745 | Bacteria | 627 |
| 518 | Ga0157379_10147410 | 3300014968 | Bacteria | 2122 |
| 519 | Ga0157379_10325637 | 3300014968 | Bacteria | 1403 |
| 520 | Ga0157379_10431168 | 3300014968 | Bacteria | 1215 |
| 521 | Ga0157379_10531124 | 3300014968 | Bacteria | 1093 |
| 522 | Ga0157379_11248177 | 3300014968 | Bacteria | 716 |
| 523 | Ga0157379_11739537 | 3300014968 | Bacteria | 611 |
| 524 | Ga0157379_12341885 | 3300014968 | Bacteria | 532 |
| 525 | Ga0157376_10045570 | 3300014969 | Bacteria | 3612 |
| 526 | Ga0157376_10046239 | 3300014969 | Bacteria | 3588 |
| 527 | Ga0157376_10087652 | 3300014969 | Bacteria | 2687 |
| 528 | Ga0157376_10570685 | 3300014969 | Bacteria | 1122 |
| 529 | Ga0157376_11387150 | 3300014969 | Bacteria | 734 |
| 530 | Ga0157376_11728483 | 3300014969 | Bacteria | 661 |
| 531 | Ga0157376_12257065 | 3300014969 | Bacteria | 583 |
| 532 | Ga0163161_10081962 | 3300017792 | Bacteria | 2376 |
| 533 | Ga0163161_10105842 | 3300017792 | Bacteria | 2099 |
| 534 | Ga0163161_12029694 | 3300017792 | Bacteria | 511 |
| 535 | Ga0197907_10050194 | 3300020069 | Bacteria | 1325 |
| 536 | Ga0197907_10086159 | 3300020069 | Bacteria | 1008 |
| 537 | Ga0197907_10212903 | 3300020069 | Bacteria | 772 |
| 538 | Ga0197907_10268076 | 3300020069 | Bacteria | 952 |
| 539 | Ga0197907_10378803 | 3300020069 | Bacteria | 1042 |
| 540 | Ga0197907_10533934 | 3300020069 | Bacteria | 1607 |
| 541 | Ga0197907_10881670 | 3300020069 | Bacteria | 764 |
| 542 | Ga0197907_11286071 | 3300020069 | Bacteria | 1575 |
| 543 | Ga0197907_11298433 | 3300020069 | Bacteria | 709 |
| 544 | Ga0197907_11482061 | 3300020069 | Bacteria | 807 |
| 545 | Ga0206356_10124042 | 3300020070 | Bacteria | 611 |
| 546 | Ga0206356_10200830 | 3300020070 | Bacteria | 593 |
| 547 | Ga0206356_10361125 | 3300020070 | Bacteria | 1257 |
| 548 | Ga0206356_10509057 | 3300020070 | Bacteria | 916 |
| 549 | Ga0206356_10516737 | 3300020070 | Bacteria | 5046 |
| 550 | Ga0206356_10824910 | 3300020070 | Bacteria | 2830 |
| 551 | Ga0206356_10913331 | 3300020070 | Bacteria | 1383 |
| 552 | Ga0206356_11044350 | 3300020070 | Bacteria | 657 |
| 553 | Ga0206356_11156669 | 3300020070 | Bacteria | 1263 |
| 554 | Ga0206356_11286683 | 3300020070 | Bacteria | 874 |
| 555 | Ga0206349_1386548 | 3300020075 | Bacteria | 1246 |
| 556 | Ga0206349_1530271 | 3300020075 | Bacteria | 614 |
| 557 | Ga0206349_1613375 | 3300020075 | Bacteria | 1472 |
| 558 | Ga0206355_1018340 | 3300020076 | Bacteria | 583 |
| 559 | Ga0206355_1035334 | 3300020076 | Bacteria | 2191 |
| 560 | Ga0206355_1055070 | 3300020076 | Bacteria | 877 |
| 561 | Ga0206355_1328705 | 3300020076 | Bacteria | 1923 |
| 562 | Ga0206355_1630452 | 3300020076 | Bacteria | 526 |
| 563 | Ga0206351_10072365 | 3300020077 | Bacteria | 2191 |
| 564 | Ga0206351_10093131 | 3300020077 | Bacteria | 1078 |
| 565 | Ga0206351_10468617 | 3300020077 | Bacteria | 1652 |
| 566 | Ga0206351_10495414 | 3300020077 | Bacteria | 1010 |
| 567 | Ga0206351_10796045 | 3300020077 | Bacteria | 952 |
| 568 | Ga0206351_10858444 | 3300020077 | Bacteria | 1021 |
| 569 | Ga0206352_10254721 | 3300020078 | Bacteria | 837 |
| 570 | Ga0206352_10314452 | 3300020078 | Bacteria | 856 |
| 571 | Ga0206352_10341291 | 3300020078 | Bacteria | 602 |
| 572 | Ga0206352_10408147 | 3300020078 | Bacteria | 984 |
| 573 | Ga0206352_10649957 | 3300020078 | Bacteria | 959 |
| 574 | Ga0206352_10815645 | 3300020078 | Bacteria | 1286 |
| 575 | Ga0206352_10939620 | 3300020078 | Bacteria | 793 |
| 576 | Ga0206352_11168067 | 3300020078 | Bacteria | 999 |
| 577 | Ga0206352_11295788 | 3300020078 | Bacteria | 658 |
| 578 | Ga0206350_10430818 | 3300020080 | Bacteria | 1907 |
| 579 | Ga0206350_10432378 | 3300020080 | Bacteria | 1085 |
| 580 | Ga0206350_10544636 | 3300020080 | Bacteria | 3726 |
| 581 | Ga0206350_11196555 | 3300020080 | Bacteria | 1542 |
| 582 | Ga0206350_11654020 | 3300020080 | Bacteria | 1018 |
| 583 | Ga0206354_10074904 | 3300020081 | Bacteria | 569 |
| 584 | Ga0206354_10208883 | 3300020081 | Bacteria | 628 |
| 585 | Ga0206354_10331979 | 3300020081 | Bacteria | 1229 |
| 586 | Ga0206354_11017939 | 3300020081 | Bacteria | 836 |
| 587 | Ga0206354_11068226 | 3300020081 | Bacteria | 586 |
| 588 | Ga0206354_11172408 | 3300020081 | Bacteria | 1283 |
| 589 | Ga0206354_11291340 | 3300020081 | Bacteria | 746 |
| 590 | Ga0206354_11520797 | 3300020081 | Bacteria | 669 |
| 591 | Ga0206354_11614879 | 3300020081 | Bacteria | 605 |
| 592 | Ga0206353_10014677 | 3300020082 | Bacteria | 3231 |
| 593 | Ga0206353_10282636 | 3300020082 | Bacteria | 1565 |
| 594 | Ga0206353_10330275 | 3300020082 | Bacteria | 528 |
| 595 | Ga0206353_10591683 | 3300020082 | Bacteria | 754 |
| 596 | Ga0206353_10790039 | 3300020082 | Bacteria | 511 |
| 597 | Ga0206353_11192759 | 3300020082 | Bacteria | 2000 |
| 598 | Ga0206353_11631527 | 3300020082 | Bacteria | 521 |
| 599 | Ga0206353_11688786 | 3300020082 | Bacteria | 1043 |
| 600 | Ga0206353_11996101 | 3300020082 | Bacteria | 607 |
| 601 | Ga0154015_1068933 | 3300020610 | Bacteria | 884 |
| 602 | Ga0154015_1105291 | 3300020610 | Bacteria | 867 |
| 603 | Ga0154015_1142575 | 3300020610 | Bacteria | 1155 |
| 604 | Ga0154015_1285479 | 3300020610 | Bacteria | 1538 |
| 605 | Ga0154015_1417016 | 3300020610 | Bacteria | 703 |
| 606 | Ga0154015_1538444 | 3300020610 | Bacteria | 734 |
| 607 | Ga0224712_10001495 | 3300022467 | Bacteria | 5409 |
| 608 | Ga0224712_10011859 | 3300022467 | Bacteria | 2720 |
| 609 | Ga0224712_10015890 | 3300022467 | Bacteria | 2459 |
| 610 | Ga0224712_10024023 | 3300022467 | Bacteria | 2124 |
| 611 | Ga0224712_10038926 | 3300022467 | Bacteria | 1779 |
| 612 | Ga0224712_10101446 | 3300022467 | Bacteria | 1221 |
| 613 | Ga0209566_100066 | 3300025225 | Bacteria | 186951 |
| 614 | Ga0209674_100001 | 3300025226 | Bacteria | 4013750 |
| 615 | Ga0209672_100039 | 3300025228 | Bacteria | 283064 |
| 616 | Ga0209147_100954 | 3300025229 | Bacteria | 12700 |
| 617 | Ga0209563_100001 | 3300025230 | Bacteria | 4013775 |
| 618 | Ga0207427_100042 | 3300025231 | Bacteria | 254170 |
| 619 | Ga0209437_100538 | 3300025233 | Bacteria | 26230 |
| 620 | Ga0209258_101761 | 3300025242 | Bacteria | 6673 |
| 621 | Ga0209677_100001 | 3300025253 | Bacteria | 4013787 |
| 622 | Ga0209677_102161 | 3300025253 | Bacteria | 7674 |
| 623 | Ga0209148_1000004 | 3300025254 | Bacteria | 1844481 |
| 624 | Ga0209233_1000001 | 3300025261 | Bacteria | 2992747 |
| 625 | Ga0209455_1000117 | 3300025272 | Bacteria | 176940 |
| 626 | Ga0209455_1003952 | 3300025272 | Bacteria | 5035 |
| 627 | Ga0207697_10119287 | 3300025315 | Bacteria | 1134 |
| 628 | Ga0207656_10013795 | 3300025321 | Bacteria | 3098 |
| 629 | Ga0207653_10047439 | 3300025885 | Bacteria | 1422 |
| 630 | Ga0207692_10007776 | 3300025898 | Bacteria | 4407 |
| 631 | Ga0207692_10288443 | 3300025898 | Bacteria | 995 |
| 632 | Ga0207642_10204023 | 3300025899 | Bacteria | 1094 |
| 633 | Ga0207642_10773310 | 3300025899 | Bacteria | 609 |
| 634 | Ga0207642_10836266 | 3300025899 | Bacteria | 587 |
| 635 | Ga0207710_10436641 | 3300025900 | Bacteria | 675 |
| 636 | Ga0207688_10003165 | 3300025901 | Bacteria | 8975 |
| 637 | Ga0207688_10016881 | 3300025901 | Bacteria | 3965 |
| 638 | Ga0207688_10036391 | 3300025901 | Bacteria | 2728 |
| 639 | Ga0207688_10167179 | 3300025901 | Bacteria | 1306 |
| 640 | Ga0207680_10598528 | 3300025903 | Bacteria | 788 |
| 641 | Ga0207647_10021889 | 3300025904 | Bacteria | 4256 |
| 642 | Ga0207647_10028990 | 3300025904 | Bacteria | 3588 |
| 643 | Ga0207647_10090838 | 3300025904 | Bacteria | 1821 |
| 644 | Ga0207685_10619191 | 3300025905 | Bacteria | 582 |
| 645 | Ga0207699_10099923 | 3300025906 | Bacteria | 1839 |
| 646 | Ga0207645_10064369 | 3300025907 | Bacteria | 2343 |
| 647 | Ga0207645_10137521 | 3300025907 | Bacteria | 1591 |
| 648 | Ga0207645_10149679 | 3300025907 | Bacteria | 1523 |
| 649 | Ga0207643_10011474 | 3300025908 | Bacteria | 4785 |
| 650 | Ga0207643_10048389 | 3300025908 | Bacteria | 2408 |
| 651 | Ga0207643_10050065 | 3300025908 | Bacteria | 2368 |
| 652 | Ga0207643_10199074 | 3300025908 | Bacteria | 1219 |
| 653 | Ga0207643_10202123 | 3300025908 | Bacteria | 1210 |
| 654 | Ga0207705_10013197 | 3300025909 | Bacteria | 5964 |
| 655 | Ga0207705_10120089 | 3300025909 | Bacteria | 1950 |
| 656 | Ga0207705_10202859 | 3300025909 | Bacteria | 1503 |
| 657 | Ga0207684_10002793 | 3300025910 | Bacteria | 17346 |
| 658 | Ga0207684_10018534 | 3300025910 | Bacteria | 5958 |
| 659 | Ga0207684_10116254 | 3300025910 | Bacteria | 2291 |
| 660 | Ga0207684_10745082 | 3300025910 | Bacteria | 831 |
| 661 | Ga0207684_10830059 | 3300025910 | Bacteria | 780 |
| 662 | Ga0207684_10897040 | 3300025910 | Bacteria | 745 |
| 663 | Ga0207654_10060489 | 3300025911 | Bacteria | 2213 |
| 664 | Ga0207654_10081460 | 3300025911 | Bacteria | 1949 |
| 665 | Ga0207654_10873031 | 3300025911 | Bacteria | 651 |
| 666 | Ga0207707_10112966 | 3300025912 | Bacteria | 2374 |
| 667 | Ga0207707_10115185 | 3300025912 | Bacteria | 2349 |
| 668 | Ga0207707_10471034 | 3300025912 | Bacteria | 1073 |
| 669 | Ga0207707_10547397 | 3300025912 | Bacteria | 983 |
| 670 | Ga0207707_10689187 | 3300025912 | Bacteria | 859 |
| 671 | Ga0207695_10129689 | 3300025913 | Bacteria | 2480 |
| 672 | Ga0207671_10080469 | 3300025914 | Bacteria | 2442 |
| 673 | Ga0207671_10508695 | 3300025914 | Bacteria | 960 |
| 674 | Ga0207693_10022846 | 3300025915 | Bacteria | 4966 |
| 675 | Ga0207693_10258912 | 3300025915 | Bacteria | 1364 |
| 676 | Ga0207693_10900110 | 3300025915 | Bacteria | 679 |
| 677 | Ga0207693_10910752 | 3300025915 | Bacteria | 674 |
| 678 | Ga0207663_10011677 | 3300025916 | Bacteria | 4727 |
| 679 | Ga0207663_11442947 | 3300025916 | Bacteria | 554 |
| 680 | Ga0207660_10000002 | 3300025917 | Bacteria | 883566 |
| 681 | Ga0207660_10117448 | 3300025917 | Bacteria | 2011 |
| 682 | Ga0207660_10197986 | 3300025917 | Bacteria | 1568 |
| 683 | Ga0207660_10318694 | 3300025917 | Bacteria | 1241 |
| 684 | Ga0207660_11056144 | 3300025917 | Bacteria | 662 |
| 685 | Ga0207662_10397766 | 3300025918 | Bacteria | 933 |
| 686 | Ga0207657_10001055 | 3300025919 | Bacteria | 29226 |
| 687 | Ga0207657_10031572 | 3300025919 | Bacteria | 4797 |
| 688 | Ga0207657_10044718 | 3300025919 | Bacteria | 3891 |
| 689 | Ga0207657_10171230 | 3300025919 | Bacteria | 1759 |
| 690 | Ga0207657_10404575 | 3300025919 | Bacteria | 1073 |
| 691 | Ga0207649_10730382 | 3300025920 | Bacteria | 769 |
| 692 | Ga0207649_10978365 | 3300025920 | Bacteria | 665 |
| 693 | Ga0207652_10015058 | 3300025921 | Bacteria | 6274 |
| 694 | Ga0207652_10079196 | 3300025921 | Bacteria | 2870 |
| 695 | Ga0207652_10447665 | 3300025921 | Bacteria | 1164 |
| 696 | Ga0207652_10542269 | 3300025921 | Bacteria | 1046 |
| 697 | Ga0207646_10028575 | 3300025922 | Bacteria | 5073 |
| 698 | Ga0207646_10037146 | 3300025922 | Bacteria | 4392 |
| 699 | Ga0207646_10048634 | 3300025922 | Bacteria | 3801 |
| 700 | Ga0207646_10067220 | 3300025922 | Bacteria | 3200 |
| 701 | Ga0207681_10357039 | 3300025923 | Bacteria | 1171 |
| 702 | Ga0207681_10982571 | 3300025923 | Bacteria | 708 |
| 703 | Ga0207694_10006100 | 3300025924 | Bacteria | 9215 |
| 704 | Ga0207694_10010017 | 3300025924 | Bacteria | 7144 |
| 705 | Ga0207694_10079437 | 3300025924 | Bacteria | 2573 |
| 706 | Ga0207694_10261073 | 3300025924 | Bacteria | 1419 |
| 707 | Ga0207694_10321104 | 3300025924 | Bacteria | 1278 |
| 708 | Ga0207650_10263591 | 3300025925 | Bacteria | 1398 |
| 709 | Ga0207650_10358983 | 3300025925 | Bacteria | 1200 |
| 710 | Ga0207659_10083284 | 3300025926 | Bacteria | 2371 |
| 711 | Ga0207659_10100407 | 3300025926 | Bacteria | 2180 |
| 712 | Ga0207659_10659337 | 3300025926 | Bacteria | 895 |
| 713 | Ga0207687_10000332 | 3300025927 | Bacteria | 31692 |
| 714 | Ga0207687_10068636 | 3300025927 | Bacteria | 2526 |
| 715 | Ga0207687_10076469 | 3300025927 | Bacteria | 2405 |
| 716 | Ga0207687_10486464 | 3300025927 | Bacteria | 1028 |
| 717 | Ga0207687_11125178 | 3300025927 | Bacteria | 675 |
| 718 | Ga0207687_11342338 | 3300025927 | Bacteria | 615 |
| 719 | Ga0207687_11533538 | 3300025927 | Bacteria | 572 |
| 720 | Ga0207700_10199007 | 3300025928 | Bacteria | 1687 |
| 721 | Ga0207700_11333167 | 3300025928 | Bacteria | 639 |
| 722 | Ga0207664_10004696 | 3300025929 | Bacteria | 9271 |
| 723 | Ga0207664_10106499 | 3300025929 | Bacteria | 2325 |
| 724 | Ga0207644_10862613 | 3300025931 | Bacteria | 758 |
| 725 | Ga0207644_10987685 | 3300025931 | Bacteria | 706 |
| 726 | Ga0207690_10043139 | 3300025932 | Bacteria | 2967 |
| 727 | Ga0207690_10096274 | 3300025932 | Bacteria | 2104 |
| 728 | Ga0207690_10623211 | 3300025932 | Bacteria | 882 |
| 729 | Ga0207690_11518080 | 3300025932 | Bacteria | 560 |
| 730 | Ga0207706_10012543 | 3300025933 | Bacteria | 7718 |
| 731 | Ga0207706_10196299 | 3300025933 | Bacteria | 1771 |
| 732 | Ga0207706_10199972 | 3300025933 | Bacteria | 1753 |
| 733 | Ga0207706_10482472 | 3300025933 | Bacteria | 1071 |
| 734 | Ga0207706_10603301 | 3300025933 | Bacteria | 943 |
| 735 | Ga0207686_10020647 | 3300025934 | Bacteria | 3766 |
| 736 | Ga0207686_10059068 | 3300025934 | Bacteria | 2421 |
| 737 | Ga0207686_10465798 | 3300025934 | Bacteria | 975 |
| 738 | Ga0207686_10991413 | 3300025934 | Bacteria | 681 |
| 739 | Ga0207686_11206580 | 3300025934 | Bacteria | 619 |
| 740 | Ga0207709_10020150 | 3300025935 | Bacteria | 3759 |
| 741 | Ga0207709_10136935 | 3300025935 | Bacteria | 1678 |
| 742 | Ga0207709_10179787 | 3300025935 | Bacteria | 1493 |
| 743 | Ga0207709_10254716 | 3300025935 | Bacteria | 1284 |
| 744 | Ga0207709_10554129 | 3300025935 | Bacteria | 905 |
| 745 | Ga0207709_10575743 | 3300025935 | Bacteria | 889 |
| 746 | Ga0207709_10593553 | 3300025935 | Bacteria | 876 |
| 747 | Ga0207670_10055965 | 3300025936 | Bacteria | 2668 |
| 748 | Ga0207670_10225281 | 3300025936 | Bacteria | 1437 |
| 749 | Ga0207669_10039257 | 3300025937 | Bacteria | 2734 |
| 750 | Ga0207669_10101044 | 3300025937 | Bacteria | 1907 |
| 751 | Ga0207669_10174457 | 3300025937 | Bacteria | 1534 |
| 752 | Ga0207669_10194744 | 3300025937 | Bacteria | 1465 |
| 753 | Ga0207704_10061699 | 3300025938 | Bacteria | 2327 |
| 754 | Ga0207704_10111612 | 3300025938 | Bacteria | 1849 |
| 755 | Ga0207704_10412076 | 3300025938 | Bacteria | 1069 |
| 756 | Ga0207704_10521277 | 3300025938 | Bacteria | 961 |
| 757 | Ga0207665_10159641 | 3300025939 | Bacteria | 1621 |
| 758 | Ga0207665_11145254 | 3300025939 | Bacteria | 620 |
| 759 | Ga0207691_10138961 | 3300025940 | Bacteria | 2141 |
| 760 | Ga0207691_10221557 | 3300025940 | Bacteria | 1640 |
| 761 | Ga0207691_10527891 | 3300025940 | Bacteria | 1001 |
| 762 | Ga0207691_11386318 | 3300025940 | Bacteria | 578 |
| 763 | Ga0207711_10110582 | 3300025941 | Bacteria | 2443 |
| 764 | Ga0207711_10113217 | 3300025941 | Bacteria | 2415 |
| 765 | Ga0207711_10325705 | 3300025941 | Bacteria | 1420 |
| 766 | Ga0207711_10488048 | 3300025941 | Bacteria | 1148 |
| 767 | Ga0207689_10021685 | 3300025942 | Bacteria | 5403 |
| 768 | Ga0207689_10029116 | 3300025942 | Bacteria | 4615 |
| 769 | Ga0207689_10095522 | 3300025942 | Bacteria | 2441 |
| 770 | Ga0207661_10000189 | 3300025944 | Bacteria | 40034 |
| 771 | Ga0207661_10016251 | 3300025944 | Bacteria | 5489 |
| 772 | Ga0207661_10030780 | 3300025944 | Bacteria | 4137 |
| 773 | Ga0207661_10283621 | 3300025944 | Bacteria | 1481 |
| 774 | Ga0207661_10508833 | 3300025944 | Bacteria | 1100 |
| 775 | Ga0207661_10529277 | 3300025944 | Bacteria | 1078 |
| 776 | Ga0207661_10772628 | 3300025944 | Bacteria | 884 |
| 777 | Ga0207661_10966456 | 3300025944 | Bacteria | 784 |
| 778 | Ga0207661_11445882 | 3300025944 | Bacteria | 630 |
| 779 | Ga0207679_10216472 | 3300025945 | Bacteria | 1609 |
| 780 | Ga0207679_10246993 | 3300025945 | Bacteria | 1515 |
| 781 | Ga0207679_10673327 | 3300025945 | Bacteria | 937 |
| 782 | Ga0207679_10700184 | 3300025945 | Bacteria | 919 |
| 783 | Ga0207667_10011493 | 3300025949 | Bacteria | 10284 |
| 784 | Ga0207667_10266250 | 3300025949 | Bacteria | 1752 |
| 785 | Ga0207667_11307650 | 3300025949 | Bacteria | 701 |
| 786 | Ga0207651_10602306 | 3300025960 | Bacteria | 960 |
| 787 | Ga0207651_10793014 | 3300025960 | Bacteria | 839 |
| 788 | Ga0207651_11378465 | 3300025960 | Bacteria | 634 |
| 789 | Ga0207651_11583715 | 3300025960 | Bacteria | 590 |
| 790 | Ga0207712_10153966 | 3300025961 | Bacteria | 1779 |
| 791 | Ga0207712_10653681 | 3300025961 | Bacteria | 914 |
| 792 | Ga0207712_10671211 | 3300025961 | Bacteria | 902 |
| 793 | Ga0207712_11326639 | 3300025961 | Bacteria | 643 |
| 794 | Ga0207640_10018900 | 3300025981 | Bacteria | 4059 |
| 795 | Ga0207640_10063865 | 3300025981 | Bacteria | 2449 |
| 796 | Ga0207640_10266741 | 3300025981 | Bacteria | 1337 |
| 797 | Ga0207640_10616263 | 3300025981 | Bacteria | 921 |
| 798 | Ga0207658_10125019 | 3300025986 | Bacteria | 2057 |
| 799 | Ga0207658_10691348 | 3300025986 | Bacteria | 921 |
| 800 | Ga0207677_10063649 | 3300026023 | Bacteria | 2565 |
| 801 | Ga0207677_10114794 | 3300026023 | Bacteria | 2013 |
| 802 | Ga0207677_10542254 | 3300026023 | Bacteria | 1012 |
| 803 | Ga0207677_10566713 | 3300026023 | Bacteria | 992 |
| 804 | Ga0207677_10696072 | 3300026023 | Bacteria | 901 |
| 805 | Ga0207677_10723305 | 3300026023 | Bacteria | 885 |
