metagRoot

F495686

General Info

Members	Datasets	Scaffolds	Average Seq Length
1783	712	3566	256

Family's Representative Sequence

Representative Sequence	3300005614\|Ga0068856_100717839\|Ga0068856_1007178391
Length	267
Sequence	MITLTSAEINQWMISFFWPLARILALVAAAPVLGNTAIPTRVKIGLGALVTFVIAPMIETPPKIDPASLEGLLVLGQQILIGLAMGFAMRIIFSGVEMAGEIAGLQMGLGFATFFSSHSEGSTLVVGKFLGLLATLAFLSVNGHLLMLSVLAESFNAFPISAEPFSVTGWRTLADWGSQIFLAGLKLALPVVATLMIVNLALGILTRAAPQLNIFAVGFPITLMAGMVALMLSLPYFTPVIEQLISEGLQTMLDIANGARATPPKAR

Samples

	Sample ID	Description	Type	Environment
1	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
2	2124908027	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1	Metagenome	Rhizosphere
3	2162886007	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1	Metagenome	Rhizosphere
4	2162886012	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1	Metagenome	Rhizosphere
5	3300001915	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7	Metagenome	Rhizosphere
6	3300002737	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA	Metagenome	Endosphere
7	3300002738	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA	Metagenome	Unclassified
8	3300002771	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB	Metagenome	Endosphere
9	3300002772	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS	Metagenome	Endosphere
10	3300003187	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB	Metagenome	Endosphere
11	3300003214	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL	Metagenome	Endosphere
12	3300003347	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM	Metagenome	Rhizosphere
13	3300003751	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2	Metagenome	Endosphere
14	3300003752	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2	Metagenome	Endosphere
15	3300003756	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2	Metagenome	Endosphere
16	3300003758	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2	Metagenome	Endosphere
17	3300003759	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2	Metagenome	Endosphere
18	3300003781	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2	Metagenome	Endosphere
19	3300003791	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2	Metagenome	Endosphere
20	3300003792	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2	Metagenome	Endosphere
21	3300003794	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2	Metagenome	Endosphere
22	3300003841	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2	Metagenome	Endosphere
23	3300005262	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3)	Metagenome	Endosphere
24	3300005288	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2)	Metagenome	Rhizosphere
25	3300005289	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2)	Metagenome	Rhizosphere
26	3300005290	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3)	Metagenome	Rhizosphere
27	3300005293	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2)	Metagenome	Rhizosphere
28	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
29	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
30	3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Metagenome	Rhizosphere
31	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
32	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
33	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
34	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
35	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
36	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
37	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
38	3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Metagenome	Rhizosphere
39	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
40	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
41	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
42	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
43	3300005466	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG	Metagenome	Rhizosphere
44	3300005468	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG	Metagenome	Rhizosphere
45	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
46	3300005536	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG	Metagenome	Rhizosphere
47	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
48	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
49	3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Metagenome	Rhizosphere
50	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
51	3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Metagenome	Rhizosphere
52	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
53	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
54	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
55	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
56	3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Metagenome	Rhizosphere
57	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
58	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
59	3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Metagenome	Rhizosphere
60	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
61	3300005834	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2	Metagenome	Rhizosphere
62	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
63	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
64	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
65	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
66	3300006051	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Metagenome	Endosphere
67	3300006058	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1	Metagenome	Rhizosphere
68	3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Metagenome	Rhizosphere
69	3300006177	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2	Metagenome	Endosphere
70	3300006353	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5	Metagenome	Endosphere
71	3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Metagenome	Rhizosphere
72	3300006846	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Metagenome	Rhizosphere
73	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
74	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
75	3300006880	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Metagenome	Rhizosphere
76	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
77	3300006914	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5	Metagenome	Rhizosphere
78	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
79	3300006944	Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW	Metagenome	Nodule
80	3300