| 806 | Ga0207703_10074488 | 3300026035 | Bacteria | 2811 |
| 807 | Ga0207703_11458167 | 3300026035 | Bacteria | 658 |
| 808 | Ga0207639_10430698 | 3300026041 | Bacteria | 1194 |
| 809 | Ga0207639_10764363 | 3300026041 | Bacteria | 899 |
| 810 | Ga0207678_10112985 | 3300026067 | Bacteria | 2317 |
| 811 | Ga0207678_10146870 | 3300026067 | Bacteria | 2013 |
| 812 | Ga0207678_10330038 | 3300026067 | Bacteria | 1313 |
| 813 | Ga0207678_10353523 | 3300026067 | Bacteria | 1267 |
| 814 | Ga0207678_10509204 | 3300026067 | Bacteria | 1050 |
| 815 | Ga0207678_10587647 | 3300026067 | Bacteria | 976 |
| 816 | Ga0207678_10993361 | 3300026067 | Bacteria | 743 |
| 817 | Ga0207708_10026038 | 3300026075 | Bacteria | 4425 |
| 818 | Ga0207708_10090013 | 3300026075 | Bacteria | 2365 |
| 819 | Ga0207708_10118012 | 3300026075 | Bacteria | 2065 |
| 820 | Ga0207708_10153468 | 3300026075 | Bacteria | 1815 |
| 821 | Ga0207708_10213965 | 3300026075 | Bacteria | 1542 |
| 822 | Ga0207708_10321121 | 3300026075 | Bacteria | 1264 |
| 823 | Ga0207708_10324981 | 3300026075 | Bacteria | 1256 |
| 824 | Ga0207708_10568282 | 3300026075 | Bacteria | 958 |
| 825 | Ga0207702_10033880 | 3300026078 | Bacteria | 4268 |
| 826 | Ga0207702_10042541 | 3300026078 | Bacteria | 3811 |
| 827 | Ga0207702_10149288 | 3300026078 | Bacteria | 2125 |
| 828 | Ga0207702_10158054 | 3300026078 | Bacteria | 2068 |
| 829 | Ga0207702_10503454 | 3300026078 | Bacteria | 1181 |
| 830 | Ga0207702_10846700 | 3300026078 | Bacteria | 905 |
| 831 | Ga0207702_11296370 | 3300026078 | Bacteria | 722 |
| 832 | Ga0207641_10049012 | 3300026088 | Bacteria | 3568 |
| 833 | Ga0207641_10308358 | 3300026088 | Bacteria | 1497 |
| 834 | Ga0207648_10078065 | 3300026089 | Bacteria | 2888 |
| 835 | Ga0207648_10151012 | 3300026089 | Bacteria | 2050 |
| 836 | Ga0207648_10228692 | 3300026089 | Bacteria | 1654 |
| 837 | Ga0207648_10334264 | 3300026089 | Bacteria | 1363 |
| 838 | Ga0207676_10065702 | 3300026095 | Bacteria | 2889 |
| 839 | Ga0207676_10140024 | 3300026095 | Bacteria | 2070 |
| 840 | Ga0207676_10851219 | 3300026095 | Bacteria | 892 |
| 841 | Ga0207674_10134020 | 3300026116 | Bacteria | 2440 |
| 842 | Ga0207674_10162985 | 3300026116 | Bacteria | 2184 |
| 843 | Ga0207674_10168198 | 3300026116 | Bacteria | 2146 |
| 844 | Ga0207674_10455687 | 3300026116 | Bacteria | 1236 |
| 845 | Ga0207674_10532577 | 3300026116 | Bacteria | 1135 |
| 846 | Ga0207675_100082898 | 3300026118 | Bacteria | 3007 |
| 847 | Ga0207675_100166279 | 3300026118 | Bacteria | 2107 |
| 848 | Ga0207675_100195629 | 3300026118 | Bacteria | 1941 |
| 849 | Ga0207675_101470333 | 3300026118 | Bacteria | 702 |
| 850 | Ga0207683_10008575 | 3300026121 | Bacteria | 8749 |
| 851 | Ga0207683_10067303 | 3300026121 | Bacteria | 3159 |
| 852 | Ga0207683_10154003 | 3300026121 | Bacteria | 2076 |
| 853 | Ga0207683_10358518 | 3300026121 | Bacteria | 1339 |
| 854 | Ga0207683_10427335 | 3300026121 | Bacteria | 1220 |
| 855 | Ga0207683_10461075 | 3300026121 | Bacteria | 1172 |
| 856 | Ga0207683_10515193 | 3300026121 | Bacteria | 1105 |
| 857 | Ga0207683_10740649 | 3300026121 | Bacteria | 912 |
| 858 | Ga0207683_10957018 | 3300026121 | Bacteria | 795 |
| 859 | Ga0207683_12149743 | 3300026121 | Bacteria | 506 |
| 860 | Ga0207698_10020583 | 3300026142 | Bacteria | 4544 |
| 861 | Ga0207698_10324013 | 3300026142 | Bacteria | 1444 |
| 862 | Ga0209973_1020452 | 3300027252 | Bacteria | 874 |
| 863 | Ga0209969_1032723 | 3300027360 | Bacteria | 797 |
| 864 | Ga0209967_1013822 | 3300027364 | Bacteria | 1147 |
| 865 | Ga0209996_1031334 | 3300027395 | Bacteria | 774 |
| 866 | Ga0209995_1064474 | 3300027471 | Bacteria | 625 |
| 867 | Ga0209968_1014896 | 3300027526 | Bacteria | 1226 |
| 868 | Ga0209999_1010955 | 3300027543 | Bacteria | 1639 |
| 869 | Ga0209982_1034364 | 3300027552 | Bacteria | 802 |
| 870 | Ga0210002_1018339 | 3300027617 | Bacteria | 1118 |
| 871 | Ga0209983_1058714 | 3300027665 | Bacteria | 848 |
| 872 | Ga0209971_1007217 | 3300027682 | Bacteria | 2636 |
| 873 | Ga0209966_1025954 | 3300027695 | Bacteria | 1165 |
| 874 | Ga0209998_10007811 | 3300027717 | Bacteria | 2220 |
| 875 | Ga0209998_10024310 | 3300027717 | Bacteria | 1314 |
| 876 | Ga0209974_10019832 | 3300027876 | Bacteria | 2229 |
| 877 | Ga0207428_10000181 | 3300027907 | Bacteria | 88299 |
| 878 | Ga0268266_10338848 | 3300028379 | Bacteria | 1411 |
| 879 | Ga0268266_10958393 | 3300028379 | Bacteria | 828 |
| 880 | Ga0268265_10321086 | 3300028380 | Bacteria | 1402 |
| 881 | Ga0268265_10997499 | 3300028380 | Bacteria | 827 |
| 882 | Ga0268264_10102520 | 3300028381 | Bacteria | 2490 |
| 883 | Ga0268264_10569197 | 3300028381 | Bacteria | 1113 |
| 884 | Ga0268264_10591831 | 3300028381 | Bacteria | 1092 |
| 885 | Ga0268264_10756906 | 3300028381 | Bacteria | 968 |
| 886 | Ga0268264_11401749 | 3300028381 | Bacteria | 709 |
| 887 | Ga0265337_1016621 | 3300028556 | Bacteria | 2373 |
| 888 | Ga0265337_1035179 | 3300028556 | Bacteria | 1469 |
| 889 | Ga0265326_10014445 | 3300028558 | Bacteria | 2300 |
| 890 | Ga0265319_1000855 | 3300028563 | Bacteria | 19414 |
| 891 | Ga0265319_1101346 | 3300028563 | Bacteria | 904 |
| 892 | Ga0265334_10030082 | 3300028573 | Bacteria | 2175 |
| 893 | Ga0265318_10033646 | 3300028577 | Bacteria | 1977 |
| 894 | Ga0265323_10078944 | 3300028653 | Bacteria | 1114 |
| 895 | Ga0265322_10010856 | 3300028654 | Bacteria | 2644 |
| 896 | Ga0265336_10167246 | 3300028666 | Bacteria | 654 |
| 897 | Ga0265338_10030239 | 3300028800 | Bacteria | 5344 |
| 898 | Ga0265338_10739638 | 3300028800 | Bacteria | 677 |
| 899 | Ga0265324_10006460 | 3300029957 | Bacteria | 4886 |
| 900 | Ga0265324_10017063 | 3300029957 | Bacteria | 2642 |
| 901 | Ga0265330_10010314 | 3300031235 | Bacteria | 4409 |
| 902 | Ga0265330_10013785 | 3300031235 | Bacteria | 3761 |
| 903 | Ga0265332_10023897 | 3300031238 | Bacteria | 2693 |
| 904 | Ga0265332_10030283 | 3300031238 | Bacteria | 2364 |
| 905 | Ga0265332_10153172 | 3300031238 | Bacteria | 964 |
| 906 | Ga0265320_10002674 | 3300031240 | Bacteria | 12328 |
| 907 | Ga0265320_10004554 | 3300031240 | Bacteria | 9068 |
| 908 | Ga0265325_10004083 | 3300031241 | Bacteria | 9300 |
| 909 | Ga0265329_10003710 | 3300031242 | Bacteria | 6583 |
| 910 | Ga0265329_10004401 | 3300031242 | Bacteria | 5872 |
| 911 | Ga0265340_10004482 | 3300031247 | Bacteria | 7797 |
| 912 | Ga0265339_10098430 | 3300031249 | Bacteria | 1525 |
| 913 | Ga0265327_10003480 | 3300031251 | Bacteria | 14979 |
| 914 | Ga0265327_10075274 | 3300031251 | Bacteria | 1679 |
| 915 | Ga0265316_10007887 | 3300031344 | Bacteria | 9962 |
| 916 | Ga0265316_10023310 | 3300031344 | Bacteria | 5201 |
| 917 | Ga0265316_10059571 | 3300031344 | Bacteria | 2969 |
| 918 | Ga0265313_10053419 | 3300031595 | Bacteria | 1923 |
| 919 | Ga0307514_10020272 | 3300031649 | Bacteria | 5427 |
| 920 | Ga0316575_10006117 | 3300031665 | Bacteria | 4320 |
| 921 | Ga0316575_10317684 | 3300031665 | Bacteria | 660 |
| 922 | Ga0316579_10023159 | 3300031691 | Bacteria | 2784 |
| 923 | Ga0316579_10066726 | 3300031691 | Bacteria | 1699 |
| 924 | Ga0316579_10130380 | 3300031691 | Bacteria | 1211 |
| 925 | Ga0316579_10145130 | 3300031691 | Bacteria | 1144 |
| 926 | Ga0316579_10219317 | 3300031691 | Bacteria | 920 |
| 927 | Ga0316579_10503885 | 3300031691 | Bacteria | 586 |
| 928 | Ga0265314_10016170 | 3300031711 | Bacteria | 5907 |
| 929 | Ga0265314_10116285 | 3300031711 | Bacteria | 1691 |
| 930 | Ga0265342_10001795 | 3300031712 | Bacteria | 19520 |
| 931 | Ga0265342_10034561 | 3300031712 | Bacteria | 3101 |
| 932 | Ga0316576_10037846 | 3300031727 | Bacteria | 3456 |
| 933 | Ga0316576_10043431 | 3300031727 | Bacteria | 3243 |
| 934 | Ga0316576_10074501 | 3300031727 | Bacteria | 2510 |
| 935 | Ga0316576_10076538 | 3300031727 | Bacteria | 2476 |
| 936 | Ga0316576_10240448 | 3300031727 | Bacteria | 1360 |
| 937 | Ga0316576_10689990 | 3300031727 | Bacteria | 740 |
| 938 | Ga0316578_10100243 | 3300031728 | Bacteria | 1736 |
| 939 | Ga0316578_10132551 | 3300031728 | Bacteria | 1500 |
| 940 | Ga0316578_10445361 | 3300031728 | Bacteria | 765 |
| 941 | Ga0307405_11648287 | 3300031731 | Bacteria | 567 |
| 942 | Ga0316577_10017827 | 3300031733 | Bacteria | 3924 |
| 943 | Ga0316577_10083780 | 3300031733 | Bacteria | 1783 |
| 944 | Ga0316577_10092089 | 3300031733 | Bacteria | 1697 |
| 945 | Ga0316577_10224268 | 3300031733 | Bacteria | 1063 |
| 946 | Ga0316577_10232320 | 3300031733 | Bacteria | 1043 |
| 947 | Ga0316577_10249295 | 3300031733 | Bacteria | 1005 |
| 948 | Ga0316577_10305216 | 3300031733 | Bacteria | 902 |
| 949 | Ga0316577_10520103 | 3300031733 | Bacteria | 676 |
| 950 | Ga0307410_10454535 | 3300031852 | Bacteria | 1045 |
| 951 | Ga0307412_11506679 | 3300031911 | Bacteria | 612 |
| 952 | Ga0307409_100096715 | 3300031995 | Bacteria | 2437 |
| 953 | Ga0307409_100548092 | 3300031995 | Bacteria | 1135 |
| 954 | Ga0307409_101808684 | 3300031995 | Bacteria | 640 |
| 955 | Ga0307416_100613719 | 3300032002 | Bacteria | 1169 |
| 956 | Ga0307416_100855774 | 3300032002 | Bacteria | 1007 |
| 957 | Ga0307415_100625789 | 3300032126 | Bacteria | 961 |
| 958 | Ga0316583_10023673 | 3300032133 | Bacteria | 2192 |
| 959 | Ga0316583_10061258 | 3300032133 | Bacteria | 1319 |
| 960 | Ga0316585_10004351 | 3300032137 | Bacteria | 3939 |
| 961 | Ga0316585_10091378 | 3300032137 | Bacteria | 995 |
| 962 | Ga0316585_10181001 | 3300032137 | Bacteria | 696 |
| 963 | Ga0316593_10053135 | 3300032168 | Bacteria | 1372 |
| 964 | Ga0316593_10120476 | 3300032168 | Bacteria | 942 |
| 965 | Ga0316593_10250320 | 3300032168 | Bacteria | 663 |
| 966 | Ga0316593_10367576 | 3300032168 | Bacteria | 552 |
| 967 | Ga0316592_1013793 | 3300033524 | Bacteria | 1671 |
| 968 | Ga0316592_1021646 | 3300033524 | Bacteria | 1370 |
| 969 | Ga0316592_1026831 | 3300033524 | Bacteria | 1244 |
| 970 | Ga0316592_1096925 | 3300033524 | Bacteria | 677 |
| 971 | Ga0316586_1058871 | 3300033527 | Bacteria | 696 |
| 972 | Ga0316587_1081568 | 3300033529 | Bacteria | 612 |
| 973 | Ga0316596_1025941 | 3300033541 | Bacteria | 1509 |
| 974 | Ga0316596_1040913 | 3300033541 | Bacteria | 1218 |
| 975 | Ga0316596_1058524 | 3300033541 | Bacteria | 1026 |
| 976 | Ga0316596_1130116 | 3300033541 | Bacteria | 687 |
| 977 | Ga0316596_1146706 | 3300033541 | Bacteria | 647 |
| 978 | Ga0373948_0133675 | 3300034817 | Bacteria | 609 |
| 979 | Ga0373959_0036141 | 3300034820 | Bacteria | 1018 |
| 980 | Ga0373959_0037465 | 3300034820 | Bacteria | 1005 |
| 981 | Ga0373959_0117360 | 3300034820 | Bacteria | 648 |
| 982 | Ga0373938_0029372 | 3300034957 | Bacteria | 1167 |
| 983 | Ga0373926_0098922 | 3300035083 | Bacteria | 1089 |
| 984 | Ga0373929_0133040 | 3300035085 | Bacteria | 654 |
| 985 | Ga0373934_0069319 | 3300035086 | Bacteria | 1409 |
| 986 | Ga0373940_0077785 | 3300035088 | Bacteria | 976 |
| 987 | Ga0373944_0317673 | 3300035089 | Bacteria | 587 |
| 988 | Ga0373949_0048275 | 3300035090 | Bacteria | 1066 |
| 989 | Ga0373949_0076228 | 3300035090 | Bacteria | 886 |
| 990 | Ga0373951_0017339 | 3300035091 | Bacteria | 1629 |
| 991 | Ga0373952_0009679 | 3300035092 | Bacteria | 1851 |
| 992 | Ga0373952_0029204 | 3300035092 | Bacteria | 1214 |
| 993 | Ga0373952_0089127 | 3300035092 | Bacteria | 799 |
| 994 | Ga0373952_0110733 | 3300035092 | Bacteria | 735 |
| 995 | Ga0373923_0007437 | 3300035111 | Bacteria | 3851 |
| 996 | Ga0373932_0013656 | 3300035112 | Bacteria | 2026 |
| 997 | Ga0373932_0075009 | 3300035112 | Bacteria | 1057 |
| 998 | Ga0373936_0273187 | 3300035113 | Bacteria | 759 |
| 999 | Ga0373941_0043255 | 3300035115 | Bacteria | 1401 |
| 1000 | Ga0373941_0068497 | 3300035115 | Bacteria | 1172 |
| 1001 | Ga0373941_0148827 | 3300035115 | Bacteria | 857 |
| 1002 | Ga0373945_0092711 | 3300035116 | Bacteria | 1171 |
| 1003 | Ga0373945_0157657 | 3300035116 | Bacteria | 924 |
| 1004 | Ga0373953_0038654 | 3300035117 | Bacteria | 1889 |
| 1005 | Ga0373953_0091225 | 3300035117 | Bacteria | 1275 |
| 1006 | Ga0373954_0023325 | 3300035118 | Bacteria | 2813 |
| 1007 | Ga0373956_0264297 | 3300035119 | Bacteria | 818 |
| 1008 | Ga0373956_0525352 | 3300035119 | Bacteria | 565 |
| 1009 | Ga0373957_0010245 | 3300035120 | Bacteria | 3092 |
| 1010 | Ga0373957_0134599 | 3300035120 | Bacteria | 1008 |
| 1011 | Ga0373957_0152183 | 3300035120 | Bacteria | 950 |
| 1012 | Ga0373960_0125435 | 3300035121 | Bacteria | 856 |
| 1013 | Ga0373943_0004020 | 3300035170 | Bacteria | 6689 |
| 1014 | Ga0373943_0416805 | 3300035170 | Bacteria | 777 |
| 1015 | Ga0373943_0761783 | 3300035170 | Bacteria | 575 |
| 1016 | Ga0373946_0028376 | 3300035171 | Bacteria | 2219 |
| 1017 | Ga0373955_0106446 | 3300035172 | Bacteria | 1617 |
| 1018 | Ga0373955_0575158 | 3300035172 | Bacteria | 689 |
| 1019 | Ga0373942_0006705 | 3300035207 | Bacteria | 2660 |
| 1020 | Ga0373942_0276851 | 3300035207 | Bacteria | 577 |
| 1021 | Ga0373961_0032995 | 3300035241 | Bacteria | 1456 |
| 1022 | Ga0373961_0197210 | 3300035241 | Bacteria | 708 |
| 1023 | Ga0373962_0057119 | 3300035242 | Bacteria | 1138 |
| 1024 | Ga0373962_0083237 | 3300035242 | Bacteria | 975 |
| 1025 | Ga0373962_0148661 | 3300035242 | Bacteria | 766 |
| 1026 | Ga0316574_0071591 | 3300035398 | Bacteria | 2190 |
| 1027 | Ga0316574_0098761 | 3300035398 | Bacteria | 1867 |
| 1028 | Ga0316574_0172997 | 3300035398 | Bacteria | 1390 |
| 1029 | Ga0316574_0224946 | 3300035398 | Bacteria | 1202 |
| 1030 | Ga0316574_0232470 | 3300035398 | Bacteria | 1179 |
| 1031 | Ga0316574_0392708 | 3300035398 | Bacteria | 874 |
| 1032 | Ga0316574_0427029 | 3300035398 | Bacteria | 832 |
| 1033 | Ga0373924_0037789 | 3300035410 | Bacteria | 1967 |
| 1034 | Ga0373924_0231086 | 3300035410 | Bacteria | 818 |
| 1035 | Ga0373931_0029997 | 3300035691 | Bacteria | 2797 |
| 1036 | Ga0373931_0116969 | 3300035691 | Bacteria | 1519 |
| 1037 | Ga0373931_0126812 | 3300035691 | Bacteria | 1465 |
| 1038 | Ga0373931_1135771 | 3300035691 | Bacteria | 533 |
| 1039 | Ga0373935_0012638 | 3300035692 | Bacteria | 5079 |
| 1040 | Ga0373927_0308574 | 3300035695 | Bacteria | 1041 |
| 1041 | Ga0373933_0181960 | 3300035724 | Bacteria | 1341 |
| 1042 | Ga0373933_0412599 | 3300035724 | Bacteria | 882 |
| 1043 | Ga0373947_0015474 | 3300035725 | Bacteria | 4380 |
| 1044 | Ga0373947_0101636 | 3300035725 | Bacteria | 1808 |
| 1045 | Ga0373947_0245579 | 3300035725 | Bacteria | 1182 |
| 1046 | Ga0373937_0278938 | 3300036401 | Bacteria | 1578 |
| 1047 | Ga0373937_0445807 | 3300036401 | Bacteria | 1229 |
| 1048 | Ga0373937_0516876 | 3300036401 | Bacteria | 1134 |
| 1049 | Ga0373937_0708534 | 3300036401 | Bacteria | 953 |
| 1050 | Ga0373937_0744223 | 3300036401 | Bacteria | 928 |
| 1051 | Ga0265778_022895 | 3300036457 | Bacteria | 780 |
| 1052 | Ga0316582_0016976 | 3300036647 | Bacteria | 4199 |
| 1053 | Ga0316582_0019246 | 3300036647 | Bacteria | 3992 |
| 1054 | Ga0316582_0180659 | 3300036647 | Bacteria | 1435 |
| 1055 | Ga0316582_0240395 | 3300036647 | Bacteria | 1240 |
| 1056 | Ga0316582_0435598 | 3300036647 | Bacteria | 903 |
| 1057 | Ga0316582_0493860 | 3300036647 | Bacteria | 843 |
| 1058 | Ga0316582_0790219 | 3300036647 | Bacteria | 650 |
| 1059 | Ga0316584_0003848 | 3300036712 | Bacteria | 9841 |
| 1060 | Ga0316584_0008456 | 3300036712 | Bacteria | 7094 |
| 1061 | Ga0316584_0032481 | 3300036712 | Bacteria | 3864 |
| 1062 | Ga0316584_0122179 | 3300036712 | Bacteria | 1946 |
| 1063 | Ga0316584_0225132 | 3300036712 | Bacteria | 1376 |
| 1064 | Ga0316584_0229218 | 3300036712 | Bacteria | 1362 |
| 1065 | Ga0316584_0278001 | 3300036712 | Bacteria | 1217 |
| 1066 | Ga0316584_0359630 | 3300036712 | Bacteria | 1044 |
| 1067 | Ga0316584_0361671 | 3300036712 | Bacteria | 1040 |
| 1068 | Ga0316584_0863698 | 3300036712 | Bacteria | 611 |
| 1069 | Ga0373925_0013236 | 3300037068 | Bacteria | 5970 |
| 1070 | Ga0373925_1026623 | 3300037068 | Bacteria | 679 |
| 1071 | Ga0395899_0166028 | 3300037312 | Bacteria | 1557 |
| 1072 | Ga0395900_0061899 | 3300037418 | Bacteria | 3847 |
| 1073 | Ga0395900_0078136 | 3300037418 | Bacteria | 3401 |
| 1074 | Ga0395900_0103562 | 3300037418 | Bacteria | 2923 |
| 1075 | Ga0395900_0113402 | 3300037418 | Bacteria | 2782 |
| 1076 | Ga0395898_0000381 | 3300037466 | Bacteria | 97274 |
| 1077 | Ga0395898_0240350 | 3300037466 | Bacteria | 1727 |
| 1078 | Ga0395905_0518375 | 3300037471 | Bacteria | 1093 |
| 1079 | Ga0395905_0822163 | 3300037471 | Bacteria | 832 |
| 1080 | Ga0316581_0002334 | 3300037588 | Bacteria | 4514 |
| 1081 | Ga0316581_0030105 | 3300037588 | Bacteria | 1632 |
| 1082 | Ga0316581_0060460 | 3300037588 | Bacteria | 1162 |
| 1083 | Ga0395901_0150442 | 3300038443 | Bacteria | 2446 |
| 1084 | Ga0395901_0172994 | 3300038443 | Bacteria | 2266 |
| 1085 | Ga0395901_0233292 | 3300038443 | Bacteria | 1921 |
| 1086 | Ga0395901_0492651 | 3300038443 | Bacteria | 1249 |
| 1087 | Ga0242420_122642 | 3300038996 | Bacteria | 568 |
| 1088 | Ga0242420_165300 | 3300038996 | Bacteria | 503 |
| 1089 | Ga0400489_12849 | 3300039093 | Bacteria | 1605 |
| 1090 | Ga0436365_0144673 | 3300039437 | Bacteria | 1603 |
| 1091 | Ga0436365_1046517 | 3300039437 | Bacteria | 847 |
| 1092 | Ga0436361_0793921 | 3300039447 | Bacteria | 537 |
| 1093 | Ga0436363_0126624 | 3300039450 | Bacteria | 569 |
| 1094 | Ga0436362_0739222 | 3300039453 | Bacteria | 621 |
| 1095 | Ga0439465_0020112 | 3300041413 | Bacteria | 2089 |
| 1096 | Ga0451789_0724155 | 3300041443 | Bacteria | 657 |
| 1097 | Ga0451793_1457874 | 3300041452 | Bacteria | 1382 |
| 1098 | Ga0451798_0847145 | 3300041458 | Bacteria | 1307 |
| 1099 | Ga0451805_017166 | 3300041461 | Bacteria | 776 |
| 1100 | Ga0451807_2770562 | 3300041486 | Bacteria | 703 |
| 1101 | Ga0451833_0697339 | 3300041491 | Bacteria | 628 |
| 1102 | Ga0451839_1230110 | 3300041496 | Bacteria | 1062 |
| 1103 | Ga0451845_0305454 | 3300041501 | Bacteria | 515 |
| 1104 | Ga0451845_0608312 | 3300041501 | Bacteria | 794 |
| 1105 | Ga0451849_0000801 | 3300041505 | Bacteria | 675 |
| 1106 | Ga0451851_0422564 | 3300041507 | Bacteria | 644 |
| 1107 | Ga0451843_0725649 | 3300041509 | Bacteria | 545 |
| 1108 | Ga0451855_1617624 | 3300041511 | Bacteria | 869 |
| 1109 | Ga0451853_0600829 | 3300041512 | Bacteria | 775 |
| 1110 | Ga0451853_1418465 | 3300041512 | Bacteria | 1213 |
| 1111 | Ga0439448_0011384 | 3300042005 | Bacteria | 2651 |
| 1112 | Ga0439448_0202695 | 3300042005 | Bacteria | 696 |
| 1113 | Ga0439450_122795 | 3300042008 | Bacteria | 670 |
| 1114 | Ga0439450_227377 | 3300042008 | Bacteria | 503 |
| 1115 | Ga0439455_0104539 | 3300042012 | Bacteria | 784 |
| 1116 | Ga0439456_043915 | 3300042013 | Bacteria | 972 |
| 1117 | Ga0450920_007738 | 3300042122 | Bacteria | 1950 |
| 1118 | Ga0450923_014865 | 3300042125 | Bacteria | 1448 |
| 1119 | Ga0450906_008981 | 3300042145 | Bacteria | 1918 |
| 1120 | Ga0450907_037255 | 3300042146 | Bacteria | 831 |
| 1121 | Ga0439458_0148677 | 3300042157 | Bacteria | 627 |
| 1122 | Ga0439434_0060393 | 3300042435 | Bacteria | 1184 |
| 1123 | Ga0439435_0070056 | 3300042436 | Bacteria | 1037 |
| 1124 | Ga0439444_0050696 | 3300042437 | Bacteria | 843 |
| 1125 | Ga0439464_0165014 | 3300042439 | Bacteria | 697 |
| 1126 | Ga0439460_0311138 | 3300042461 | Bacteria | 551 |
| 1127 | Ga0450916_022216 | 3300042530 | Bacteria | 878 |
| 1128 | Ga0450918_013050 | 3300042531 | Bacteria | 1445 |
| 1129 | Ga0451577_0016881 | 3300042876 | Bacteria | 6752 |
| 1130 | Ga0451577_0117036 | 3300042876 | Bacteria | 2387 |
| 1131 | Ga0451577_0143807 | 3300042876 | Bacteria | 2144 |
| 1132 | Ga0451577_0276905 | 3300042876 | Bacteria | 1520 |
| 1133 | Ga0451577_0314814 | 3300042876 | Bacteria | 1419 |
| 1134 | Ga0439440_0115149 | 3300042993 | Bacteria | 743 |
| 1135 | Ga0466969_0103990 | 3300044656 | Bacteria | 1334 |
| 1136 | Ga0466972_0005615 | 3300044658 | Bacteria | 6284 |
| 1137 | Ga0466972_0234463 | 3300044658 | Bacteria | 858 |
| 1138 | Ga0453683_0036050 | 3300044673 | Bacteria | 3114 |
| 1139 | Ga0453683_0154124 | 3300044673 | Bacteria | 1452 |
| 1140 | Ga0453683_0466537 | 3300044673 | Bacteria | 818 |
| 1141 | Ga0466965_0006167 | 3300044683 | Bacteria | 5423 |
| 1142 | Ga0466965_0014387 | 3300044683 | Bacteria | 3743 |
| 1143 | Ga0466965_0107260 | 3300044683 | Bacteria | 1433 |
| 1144 | Ga0466966_0010977 | 3300044684 | Bacteria | 6011 |
| 1145 | Ga0466961_0087743 | 3300044693 | Bacteria | 1965 |
| 1146 | Ga0466961_0201841 | 3300044693 | Bacteria | 1229 |
| 1147 | Ga0466961_0204689 | 3300044693 | Bacteria | 1220 |
| 1148 | Ga0466963_0083412 | 3300044694 | Bacteria | 2168 |
| 1149 | Ga0466963_1016940 | 3300044694 | Bacteria | 583 |
| 1150 | Ga0466964_0180154 | 3300044706 | Bacteria | 1001 |
| 1151 | Ga0466964_0224970 | 3300044706 | Bacteria | 913 |
| 1152 | Ga0453684_0060759 | 3300044712 | Bacteria | 4857 |
| 1153 | Ga0453684_0088810 | 3300044712 | Bacteria | 3826 |
| 1154 | Ga0453684_0456657 | 3300044712 | Bacteria | 1421 |
| 1155 | Ga0453684_0491965 | 3300044712 | Bacteria | 1359 |
| 1156 | Ga0453684_0526506 | 3300044712 | Bacteria | 1305 |
| 1157 | Ga0453684_0627939 | 3300044712 | Bacteria | 1174 |
| 1158 | Ga0453684_1134237 | 3300044712 | Bacteria | 824 |
| 1159 | Ga0453684_2424098 | 3300044712 | Bacteria | 519 |
| 1160 | Ga0466971_0059038 | 3300044719 | Bacteria | 1732 |
| 1161 | Ga0466971_0183400 | 3300044719 | Bacteria | 984 |
| 1162 | Ga0466971_0608400 | 3300044719 | Bacteria | 545 |
| 1163 | Ga0466968_0354300 | 3300044735 | Bacteria | 713 |
| 1164 | Ga0466968_0381720 | 3300044735 | Bacteria | 688 |
| 1165 | Ga0466968_0491539 | 3300044735 | Bacteria | 610 |
| 1166 | Ga0466970_0033983 | 3300044765 | Bacteria | 2697 |
| 1167 | Ga0466970_0072211 | 3300044765 | Bacteria | 1856 |
| 1168 | Ga0466957_0038195 | 3300044842 | Bacteria | 2892 |
| 1169 | Ga0466957_0052384 | 3300044842 | Bacteria | 2485 |
| 1170 | Ga0466957_0070960 | 3300044842 | Bacteria | 2153 |
| 1171 | Ga0466957_0196793 | 3300044842 | Bacteria | 1322 |
| 1172 | Ga0466957_0224728 | 3300044842 | Bacteria | 1241 |
| 1173 | Ga0466957_0247951 | 3300044842 | Bacteria | 1183 |
| 1174 | Ga0466960_0019581 | 3300044901 | Bacteria | 2985 |
| 1175 | Ga0466960_0057834 | 3300044901 | Bacteria | 1892 |
| 1176 | Ga0466960_0059399 | 3300044901 | Bacteria | 1870 |
| 1177 | Ga0466959_0004261 | 3300045049 | Bacteria | 9543 |
| 1178 | Ga0466959_0039513 | 3300045049 | Bacteria | 3486 |
| 1179 | Ga0451576_0034109 | 3300045051 | Bacteria | 5406 |
| 1180 | Ga0451576_0185581 | 3300045051 | Bacteria | 2172 |
| 1181 | Ga0466958_0002151 | 3300045836 | Bacteria | 9809 |
| 1182 | Ga0466958_0018252 | 3300045836 | Bacteria | 4068 |
| 1183 | Ga0466958_0031221 | 3300045836 | Bacteria | 3166 |
| 1184 | Ga0466958_0087216 | 3300045836 | Bacteria | 1927 |
| 1185 | Ga0466958_0399398 | 3300045836 | Bacteria | 887 |
| 1186 | Ga0466967_0266913 | 3300045976 | Bacteria | 1639 |
| 1187 | Ga0466967_0903807 | 3300045976 | Bacteria | 878 |
| 1188 | Ga0466967_1299685 | 3300045976 | Bacteria | 724 |
| 1189 | Ga0466967_2311786 | 3300045976 | Bacteria | 533 |
| 1190 | Ga0495592_0065934 | 3300046454 | Bacteria | 2650 |
| 1191 | Ga0495592_0233423 | 3300046454 | Bacteria | 1224 |
| 1192 | Ga0495592_0286511 | 3300046454 | Bacteria | 1075 |
| 1193 | Ga0495592_0685808 | 3300046454 | Bacteria | 617 |
| 1194 | Ga0495603_0009479 | 3300046455 | Bacteria | 5882 |
| 1195 | Ga0495603_0097528 | 3300046455 | Bacteria | 1716 |
| 1196 | Ga0495603_0191092 | 3300046455 | Bacteria | 1184 |
| 1197 | Ga0495629_0124017 | 3300046459 | Bacteria | 1799 |
| 1198 | Ga0495629_0161553 | 3300046459 | Bacteria | 1556 |
| 1199 | Ga0495641_0006189 | 3300046461 | Bacteria | 7821 |
| 1200 | Ga0495641_0055802 | 3300046461 | Bacteria | 1792 |
| 1201 | Ga0495641_0060859 | 3300046461 | Bacteria | 1705 |
| 1202 | Ga0495651_0041297 | 3300046462 | Bacteria | 3583 |
| 1203 | Ga0495653_0011794 | 3300046463 | Bacteria | 7137 |
| 1204 | Ga0495653_0025679 | 3300046463 | Bacteria | 4729 |
| 1205 | Ga0495653_0308089 | 3300046463 | Bacteria | 1031 |
| 1206 | Ga0495650_0040933 | 3300046471 | Bacteria | 1985 |
| 1207 | Ga0495650_0048271 | 3300046471 | Bacteria | 1775 |
| 1208 | Ga0495650_0111255 | 3300046471 | Bacteria | 1017 |
| 1209 | Ga0495580_0120527 | 3300046472 | Bacteria | 1821 |
| 1210 | Ga0495582_0031758 | 3300046473 | Bacteria | 2903 |
| 1211 | Ga0495582_0080740 | 3300046473 | Bacteria | 1806 |
| 1212 | Ga0495582_0233016 | 3300046473 | Bacteria | 1054 |
| 1213 | Ga0495639_0172417 | 3300046475 | Bacteria | 1050 |
| 1214 | Ga0495639_0373464 | 3300046475 | Bacteria | 718 |
| 1215 | Ga0495662_0019242 | 3300046476 | Bacteria | 3302 |
| 1216 | Ga0495662_0180519 | 3300046476 | Bacteria | 1040 |
| 1217 | Ga0495664_0145839 | 3300046477 | Bacteria | 1435 |
| 1218 | Ga0495664_0226434 | 3300046477 | Bacteria | 1132 |
| 1219 | Ga0495664_0949774 | 3300046477 | Bacteria | 502 |
| 1220 | Ga0495584_0228811 | 3300046491 | Bacteria | 945 |
| 1221 | Ga0495584_0337063 | 3300046491 | Bacteria | 766 |
| 1222 | Ga0495584_0385238 | 3300046491 | Bacteria | 712 |
| 1223 | Ga0495594_0367075 | 3300046499 | Bacteria | 819 |
| 1224 | Ga0495594_0423396 | 3300046499 | Bacteria | 757 |
| 1225 | Ga0495596_0087503 | 3300046500 | Bacteria | 1209 |
| 1226 | Ga0495606_0259492 | 3300046507 | Bacteria | 960 |
| 1227 | Ga0495608_0060429 | 3300046511 | Bacteria | 2493 |
| 1228 | Ga0495608_0127238 | 3300046511 | Bacteria | 1632 |
| 1229 | Ga0495616_0228237 | 3300046513 | Bacteria | 808 |
| 1230 | Ga0495618_0029382 | 3300046514 | Bacteria | 3430 |
| 1231 | Ga0495618_0060714 | 3300046514 | Bacteria | 2397 |
| 1232 | Ga0495618_0238478 | 3300046514 | Bacteria | 1144 |
| 1233 | Ga0495620_0263375 | 3300046515 | Bacteria | 657 |
| 1234 | Ga0495628_0043996 | 3300046516 | Bacteria | 3554 |
| 1235 | Ga0495628_0867295 | 3300046516 | Bacteria | 628 |
| 1236 | Ga0495630_0035741 | 3300046517 | Bacteria | 3712 |
| 1237 | Ga0495630_0170906 | 3300046517 | Bacteria | 1656 |
| 1238 | Ga0495637_0254397 | 3300046520 | Bacteria | 632 |
| 1239 | Ga0495644_0187506 | 3300046523 | Bacteria | 796 |
| 1240 | Ga0495648_0033982 | 3300046524 | Bacteria | 3325 |
| 1241 | Ga0495663_0125873 | 3300046525 | Bacteria | 861 |
| 1242 | Ga0495663_0224886 | 3300046525 | Bacteria | 661 |
| 1243 | Ga0495666_0031409 | 3300046526 | Bacteria | 2602 |
| 1244 | Ga0495666_0545796 | 3300046526 | Bacteria | 517 |
| 1245 | Ga0495652_0127724 | 3300046529 | Bacteria | 2017 |
| 1246 | Ga0495652_0333093 | 3300046529 | Bacteria | 1093 |
| 1247 | Ga0495652_0787729 | 3300046529 | Bacteria | 634 |
| 1248 | Ga0495652_1016440 | 3300046529 | Bacteria | 542 |
| 1249 | Ga0495665_0018361 | 3300046531 | Bacteria | 3758 |
| 1250 | Ga0495640_0021538 | 3300046533 | Bacteria | 4729 |
| 1251 | Ga0495640_0302808 | 3300046533 | Bacteria | 992 |
| 1252 | Ga0495587_0223807 | 3300046536 | Bacteria | 1061 |
| 1253 | Ga0495598_0165374 | 3300046537 | Bacteria | 781 |
| 1254 | Ga0495609_0151753 | 3300046538 | Bacteria | 985 |
| 1255 | Ga0495645_0071267 | 3300046543 | Bacteria | 2506 |
| 1256 | Ga0495645_0316647 | 3300046543 | Bacteria | 1014 |
| 1257 | Ga0495645_0495045 | 3300046543 | Bacteria | 765 |
| 1258 | Ga0495667_0077476 | 3300046559 | Bacteria | 2162 |
| 1259 | Ga0495667_0516058 | 3300046559 | Bacteria | 748 |
| 1260 | Ga0495656_0019032 | 3300046615 | Bacteria | 2645 |
| 1261 | Ga0495656_0410222 | 3300046615 | Bacteria | 710 |
| 1262 | Ga0495634_0008932 | 3300046642 | Bacteria | 7419 |
| 1263 | Ga0495634_0132568 | 3300046642 | Bacteria | 1587 |
| 1264 | Ga0495635_0063284 | 3300046663 | Bacteria | 2540 |
| 1265 | Ga0495635_0206729 | 3300046663 | Bacteria | 1330 |
| 1266 | Ga0495635_0788357 | 3300046663 | Bacteria | 613 |
| 1267 | Ga0495588_0006175 | 3300046674 | Bacteria | 5381 |
| 1268 | Ga0495657_0003110 | 3300046675 | Bacteria | 13700 |
| 1269 | Ga0495599_0151254 | 3300046678 | Bacteria | 1437 |
| 1270 | Ga0495599_0735957 | 3300046678 | Bacteria | 567 |
| 1271 | Ga0495623_0296175 | 3300046679 | Bacteria | 895 |
| 1272 | Ga0495646_0093243 | 3300046680 | Bacteria | 1735 |
| 1273 | Ga0495646_0168405 | 3300046680 | Bacteria | 1209 |
| 1274 | Ga0495647_0003870 | 3300046681 | Bacteria | 4826 |
| 1275 | Ga0495647_0004692 | 3300046681 | Bacteria | 4456 |
| 1276 | Ga0495647_0432965 | 3300046681 | Bacteria | 607 |
| 1277 | Ga0495647_0507820 | 3300046681 | Bacteria | 561 |
| 1278 | Ga0495658_0064282 | 3300046683 | Bacteria | 2113 |
| 1279 | Ga0495658_0070216 | 3300046683 | Bacteria | 2032 |
| 1280 | Ga0495658_0081948 | 3300046683 | Bacteria | 1895 |
| 1281 | Ga0495658_0133954 | 3300046683 | Bacteria | 1511 |
| 1282 | Ga0495658_0692567 | 3300046683 | Bacteria | 653 |
| 1283 | Ga0495669_0117319 | 3300046684 | Bacteria | 1246 |
| 1284 | Ga0495613_0026405 | 3300046689 | Bacteria | 4326 |
| 1285 | Ga0495613_0030825 | 3300046689 | Bacteria | 3984 |
| 1286 | Ga0495613_0306163 | 3300046689 | Bacteria | 1099 |
| 1287 | Ga0495624_0156737 | 3300046690 | Bacteria | 1391 |
| 1288 | Ga0495624_0440497 | 3300046690 | Bacteria | 781 |
| 1289 | Ga0495589_0031760 | 3300046794 | Bacteria | 2658 |
| 1290 | Ga0495600_0003596 | 3300046809 | Bacteria | 9135 |
| 1291 | Ga0495600_0183782 | 3300046809 | Bacteria | 1347 |
| 1292 | Ga0495581_0004186 | 3300047315 | Bacteria | 8314 |
| 1293 | Ga0495581_0217471 | 3300047315 | Bacteria | 1117 |
| 1294 | Ga0495604_0016907 | 3300047317 | Bacteria | 5832 |
| 1295 | Ga0495604_0288647 | 3300047317 | Bacteria | 1106 |
| 1296 | Ga0495604_0337907 | 3300047317 | Bacteria | 1003 |
| 1297 | Ga0495674_0012859 | 3300047319 | Bacteria | 7883 |
| 1298 | Ga0495674_0023760 | 3300047319 | Bacteria | 5644 |
| 1299 | Ga0495674_0238423 | 3300047319 | Bacteria | 1499 |
| 1300 | Ga0495672_0004778 | 3300047320 | Bacteria | 10928 |
| 1301 | Ga0495676_0251165 | 3300047321 | Bacteria | 1206 |
| 1302 | Ga0495676_0435511 | 3300047321 | Bacteria | 866 |
| 1303 | Ga0495676_0474316 | 3300047321 | Bacteria | 823 |
| 1304 | Ga0495680_0018449 | 3300047322 | Bacteria | 5924 |
| 1305 | Ga0495680_0074503 | 3300047322 | Bacteria | 2578 |
| 1306 | Ga0495680_0281901 | 3300047322 | Bacteria | 1171 |
| 1307 | Ga0495680_0445908 | 3300047322 | Bacteria | 886 |
| 1308 | Ga0495675_0035654 | 3300047444 | Bacteria | 3176 |
| 1309 | Ga0495677_0172211 | 3300047445 | Bacteria | 838 |
| 1310 | Ga0495684_0014399 | 3300047471 | Bacteria | 6085 |
| 1311 | Ga0495684_0014428 | 3300047471 | Bacteria | 6079 |
| 1312 | Ga0495686_0155677 | 3300047472 | Bacteria | 1339 |
| 1313 | Ga0495593_0010386 | 3300047673 | Bacteria | 5382 |
| 1314 | Ga0495593_0499110 | 3300047673 | Bacteria | 610 |
| 1315 | Ga0495602_0048098 | 3300048088 | Bacteria | 3837 |
| 1316 | Ga0495602_0598083 | 3300048088 | Bacteria | 759 |
| 1317 | Ga0495614_0002806 | 3300048089 | Bacteria | 7750 |
| 1318 | Ga0496100_0020442 | 3300048903 | Bacteria | 3969 |
| 1319 | Ga0496100_0037424 | 3300048903 | Bacteria | 3067 |
| 1320 | Ga0496100_0046263 | 3300048903 | Bacteria | 2797 |
| 1321 | Ga0496100_0129847 | 3300048903 | Bacteria | 1773 |
| 1322 | Ga0496100_0156060 | 3300048903 | Bacteria | 1632 |
| 1323 | Ga0496100_0263667 | 3300048903 | Bacteria | 1278 |
| 1324 | Ga0496100_0275060 | 3300048903 | Bacteria | 1253 |
| 1325 | Ga0496100_0532940 | 3300048903 | Bacteria | 907 |
| 1326 | Ga0496100_0798570 | 3300048903 | Bacteria | 739 |
| 1327 | Ga0496101_0029830 | 3300048904 | Bacteria | 3816 |
| 1328 | Ga0496101_0064090 | 3300048904 | Bacteria | 2676 |
| 1329 | Ga0496101_0156944 | 3300048904 | Bacteria | 1743 |
| 1330 | Ga0496101_0331525 | 3300048904 | Bacteria | 1194 |
| 1331 | Ga0496101_0415467 | 3300048904 | Bacteria | 1060 |
| 1332 | Ga0496101_0475184 | 3300048904 | Bacteria | 987 |
| 1333 | Ga0496101_1526072 | 3300048904 | Bacteria | 520 |
| 1334 | Ga0496102_0008426 | 3300048905 | Bacteria | 8836 |
| 1335 | Ga0496102_0039336 | 3300048905 | Bacteria | 4273 |
| 1336 | Ga0496102_0256404 | 3300048905 | Bacteria | 1649 |
| 1337 | Ga0496102_0355090 | 3300048905 | Bacteria | 1380 |
| 1338 | Ga0496102_0520129 | 3300048905 | Bacteria | 1112 |
| 1339 | Ga0496102_0596746 | 3300048905 | Bacteria | 1027 |
| 1340 | Ga0496102_0782946 | 3300048905 | Bacteria | 876 |
| 1341 | Ga0496102_0816894 | 3300048905 | Bacteria | 854 |
| 1342 | Ga0496102_1254518 | 3300048905 | Bacteria | 660 |
| 1343 | Ga0496103_0019667 | 3300048906 | Bacteria | 4053 |
| 1344 | Ga0496103_0039276 | 3300048906 | Bacteria | 2908 |
| 1345 | Ga0496103_0185811 | 3300048906 | Bacteria | 1336 |
| 1346 | Ga0496103_0377231 | 3300048906 | Bacteria | 911 |
| 1347 | Ga0496103_0458330 | 3300048906 | Bacteria | 817 |
| 1348 | Ga0496103_0663379 | 3300048906 | Bacteria | 662 |
| 1349 | Ga0496104_0008605 | 3300048907 | Bacteria | 9075 |
| 1350 | Ga0496104_0045348 | 3300048907 | Bacteria | 4134 |
| 1351 | Ga0496104_0054378 | 3300048907 | Bacteria | 3783 |
| 1352 | Ga0496104_0106807 | 3300048907 | Bacteria | 2683 |
| 1353 | Ga0496104_0136994 | 3300048907 | Bacteria | 2352 |
| 1354 | Ga0496104_0181317 | 3300048907 | Bacteria | 2016 |
| 1355 | Ga0496104_0958994 | 3300048907 | Bacteria | 760 |
| 1356 | Ga0496105_0034806 | 3300048908 | Bacteria | 4144 |
| 1357 | Ga0496105_0036308 | 3300048908 | Bacteria | 4059 |
| 1358 | Ga0496105_0054080 | 3300048908 | Bacteria | 3316 |
| 1359 | Ga0496105_0069692 | 3300048908 | Bacteria | 2906 |
| 1360 | Ga0496105_0070961 | 3300048908 | Bacteria | 2879 |
| 1361 | Ga0496105_0115593 | 3300048908 | Bacteria | 2213 |
| 1362 | Ga0496105_0204619 | 3300048908 | Bacteria | 1610 |
| 1363 | Ga0496105_0839121 | 3300048908 | Bacteria | 696 |
| 1364 | Ga0496105_1279356 | 3300048908 | Bacteria | 536 |
| 1365 | Ga0496106_0019758 | 3300048909 | Bacteria | 4995 |
| 1366 | Ga0496106_0077650 | 3300048909 | Bacteria | 2546 |
| 1367 | Ga0496106_0169102 | 3300048909 | Bacteria | 1732 |
| 1368 | Ga0496106_0245166 | 3300048909 | Bacteria | 1432 |
| 1369 | Ga0496106_0284688 | 3300048909 | Bacteria | 1324 |
| 1370 | Ga0496106_0433338 | 3300048909 | Bacteria | 1056 |
| 1371 | Ga0496106_0625231 | 3300048909 | Bacteria | 861 |
| 1372 | Ga0496106_0742049 | 3300048909 | Bacteria | 781 |
| 1373 | Ga0496106_1279327 | 3300048909 | Bacteria | 570 |
| 1374 | Ga0496107_0018477 | 3300048910 | Bacteria | 4909 |
| 1375 | Ga0496107_0023742 | 3300048910 | Bacteria | 4334 |
| 1376 | Ga0496107_0033346 | 3300048910 | Bacteria | 3684 |
| 1377 | Ga0496107_0053046 | 3300048910 | Bacteria | 2925 |
| 1378 | Ga0496107_0140243 | 3300048910 | Bacteria | 1787 |
| 1379 | Ga0496107_0480403 | 3300048910 | Bacteria | 922 |
| 1380 | Ga0496108_0009320 | 3300048911 | Bacteria | 7947 |
| 1381 | Ga0496108_0010462 | 3300048911 | Bacteria | 7536 |
| 1382 | Ga0496108_0277693 | 3300048911 | Bacteria | 1458 |
| 1383 | Ga0496108_0574227 | 3300048911 | Bacteria | 983 |
| 1384 | Ga0496108_0719853 | 3300048911 | Bacteria | 865 |
| 1385 | Ga0496109_0000445 | 3300048912 | Bacteria | 35570 |
| 1386 | Ga0496109_0003257 | 3300048912 | Bacteria | 13535 |
| 1387 | Ga0496109_0082254 | 3300048912 | Bacteria | 2967 |
| 1388 | Ga0496109_0161488 | 3300048912 | Bacteria | 2099 |
| 1389 | Ga0496109_0169101 | 3300048912 | Bacteria | 2050 |
| 1390 | Ga0496109_0190345 | 3300048912 | Bacteria | 1928 |
| 1391 | Ga0496109_0217162 | 3300048912 | Bacteria | 1798 |
| 1392 | Ga0496109_0225976 | 3300048912 | Bacteria | 1760 |
| 1393 | Ga0496109_0775071 | 3300048912 | Bacteria | 897 |
| 1394 | Ga0496109_1874503 | 3300048912 | Bacteria | 532 |
| 1395 | Ga0496110_0000079 | 3300048913 | Bacteria | 50026 |
| 1396 | Ga0496110_0000983 | 3300048913 | Bacteria | 19971 |
| 1397 | Ga0496110_0017812 | 3300048913 | Bacteria | 5945 |
| 1398 | Ga0496110_0032177 | 3300048913 | Bacteria | 4528 |
| 1399 | Ga0496110_0207399 | 3300048913 | Bacteria | 1781 |
| 1400 | Ga0496110_0915272 | 3300048913 | Bacteria | 783 |
| 1401 | Ga0496110_0940903 | 3300048913 | Bacteria | 771 |
| 1402 | Ga0496111_0000557 | 3300048914 | Bacteria | 19378 |
| 1403 | Ga0496111_0001267 | 3300048914 | Bacteria | 14151 |
| 1404 | Ga0496111_0096517 | 3300048914 | Bacteria | 2169 |
| 1405 | Ga0496111_0204837 | 3300048914 | Bacteria | 1466 |
| 1406 | Ga0496111_0647267 | 3300048914 | Bacteria | 771 |
| 1407 | Ga0496111_0954755 | 3300048914 | Bacteria | 616 |
| 1408 | Ga0496112_0000007 | 3300048915 | Bacteria | 338850 |
| 1409 | Ga0496112_0008451 | 3300048915 | Bacteria | 9223 |
| 1410 | Ga0496112_0017728 | 3300048915 | Bacteria | 6701 |
| 1411 | Ga0496112_0055603 | 3300048915 | Bacteria | 3892 |
| 1412 | Ga0496112_0078197 | 3300048915 | Bacteria | 3272 |
| 1413 | Ga0496112_1011175 | 3300048915 | Bacteria | 751 |
| 1414 | Ga0496112_1397289 | 3300048915 | Bacteria | 615 |
| 1415 | Ga0496112_1623170 | 3300048915 | Bacteria | 560 |
| 1416 | Ga0496113_0017092 | 3300048916 | Bacteria | 5029 |
| 1417 | Ga0496113_0020455 | 3300048916 | Bacteria | 4652 |
| 1418 | Ga0496113_0061383 | 3300048916 | Bacteria | 2836 |
| 1419 | Ga0496113_1519630 | 3300048916 | Bacteria | 516 |
| 1420 | Ga0496114_0004840 | 3300048917 | Bacteria | 10491 |
| 1421 | Ga0496114_0006753 | 3300048917 | Bacteria | 9038 |
| 1422 | Ga0496114_0037031 | 3300048917 | Bacteria | 4034 |
| 1423 | Ga0496114_0046560 | 3300048917 | Bacteria | 3604 |
| 1424 | Ga0496114_0056294 | 3300048917 | Bacteria | 3281 |
| 1425 | Ga0496114_0064981 | 3300048917 | Bacteria | 3056 |
| 1426 | Ga0496114_0117309 | 3300048917 | Bacteria | 2286 |
| 1427 | Ga0496114_0241471 | 3300048917 | Bacteria | 1588 |
| 1428 | Ga0496114_0623169 | 3300048917 | Bacteria | 950 |
| 1429 | Ga0496114_1089561 | 3300048917 | Bacteria | 683 |
| 1430 | Ga0496115_0010379 | 3300048918 | Bacteria | 6958 |
| 1431 | Ga0496115_0012343 | 3300048918 | Bacteria | 6424 |
| 1432 | Ga0496115_0027891 | 3300048918 | Bacteria | 4420 |
| 1433 | Ga0496115_0037851 | 3300048918 | Bacteria | 3824 |
| 1434 | Ga0496115_0056073 | 3300048918 | Bacteria | 3166 |
| 1435 | Ga0496115_0073003 | 3300048918 | Bacteria | 2784 |
| 1436 | Ga0496115_0094650 | 3300048918 | Bacteria | 2444 |
| 1437 | Ga0496115_0153982 | 3300048918 | Bacteria | 1899 |
| 1438 | Ga0496115_0173105 | 3300048918 | Bacteria | 1785 |
| 1439 | Ga0496115_0783581 | 3300048918 | Bacteria | 743 |
| 1440 | Ga0496116_0073590 | 3300048919 | Bacteria | 2153 |
| 1441 | Ga0496117_0085314 | 3300048920 | Bacteria | 2056 |
| 1442 | Ga0496117_0294273 | 3300048920 | Bacteria | 863 |
| 1443 | Ga0496118_0005764 | 3300048921 | Bacteria | 13915 |
| 1444 | Ga0496118_0194341 | 3300048921 | Bacteria | 1210 |
| 1445 | Ga0496119_0012846 | 3300048922 | Bacteria | 6753 |
| 1446 | Ga0496120_0033281 | 3300048923 | Bacteria | 3098 |
| 1447 | Ga0496121_0267441 | 3300048924 | Bacteria | 1177 |
| 1448 | Ga0496122_0313017 | 3300048925 | Bacteria | 839 |
| 1449 | Ga0496126_0016860 | 3300048929 | Bacteria | 7291 |
| 1450 | Ga0496126_0023859 | 3300048929 | Bacteria | 5919 |
| 1451 | Ga0496126_0093794 | 3300048929 | Bacteria | 2635 |
| 1452 | Ga0501306_015803 | 3300049127 | Bacteria | 1008 |
| 1453 | Ga0501308_008067 | 3300049128 | Bacteria | 1118 |
| 1454 | Ga0501309_033628 | 3300049129 | Bacteria | 764 |
| 1455 | Ga0501310_007316 | 3300049130 | Bacteria | 1177 |
| 1456 | Ga0501305_018823 | 3300049161 | Bacteria | 1003 |
| 1457 | Ga0501307_059577 | 3300049162 | Bacteria | 590 |
| 1458 | Ga0501317_013459 | 3300049533 | Bacteria | 1023 |
| 1459 | Ga0501031_0205302 | 3300049568 | Bacteria | 1285 |
| 1460 | Ga0501031_0303543 | 3300049568 | Bacteria | 1034 |
| 1461 | Ga0501031_0370991 | 3300049568 | Bacteria | 926 |
| 1462 | Ga0501031_0441178 | 3300049568 | Bacteria | 841 |
| 1463 | Ga0501031_0877668 | 3300049568 | Bacteria | 574 |
| 1464 | Ga0501032_0243871 | 3300049569 | Bacteria | 1167 |
| 1465 | Ga0501032_0267891 | 3300049569 | Bacteria | 1107 |
| 1466 | Ga0501032_0318392 | 3300049569 | Bacteria | 1004 |
| 1467 | Ga0501032_1025586 | 3300049569 | Bacteria | 518 |
| 1468 | Ga0501033_0335291 | 3300049570 | Bacteria | 1061 |
| 1469 | Ga0501033_0450220 | 3300049570 | Bacteria | 894 |
| 1470 | Ga0501033_0780734 | 3300049570 | Bacteria | 647 |
| 1471 | Ga0501034_0012529 | 3300049571 | Bacteria | 8754 |
| 1472 | Ga0501034_0371459 | 3300049571 | Bacteria | 1356 |
| 1473 | Ga0501034_0694229 | 3300049571 | Bacteria | 917 |
| 1474 | Ga0501036_0036626 | 3300049572 | Bacteria | 4152 |
| 1475 | Ga0501036_0084524 | 3300049572 | Bacteria | 2683 |
| 1476 | Ga0501036_0530272 | 3300049572 | Bacteria | 979 |
| 1477 | Ga0501037_0295303 | 3300049573 | Bacteria | 1126 |
| 1478 | Ga0501037_0389098 | 3300049573 | Bacteria | 957 |
| 1479 | Ga0501038_0041796 | 3300049574 | Bacteria | 3997 |
| 1480 | Ga0501039_0007709 | 3300049575 | Bacteria | 8218 |
| 1481 | Ga0501039_0012581 | 3300049575 | Bacteria | 6466 |
| 1482 | Ga0501039_0332426 | 3300049575 | Bacteria | 1194 |
| 1483 | Ga0501039_0947982 | 3300049575 | Bacteria | 669 |
| 1484 | Ga0501039_1363484 | 3300049575 | Bacteria | 546 |
| 1485 | Ga0501040_0004923 | 3300049576 | Bacteria | 8643 |
| 1486 | Ga0501040_0079281 | 3300049576 | Bacteria | 2273 |
| 1487 | Ga0501040_0264550 | 3300049576 | Bacteria | 1227 |
| 1488 | Ga0501040_0334470 | 3300049576 | Bacteria | 1084 |
| 1489 | Ga0501040_0473144 | 3300049576 | Bacteria | 902 |
| 1490 | Ga0501040_0541266 | 3300049576 | Bacteria | 840 |
| 1491 | Ga0501041_0038812 | 3300049577 | Bacteria | 2888 |
| 1492 | Ga0501041_0071912 | 3300049577 | Bacteria | 2124 |
| 1493 | Ga0501041_0222709 | 3300049577 | Bacteria | 1184 |
| 1494 | Ga0501041_0470904 | 3300049577 | Bacteria | 798 |
| 1495 | Ga0501041_0512440 | 3300049577 | Bacteria | 763 |
| 1496 | Ga0501042_0027184 | 3300049578 | Bacteria | 4022 |
| 1497 | Ga0501042_0326457 | 3300049578 | Bacteria | 1109 |
| 1498 | Ga0501042_0514206 | 3300049578 | Bacteria | 870 |
| 1499 | Ga0501042_0612620 | 3300049578 | Bacteria | 792 |
| 1500 | Ga0501043_0022634 | 3300049579 | Bacteria | 4927 |
| 1501 | Ga0501043_0361287 | 3300049579 | Bacteria | 1102 |
| 1502 | Ga0501043_0386469 | 3300049579 | Bacteria | 1059 |
| 1503 | Ga0501046_0134747 | 3300049580 | Bacteria | 1871 |
| 1504 | Ga0501046_0820294 | 3300049580 | Bacteria | 651 |
| 1505 | Ga0501047_0099339 | 3300049581 | Bacteria | 2789 |
| 1506 | Ga0501047_0583711 | 3300049581 | Bacteria | 940 |
| 1507 | Ga0501048_0010287 | 3300049582 | Bacteria | 6994 |
| 1508 | Ga0501048_0132559 | 3300049582 | Bacteria | 1761 |
| 1509 | Ga0501048_0307824 | 3300049582 | Bacteria | 1128 |
| 1510 | Ga0501067_0003078 | 3300049583 | Bacteria | 9202 |
| 1511 | Ga0501067_0042917 | 3300049583 | Bacteria | 2512 |
| 1512 | Ga0501067_0265468 | 3300049583 | Bacteria | 956 |
| 1513 | Ga0501067_0379170 | 3300049583 | Bacteria | 788 |
| 1514 | Ga0501068_0002322 | 3300049584 | Bacteria | 10142 |
| 1515 | Ga0501068_0033823 | 3300049584 | Bacteria | 3046 |
| 1516 | Ga0501068_0400123 | 3300049584 | Bacteria | 885 |
| 1517 | Ga0501068_0441565 | 3300049584 | Bacteria | 841 |
| 1518 | Ga0501069_0000453 | 3300049585 | Bacteria | 18732 |
| 1519 | Ga0501069_0023498 | 3300049585 | Bacteria | 3362 |
| 1520 | Ga0501069_0063145 | 3300049585 | Bacteria | 2068 |
| 1521 | Ga0501069_0120939 | 3300049585 | Bacteria | 1495 |
| 1522 | Ga0501069_0625440 | 3300049585 | Bacteria | 647 |
| 1523 | Ga0501070_0003383 | 3300049586 | Bacteria | 13839 |
| 1524 | Ga0501070_0005689 | 3300049586 | Bacteria | 10626 |
| 1525 | Ga0501070_0078845 | 3300049586 | Bacteria | 2725 |
| 1526 | Ga0501070_0082198 | 3300049586 | Bacteria | 2666 |
| 1527 | Ga0501070_0824638 | 3300049586 | Bacteria | 727 |
| 1528 | Ga0501071_0000119 | 3300049587 | Bacteria | 31338 |
| 1529 | Ga0501071_0001083 | 3300049587 | Bacteria | 15121 |
| 1530 | Ga0501071_0003597 | 3300049587 | Bacteria | 9710 |
| 1531 | Ga0501071_0013395 | 3300049587 | Bacteria | 5587 |
| 1532 | Ga0501071_0035692 | 3300049587 | Bacteria | 3543 |
| 1533 | Ga0501071_0079974 | 3300049587 | Bacteria | 2390 |
| 1534 | Ga0501071_0093200 | 3300049587 | Bacteria | 2215 |
| 1535 | Ga0501071_0186402 | 3300049587 | Bacteria | 1555 |
| 1536 | Ga0501071_0232425 | 3300049587 | Bacteria | 1389 |
| 1537 | Ga0501071_0325563 | 3300049587 | Bacteria | 1167 |
| 1538 | Ga0501071_0594473 | 3300049587 | Bacteria | 851 |
| 1539 | Ga0501071_0649097 | 3300049587 | Bacteria | 812 |
| 1540 | Ga0501072_0003791 | 3300049588 | Bacteria | 11412 |
| 1541 | Ga0501072_0196150 | 3300049588 | Bacteria | 1610 |
| 1542 | Ga0501072_0391552 | 3300049588 | Bacteria | 1102 |
| 1543 | Ga0501072_0838180 | 3300049588 | Bacteria | 719 |
| 1544 | Ga0501073_0050481 | 3300049589 | Bacteria | 2915 |
| 1545 | Ga0501073_0348598 | 3300049589 | Bacteria | 1022 |
| 1546 | Ga0501073_0397229 | 3300049589 | Bacteria | 952 |
| 1547 | Ga0501074_0080636 | 3300049590 | Bacteria | 2334 |
| 1548 | Ga0501074_0201833 | 3300049590 | Bacteria | 1417 |
| 1549 | Ga0501074_0219858 | 3300049590 | Bacteria | 1352 |
| 1550 | Ga0501074_0460017 | 3300049590 | Bacteria | 902 |
| 1551 | Ga0501075_0003018 | 3300049591 | Bacteria | 11243 |
| 1552 | Ga0501075_0017924 | 3300049591 | Bacteria | 5116 |
| 1553 | Ga0501075_0065727 | 3300049591 | Bacteria | 2737 |
| 1554 | Ga0501075_0417306 | 3300049591 | Bacteria | 1023 |
| 1555 | Ga0501075_0724896 | 3300049591 | Bacteria | 757 |
| 1556 | Ga0501076_0011794 | 3300049592 | Bacteria | 6526 |
| 1557 | Ga0501076_0018028 | 3300049592 | Bacteria | 5372 |
| 1558 | Ga0501076_0025886 | 3300049592 | Bacteria | 4542 |
| 1559 | Ga0501076_0235600 | 3300049592 | Bacteria | 1497 |
| 1560 | Ga0501076_0395260 | 3300049592 | Bacteria | 1137 |
| 1561 | Ga0501076_0626588 | 3300049592 | Bacteria | 887 |
| 1562 | Ga0501076_0969926 | 3300049592 | Bacteria | 700 |
| 1563 | Ga0501077_0001393 | 3300049593 | Bacteria | 14562 |
| 1564 | Ga0501077_0013176 | 3300049593 | Bacteria | 5181 |
| 1565 | Ga0501077_0341118 | 3300049593 | Bacteria | 956 |
| 1566 | Ga0501077_0547376 | 3300049593 | Bacteria | 743 |
| 1567 | Ga0501079_0001191 | 3300049741 | Bacteria | 18223 |
| 1568 | Ga0501079_0008393 | 3300049741 | Bacteria | 7829 |
| 1569 | Ga0501079_0294174 | 3300049741 | Bacteria | 1270 |
| 1570 | Ga0501079_0296414 | 3300049741 | Bacteria | 1265 |
| 1571 | Ga0501079_0369740 | 3300049741 | Bacteria | 1124 |
| 1572 | Ga0501079_0721627 | 3300049741 | Bacteria | 784 |
| 1573 | Ga0501080_0058666 | 3300049742 | Bacteria | 3582 |
| 1574 | Ga0501080_0208610 | 3300049742 | Bacteria | 1791 |
| 1575 | Ga0501080_0621568 | 3300049742 | Bacteria | 958 |
| 1576 | Ga0501080_0715172 | 3300049742 | Bacteria | 883 |
| 1577 | Ga0501080_0931016 | 3300049742 | Bacteria | 756 |
| 1578 | Ga0501080_1081449 | 3300049742 | Bacteria | 693 |
| 1579 | Ga0501081_0000266 | 3300049743 | Bacteria | 27345 |
| 1580 | Ga0501081_0016532 | 3300049743 | Bacteria | 4877 |
| 1581 | Ga0501081_0536745 | 3300049743 | Bacteria | 873 |
| 1582 | Ga0501081_1153071 | 3300049743 | Bacteria | 587 |
| 1583 | Ga0501083_0058547 | 3300049744 | Bacteria | 2578 |
| 1584 | Ga0501083_0111389 | 3300049744 | Bacteria | 1799 |
| 1585 | Ga0501083_0539371 | 3300049744 | Bacteria | 759 |
| 1586 | Ga0501083_0655407 | 3300049744 | Bacteria | 683 |
| 1587 | Ga0501083_0761909 | 3300049744 | Bacteria | 630 |
| 1588 | Ga0501035_0834418 | 3300049822 | Bacteria | 734 |
| 1589 | Ga0501044_0553545 | 3300049823 | Bacteria | 1047 |
| 1590 | Ga0501045_0010860 | 3300049824 | Bacteria | 6381 |
| 1591 | Ga0501045_0031322 | 3300049824 | Bacteria | 3852 |
| 1592 | Ga0501045_0159456 | 3300049824 | Bacteria | 1679 |
| 1593 | Ga0501045_0165912 | 3300049824 | Bacteria | 1645 |
| 1594 | Ga0501045_0284278 | 3300049824 | Bacteria | 1231 |
| 1595 | Ga0501045_0918306 | 3300049824 | Bacteria | 643 |
| 1596 | nmdc:mga00v17_41757_c1 | 3300050491 | Bacteria | 2756 |
| 1597 | nmdc:mga0yw44_18369_c1 | 3300050492 | Bacteria | 3828 |
| 1598 | nmdc:mga0yw44_310776_c1 | 3300050492 | Bacteria | 1057 |
| 1599 | nmdc:mga0yw44_47549_c1 | 3300050492 | Bacteria | 2583 |
| 1600 | nmdc:mga06z11_349474_c1 | 3300050494 | Bacteria | 885 |
| 1601 | nmdc:mga07m45_108234_c1 | 3300050496 | Bacteria | 1599 |
| 1602 | nmdc:mga05p37_24103_c1 | 3300050507 | Bacteria | 7391 |
| 1603 | nmdc:mga05p37_33875_c1 | 3300050507 | Bacteria | 6257 |
| 1604 | nmdc:mga05p37_3540_c1 | 3300050507 | Bacteria | 18225 |
| 1605 | nmdc:mga09592_208420_c2 | 3300050508 | Bacteria | 939 |
| 1606 | nmdc:mga09592_51891_c1 | 3300050508 | Bacteria | 3460 |
| 1607 | nmdc:mga0qj67_418401_c1 | 3300050509 | Bacteria | 1080 |
| 1608 | nmdc:mga06r32_134251_c1 | 3300050510 | Bacteria | 2449 |
| 1609 | nmdc:mga08y16_1246015_c1 | 3300050511 | Bacteria | 713 |
| 1610 | nmdc:mga08y16_266255_c1 | 3300050511 | Bacteria | 1769 |
| 1611 | nmdc:mga08y16_433649_c1 | 3300050511 | Bacteria | 1342 |
| 1612 | nmdc:mga08y16_82947_c1 | 3300050511 | Bacteria | 3342 |
| 1613 | nmdc:mga0n895_1104575_c1 | 3300050512 | Bacteria | 770 |
| 1614 | nmdc:mga0n895_21002_c1 | 3300050512 | Bacteria | 6100 |
| 1615 | nmdc:mga0n895_279161_c1 | 3300050512 | Bacteria | 1694 |
| 1616 | nmdc:mga0n895_363286_c1 | 3300050512 | Bacteria | 1466 |
| 1617 | nmdc:mga0n895_479689_c1 | 3300050512 | Bacteria | 1254 |
| 1618 | nmdc:mga0n895_489885_c1 | 3300050512 | Bacteria | 1239 |
| 1619 | nmdc:mga0n895_56580_c1 | 3300050512 | Bacteria | 3864 |
| 1620 | nmdc:mga0n895_719278_c1 | 3300050512 | Bacteria | 993 |
| 1621 | nmdc:mga0rr50_179533_c1 | 3300050513 | Bacteria | 1730 |
| 1622 | nmdc:mga0rr50_199265_c1 | 3300050513 | Bacteria | 1644 |
| 1623 | nmdc:mga0rr50_368092_c1 | 3300050513 | Bacteria | 1211 |
| 1624 | nmdc:mga0rr50_67644_c1 | 3300050513 | Bacteria | 2714 |
| 1625 | nmdc:mga08x19_338891_c1 | 3300050514 | Bacteria | 1048 |
| 1626 | nmdc:mga08x19_367925_c1 | 3300050514 | Bacteria | 1005 |
| 1627 | nmdc:mga08x19_425770_c1 | 3300050514 | Bacteria | 933 |
| 1628 | nmdc:mga0a205_1468245_c1 | 3300050515 | Bacteria | 530 |
| 1629 | nmdc:mga0a205_2010_c1 | 3300050515 | Bacteria | 17745 |
| 1630 | nmdc:mga0a205_252371_c1 | 3300050515 | Bacteria | 1643 |
| 1631 | nmdc:mga0a205_25674_c1 | 3300050515 | Bacteria | 5615 |
| 1632 | nmdc:mga0a205_271456_c1 | 3300050515 | Bacteria | 1573 |
| 1633 | nmdc:mga0a205_327973_c1 | 3300050515 | Bacteria | 1401 |
| 1634 | Ga0495601_0016271 | 3300053077 | Bacteria | 4506 |
| 1635 | Ga0495601_0045561 | 3300053077 | Bacteria | 2758 |
| 1636 | Ga0495601_0050354 | 3300053077 | Bacteria | 2627 |
| 1637 | Ga0495601_0073549 | 3300053077 | Bacteria | 2185 |
| 1638 | Ga0495601_0157372 | 3300053077 | Bacteria | 1484 |
| 1639 | Ga0495601_0459998 | 3300053077 | Bacteria | 822 |
| 1640 | Ga0495601_0598805 | 3300053077 | Bacteria | 707 |
| 1641 | Ga0495612_0109786 | 3300053078 | Bacteria | 1179 |
| 1642 | Ga0495612_0125030 | 3300053078 | Bacteria | 1108 |
| 1643 | Ga0500635_0000204 | 3300053080 | Bacteria | 29368 |
| 1644 | Ga0495655_0079213 | 3300053083 | Bacteria | 936 |
| 1645 | Ga0495595_0046669 | 3300053084 | Bacteria | 1996 |
| 1646 | Ga0495595_0088470 | 3300053084 | Bacteria | 1483 |
| 1647 | Ga0495619_0007866 | 3300053085 | Bacteria | 6745 |
| 1648 | Ga0495619_0026075 | 3300053085 | Bacteria | 3758 |
| 1649 | Ga0495619_0067168 | 3300053085 | Bacteria | 2393 |
| 1650 | Ga0495619_0250509 | 3300053085 | Bacteria | 1227 |
| 1651 | Ga0495619_0550580 | 3300053085 | Bacteria | 791 |
| 1652 | Ga0501084_0006409 | 3300054114 | Bacteria | 9674 |
| 1653 | Ga0501084_0015419 | 3300054114 | Bacteria | 6336 |
| 1654 | Ga0501084_0162417 | 3300054114 | Bacteria | 1885 |
| 1655 | Ga0501084_0179330 | 3300054114 | Bacteria | 1788 |
| 1656 | Ga0590071_046949 | 3300059421 | Bacteria | 1044 |
| 1657 | Ga0587084_008557 | 3300059477 | Bacteria | 1299 |
| 1658 | Ga0587084_093124 | 3300059477 | Bacteria | 600 |
| 1659 | Ga0587093_032545 | 3300059478 | Bacteria | 757 |
| 1660 | Ga0587066_105217 | 3300059490 | Bacteria | 647 |
| 1661 | Ga0587070_026154 | 3300059491 | Bacteria | 1023 |
| 1662 | Ga0587070_056270 | 3300059491 | Bacteria | 800 |
| 1663 | Ga0587070_057172 | 3300059491 | Bacteria | 796 |
| 1664 | Ga0587070_101553 | 3300059491 | Bacteria | 662 |
| 1665 | Ga0587073_0070967 | 3300059492 | Bacteria | 841 |
| 1666 | Ga0587073_0217606 | 3300059492 | Bacteria | 582 |
| 1667 | Ga0587077_077231 | 3300059493 | Bacteria | 756 |
| 1668 | Ga0587077_132746 | 3300059493 | Bacteria | 633 |
| 1669 | Ga0587077_261026 | 3300059493 | Bacteria | 505 |
| 1670 | Ga0587080_028007 | 3300059503 | Bacteria | 965 |
| 1671 | Ga0587080_029121 | 3300059503 | Bacteria | 952 |
| 1672 | Ga0587080_033122 | 3300059503 | Bacteria | 910 |
| 1673 | Ga0587080_078742 | 3300059503 | Bacteria | 672 |
| 1674 | Ga0587080_153072 | 3300059503 | Bacteria | 535 |
| 1675 | Ga0587082_108034 | 3300059504 | Bacteria | 615 |
| 1676 | Ga0587083_0003623 | 3300059505 | Bacteria | 2071 |
| 1677 | Ga0587083_0097976 | 3300059505 | Bacteria | 726 |
| 1678 | Ga0587083_0122413 | 3300059505 | Bacteria | 673 |
| 1679 | Ga0587083_0258639 | 3300059505 | Bacteria | 522 |
| 1680 | Ga0587085_009458 | 3300059506 | Bacteria | 1270 |
| 1681 | Ga0587088_003103 | 3300059508 | Bacteria | 1972 |
| 1682 | Ga0587088_061741 | 3300059508 | Bacteria | 761 |
| 1683 | Ga0587089_015017 | 3300059509 | Bacteria | 1018 |
| 1684 | Ga0587090_021586 | 3300059510 | Bacteria | 1011 |
| 1685 | Ga0587090_034598 | 3300059510 | Bacteria | 862 |
| 1686 | Ga0587091_018726 | 3300059511 | Bacteria | 1182 |
| 1687 | Ga0587091_018976 | 3300059511 | Bacteria | 1177 |
| 1688 | Ga0587091_041792 | 3300059511 | Bacteria | 907 |
| 1689 | Ga0587091_068825 | 3300059511 | Bacteria | 770 |
| 1690 | Ga0587091_080519 | 3300059511 | Bacteria | 730 |
| 1691 | Ga0587092_043274 | 3300059512 | Bacteria | 792 |
| 1692 | Ga0587094_126096 | 3300059513 | Bacteria | 517 |
| 1693 | Ga0587098_037316 | 3300059604 | Bacteria | 694 |
| 1694 | Ga0587098_088197 | 3300059604 | Bacteria | 526 |
| 1695 | Ga0587106_135570 | 3300059605 | Bacteria | 535 |
| 1696 | Ga0587101_045628 | 3300059623 | Bacteria | 738 |
| 1697 | Ga0587122_000616 | 3300059628 | Bacteria | 1976 |
| 1698 | Ga0587122_045407 | 3300059628 | Bacteria | 557 |
| 1699 | Ga0587128_000395 | 3300059630 | Bacteria | 3139 |
| 1700 | Ga0587128_022020 | 3300059630 | Bacteria | 988 |
| 1701 | Ga0587128_045034 | 3300059630 | Bacteria | 786 |
| 1702 | Ga0587128_046109 | 3300059630 | Bacteria | 780 |
| 1703 | Ga0587062_075427 | 3300059639 | Bacteria | 617 |
| 1704 | Ga0587067_058027 | 3300059640 | Bacteria | 803 |
| 1705 | Ga0587067_130653 | 3300059640 | Bacteria | 612 |
| 1706 | Ga0587067_152189 | 3300059640 | Bacteria | 582 |
| 1707 | Ga0587068_008623 | 3300059641 | Bacteria | 1483 |
| 1708 | Ga0587069_014182 | 3300059642 | Bacteria | 1108 |
| 1709 | Ga0587069_061781 | 3300059642 | Bacteria | 692 |
| 1710 | Ga0587072_126320 | 3300059643 | Bacteria | 598 |
| 1711 | Ga0587075_018259 | 3300059644 | Bacteria | 1016 |
| 1712 | Ga0587075_053703 | 3300059644 | Bacteria | 710 |
| 1713 | Ga0587076_014556 | 3300059645 | Bacteria | 1213 |
| 1714 | Ga0587076_035987 | 3300059645 | Bacteria | 903 |
| 1715 | Ga0587079_050510 | 3300059647 | Bacteria | 871 |
| 1716 | Ga0587079_063562 | 3300059647 | Bacteria | 806 |
| 1717 | Ga0587102_001277 | 3300059649 | Bacteria | 1726 |
| 1718 | Ga0587107_068402 | 3300059652 | Bacteria | 643 |
| 1719 | Ga0587107_104737 | 3300059652 | Bacteria | 564 |
| 1720 | Ga0587110_016957 | 3300059654 | Bacteria | 793 |
| 1721 | Ga0587110_038518 | 3300059654 | Bacteria | 607 |
| 1722 | Ga0587114_009697 | 3300059655 | Bacteria | 1160 |
| 1723 | Ga0587114_070143 | 3300059655 | Bacteria | 633 |
| 1724 | Ga0587120_026200 | 3300059659 | Bacteria | 578 |
| 1725 | Ga0587071_063222 | 3300060344 | Bacteria | 791 |
| 1726 | Ga0587071_074609 | 3300060344 | Bacteria | 745 |
| 1727 | Ga0587071_088613 | 3300060344 | Bacteria | 700 |
| 1728 | Ga0587071_089239 | 3300060344 | Bacteria | 698 |
| 1729 | Ga0587071_102775 | 3300060344 | Bacteria | 663 |
| 1730 | Ga0587111_0081325 | 3300060346 | Bacteria | 775 |
| 1731 | Ga0587111_0119404 | 3300060346 | Bacteria | 677 |
| 1732 | Ga0587111_0178622 | 3300060346 | Bacteria | 588 |
| 1733 | Ga0501082_0014508 | 3300060353 | Bacteria | 6784 |
| 1734 | Ga0501082_0020323 | 3300060353 | Bacteria | 5724 |
| 1735 | Ga0501082_0410999 | 3300060353 | Bacteria | 1181 |
| 1736 | Ga0501082_0521707 | 3300060353 | Bacteria | 1038 |
| 1737 | Ga0501082_1212715 | 3300060353 | Bacteria | 659 |
| 1738 | Ga0501082_1991016 | 3300060353 | Bacteria | 506 |
| 1739 | Ga0466962_0032211 | 3300061719 | Bacteria | 2509 |
| 1740 | Ga0530510_0042730 | 3300061734 | Bacteria | 3274 |
| 1741 | Ga0530510_0061548 | 3300061734 | Bacteria | 2717 |
| 1742 | Ga0530510_0126308 | 3300061734 | Bacteria | 1880 |
| 1743 | Ga0530510_0641936 | 3300061734 | Bacteria | 808 |
| 1744 | Ga0530510_1078602 | 3300061734 | Bacteria | 615 |
| 1745 | 2547411357 | 2547132111 | Bacteria | 8013147 |
| 1746 | 2554256760 | 2554235005 | Bacteria | 6457341 |
| 1747 | 2616696762 | 2616644814 | Bacteria | 11555299 |
| 1748 | 2616901906 | 2616644941 | Bacteria | 8510691 |
| 1749 | 2644439365 | 2643221678 | Bacteria | 9540101 |
| 1750 | 2644633261 | 2643221714 | Bacteria | 9015452 |
| 1751 | 2784589770 | 2784132148 | Bacteria | 8627943 |
| 1752 | 2808843366 | 2808606359 | Bacteria | 9866990 |
| 1753 | 2809233440 | 2808606448 | Bacteria | 8656184 |
| 1754 | 2812356679 | 2811994879 | Bacteria | 9313447 |
| 1755 | 2812479392 | 2811994917 | Bacteria | 7761064 |
| 1756 | 2852643123 | 2852635781 | Bacteria | 8251373 |
| 1757 | 2862185297 | 2862178590 | Bacteria | 8583590 |
| 1758 | 2862292094 | 2862290372 | Bacteria | 7471434 |
| 1759 | 2862516757 | 2862507626 | Bacteria | 9425308 |
| 1760 | 2867429963 | 2867428634 | Bacteria | 9590268 |
| 1761 | 2912718428 | 2912715099 | Bacteria | 9460473 |
| 1762 | 2912730754 | 2912723979 | Bacteria | 8557534 |
| 1763 | 2919470265 | 2919468124 | Bacteria | 9133025 |
| 1764 | 2935395234 | 2935390628 | Bacteria | 7043367 |
| 1765 | 2946069192 | 2946064051 | Bacteria | 8957905 |
| 1766 | 2946077140 | 2946072368 | Bacteria | 8999607 |
| 1767 | 2947227742 | 2947224130 | Bacteria | 9938529 |
| 1768 | 2954695554 | 2954691527 | Bacteria | 10720516 |
| 1769 | 2954710748 | 2954701450 | Bacteria | 10834262 |
| 1770 | 2954714977 | 2954711539 | Bacteria | 10867210 |
| 1771 | 2954724919 | 2954721474 | Bacteria | 10456478 |
| 1772 | 2954736899 | 2954731030 | Bacteria | 10243860 |
| 1773 | 2954743845 | 2954740390 | Bacteria | 10229294 |
| 1774 | 2954755747 | 2954749733 | Bacteria | 10366972 |
| 1775 | 2954762798 | 2954759201 | Bacteria | 9358192 |
| 1776 | 3006398680 | 3006393351 | Bacteria | 6615579 |
| 1777 | 3006490571 | 3006486233 | Bacteria | 8157040 |
| 1778 | 3006498854 | 3006493962 | Bacteria | 8825450 |
| 1779 | 8002784650 | 8002784119 | Bacteria | 9788632 |
| 1780 | 8023626963 | 8023623736 | Bacteria | 8593882 |
| 1781 | 8025417220 | 8025413630 | Bacteria | 7014048 |
| 1782 | 8033691144 | 8033684223 | Bacteria | 6906479 |
| 1783 | 8056837587 | 8056829672 | Bacteria | 9045328 |
| 1784 | Ga0070706_100001187 | |||
| 1785 | JGI24746J21847_1010606 | |||
| 1786 | JGI24747J21853_1004561 | |||
| 1787 | JGI24740J21852_10074867 | |||
| 1788 | JGI24739J22299_10014218 | |||
| 1789 | JGI24739J22299_10031467 | |||
| 1790 | JGI24737J22298_10014055 | |||
| 1791 | JGI24737J22298_10255683 | |||
| 1792 | JGI24750J21931_1025217 | |||
| 1793 | JGI24745J21846_1002378 | |||
| 1794 | JGI24738J21930_10026481 | |||
| 1795 | JGI24744J21845_10009983 | |||
| 1796 | JGI24034J26672_10019434 | |||
| 1797 | JGI24742J22300_10008900 | |||
| 1798 | JGI24751J29686_10064209 | |||
| 1799 | JGI25162J39368_1003458 | |||
| 1800 | JGI25164J39214_1000679 | |||
| 1801 | Ga0006778J45830_1037313 | |||
| 1802 | Ga0006759J45824_1035239 | |||
| 1803 | JGI25406J46586_10006196 | |||
| 1804 | JGI25406J46586_10008605 | |||
| 1805 | JGI25165J46597_1000061 | |||
| 1806 | Ga0007416J51690_1057683 | |||
| 1807 | Ga0007429J51699_1088480 | |||
| 1808 | Ga0007429J51699_1088481 | |||
| 1809 | Ga0032354_1022066 | |||
| 1810 | Ga0055539_1000808 | |||
| 1811 | Ga0055533_1000001 | |||
| 1812 | Ga0055527_1000017 | |||
| 1813 | Ga0055542_1000044 | |||
| 1814 | Ga0055529_1000279 | |||
| 1815 | Ga0055529_1039149 | |||
| 1816 | Ga0055541_1009606 | |||
| 1817 | Ga0058858_1434606 | |||
| 1818 | Ga0058859_10032894 | |||
| 1819 | Ga0058863_10079837 | |||
| 1820 | Ga0058863_10092482 | |||
| 1821 | Ga0058863_11902506 | |||
| 1822 | Ga0058863_11911031 | |||
| 1823 | Ga0058861_10002618 | |||
| 1824 | Ga0058861_10039056 | |||
| 1825 | Ga0058861_10046230 | |||
| 1826 | Ga0058861_10088000 | |||
| 1827 | Ga0058861_11840072 | |||
| 1828 | Ga0058861_12025964 | |||
| 1829 | Ga0058860_10225518 | |||
| 1830 | Ga0058860_12169112 | |||
| 1831 | Ga0058860_12198917 | |||
| 1832 | Ga0058862_10139641 | |||
| 1833 | Ga0058862_10153948 | |||
| 1834 | Ga0058862_10202782 | |||
| 1835 | Ga0058862_10277273 | |||
| 1836 | Ga0058862_12205953 | |||
| 1837 | Ga0058862_12730137 | |||
| 1838 | Ga0065714_10021838 | |||
| 1839 | Ga0070658_10028535 | |||
| 1840 | Ga0070658_10028947 | |||
| 1841 | Ga0070658_10258464 | |||
| 1842 | Ga0070658_10271826 | |||
| 1843 | Ga0070658_11038680 | |||
| 1844 | Ga0070676_10224730 | |||
| 1845 | Ga0070676_10414025 | |||
| 1846 | Ga0070683_100029975 | |||
| 1847 | Ga0070683_100274263 | |||
| 1848 | Ga0070683_100285358 | |||
| 1849 | Ga0070683_100306297 | |||
| 1850 | Ga0070683_100332725 | |||
| 1851 | Ga0070683_100346506 | |||
| 1852 | Ga0070683_100481930 | |||
| 1853 | Ga0070690_100194908 | |||
| 1854 | Ga0070690_100396542 | |||
| 1855 | Ga0070690_100523026 | |||
| 1856 | Ga0070690_100645872 | |||
| 1857 | Ga0070690_100835503 | |||
| 1858 | Ga0070670_100568059 | |||
| 1859 | Ga0070670_101091103 | |||
| 1860 | Ga0070677_10336382 | |||
| 1861 | Ga0068869_100012691 | |||
| 1862 | Ga0068869_100062239 | |||
| 1863 | Ga0068869_100168006 | |||
| 1864 | Ga0068869_100509726 | |||
| 1865 | Ga0068869_101838502 | |||
| 1866 | Ga0070680_100000015 | |||
| 1867 | Ga0070680_100033020 | |||
| 1868 | Ga0070680_100093789 | |||
| 1869 | Ga0070680_100153032 | |||
| 1870 | Ga0070680_100356170 | |||
| 1871 | Ga0070680_100432224 | |||
| 1872 | Ga0070680_100834179 | |||
| 1873 | Ga0070682_100011705 | |||
| 1874 | Ga0070682_100203653 | |||
| 1875 | Ga0070682_100236792 | |||
| 1876 | Ga0070682_100246860 | |||
| 1877 | Ga0068868_100005144 | |||
| 1878 | Ga0068868_100122450 | |||
| 1879 | Ga0068868_100382455 | |||
| 1880 | Ga0068868_100459711 | |||
| 1881 | Ga0070660_100059135 | |||
| 1882 | Ga0070660_100128075 | |||
| 1883 | Ga0070660_100134654 | |||
| 1884 | Ga0070660_100329375 | |||
| 1885 | Ga0070689_100029463 | |||
| 1886 | Ga0070689_100158604 | |||
| 1887 | Ga0070689_100818584 | |||
| 1888 | Ga0070691_10003867 | |||
| 1889 | Ga0070691_10024314 | |||
| 1890 | Ga0070691_10043635 | |||
| 1891 | Ga0070691_10206936 | |||
| 1892 | Ga0070687_100127109 | |||
| 1893 | Ga0070687_100232399 | |||
| 1894 | Ga0070687_101369961 | |||
| 1895 | Ga0070661_101478697 | |||
| 1896 | Ga0070692_10102432 | |||
| 1897 | Ga0070692_10510609 | |||
| 1898 | Ga0070692_10621542 | |||
| 1899 | Ga0070668_100646667 | |||
| 1900 | Ga0070668_100713017 | |||
| 1901 | Ga0070668_100729157 | |||
| 1902 | Ga0070669_100478705 | |||
| 1903 | Ga0070669_101260253 | |||
| 1904 | Ga0070675_100082776 | |||
| 1905 | Ga0070675_100095801 | |||
| 1906 | Ga0070675_100253957 | |||
| 1907 | Ga0070675_100417906 | |||
| 1908 | Ga0070675_100760983 | |||
| 1909 | Ga0070675_101504990 | |||
| 1910 | Ga0070671_100060488 | |||
| 1911 | Ga0070671_100151685 | |||
| 1912 | Ga0070671_100341891 | |||
| 1913 | Ga0070671_100385131 | |||
| 1914 | Ga0070671_100455397 | |||
| 1915 | Ga0070674_100041590 | |||
| 1916 | Ga0070674_100238837 | |||
| 1917 | Ga0070674_100305444 | |||
| 1918 | Ga0070674_101879946 | |||
| 1919 | Ga0070673_100019981 | |||
| 1920 | Ga0070673_100296296 | |||
| 1921 | Ga0070688_100043252 | |||
| 1922 | Ga0070688_100123596 | |||
| 1923 | Ga0070659_100012148 | |||
| 1924 | Ga0070659_100018706 | |||
| 1925 | Ga0070659_100126270 | |||
| 1926 | Ga0070659_100179838 | |||
| 1927 | Ga0070667_100644816 | |||
| 1928 | Ga0070667_100882763 | |||
| 1929 | Ga0070703_10026297 | |||
| 1930 | Ga0070709_10186968 | |||
| 1931 | Ga0070714_100005269 | |||
| 1932 | Ga0070714_101557988 | |||
| 1933 | Ga0070713_100081990 | |||
| 1934 | Ga0070710_10029185 | |||
| 1935 | Ga0070710_10090852 | |||
| 1936 | Ga0070710_10233310 | |||
| 1937 | Ga0070701_10014791 | |||
| 1938 | Ga0070701_10218853 | |||
| 1939 | Ga0070701_10751579 | |||
| 1940 | Ga0070711_100019741 | |||
| 1941 | Ga0070711_100030873 | |||
| 1942 | Ga0070705_100012679 | |||
| 1943 | Ga0070705_100064677 | |||
| 1944 | Ga0070705_100117451 | |||
| 1945 | Ga0070705_100212079 | |||
| 1946 | Ga0070705_100856494 | |||
| 1947 | Ga0070700_100014624 | |||
| 1948 | Ga0070700_100117428 | |||
| 1949 | Ga0070700_100181285 | |||
| 1950 | Ga0070700_100409710 | |||
| 1951 | Ga0070700_101440306 | |||
| 1952 | Ga0070694_100072132 | |||
| 1953 | Ga0070694_100213642 | |||
| 1954 | Ga0070694_100330046 | |||
| 1955 | Ga0070694_100648214 | |||
| 1956 | Ga0070708_100015734 | |||
| 1957 | Ga0070708_100127832 | |||
| 1958 | Ga0070708_100737148 | |||
| 1959 | Ga0070708_100770417 | |||
| 1960 | Ga0070663_100177563 | |||
| 1961 | Ga0070663_100288192 | |||
| 1962 | Ga0070663_100405282 | |||
| 1963 | Ga0070663_100721741 | |||
| 1964 | Ga0070663_100739854 | |||
| 1965 | Ga0070663_101787956 | |||
| 1966 | Ga0070678_100058968 | |||
| 1967 | Ga0070678_100068279 | |||
| 1968 | Ga0070678_100524499 | |||
| 1969 | Ga0070678_100550805 | |||
| 1970 | Ga0070662_100494365 | |||
| 1971 | Ga0070662_100565695 | |||
| 1972 | Ga0070681_10128448 | |||
| 1973 | Ga0070681_10166145 | |||
| 1974 | Ga0070681_10377690 | |||
| 1975 | Ga0070681_10471198 | |||
| 1976 | Ga0070681_11316024 | |||
| 1977 | Ga0068867_100049389 | |||
| 1978 | Ga0068867_100261733 | |||
| 1979 | Ga0068867_100470533 | |||
| 1980 | Ga0070685_10030710 | |||
| 1981 | Ga0070685_10067598 | |||
| 1982 | Ga0070706_100011787 | |||
| 1983 | Ga0070706_100531095 | |||
| 1984 | Ga0070707_100005867 | |||
| 1985 | Ga0070707_100038225 | |||
| 1986 | Ga0070707_100064600 | |||
| 1987 | Ga0070707_100223342 | |||
| 1988 | Ga0070707_101013754 | |||
| 1989 | Ga0070698_100094301 | |||
| 1990 | Ga0070698_100104288 | |||
| 1991 | Ga0070698_102076193 | |||
| 1992 | Ga0070699_100058035 | |||
| 1993 | Ga0070679_100025472 | |||
| 1994 | Ga0070679_100038792 | |||
| 1995 | Ga0070679_100575647 | |||
| 1996 | Ga0070679_101455700 | |||
| 1997 | Ga0070679_101882188 | |||
| 1998 | Ga0070684_100051018 | |||
| 1999 | Ga0070684_100076715 | |||
| 2000 | Ga0070684_100092545 | |||
| 2001 | Ga0070684_100114067 | |||
| 2002 | Ga0070684_100308206 | |||
| 2003 | Ga0070684_100454164 | |||
| 2004 | Ga0070684_100520389 | |||
| 2005 | Ga0070684_100721633 | |||
| 2006 | Ga0070697_100025528 | |||
| 2007 | Ga0070697_100055682 | |||
| 2008 | Ga0070697_100098342 | |||
| 2009 | Ga0070697_100316355 | |||
| 2010 | Ga0070697_100758674 | |||
| 2011 | Ga0070697_102107727 | |||
| 2012 | Ga0068853_100047078 | |||
| 2013 | Ga0068853_100167867 | |||
| 2014 | Ga0068853_100353953 | |||
| 2015 | Ga0068853_101812360 | |||
| 2016 | Ga0068853_102263871 | |||
| 2017 | Ga0070672_100130525 | |||
| 2018 | Ga0070672_100823102 | |||
| 2019 | Ga0070686_100008884 | |||
| 2020 | Ga0070686_100042639 | |||
| 2021 | Ga0070686_100200306 | |||
| 2022 | Ga0070686_100814129 | |||
| 2023 | Ga0070695_100156634 | |||
| 2024 | Ga0070695_100206721 | |||
| 2025 | Ga0070695_100577631 | |||
| 2026 | Ga0070696_100006963 | |||
| 2027 | Ga0070696_100082401 | |||
| 2028 | Ga0070696_100082497 | |||
| 2029 | Ga0070696_100116381 | |||
| 2030 | Ga0070696_100260895 | |||
| 2031 | Ga0070696_100288614 | |||
| 2032 | Ga0070696_100318727 | |||
| 2033 | Ga0070696_100534091 | |||
| 2034 | Ga0070696_100617234 | |||
| 2035 | Ga0070696_100885697 | |||
| 2036 | Ga0070696_101576902 | |||
| 2037 | Ga0070693_100011341 | |||
| 2038 | Ga0070693_100045839 | |||
| 2039 | Ga0070693_100139888 | |||
| 2040 | Ga0070693_100353398 | |||
| 2041 | Ga0070693_100355640 | |||
| 2042 | Ga0070693_100598675 | |||
| 2043 | Ga0070665_100355567 | |||
| 2044 | Ga0070665_100360118 | |||
| 2045 | Ga0070704_100016174 | |||
| 2046 | Ga0070704_100866435 | |||
| 2047 | Ga0070704_100879611 | |||
| 2048 | Ga0068855_100026947 | |||
| 2049 | Ga0068855_100052631 | |||
| 2050 | Ga0068855_100066868 | |||
| 2051 | Ga0068855_101539999 | |||
| 2052 | Ga0068855_102164059 | |||
| 2053 | Ga0070664_100010033 | |||
| 2054 | Ga0070664_100100347 | |||
| 2055 | Ga0070664_100217308 | |||
| 2056 | Ga0070664_101278998 | |||
| 2057 | Ga0070664_101783163 | |||
| 2058 | Ga0068857_100129395 | |||
| 2059 | Ga0068857_100481910 | |||
| 2060 | Ga0068857_100670337 | |||
| 2061 | Ga0068857_101846732 | |||
| 2062 | Ga0068854_100030804 | |||
| 2063 | Ga0068854_101577851 | |||
| 2064 | Ga0068856_100048606 | |||
| 2065 | Ga0068856_100061274 | |||
| 2066 | Ga0068856_100102656 | |||
| 2067 | Ga0068856_100230255 | |||
| 2068 | Ga0068856_100290876 | |||
| 2069 | Ga0068856_100366475 | |||
| 2070 | Ga0070702_100016072 | |||
| 2071 | Ga0070702_100161541 | |||
| 2072 | Ga0070702_100234700 | |||
| 2073 | Ga0068852_100082296 | |||
| 2074 | Ga0068852_100132206 | |||
| 2075 | Ga0068852_100302958 | |||
| 2076 | Ga0068852_101304543 | |||
| 2077 | Ga0068852_102847750 | |||
| 2078 | Ga0068859_100038389 | |||
| 2079 | Ga0068859_101887037 | |||
| 2080 | Ga0068864_100083353 | |||
| 2081 | Ga0068864_100571654 | |||
| 2082 | Ga0068866_10036626 | |||
| 2083 | Ga0068866_10136583 | |||
| 2084 | Ga0068866_10712135 | |||
| 2085 | Ga0068861_100105850 | |||
| 2086 | Ga0068861_100316610 | |||
| 2087 | Ga0068861_100482997 | |||
| 2088 | Ga0068861_100893563 | |||
| 2089 | Ga0068861_101168994 | |||
| 2090 | Ga0068861_102551714 | |||
| 2091 | Ga0068851_10282940 | |||
| 2092 | Ga0068870_10084742 | |||
| 2093 | Ga0068870_10934948 | |||
| 2094 | Ga0068863_100260616 | |||
| 2095 | Ga0068863_100344654 | |||
| 2096 | Ga0068858_100046786 | |||
| 2097 | Ga0068858_100161047 | |||
| 2098 | Ga0068858_100693419 | |||
| 2099 | Ga0068860_100027971 | |||
| 2100 | Ga0068860_100344499 | |||
| 2101 | Ga0068860_100505616 | |||
| 2102 | Ga0068860_100928713 | |||
| 2103 | Ga0068862_100395989 | |||
| 2104 | Ga0068862_100556312 | |||
| 2105 | Ga0068862_101352363 | |||
| 2106 | Ga0081455_10047065 | |||
| 2107 | Ga0081455_10236082 | |||
| 2108 | Ga0081539_10003252 | |||
| 2109 | Ga0081539_10012303 | |||
| 2110 | Ga0070717_10033904 | |||
| 2111 | Ga0070717_10047424 | |||
| 2112 | Ga0070717_10241231 | |||
| 2113 | Ga0075364_10055931 | |||
| 2114 | Ga0075432_10015139 | |||
| 2115 | Ga0070716_100545422 | |||
| 2116 | Ga0070716_101271164 | |||
| 2117 | Ga0070712_100012347 | |||
| 2118 | Ga0070712_100266878 | |||
| 2119 | Ga0097621_100013802 | |||
| 2120 | Ga0097621_100024219 | |||
| 2121 | Ga0097621_100355537 | |||
| 2122 | Ga0097621_100587813 | |||
| 2123 | Ga0097621_100810564 | |||
| 2124 | Ga0075370_10264234 | |||
| 2125 | Ga0068871_100027934 | |||
| 2126 | Ga0075428_100000694 | |||
| 2127 | Ga0075428_100004768 | |||
| 2128 | Ga0075428_100294355 | |||
| 2129 | Ga0075428_100587336 | |||
| 2130 | Ga0075433_10043437 | |||
| 2131 | Ga0075433_10080542 | |||
| 2132 | Ga0075433_10178155 | |||
| 2133 | Ga0075433_10210759 | |||
| 2134 | Ga0075433_10345789 | |||
| 2135 | Ga0075434_100007021 | |||
| 2136 | Ga0075434_100233167 | |||
| 2137 | Ga0075434_100260368 | |||
| 2138 | Ga0075434_100261099 | |||
| 2139 | Ga0075434_100268762 | |||
| 2140 | Ga0075434_100278696 | |||
| 2141 | Ga0075434_100438986 | |||
| 2142 | Ga0075434_101034808 | |||
| 2143 | Ga0075429_100411179 | |||
| 2144 | Ga0075429_100626261 | |||
| 2145 | Ga0068865_100031053 | |||
| 2146 | Ga0068865_100064080 | |||
| 2147 | Ga0068865_100140491 | |||
| 2148 | Ga0068865_100163955 | |||
| 2149 | Ga0068865_102057633 | |||
| 2150 | Ga0075436_100073498 | |||
| 2151 | Ga0097620_100038389 | |||
| 2152 | Ga0097620_101887085 | |||
| 2153 | Ga0075435_100013055 | |||
| 2154 | Ga0075435_100167058 | |||
| 2155 | Ga0075435_100621124 | |||
| 2156 | Ga0075435_100730755 | |||
| 2157 | Ga0105240_10142595 | |||
| 2158 | Ga0105240_10535128 | |||
| 2159 | Ga0111539_10008690 | |||
| 2160 | Ga0111539_10148167 | |||
| 2161 | Ga0111539_11913215 | |||
| 2162 | Ga0111539_12017782 | |||
| 2163 | Ga0105245_10036956 | |||
| 2164 | Ga0105245_10048434 | |||
| 2165 | Ga0105245_10091660 | |||
| 2166 | Ga0105245_10251918 | |||
| 2167 | Ga0105245_10484083 | |||
| 2168 | Ga0105245_10778720 | |||
| 2169 | Ga0105245_10874176 | |||
| 2170 | Ga0105247_10046136 | |||
| 2171 | Ga0105247_10907461 | |||
| 2172 | Ga0114129_10009938 | |||
| 2173 | Ga0114129_10015434 | |||
| 2174 | Ga0114129_10022103 | |||
| 2175 | Ga0105243_10035607 | |||
| 2176 | Ga0105243_10152057 | |||
| 2177 | Ga0105243_10422171 | |||
| 2178 | Ga0105243_10718801 | |||
| 2179 | Ga0105243_10955436 | |||
| 2180 | Ga0105243_10997357 | |||
| 2181 | Ga0105241_10023878 | |||
| 2182 | Ga0105241_10189650 | |||
| 2183 | Ga0105241_10382493 | |||
| 2184 | Ga0105241_10411926 | |||
| 2185 | Ga0105242_10081594 | |||
| 2186 | Ga0105242_10104555 | |||
| 2187 | Ga0105242_10106171 | |||
| 2188 | Ga0105242_10117748 | |||
| 2189 | Ga0105242_10254553 | |||
| 2190 | Ga0105242_10843581 | |||
| 2191 | Ga0105242_11392689 | |||
| 2192 | Ga0105248_10105254 | |||
| 2193 | Ga0105248_10421419 | |||
| 2194 | Ga0105248_10556440 | |||
| 2195 | Ga0105248_10621293 | |||
| 2196 | Ga0105237_10037185 | |||
| 2197 | Ga0105237_10358146 | |||
| 2198 | Ga0105237_11194597 | |||
| 2199 | Ga0105238_10017104 | |||
| 2200 | Ga0105238_10069677 | |||
| 2201 | Ga0105238_10366945 | |||
| 2202 | Ga0105238_10369097 | |||
| 2203 | Ga0105238_10450806 | |||
| 2204 | Ga0105249_10283460 | |||
| 2205 | Ga0105249_10689710 | |||
| 2206 | Ga0105249_10772853 | |||
| 2207 | Ga0105249_11107463 | |||
| 2208 | Ga0105249_11995395 | |||
| 2209 | Ga0105029_112195 | |||
| 2210 | Ga0105239_10226875 | |||
| 2211 | Ga0105239_10389075 | |||
| 2212 | Ga0105239_10427946 | |||
| 2213 | Ga0105239_10442962 | |||
| 2214 | Ga0105239_10466363 | |||
| 2215 | Ga0105239_10557683 | |||
| 2216 | Ga0105239_11495136 | |||
| 2217 | Ga0105246_10049177 | |||
| 2218 | Ga0105246_10057920 | |||
| 2219 | Ga0105246_10177519 | |||
| 2220 | Ga0105246_10182799 | |||
| 2221 | Ga0105246_10287073 | |||
| 2222 | Ga0105246_11105564 | |||
| 2223 | Ga0157341_1023156 | |||
| 2224 | Ga0154019_108401 | |||
| 2225 | Ga0154016_109853 | |||
| 2226 | Ga0154014_155088 | |||
| 2227 | Ga0154012_174592 | |||
| 2228 | Ga0154010_169846 | |||
| 2229 | Ga0157373_10129520 | |||
| 2230 | Ga0157373_10252116 | |||
| 2231 | Ga0157373_10269428 | |||
| 2232 | Ga0157371_10917546 | |||
| 2233 | Ga0157371_11319145 | |||
| 2234 | Ga0157370_10288553 | |||
| 2235 | Ga0157370_10472846 | |||
| 2236 | Ga0157370_10645810 | |||
| 2237 | Ga0157370_10868953 | |||
| 2238 | Ga0157369_10040784 | |||
| 2239 | Ga0157369_10054751 | |||
| 2240 | Ga0157369_10160525 | |||
| 2241 | Ga0157369_10368741 | |||
| 2242 | Ga0157369_10490498 | |||
| 2243 | Ga0157369_11135253 | |||
| 2244 | Ga0157369_11734600 | |||
| 2245 | Ga0157374_10524581 | |||
| 2246 | Ga0157374_10959560 | |||
| 2247 | Ga0157374_11907935 | |||
| 2248 | Ga0157378_10151859 | |||
| 2249 | Ga0157378_10266849 | |||
| 2250 | Ga0157378_10284059 | |||
| 2251 | Ga0157378_10428887 | |||
| 2252 | Ga0157378_10724113 | |||
| 2253 | Ga0157378_11885732 | |||
| 2254 | Ga0157378_13075037 | |||
| 2255 | Ga0163162_10046453 | |||
| 2256 | Ga0163162_10099425 | |||
| 2257 | Ga0163162_10414718 | |||
| 2258 | Ga0163162_10415409 | |||
| 2259 | Ga0163162_10415666 | |||
| 2260 | Ga0163162_10432833 | |||
| 2261 | Ga0163162_11026675 | |||
| 2262 | Ga0163162_11356503 | |||
| 2263 | Ga0163162_11863438 | |||
| 2264 | Ga0157372_10046776 | |||
| 2265 | Ga0157372_10060128 | |||
| 2266 | Ga0157372_10079691 | |||
| 2267 | Ga0157372_10418862 | |||
| 2268 | Ga0157372_10555161 | |||
| 2269 | Ga0157372_10743218 | |||
| 2270 | Ga0157372_10883289 | |||
| 2271 | Ga0157372_11425747 | |||
| 2272 | Ga0157372_11487203 | |||
| 2273 | Ga0157372_11630064 | |||
| 2274 | Ga0157375_10064914 | |||
| 2275 | Ga0157375_10139200 | |||
| 2276 | Ga0157375_10316555 | |||
| 2277 | Ga0157375_10525836 | |||
| 2278 | Ga0157375_10724968 | |||
| 2279 | Ga0157375_11946183 | |||
| 2280 | Ga0163163_10096702 | |||
| 2281 | Ga0163163_10176943 | |||
| 2282 | Ga0163163_10208613 | |||
| 2283 | Ga0163163_10268245 | |||
| 2284 | Ga0163163_10339457 | |||
| 2285 | Ga0163163_11371723 | |||
| 2286 | Ga0163163_13039115 | |||
| 2287 | Ga0157380_10047519 | |||
| 2288 | Ga0157380_10288228 | |||
| 2289 | Ga0157380_10376954 | |||
| 2290 | Ga0157380_10400833 | |||
| 2291 | Ga0157380_10572893 | |||
| 2292 | Ga0157380_11516359 | |||
| 2293 | Ga0157380_11524265 | |||
| 2294 | Ga0157380_12711699 | |||
| 2295 | Ga0157377_10026594 | |||
| 2296 | Ga0157377_10314041 | |||
| 2297 | Ga0157377_10356594 | |||
| 2298 | Ga0157377_10592670 | |||
| 2299 | Ga0157377_10928095 | |||
| 2300 | Ga0157377_11023182 | |||
| 2301 | Ga0157379_10147410 | |||
| 2302 | Ga0157379_10325637 | |||
| 2303 | Ga0157379_10431168 | |||
| 2304 | Ga0157379_10531124 | |||
| 2305 | Ga0157379_11248177 | |||
| 2306 | Ga0157379_11739537 | |||
| 2307 | Ga0157379_12341885 | |||
| 2308 | Ga0157376_10045570 | |||
| 2309 | Ga0157376_10046239 | |||
| 2310 | Ga0157376_10087652 | |||
| 2311 | Ga0157376_10570685 | |||
| 2312 | Ga0157376_11387150 | |||
| 2313 | Ga0157376_11728483 | |||
| 2314 | Ga0157376_12257065 | |||
| 2315 | Ga0163161_10081962 | |||
| 2316 | Ga0163161_10105842 | |||
| 2317 | Ga0163161_12029694 | |||
| 2318 | Ga0197907_10050194 | |||
| 2319 | Ga0197907_10086159 | |||
| 2320 | Ga0197907_10212903 | |||
| 2321 | Ga0197907_10268076 | |||
| 2322 | Ga0197907_10378803 | |||
| 2323 | Ga0197907_10533934 | |||
| 2324 | Ga0197907_10881670 | |||
| 2325 | Ga0197907_11286071 | |||
| 2326 | Ga0197907_11298433 | |||
| 2327 | Ga0197907_11482061 | |||
| 2328 | Ga0206356_10124042 | |||
| 2329 | Ga0206356_10200830 | |||
| 2330 | Ga0206356_10361125 | |||
| 2331 | Ga0206356_10509057 | |||
| 2332 | Ga0206356_10516737 | |||
| 2333 | Ga0206356_10824910 | |||
| 2334 | Ga0206356_10913331 | |||
| 2335 | Ga0206356_11044350 | |||
| 2336 | Ga0206356_11156669 | |||
| 2337 | Ga0206356_11286683 | |||
| 2338 | Ga0206349_1386548 | |||
| 2339 | Ga0206349_1530271 | |||
| 2340 | Ga0206349_1613375 | |||
| 2341 | Ga0206355_1018340 | |||
| 2342 | Ga0206355_1035334 | |||
| 2343 | Ga0206355_1055070 | |||
| 2344 | Ga0206355_1328705 | |||
| 2345 | Ga0206355_1630452 | |||
| 2346 | Ga0206351_10072365 | |||
| 2347 | Ga0206351_10093131 | |||
| 2348 | Ga0206351_10468617 | |||
| 2349 | Ga0206351_10495414 | |||
| 2350 | Ga0206351_10796045 | |||
| 2351 | Ga0206351_10858444 | |||
| 2352 | Ga0206352_10254721 | |||
| 2353 | Ga0206352_10314452 | |||
| 2354 | Ga0206352_10341291 | |||
| 2355 | Ga0206352_10408147 | |||
| 2356 | Ga0206352_10649957 | |||
| 2357 | Ga0206352_10815645 | |||
| 2358 | Ga0206352_10939620 | |||
| 2359 | Ga0206352_11168067 | |||
| 2360 | Ga0206352_11295788 | |||
| 2361 | Ga0206350_10430818 | |||
| 2362 | Ga0206350_10432378 | |||
| 2363 | Ga0206350_10544636 | |||
| 2364 | Ga0206350_11196555 | |||
| 2365 | Ga0206350_11654020 | |||
| 2366 | Ga0206354_10074904 | |||
| 2367 | Ga0206354_10208883 | |||
| 2368 | Ga0206354_10331979 | |||
| 2369 | Ga0206354_11017939 | |||
| 2370 | Ga0206354_11068226 | |||
| 2371 | Ga0206354_11172408 | |||
| 2372 | Ga0206354_11291340 | |||
| 2373 | Ga0206354_11520797 | |||
| 2374 | Ga0206354_11614879 | |||
| 2375 | Ga0206353_10014677 | |||
| 2376 | Ga0206353_10282636 | |||
| 2377 | Ga0206353_10330275 | |||
| 2378 | Ga0206353_10591683 | |||
| 2379 | Ga0206353_10790039 | |||
| 2380 | Ga0206353_11192759 | |||
| 2381 | Ga0206353_11631527 | |||
| 2382 | Ga0206353_11688786 | |||
| 2383 | Ga0206353_11996101 | |||
| 2384 | Ga0154015_1068933 | |||
| 2385 | Ga0154015_1105291 | |||
| 2386 | Ga0154015_1142575 | |||
| 2387 | Ga0154015_1285479 | |||
| 2388 | Ga0154015_1417016 | |||
| 2389 | Ga0154015_1538444 | |||
| 2390 | Ga0224712_10001495 | |||
| 2391 | Ga0224712_10011859 | |||
| 2392 | Ga0224712_10015890 | |||
| 2393 | Ga0224712_10024023 | |||
| 2394 | Ga0224712_10038926 | |||
| 2395 | Ga0224712_10101446 | |||
| 2396 | Ga0209566_100066 | |||
| 2397 | Ga0209674_100001 | |||
| 2398 | Ga0209672_100039 | |||
| 2399 | Ga0209147_100954 | |||
| 2400 | Ga0209563_100001 | |||
| 2401 | Ga0207427_100042 | |||
| 2402 | Ga0209437_100538 | |||
| 2403 | Ga0209258_101761 | |||
| 2404 | Ga0209677_100001 | |||
| 2405 | Ga0209677_102161 | |||
| 2406 | Ga0209148_1000004 | |||
| 2407 | Ga0209233_1000001 | |||
| 2408 | Ga0209455_1000117 | |||
| 2409 | Ga0209455_1003952 | |||
| 2410 | Ga0207697_10119287 | |||
| 2411 | Ga0207656_10013795 | |||
| 2412 | Ga0207653_10047439 | |||
| 2413 | Ga0207692_10007776 | |||
| 2414 | Ga0207692_10288443 | |||
| 2415 | Ga0207642_10204023 | |||
| 2416 | Ga0207642_10773310 | |||
| 2417 | Ga0207642_10836266 | |||
| 2418 | Ga0207710_10436641 | |||
| 2419 | Ga0207688_10003165 | |||
| 2420 | Ga0207688_10016881 | |||
| 2421 | Ga0207688_10036391 | |||
| 2422 | Ga0207688_10167179 | |||
| 2423 | Ga0207680_10598528 | |||
| 2424 | Ga0207647_10021889 | |||
| 2425 | Ga0207647_10028990 | |||
| 2426 | Ga0207647_10090838 | |||
| 2427 | Ga0207685_10619191 | |||
| 2428 | Ga0207699_10099923 | |||
| 2429 | Ga0207645_10064369 | |||
| 2430 | Ga0207645_10137521 | |||
| 2431 | Ga0207645_10149679 | |||
| 2432 | Ga0207643_10011474 | |||
| 2433 | Ga0207643_10048389 | |||
| 2434 | Ga0207643_10050065 | |||
| 2435 | Ga0207643_10199074 | |||
| 2436 | Ga0207643_10202123 | |||
| 2437 | Ga0207705_10013197 | |||
| 2438 | Ga0207705_10120089 | |||
| 2439 | Ga0207705_10202859 | |||
| 2440 | Ga0207684_10002793 | |||
| 2441 | Ga0207684_10018534 | |||
| 2442 | Ga0207684_10116254 | |||
| 2443 | Ga0207684_10745082 | |||
| 2444 | Ga0207684_10830059 | |||
| 2445 | Ga0207684_10897040 | |||
| 2446 | Ga0207654_10060489 | |||
| 2447 | Ga0207654_10081460 | |||
| 2448 | Ga0207654_10873031 | |||
| 2449 | Ga0207707_10112966 | |||
| 2450 | Ga0207707_10115185 | |||
| 2451 | Ga0207707_10471034 | |||
| 2452 | Ga0207707_10547397 | |||
| 2453 | Ga0207707_10689187 | |||
| 2454 | Ga0207695_10129689 | |||
| 2455 | Ga0207671_10080469 | |||
| 2456 | Ga0207671_10508695 | |||
| 2457 | Ga0207693_10022846 | |||
| 2458 | Ga0207693_10258912 | |||
| 2459 | Ga0207693_10900110 | |||
| 2460 | Ga0207693_10910752 | |||
| 2461 | Ga0207663_10011677 | |||
| 2462 | Ga0207663_11442947 | |||
| 2463 | Ga0207660_10000002 | |||
| 2464 | Ga0207660_10117448 | |||
| 2465 | Ga0207660_10197986 | |||
| 2466 | Ga0207660_10318694 | |||
| 2467 | Ga0207660_11056144 | |||
| 2468 | Ga0207662_10397766 | |||
| 2469 | Ga0207657_10001055 | |||
| 2470 | Ga0207657_10031572 | |||
| 2471 | Ga0207657_10044718 | |||
| 2472 | Ga0207657_10171230 | |||
| 2473 | Ga0207657_10404575 | |||
| 2474 | Ga0207649_10730382 | |||
| 2475 | Ga0207649_10978365 | |||
| 2476 | Ga0207652_10015058 | |||
| 2477 | Ga0207652_10079196 | |||
| 2478 | Ga0207652_10447665 | |||
| 2479 | Ga0207652_10542269 | |||
| 2480 | Ga0207646_10028575 | |||
| 2481 | Ga0207646_10037146 | |||
| 2482 | Ga0207646_10048634 | |||
| 2483 | Ga0207646_10067220 | |||
| 2484 | Ga0207681_10357039 | |||
| 2485 | Ga0207681_10982571 | |||
| 2486 | Ga0207694_10006100 | |||
| 2487 | Ga0207694_10010017 | |||
| 2488 | Ga0207694_10079437 | |||
| 2489 | Ga0207694_10261073 | |||
| 2490 | Ga0207694_10321104 | |||
| 2491 | Ga0207650_10263591 | |||
| 2492 | Ga0207650_10358983 | |||
| 2493 | Ga0207659_10083284 | |||
| 2494 | Ga0207659_10100407 | |||
| 2495 | Ga0207659_10659337 | |||
| 2496 | Ga0207687_10000332 | |||
| 2497 | Ga0207687_10068636 | |||
| 2498 | Ga0207687_10076469 | |||
| 2499 | Ga0207687_10486464 | |||
| 2500 | Ga0207687_11125178 | |||
| 2501 | Ga0207687_11342338 | |||
| 2502 | Ga0207687_11533538 | |||
| 2503 | Ga0207700_10199007 | |||
| 2504 | Ga0207700_11333167 | |||
| 2505 | Ga0207664_10004696 | |||
| 2506 | Ga0207664_10106499 | |||
| 2507 | Ga0207644_10862613 | |||
| 2508 | Ga0207644_10987685 | |||
| 2509 | Ga0207690_10043139 | |||
| 2510 | Ga0207690_10096274 | |||
| 2511 | Ga0207690_10623211 | |||
| 2512 | Ga0207690_11518080 | |||
| 2513 | Ga0207706_10012543 | |||
| 2514 | Ga0207706_10196299 | |||
| 2515 | Ga0207706_10199972 | |||
| 2516 | Ga0207706_10482472 | |||
| 2517 | Ga0207706_10603301 | |||
| 2518 | Ga0207686_10020647 | |||
| 2519 | Ga0207686_10059068 | |||
| 2520 | Ga0207686_10465798 | |||
| 2521 | Ga0207686_10991413 | |||
| 2522 | Ga0207686_11206580 | |||
| 2523 | Ga0207709_10020150 | |||
| 2524 | Ga0207709_10136935 | |||
| 2525 | Ga0207709_10179787 | |||
| 2526 | Ga0207709_10254716 | |||
| 2527 | Ga0207709_10554129 | |||
| 2528 | Ga0207709_10575743 | |||
| 2529 | Ga0207709_10593553 | |||
| 2530 | Ga0207670_10055965 | |||
| 2531 | Ga0207670_10225281 | |||
| 2532 | Ga0207669_10039257 | |||
| 2533 | Ga0207669_10101044 | |||
| 2534 | Ga0207669_10174457 | |||
| 2535 | Ga0207669_10194744 | |||
| 2536 | Ga0207704_10061699 | |||
| 2537 | Ga0207704_10111612 | |||
| 2538 | Ga0207704_10412076 | |||
| 2539 | Ga0207704_10521277 | |||
| 2540 | Ga0207665_10159641 | |||
| 2541 | Ga0207665_11145254 | |||
| 2542 | Ga0207691_10138961 | |||
| 2543 | Ga0207691_10221557 | |||
| 2544 | Ga0207691_10527891 | |||
| 2545 | Ga0207691_11386318 | |||
| 2546 | Ga0207711_10110582 | |||
| 2547 | Ga0207711_10113217 | |||
| 2548 | Ga0207711_10325705 | |||
| 2549 | Ga0207711_10488048 | |||
| 2550 | Ga0207689_10021685 | |||
| 2551 | Ga0207689_10029116 | |||
| 2552 | Ga0207689_10095522 | |||
| 2553 | Ga0207661_10000189 | |||
| 2554 | Ga0207661_10016251 | |||
| 2555 | Ga0207661_10030780 | |||
| 2556 | Ga0207661_10283621 | |||
| 2557 | Ga0207661_10508833 | |||
| 2558 | Ga0207661_10529277 | |||
| 2559 | Ga0207661_10772628 | |||
| 2560 | Ga0207661_10966456 | |||
| 2561 | Ga0207661_11445882 | |||
| 2562 | Ga0207679_10216472 | |||
| 2563 | Ga0207679_10246993 | |||
| 2564 | Ga0207679_10673327 | |||
| 2565 | Ga0207679_10700184 | |||
| 2566 | Ga0207667_10011493 | |||
| 2567 | Ga0207667_10266250 | |||
| 2568 | Ga0207667_11307650 | |||
| 2569 | Ga0207651_10602306 | |||
| 2570 | Ga0207651_10793014 | |||
| 2571 | Ga0207651_11378465 | |||
| 2572 | Ga0207651_11583715 | |||
| 2573 | Ga0207712_10153966 | |||
| 2574 | Ga0207712_10653681 | |||
| 2575 | Ga0207712_10671211 | |||
| 2576 | Ga0207712_11326639 | |||
| 2577 | Ga0207640_10018900 | |||
| 2578 | Ga0207640_10063865 | |||
| 2579 | Ga0207640_10266741 | |||
| 2580 | Ga0207640_10616263 | |||
| 2581 | Ga0207658_10125019 | |||
| 2582 | Ga0207658_10691348 | |||
| 2583 | Ga0207677_10063649 | |||
| 2584 | Ga0207677_10114794 | |||
| 2585 | Ga0207677_10542254 | |||
| 2586 | Ga0207677_10566713 | |||
| 2587 | Ga0207677_10696072 | |||
| 2588 | Ga0207677_10723305 | |||
| 2589 | Ga0207703_10074488 | |||
| 2590 | Ga0207703_11458167 | |||
| 2591 | Ga0207639_10430698 | |||
| 2592 | Ga0207639_10764363 | |||
| 2593 | Ga0207678_10112985 | |||
| 2594 | Ga0207678_10146870 | |||
| 2595 | Ga0207678_10330038 | |||
| 2596 | Ga0207678_10353523 | |||
| 2597 | Ga0207678_10509204 | |||
| 2598 | Ga0207678_10587647 | |||
| 2599 | Ga0207678_10993361 | |||
| 2600 | Ga0207708_10026038 | |||
| 2601 | Ga0207708_10090013 | |||
| 2602 | Ga0207708_10118012 | |||
| 2603 | Ga0207708_10153468 | |||
| 2604 | Ga0207708_10213965 | |||
| 2605 | Ga0207708_10321121 | |||
| 2606 | Ga0207708_10324981 | |||
| 2607 | Ga0207708_10568282 | |||
| 2608 | Ga0207702_10033880 | |||
| 2609 | Ga0207702_10042541 | |||
| 2610 | Ga0207702_10149288 | |||
| 2611 | Ga0207702_10158054 | |||
| 2612 | Ga0207702_10503454 | |||
| 2613 | Ga0207702_10846700 | |||
| 2614 | Ga0207702_11296370 | |||
| 2615 | Ga0207641_10049012 | |||
| 2616 | Ga0207641_10308358 | |||
| 2617 | Ga0207648_10078065 | |||
| 2618 | Ga0207648_10151012 | |||
| 2619 | Ga0207648_10228692 | |||
| 2620 | Ga0207648_10334264 | |||
| 2621 | Ga0207676_10065702 | |||
| 2622 | Ga0207676_10140024 | |||
| 2623 | Ga0207676_10851219 | |||
| 2624 | Ga0207674_10134020 | |||
| 2625 | Ga0207674_10162985 | |||
| 2626 | Ga0207674_10168198 | |||
| 2627 | Ga0207674_10455687 | |||
| 2628 | Ga0207674_10532577 | |||
| 2629 | Ga0207675_100082898 | |||
| 2630 | Ga0207675_100166279 | |||
| 2631 | Ga0207675_100195629 | |||
| 2632 | Ga0207675_101470333 | |||
| 2633 | Ga0207683_10008575 | |||
| 2634 | Ga0207683_10067303 | |||
| 2635 | Ga0207683_10154003 | |||
| 2636 | Ga0207683_10358518 | |||
| 2637 | Ga0207683_10427335 | |||
| 2638 | Ga0207683_10461075 | |||
| 2639 | Ga0207683_10515193 | |||
| 2640 | Ga0207683_10740649 | |||
| 2641 | Ga0207683_10957018 | |||
| 2642 | Ga0207683_12149743 | |||
| 2643 | Ga0207698_10020583 | |||
| 2644 | Ga0207698_10324013 | |||
| 2645 | Ga0209973_1020452 | |||
| 2646 | Ga0209969_1032723 | |||
| 2647 | Ga0209967_1013822 | |||
| 2648 | Ga0209996_1031334 | |||
| 2649 | Ga0209995_1064474 | |||
| 2650 | Ga0209968_1014896 | |||
| 2651 | Ga0209999_1010955 | |||
| 2652 | Ga0209982_1034364 | |||
| 2653 | Ga0210002_1018339 | |||
| 2654 | Ga0209983_1058714 | |||
| 2655 | Ga0209971_1007217 | |||
| 2656 | Ga0209966_1025954 | |||
| 2657 | Ga0209998_10007811 | |||
| 2658 | Ga0209998_10024310 | |||
| 2659 | Ga0209974_10019832 | |||
| 2660 | Ga0207428_10000181 | |||
| 2661 | Ga0268266_10338848 | |||
| 2662 | Ga0268266_10958393 | |||
| 2663 | Ga0268265_10321086 | |||
| 2664 | Ga0268265_10997499 | |||
| 2665 | Ga0268264_10102520 | |||
| 2666 | Ga0268264_10569197 | |||
| 2667 | Ga0268264_10591831 | |||
| 2668 | Ga0268264_10756906 | |||
| 2669 | Ga0268264_11401749 | |||
| 2670 | Ga0265337_1016621 | |||
| 2671 | Ga0265337_1035179 | |||
| 2672 | Ga0265326_10014445 | |||
| 2673 | Ga0265319_1000855 | |||
| 2674 | Ga0265319_1101346 | |||
| 2675 | Ga0265334_10030082 | |||
| 2676 | Ga0265318_10033646 | |||
| 2677 | Ga0265323_10078944 | |||
| 2678 | Ga0265322_10010856 | |||
| 2679 | Ga0265336_10167246 | |||
| 2680 | Ga0265338_10030239 | |||
| 2681 | Ga0265338_10739638 | |||
| 2682 | Ga0265324_10006460 | |||
| 2683 | Ga0265324_10017063 | |||
| 2684 | Ga0265330_10010314 | |||
| 2685 | Ga0265330_10013785 | |||
| 2686 | Ga0265332_10023897 | |||
| 2687 | Ga0265332_10030283 | |||
| 2688 | Ga0265332_10153172 | |||
| 2689 | Ga0265320_10002674 | |||
| 2690 | Ga0265320_10004554 | |||
| 2691 | Ga0265325_10004083 | |||
| 2692 | Ga0265329_10003710 | |||
| 2693 | Ga0265329_10004401 | |||
| 2694 | Ga0265340_10004482 | |||
| 2695 | Ga0265339_10098430 | |||
| 2696 | Ga0265327_10003480 | |||
| 2697 | Ga0265327_10075274 | |||
| 2698 | Ga0265316_10007887 | |||
| 2699 | Ga0265316_10023310 | |||
| 2700 | Ga0265316_10059571 | |||
| 2701 | Ga0265313_10053419 | |||
| 2702 | Ga0307514_10020272 | |||
| 2703 | Ga0316575_10006117 | |||
| 2704 | Ga0316575_10317684 | |||
| 2705 | Ga0316579_10023159 | |||
| 2706 | Ga0316579_10066726 | |||
| 2707 | Ga0316579_10130380 | |||
| 2708 | Ga0316579_10145130 | |||
| 2709 | Ga0316579_10219317 | |||
| 2710 | Ga0316579_10503885 | |||
| 2711 | Ga0265314_10016170 | |||
| 2712 | Ga0265314_10116285 | |||
| 2713 | Ga0265342_10001795 | |||
| 2714 | Ga0265342_10034561 | |||
| 2715 | Ga0316576_10037846 | |||
| 2716 | Ga0316576_10043431 | |||
| 2717 | Ga0316576_10074501 | |||
| 2718 | Ga0316576_10076538 | |||
| 2719 | Ga0316576_10240448 | |||
| 2720 | Ga0316576_10689990 | |||
| 2721 | Ga0316578_10100243 | |||
| 2722 | Ga0316578_10132551 | |||
| 2723 | Ga0316578_10445361 | |||
| 2724 | Ga0307405_11648287 | |||
| 2725 | Ga0316577_10017827 | |||
| 2726 | Ga0316577_10083780 | |||
| 2727 | Ga0316577_10092089 | |||
| 2728 | Ga0316577_10224268 | |||
| 2729 | Ga0316577_10232320 | |||
| 2730 | Ga0316577_10249295 | |||
| 2731 | Ga0316577_10305216 | |||
| 2732 | Ga0316577_10520103 | |||
| 2733 | Ga0307410_10454535 | |||
| 2734 | Ga0307412_11506679 | |||
| 2735 | Ga0307409_100096715 | |||
| 2736 | Ga0307409_100548092 | |||
| 2737 | Ga0307409_101808684 | |||
| 2738 | Ga0307416_100613719 | |||
| 2739 | Ga0307416_100855774 | |||
| 2740 | Ga0307415_100625789 | |||
| 2741 | Ga0316583_10023673 | |||
| 2742 | Ga0316583_10061258 | |||
| 2743 | Ga0316585_10004351 | |||
| 2744 | Ga0316585_10091378 | |||
| 2745 | Ga0316585_10181001 | |||
| 2746 | Ga0316593_10053135 | |||
| 2747 | Ga0316593_10120476 | |||
| 2748 | Ga0316593_10250320 | |||
| 2749 | Ga0316593_10367576 | |||
| 2750 | Ga0316592_1013793 | |||
| 2751 | Ga0316592_1021646 | |||
| 2752 | Ga0316592_1026831 | |||
| 2753 | Ga0316592_1096925 | |||
| 2754 | Ga0316586_1058871 | |||
| 2755 | Ga0316587_1081568 | |||
| 2756 | Ga0316596_1025941 | |||
| 2757 | Ga0316596_1040913 | |||
| 2758 | Ga0316596_1058524 | |||
| 2759 | Ga0316596_1130116 | |||
| 2760 | Ga0316596_1146706 | |||
| 2761 | Ga0373948_0133675 | |||
| 2762 | Ga0373959_0036141 | |||
| 2763 | Ga0373959_0037465 | |||
| 2764 | Ga0373959_0117360 | |||
| 2765 | Ga0373938_0029372 | |||
| 2766 | Ga0373926_0098922 | |||
| 2767 | Ga0373929_0133040 | |||
| 2768 | Ga0373934_0069319 | |||
| 2769 | Ga0373940_0077785 | |||
| 2770 | Ga0373944_0317673 | |||
| 2771 | Ga0373949_0048275 | |||
| 2772 | Ga0373949_0076228 | |||
| 2773 | Ga0373951_0017339 | |||
| 2774 | Ga0373952_0009679 | |||
| 2775 | Ga0373952_0029204 | |||
| 2776 | Ga0373952_0089127 | |||
| 2777 | Ga0373952_0110733 | |||
| 2778 | Ga0373923_0007437 | |||
| 2779 | Ga0373932_0013656 | |||
| 2780 | Ga0373932_0075009 | |||
| 2781 | Ga0373936_0273187 | |||
| 2782 | Ga0373941_0043255 | |||
| 2783 | Ga0373941_0068497 | |||
| 2784 | Ga0373941_0148827 | |||
| 2785 | Ga0373945_0092711 | |||
| 2786 | Ga0373945_0157657 | |||
| 2787 | Ga0373953_0038654 | |||
| 2788 | Ga0373953_0091225 | |||
| 2789 | Ga0373954_0023325 | |||
| 2790 | Ga0373956_0264297 | |||
| 2791 | Ga0373956_0525352 | |||
| 2792 | Ga0373957_0010245 | |||
| 2793 | Ga0373957_0134599 | |||
| 2794 | Ga0373957_0152183 | |||
| 2795 | Ga0373960_0125435 | |||
| 2796 | Ga0373943_0004020 | |||
| 2797 | Ga0373943_0416805 | |||
| 2798 | Ga0373943_0761783 | |||
| 2799 | Ga0373946_0028376 | |||
| 2800 | Ga0373955_0106446 | |||
| 2801 | Ga0373955_0575158 | |||
| 2802 | Ga0373942_0006705 | |||
| 2803 | Ga0373942_0276851 | |||
| 2804 | Ga0373961_0032995 | |||
| 2805 | Ga0373961_0197210 | |||
| 2806 | Ga0373962_0057119 | |||
| 2807 | Ga0373962_0083237 | |||
| 2808 | Ga0373962_0148661 | |||
| 2809 | Ga0316574_0071591 | |||
| 2810 | Ga0316574_0098761 | |||
| 2811 | Ga0316574_0172997 | |||
| 2812 | Ga0316574_0224946 | |||
| 2813 | Ga0316574_0232470 | |||
| 2814 | Ga0316574_0392708 | |||
| 2815 | Ga0316574_0427029 | |||
| 2816 | Ga0373924_0037789 | |||
| 2817 | Ga0373924_0231086 | |||
| 2818 | Ga0373931_0029997 | |||
| 2819 | Ga0373931_0116969 | |||
| 2820 | Ga0373931_0126812 | |||
| 2821 | Ga0373931_1135771 | |||
| 2822 | Ga0373935_0012638 | |||
| 2823 | Ga0373927_0308574 | |||
| 2824 | Ga0373933_0181960 | |||
| 2825 | Ga0373933_0412599 | |||
| 2826 | Ga0373947_0015474 | |||
| 2827 | Ga0373947_0101636 | |||
| 2828 | Ga0373947_0245579 | |||
| 2829 | Ga0373937_0278938 | |||
| 2830 | Ga0373937_0445807 | |||
| 2831 | Ga0373937_0516876 | |||
| 2832 | Ga0373937_0708534 | |||
| 2833 | Ga0373937_0744223 | |||
| 2834 | Ga0265778_022895 | |||
| 2835 | Ga0316582_0016976 | |||
| 2836 | Ga0316582_0019246 | |||
| 2837 | Ga0316582_0180659 | |||
| 2838 | Ga0316582_0240395 | |||
| 2839 | Ga0316582_0435598 | |||
| 2840 | Ga0316582_0493860 | |||
| 2841 | Ga0316582_0790219 | |||
| 2842 | Ga0316584_0003848 | |||
| 2843 | Ga0316584_0008456 | |||
| 2844 | Ga0316584_0032481 | |||
| 2845 | Ga0316584_0122179 | |||
| 2846 | Ga0316584_0225132 | |||
| 2847 | Ga0316584_0229218 | |||
| 2848 | Ga0316584_0278001 | |||
| 2849 | Ga0316584_0359630 | |||
| 2850 | Ga0316584_0361671 | |||
| 2851 | Ga0316584_0863698 | |||
| 2852 | Ga0373925_0013236 | |||
| 2853 | Ga0373925_1026623 | |||
| 2854 | Ga0395899_0166028 | |||
| 2855 | Ga0395900_0061899 | |||
| 2856 | Ga0395900_0078136 | |||
| 2857 | Ga0395900_0103562 | |||
| 2858 | Ga0395900_0113402 | |||
| 2859 | Ga0395898_0000381 | |||
| 2860 | Ga0395898_0240350 | |||
| 2861 | Ga0395905_0518375 | |||
| 2862 | Ga0395905_0822163 | |||
| 2863 | Ga0316581_0002334 | |||
| 2864 | Ga0316581_0030105 | |||
| 2865 | Ga0316581_0060460 | |||
| 2866 | Ga0395901_0150442 | |||
| 2867 | Ga0395901_0172994 | |||
| 2868 | Ga0395901_0233292 | |||
| 2869 | Ga0395901_0492651 | |||
| 2870 | Ga0242420_122642 | |||
| 2871 | Ga0242420_165300 | |||
| 2872 | Ga0400489_12849 | |||
| 2873 | Ga0436365_0144673 | |||
| 2874 | Ga0436365_1046517 | |||
| 2875 | Ga0436361_0793921 | |||
| 2876 | Ga0436363_0126624 | |||
| 2877 | Ga0436362_0739222 | |||
| 2878 | Ga0439465_0020112 | |||
| 2879 | Ga0451789_0724155 | |||
| 2880 | Ga0451793_1457874 | |||
| 2881 | Ga0451798_0847145 | |||
| 2882 | Ga0451805_017166 | |||
| 2883 | Ga0451807_2770562 | |||
| 2884 | Ga0451833_0697339 | |||
| 2885 | Ga0451839_1230110 | |||
| 2886 | Ga0451845_0305454 | |||
| 2887 | Ga0451845_0608312 | |||
| 2888 | Ga0451849_0000801 | |||
| 2889 | Ga0451851_0422564 | |||
| 2890 | Ga0451843_0725649 | |||
| 2891 | Ga0451855_1617624 | |||
| 2892 | Ga0451853_0600829 | |||
| 2893 | Ga0451853_1418465 | |||
| 2894 | Ga0439448_0011384 | |||
| 2895 | Ga0439448_0202695 | |||
| 2896 | Ga0439450_122795 | |||
| 2897 | Ga0439450_227377 | |||
| 2898 | Ga0439455_0104539 | |||
| 2899 | Ga0439456_043915 | |||
| 2900 | Ga0450920_007738 | |||
| 2901 | Ga0450923_014865 | |||
| 2902 | Ga0450906_008981 | |||
| 2903 | Ga0450907_037255 | |||
| 2904 | Ga0439458_0148677 | |||
| 2905 | Ga0439434_0060393 | |||
| 2906 | Ga0439435_0070056 | |||
| 2907 | Ga0439444_0050696 | |||
| 2908 | Ga0439464_0165014 | |||
| 2909 | Ga0439460_0311138 | |||
| 2910 | Ga0450916_022216 | |||
| 2911 | Ga0450918_013050 | |||
| 2912 | Ga0451577_0016881 | |||
| 2913 | Ga0451577_0117036 | |||
| 2914 | Ga0451577_0143807 | |||
| 2915 | Ga0451577_0276905 | |||
| 2916 | Ga0451577_0314814 | |||
| 2917 | Ga0439440_0115149 | |||
| 2918 | Ga0466969_0103990 | |||
| 2919 | Ga0466972_0005615 | |||
| 2920 | Ga0466972_0234463 | |||
| 2921 | Ga0453683_0036050 | |||
| 2922 | Ga0453683_0154124 | |||
| 2923 | Ga0453683_0466537 | |||
| 2924 | Ga0466965_0006167 | |||
| 2925 | Ga0466965_0014387 | |||
| 2926 | Ga0466965_0107260 | |||
| 2927 | Ga0466966_0010977 | |||
| 2928 | Ga0466961_0087743 | |||
| 2929 | Ga0466961_0201841 | |||
| 2930 | Ga0466961_0204689 | |||
| 2931 | Ga0466963_0083412 | |||
| 2932 | Ga0466963_1016940 | |||
| 2933 | Ga0466964_0180154 | |||
| 2934 | Ga0466964_0224970 | |||
| 2935 | Ga0453684_0060759 | |||
| 2936 | Ga0453684_0088810 | |||
| 2937 | Ga0453684_0456657 | |||
| 2938 | Ga0453684_0491965 | |||
| 2939 | Ga0453684_0526506 | |||
| 2940 | Ga0453684_0627939 | |||
| 2941 | Ga0453684_1134237 | |||
| 2942 | Ga0453684_2424098 | |||
| 2943 | Ga0466971_0059038 | |||
| 2944 | Ga0466971_0183400 | |||
| 2945 | Ga0466971_0608400 | |||
| 2946 | Ga0466968_0354300 | |||
| 2947 | Ga0466968_0381720 | |||
| 2948 | Ga0466968_0491539 | |||
| 2949 | Ga0466970_0033983 | |||
| 2950 | Ga0466970_0072211 | |||
| 2951 | Ga0466957_0038195 | |||
| 2952 | Ga0466957_0052384 | |||
| 2953 | Ga0466957_0070960 | |||
| 2954 | Ga0466957_0196793 | |||
| 2955 | Ga0466957_0224728 | |||
| 2956 | Ga0466957_0247951 | |||
| 2957 | Ga0466960_0019581 | |||
| 2958 | Ga0466960_0057834 | |||
| 2959 | Ga0466960_0059399 | |||
| 2960 | Ga0466959_0004261 | |||
| 2961 | Ga0466959_0039513 | |||
| 2962 | Ga0451576_0034109 | |||
| 2963 | Ga0451576_0185581 | |||
| 2964 | Ga0466958_0002151 | |||
| 2965 | Ga0466958_0018252 | |||
| 2966 | Ga0466958_0031221 | |||
| 2967 | Ga0466958_0087216 | |||
| 2968 | Ga0466958_0399398 | |||
| 2969 | Ga0466967_0266913 | |||
| 2970 | Ga0466967_0903807 | |||
| 2971 | Ga0466967_1299685 | |||
| 2972 | Ga0466967_2311786 | |||
| 2973 | Ga0495592_0065934 | |||
| 2974 | Ga0495592_0233423 | |||
| 2975 | Ga0495592_0286511 | |||
| 2976 | Ga0495592_0685808 | |||
| 2977 | Ga0495603_0009479 | |||
| 2978 | Ga0495603_0097528 | |||
| 2979 | Ga0495603_0191092 | |||
| 2980 | Ga0495629_0124017 | |||
| 2981 | Ga0495629_0161553 | |||
| 2982 | Ga0495641_0006189 | |||
| 2983 | Ga0495641_0055802 | |||
| 2984 | Ga0495641_0060859 | |||
| 2985 | Ga0495651_0041297 | |||
| 2986 | Ga0495653_0011794 | |||
| 2987 | Ga0495653_0025679 | |||
| 2988 | Ga0495653_0308089 | |||
| 2989 | Ga0495650_0040933 | |||
| 2990 | Ga0495650_0048271 | |||
| 2991 | Ga0495650_0111255 | |||
| 2992 | Ga0495580_0120527 | |||
| 2993 | Ga0495582_0031758 | |||
| 2994 | Ga0495582_0080740 | |||
| 2995 | Ga0495582_0233016 | |||
| 2996 | Ga0495639_0172417 | |||
| 2997 | Ga0495639_0373464 | |||
| 2998 | Ga0495662_0019242 | |||
| 2999 | Ga0495662_0180519 | |||
| 3000 | Ga0495664_0145839 | |||
| 3001 | Ga0495664_0226434 | |||
| 3002 | Ga0495664_0949774 | |||
| 3003 | Ga0495584_0228811 | |||
| 3004 | Ga0495584_0337063 | |||
| 3005 | Ga0495584_0385238 | |||
| 3006 | Ga0495594_0367075 | |||
| 3007 | Ga0495594_0423396 | |||
| 3008 | Ga0495596_0087503 | |||
| 3009 | Ga0495606_0259492 | |||
| 3010 | Ga0495608_0060429 | |||
| 3011 | Ga0495608_0127238 | |||
| 3012 | Ga0495616_0228237 | |||
| 3013 | Ga0495618_0029382 | |||
| 3014 | Ga0495618_0060714 | |||
| 3015 | Ga0495618_0238478 | |||
| 3016 | Ga0495620_0263375 | |||
| 3017 | Ga0495628_0043996 | |||
| 3018 | Ga0495628_0867295 | |||
| 3019 | Ga0495630_0035741 | |||
| 3020 | Ga0495630_0170906 | |||
| 3021 | Ga0495637_0254397 | |||
| 3022 | Ga0495644_0187506 | |||
| 3023 | Ga0495648_0033982 | |||
| 3024 | Ga0495663_0125873 | |||
| 3025 | Ga0495663_0224886 | |||
| 3026 | Ga0495666_0031409 | |||
| 3027 | Ga0495666_0545796 | |||
| 3028 | Ga0495652_0127724 | |||
| 3029 | Ga0495652_0333093 | |||
| 3030 | Ga0495652_0787729 | |||
| 3031 | Ga0495652_1016440 | |||
| 3032 | Ga0495665_0018361 | |||
| 3033 | Ga0495640_0021538 | |||
| 3034 | Ga0495640_0302808 | |||
| 3035 | Ga0495587_0223807 | |||
| 3036 | Ga0495598_0165374 | |||
| 3037 | Ga0495609_0151753 | |||
| 3038 | Ga0495645_0071267 | |||
| 3039 | Ga0495645_0316647 | |||
| 3040 | Ga0495645_0495045 | |||
| 3041 | Ga0495667_0077476 | |||
| 3042 | Ga0495667_0516058 | |||
| 3043 | Ga0495656_0019032 | |||
| 3044 | Ga0495656_0410222 | |||
| 3045 | Ga0495634_0008932 | |||
| 3046 | Ga0495634_0132568 | |||
| 3047 | Ga0495635_0063284 | |||
| 3048 | Ga0495635_0206729 | |||
| 3049 | Ga0495635_0788357 | |||
| 3050 | Ga0495588_0006175 | |||
| 3051 | Ga0495657_0003110 | |||
| 3052 | Ga0495599_0151254 | |||
| 3053 | Ga0495599_0735957 | |||
| 3054 | Ga0495623_0296175 | |||
| 3055 | Ga0495646_0093243 | |||
| 3056 | Ga0495646_0168405 | |||
| 3057 | Ga0495647_0003870 | |||
| 3058 | Ga0495647_0004692 | |||
| 3059 | Ga0495647_0432965 | |||
| 3060 | Ga0495647_0507820 | |||
| 3061 | Ga0495658_0064282 | |||
| 3062 | Ga0495658_0070216 | |||
| 3063 | Ga0495658_0081948 | |||
| 3064 | Ga0495658_0133954 | |||
| 3065 | Ga0495658_0692567 | |||
| 3066 | Ga0495669_0117319 | |||
| 3067 | Ga0495613_0026405 | |||
| 3068 | Ga0495613_0030825 | |||
| 3069 | Ga0495613_0306163 | |||
| 3070 | Ga0495624_0156737 | |||
| 3071 | Ga0495624_0440497 | |||
| 3072 | Ga0495589_0031760 | |||
| 3073 | Ga0495600_0003596 | |||
| 3074 | Ga0495600_0183782 | |||
| 3075 | Ga0495581_0004186 | |||
| 3076 | Ga0495581_0217471 | |||
| 3077 | Ga0495604_0016907 | |||
| 3078 | Ga0495604_0288647 | |||
| 3079 | Ga0495604_0337907 | |||
| 3080 | Ga0495674_0012859 | |||
| 3081 | Ga0495674_0023760 | |||
| 3082 | Ga0495674_0238423 | |||
| 3083 | Ga0495672_0004778 | |||
| 3084 | Ga0495676_0251165 | |||
| 3085 | Ga0495676_0435511 | |||
| 3086 | Ga0495676_0474316 | |||
| 3087 | Ga0495680_0018449 | |||
| 3088 | Ga0495680_0074503 | |||
| 3089 | Ga0495680_0281901 | |||
| 3090 | Ga0495680_0445908 | |||
| 3091 | Ga0495675_0035654 | |||
| 3092 | Ga0495677_0172211 | |||
| 3093 | Ga0495684_0014399 | |||
| 3094 | Ga0495684_0014428 | |||
| 3095 | Ga0495686_0155677 | |||
| 3096 | Ga0495593_0010386 | |||
| 3097 | Ga0495593_0499110 | |||
| 3098 | Ga0495602_0048098 | |||
| 3099 | Ga0495602_0598083 | |||
| 3100 | Ga0495614_0002806 | |||
| 3101 | Ga0496100_0020442 | |||
| 3102 | Ga0496100_0037424 | |||
| 3103 | Ga0496100_0046263 | |||
| 3104 | Ga0496100_0129847 | |||
| 3105 | Ga0496100_0156060 | |||
| 3106 | Ga0496100_0263667 | |||
| 3107 | Ga0496100_0275060 | |||
| 3108 | Ga0496100_0532940 | |||
| 3109 | Ga0496100_0798570 | |||
| 3110 | Ga0496101_0029830 | |||
| 3111 | Ga0496101_0064090 | |||
| 3112 | Ga0496101_0156944 | |||
| 3113 | Ga0496101_0331525 | |||
| 3114 | Ga0496101_0415467 | |||
| 3115 | Ga0496101_0475184 | |||
| 3116 | Ga0496101_1526072 | |||
| 3117 | Ga0496102_0008426 | |||
| 3118 | Ga0496102_0039336 | |||
| 3119 | Ga0496102_0256404 | |||
| 3120 | Ga0496102_0355090 | |||
| 3121 | Ga0496102_0520129 | |||
| 3122 | Ga0496102_0596746 | |||
| 3123 | Ga0496102_0782946 | |||
| 3124 | Ga0496102_0816894 | |||
| 3125 | Ga0496102_1254518 | |||
| 3126 | Ga0496103_0019667 | |||
| 3127 | Ga0496103_0039276 | |||
| 3128 | Ga0496103_0185811 | |||
| 3129 | Ga0496103_0377231 | |||
| 3130 | Ga0496103_0458330 | |||
| 3131 | Ga0496103_0663379 | |||
| 3132 | Ga0496104_0008605 | |||
| 3133 | Ga0496104_0045348 | |||
| 3134 | Ga0496104_0054378 | |||
| 3135 | Ga0496104_0106807 | |||
| 3136 | Ga0496104_0136994 | |||
| 3137 | Ga0496104_0181317 | |||
| 3138 | Ga0496104_0958994 | |||
| 3139 | Ga0496105_0034806 | |||
| 3140 | Ga0496105_0036308 | |||
| 3141 | Ga0496105_0054080 | |||
| 3142 | Ga0496105_0069692 | |||
| 3143 | Ga0496105_0070961 | |||
| 3144 | Ga0496105_0115593 | |||
| 3145 | Ga0496105_0204619 | |||
| 3146 | Ga0496105_0839121 | |||
| 3147 | Ga0496105_1279356 | |||
| 3148 | Ga0496106_0019758 | |||
| 3149 | Ga0496106_0077650 | |||
| 3150 | Ga0496106_0169102 | |||
| 3151 | Ga0496106_0245166 | |||
| 3152 | Ga0496106_0284688 | |||
| 3153 | Ga0496106_0433338 | |||
| 3154 | Ga0496106_0625231 | |||
| 3155 | Ga0496106_0742049 | |||
| 3156 | Ga0496106_1279327 | |||
| 3157 | Ga0496107_0018477 | |||
| 3158 | Ga0496107_0023742 | |||
| 3159 | Ga0496107_0033346 | |||
| 3160 | Ga0496107_0053046 | |||
| 3161 | Ga0496107_0140243 | |||
| 3162 | Ga0496107_0480403 | |||
| 3163 | Ga0496108_0009320 | |||
| 3164 | Ga0496108_0010462 | |||
| 3165 | Ga0496108_0277693 | |||
| 3166 | Ga0496108_0574227 | |||
| 3167 | Ga0496108_0719853 | |||
| 3168 | Ga0496109_0000445 | |||
| 3169 | Ga0496109_0003257 | |||
| 3170 | Ga0496109_0082254 | |||
| 3171 | Ga0496109_0161488 | |||
| 3172 | Ga0496109_0169101 | |||
| 3173 | Ga0496109_0190345 | |||
| 3174 | Ga0496109_0217162 | |||
| 3175 | Ga0496109_0225976 | |||
| 3176 | Ga0496109_0775071 | |||
| 3177 | Ga0496109_1874503 | |||
| 3178 | Ga0496110_0000079 | |||
| 3179 | Ga0496110_0000983 | |||
| 3180 | Ga0496110_0017812 | |||
| 3181 | Ga0496110_0032177 | |||
| 3182 | Ga0496110_0207399 | |||
| 3183 | Ga0496110_0915272 | |||
| 3184 | Ga0496110_0940903 | |||
| 3185 | Ga0496111_0000557 | |||
| 3186 | Ga0496111_0001267 | |||
| 3187 | Ga0496111_0096517 | |||
| 3188 | Ga0496111_0204837 | |||
| 3189 | Ga0496111_0647267 | |||
| 3190 | Ga0496111_0954755 | |||
| 3191 | Ga0496112_0000007 | |||
| 3192 | Ga0496112_0008451 | |||
| 3193 | Ga0496112_0017728 | |||
| 3194 | Ga0496112_0055603 | |||
| 3195 | Ga0496112_0078197 | |||
| 3196 | Ga0496112_1011175 | |||
| 3197 | Ga0496112_1397289 | |||
| 3198 | Ga0496112_1623170 | |||
| 3199 | Ga0496113_0017092 | |||
| 3200 | Ga0496113_0020455 | |||
| 3201 | Ga0496113_0061383 | |||
| 3202 | Ga0496113_1519630 | |||
| 3203 | Ga0496114_0004840 | |||
| 3204 | Ga0496114_0006753 | |||
| 3205 | Ga0496114_0037031 | |||
| 3206 | Ga0496114_0046560 | |||
| 3207 | Ga0496114_0056294 | |||
| 3208 | Ga0496114_0064981 | |||
| 3209 | Ga0496114_0117309 | |||
| 3210 | Ga0496114_0241471 | |||
| 3211 | Ga0496114_0623169 | |||
| 3212 | Ga0496114_1089561 | |||
| 3213 | Ga0496115_0010379 | |||
| 3214 | Ga0496115_0012343 | |||
| 3215 | Ga0496115_0027891 | |||
| 3216 | Ga0496115_0037851 | |||
| 3217 | Ga0496115_0056073 | |||
| 3218 | Ga0496115_0073003 | |||
| 3219 | Ga0496115_0094650 | |||
| 3220 | Ga0496115_0153982 | |||
| 3221 | Ga0496115_0173105 | |||
| 3222 | Ga0496115_0783581 | |||
| 3223 | Ga0496116_0073590 | |||
| 3224 | Ga0496117_0085314 | |||
| 3225 | Ga0496117_0294273 | |||
| 3226 | Ga0496118_0005764 | |||
| 3227 | Ga0496118_0194341 | |||
| 3228 | Ga0496119_0012846 | |||
| 3229 | Ga0496120_0033281 | |||
| 3230 | Ga0496121_0267441 | |||
| 3231 | Ga0496122_0313017 | |||
| 3232 | Ga0496126_0016860 | |||
| 3233 | Ga0496126_0023859 | |||
| 3234 | Ga0496126_0093794 | |||
| 3235 | Ga0501306_015803 | |||
| 3236 | Ga0501308_008067 | |||
| 3237 | Ga0501309_033628 | |||
| 3238 | Ga0501310_007316 | |||
| 3239 | Ga0501305_018823 | |||
| 3240 | Ga0501307_059577 | |||
| 3241 | Ga0501317_013459 | |||
| 3242 | Ga0501031_0205302 | |||
| 3243 | Ga0501031_0303543 | |||
| 3244 | Ga0501031_0370991 | |||
| 3245 | Ga0501031_0441178 | |||
| 3246 | Ga0501031_0877668 | |||
| 3247 | Ga0501032_0243871 | |||
| 3248 | Ga0501032_0267891 | |||
| 3249 | Ga0501032_0318392 | |||
| 3250 | Ga0501032_1025586 | |||
| 3251 | Ga0501033_0335291 | |||
| 3252 | Ga0501033_0450220 | |||
| 3253 | Ga0501033_0780734 | |||
| 3254 | Ga0501034_0012529 | |||
| 3255 | Ga0501034_0371459 | |||
| 3256 | Ga0501034_0694229 | |||
| 3257 | Ga0501036_0036626 | |||
| 3258 | Ga0501036_0084524 | |||
| 3259 | Ga0501036_0530272 | |||
| 3260 | Ga0501037_0295303 | |||
| 3261 | Ga0501037_0389098 | |||
| 3262 | Ga0501038_0041796 | |||
| 3263 | Ga0501039_0007709 | |||
| 3264 | Ga0501039_0012581 | |||
| 3265 | Ga0501039_0332426 | |||
| 3266 | Ga0501039_0947982 | |||
| 3267 | Ga0501039_1363484 | |||
| 3268 | Ga0501040_0004923 | |||
| 3269 | Ga0501040_0079281 | |||
| 3270 | Ga0501040_0264550 | |||
| 3271 | Ga0501040_0334470 | |||
| 3272 | Ga0501040_0473144 | |||
| 3273 | Ga0501040_0541266 | |||
| 3274 | Ga0501041_0038812 | |||
| 3275 | Ga0501041_0071912 | |||
| 3276 | Ga0501041_0222709 | |||
| 3277 | Ga0501041_0470904 | |||
| 3278 | Ga0501041_0512440 | |||
| 3279 | Ga0501042_0027184 | |||
| 3280 | Ga0501042_0326457 | |||
| 3281 | Ga0501042_0514206 | |||
| 3282 | Ga0501042_0612620 | |||
| 3283 | Ga0501043_0022634 | |||
| 3284 | Ga0501043_0361287 | |||
| 3285 | Ga0501043_0386469 | |||
| 3286 | Ga0501046_0134747 | |||
| 3287 | Ga0501046_0820294 | |||
| 3288 | Ga0501047_0099339 | |||
| 3289 | Ga0501047_0583711 | |||
| 3290 | Ga0501048_0010287 | |||
| 3291 | Ga0501048_0132559 | |||
| 3292 | Ga0501048_0307824 | |||
| 3293 | Ga0501067_0003078 | |||
| 3294 | Ga0501067_0042917 | |||
| 3295 | Ga0501067_0265468 | |||
| 3296 | Ga0501067_0379170 | |||
| 3297 | Ga0501068_0002322 | |||
| 3298 | Ga0501068_0033823 | |||
| 3299 | Ga0501068_0400123 | |||
| 3300 | Ga0501068_0441565 | |||
| 3301 | Ga0501069_0000453 | |||
| 3302 | Ga0501069_0023498 | |||
| 3303 | Ga0501069_0063145 | |||
| 3304 | Ga0501069_0120939 | |||
| 3305 | Ga0501069_0625440 | |||
| 3306 | Ga0501070_0003383 | |||
| 3307 | Ga0501070_0005689 | |||
| 3308 | Ga0501070_0078845 | |||
| 3309 | Ga0501070_0082198 | |||
| 3310 | Ga0501070_0824638 | |||
| 3311 | Ga0501071_0000119 | |||
| 3312 | Ga0501071_0001083 | |||
| 3313 | Ga0501071_0003597 | |||
| 3314 | Ga0501071_0013395 | |||
| 3315 | Ga0501071_0035692 | |||
| 3316 | Ga0501071_0079974 | |||
| 3317 | Ga0501071_0093200 | |||
| 3318 | Ga0501071_0186402 | |||
| 3319 | Ga0501071_0232425 | |||
| 3320 | Ga0501071_0325563 | |||
| 3321 | Ga0501071_0594473 | |||
| 3322 | Ga0501071_0649097 | |||
| 3323 | Ga0501072_0003791 | |||
| 3324 | Ga0501072_0196150 | |||
| 3325 | Ga0501072_0391552 | |||
| 3326 | Ga0501072_0838180 | |||
| 3327 | Ga0501073_0050481 | |||
| 3328 | Ga0501073_0348598 | |||
| 3329 | Ga0501073_0397229 | |||
| 3330 | Ga0501074_0080636 | |||
| 3331 | Ga0501074_0201833 | |||
| 3332 | Ga0501074_0219858 | |||
| 3333 | Ga0501074_0460017 | |||
| 3334 | Ga0501075_0003018 | |||
| 3335 | Ga0501075_0017924 | |||
| 3336 | Ga0501075_0065727 | |||
| 3337 | Ga0501075_0417306 | |||
| 3338 | Ga0501075_0724896 | |||
| 3339 | Ga0501076_0011794 | |||
| 3340 | Ga0501076_0018028 | |||
| 3341 | Ga0501076_0025886 | |||
| 3342 | Ga0501076_0235600 | |||
| 3343 | Ga0501076_0395260 | |||
| 3344 | Ga0501076_0626588 | |||
| 3345 | Ga0501076_0969926 | |||
| 3346 | Ga0501077_0001393 | |||
| 3347 | Ga0501077_0013176 | |||
| 3348 | Ga0501077_0341118 | |||
| 3349 | Ga0501077_0547376 | |||
| 3350 | Ga0501079_0001191 | |||
| 3351 | Ga0501079_0008393 | |||
| 3352 | Ga0501079_0294174 | |||
| 3353 | Ga0501079_0296414 | |||
| 3354 | Ga0501079_0369740 | |||
| 3355 | Ga0501079_0721627 | |||
| 3356 | Ga0501080_0058666 | |||
| 3357 | Ga0501080_0208610 | |||
| 3358 | Ga0501080_0621568 | |||
| 3359 | Ga0501080_0715172 | |||
| 3360 | Ga0501080_0931016 | |||
| 3361 | Ga0501080_1081449 | |||
| 3362 | Ga0501081_0000266 | |||
| 3363 | Ga0501081_0016532 | |||
| 3364 | Ga0501081_0536745 | |||
| 3365 | Ga0501081_1153071 | |||
| 3366 | Ga0501083_0058547 | |||
| 3367 | Ga0501083_0111389 | |||
| 3368 | Ga0501083_0539371 | |||
| 3369 | Ga0501083_0655407 | |||
| 3370 | Ga0501083_0761909 | |||
| 3371 | Ga0501035_0834418 | |||
| 3372 | Ga0501044_0553545 | |||
| 3373 | Ga0501045_0010860 | |||
| 3374 | Ga0501045_0031322 | |||
| 3375 | Ga0501045_0159456 | |||
| 3376 | Ga0501045_0165912 | |||
| 3377 | Ga0501045_0284278 | |||
| 3378 | Ga0501045_0918306 | |||
| 3379 | nmdc:mga00v17_41757_c1 | |||
| 3380 | nmdc:mga0yw44_18369_c1 | |||
| 3381 | nmdc:mga0yw44_310776_c1 | |||
| 3382 | nmdc:mga0yw44_47549_c1 | |||
| 3383 | nmdc:mga06z11_349474_c1 | |||
| 3384 | nmdc:mga07m45_108234_c1 | |||
| 3385 | nmdc:mga05p37_24103_c1 | |||
| 3386 | nmdc:mga05p37_33875_c1 | |||
| 3387 | nmdc:mga05p37_3540_c1 | |||
| 3388 | nmdc:mga09592_208420_c2 | |||
| 3389 | nmdc:mga09592_51891_c1 | |||
| 3390 | nmdc:mga0qj67_418401_c1 | |||
| 3391 | nmdc:mga06r32_134251_c1 | |||
| 3392 | nmdc:mga08y16_1246015_c1 | |||
| 3393 | nmdc:mga08y16_266255_c1 | |||
| 3394 | nmdc:mga08y16_433649_c1 | |||
| 3395 | nmdc:mga08y16_82947_c1 | |||
| 3396 | nmdc:mga0n895_1104575_c1 | |||
| 3397 | nmdc:mga0n895_21002_c1 | |||
| 3398 | nmdc:mga0n895_279161_c1 | |||
| 3399 | nmdc:mga0n895_363286_c1 | |||
| 3400 | nmdc:mga0n895_479689_c1 | |||
| 3401 | nmdc:mga0n895_489885_c1 | |||
| 3402 | nmdc:mga0n895_56580_c1 | |||
| 3403 | nmdc:mga0n895_719278_c1 | |||
| 3404 | nmdc:mga0rr50_179533_c1 | |||
| 3405 | nmdc:mga0rr50_199265_c1 | |||
| 3406 | nmdc:mga0rr50_368092_c1 | |||
| 3407 | nmdc:mga0rr50_67644_c1 | |||
| 3408 | nmdc:mga08x19_338891_c1 | |||
| 3409 | nmdc:mga08x19_367925_c1 | |||
| 3410 | nmdc:mga08x19_425770_c1 | |||
| 3411 | nmdc:mga0a205_1468245_c1 | |||
| 3412 | nmdc:mga0a205_2010_c1 | |||
| 3413 | nmdc:mga0a205_252371_c1 | |||
| 3414 | nmdc:mga0a205_25674_c1 | |||
| 3415 | nmdc:mga0a205_271456_c1 | |||
| 3416 | nmdc:mga0a205_327973_c1 | |||
| 3417 | Ga0495601_0016271 | |||
| 3418 | Ga0495601_0045561 | |||
| 3419 | Ga0495601_0050354 | |||
| 3420 | Ga0495601_0073549 | |||
| 3421 | Ga0495601_0157372 | |||
| 3422 | Ga0495601_0459998 | |||
| 3423 | Ga0495601_0598805 | |||
| 3424 | Ga0495612_0109786 | |||
| 3425 | Ga0495612_0125030 | |||
| 3426 | Ga0500635_0000204 | |||
| 3427 | Ga0495655_0079213 | |||
| 3428 | Ga0495595_0046669 | |||
| 3429 | Ga0495595_0088470 | |||
| 3430 | Ga0495619_0007866 | |||
| 3431 | Ga0495619_0026075 | |||
| 3432 | Ga0495619_0067168 | |||
| 3433 | Ga0495619_0250509 | |||
| 3434 | Ga0495619_0550580 | |||
| 3435 | Ga0501084_0006409 | |||
| 3436 | Ga0501084_0015419 | |||
| 3437 | Ga0501084_0162417 | |||
| 3438 | Ga0501084_0179330 | |||
| 3439 | Ga0590071_046949 | |||
| 3440 | Ga0587084_008557 | |||
| 3441 | Ga0587084_093124 | |||
| 3442 | Ga0587093_032545 | |||
| 3443 | Ga0587066_105217 | |||
| 3444 | Ga0587070_026154 | |||
| 3445 | Ga0587070_056270 | |||
| 3446 | Ga0587070_057172 | |||
| 3447 | Ga0587070_101553 | |||
| 3448 | Ga0587073_0070967 | |||
| 3449 | Ga0587073_0217606 | |||
| 3450 | Ga0587077_077231 | |||
| 3451 | Ga0587077_132746 | |||
| 3452 | Ga0587077_261026 | |||
| 3453 | Ga0587080_028007 | |||
| 3454 | Ga0587080_029121 | |||
| 3455 | Ga0587080_033122 | |||
| 3456 | Ga0587080_078742 | |||
| 3457 | Ga0587080_153072 | |||
| 3458 | Ga0587082_108034 | |||
| 3459 | Ga0587083_0003623 | |||
| 3460 | Ga0587083_0097976 | |||
| 3461 | Ga0587083_0122413 | |||
| 3462 | Ga0587083_0258639 | |||
| 3463 | Ga0587085_009458 | |||
| 3464 | Ga0587088_003103 | |||
| 3465 | Ga0587088_061741 | |||
| 3466 | Ga0587089_015017 | |||
| 3467 | Ga0587090_021586 | |||
| 3468 | Ga0587090_034598 | |||
| 3469 | Ga0587091_018726 | |||
| 3470 | Ga0587091_018976 | |||
| 3471 | Ga0587091_041792 | |||
| 3472 | Ga0587091_068825 | |||
| 3473 | Ga0587091_080519 | |||
| 3474 | Ga0587092_043274 | |||
| 3475 | Ga0587094_126096 | |||
| 3476 | Ga0587098_037316 | |||
| 3477 | Ga0587098_088197 | |||
| 3478 | Ga0587106_135570 | |||
| 3479 | Ga0587101_045628 | |||
| 3480 | Ga0587122_000616 | |||
| 3481 | Ga0587122_045407 | |||
| 3482 | Ga0587128_000395 | |||
| 3483 | Ga0587128_022020 | |||
| 3484 | Ga0587128_045034 | |||
| 3485 | Ga0587128_046109 | |||
| 3486 | Ga0587062_075427 | |||
| 3487 | Ga0587067_058027 | |||
| 3488 | Ga0587067_130653 | |||
| 3489 | Ga0587067_152189 | |||
| 3490 | Ga0587068_008623 | |||
| 3491 | Ga0587069_014182 | |||
| 3492 | Ga0587069_061781 | |||
| 3493 | Ga0587072_126320 | |||
| 3494 | Ga0587075_018259 | |||
| 3495 | Ga0587075_053703 | |||
| 3496 | Ga0587076_014556 | |||
| 3497 | Ga0587076_035987 | |||
| 3498 | Ga0587079_050510 | |||
| 3499 | Ga0587079_063562 | |||
| 3500 | Ga0587102_001277 | |||
| 3501 | Ga0587107_068402 | |||
| 3502 | Ga0587107_104737 | |||
| 3503 | Ga0587110_016957 | |||
| 3504 | Ga0587110_038518 | |||
| 3505 | Ga0587114_009697 | |||
| 3506 | Ga0587114_070143 | |||
| 3507 | Ga0587120_026200 | |||
| 3508 | Ga0587071_063222 | |||
| 3509 | Ga0587071_074609 | |||
| 3510 | Ga0587071_088613 | |||
| 3511 | Ga0587071_089239 | |||
| 3512 | Ga0587071_102775 | |||
| 3513 | Ga0587111_0081325 | |||
| 3514 | Ga0587111_0119404 | |||
| 3515 | Ga0587111_0178622 | |||
| 3516 | Ga0501082_0014508 | |||
| 3517 | Ga0501082_0020323 | |||
| 3518 | Ga0501082_0410999 | |||
| 3519 | Ga0501082_0521707 | |||
| 3520 | Ga0501082_1212715 | |||
| 3521 | Ga0501082_1991016 | |||
| 3522 | Ga0466962_0032211 | |||
| 3523 | Ga0530510_0042730 | |||
| 3524 | Ga0530510_0061548 | |||
| 3525 | Ga0530510_0126308 | |||
| 3526 | Ga0530510_0641936 | |||
| 3527 | Ga0530510_1078602 | |||
| 3528 | 2547411357 | |||
| 3529 | 2554256760 | |||
| 3530 | 2616696762 | |||
| 3531 | 2616901906 | |||
| 3532 | 2644439365 | |||
| 3533 | 2644633261 | |||
| 3534 | 2784589770 | |||
| 3535 | 2808843366 | |||
| 3536 | 2809233440 | |||
| 3537 | 2812356679 | |||
| 3538 | 2812479392 | |||
| 3539 | 2852643123 | |||
| 3540 | 2862185297 | |||
| 3541 | 2862292094 | |||
| 3542 | 2862516757 | |||
| 3543 | 2867429963 | |||
| 3544 | 2912718428 | |||
| 3545 | 2912730754 | |||
| 3546 | 2919470265 | |||
| 3547 | 2935395234 | |||
| 3548 | 2946069192 | |||
| 3549 | 2946077140 | |||
| 3550 | 2947227742 | |||
| 3551 | 2954695554 | |||
| 3552 | 2954710748 | |||
| 3553 | 2954714977 | |||
| 3554 | 2954724919 | |||
| 3555 | 2954736899 | |||
| 3556 | 2954743845 | |||
| 3557 | 2954755747 | |||
| 3558 | 2954762798 | |||
| 3559 | 3006398680 | |||
| 3560 | 3006490571 | |||
| 3561 | 3006498854 | |||
| 3562 | 8002784650 | |||
| 3563 | 8023626963 | |||
| 3564 | 8025417220 | |||
| 3565 | 8033691144 | |||
| 3566 | 8056837587 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1l2b-assembly1.cif.gz_A | mutm (fpg) dna end-product structure | 0.9115 | 25 | 58 |
| 3vk7-assembly2.cif.gz_B | crystal structure of dna-glycosylase bound to dna containing 5-hydroxyuracil | 0.9038 | 25 | 60 |
| 3a46-assembly2.cif.gz_B | crystal structure of mvnei1/thf complex | 0.9022 | 25 | 60 |
| 1l1z-assembly1.cif.gz_A | mutm (fpg) covalent-dna intermediate | 0.902 | 25 | 58 |
| 4nrw-assembly2.cif.gz_B | mvnei1-g86d | 0.9017 | 25 | 60 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1i94M01 | Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; | 0.9273 | 14 | 63 | 1.10.8.50 |
| af_Q8HCP0_1_71_1.10.8.50 | Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; | 0.903 | 1 | 70 | 1.10.8.50 |
| af_P54019_1_77_1.10.8.50 | Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; | 0.9012 | 2 | 60 | 1.10.8.50 |
| af_A0A1D8PQQ5_1_82_1.10.8.50 | Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; | 0.8966 | 2 | 61 | 1.10.8.50 |
| af_P9WH61_1_72_1.10.8.50 | Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; | 0.8963 | 1 | 71 | 1.10.8.50 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6A6K1H1-F1-model_v4 | DNA-directed RNA polymerase (EC 2.7.7.6) (Plastid-encoded RNA polymerase subunit alpha) | 0.9206 | 2 | 67 |
GO:0000428
GO:0001054 GO:0001055 GO:0001056 GO:0001057 GO:0001058 GO:0001065 GO:0001066 GO:0003677 GO:0003735 GO:0005737 GO:0005840 GO:0006412 GO:0019843 GO:0046983 GO:1990904 |
| AF-M2S144-F1-model_v4 | 40S ribosomal protein S18 | 0.9139 | 1 | 61 |
GO:0003723
GO:0003735 GO:0005829 GO:0006412 GO:0015935 |
| AF-A0A7C0UWM7-F1-model_v4 | 30S ribosomal protein S13 | 0.9136 | 2 | 60 |
GO:0003723
GO:0003735 GO:0005829 GO:0006412 GO:0015935 |
| AF-A0A1J3D8M4-F1-model_v4 | 40S ribosomal protein S18 | 0.9114 | 2 | 62 |
GO:0003723
GO:0003735 GO:0005829 GO:0006412 GO:0015935 |
| AF-A0A7I9XLN3-F1-model_v4 | Small ribosomal subunit protein uS11 | 0.9052 | 3 | 67 |
GO:0003735
GO:0005840 GO:0006412 GO:0019843 GO:1990904 |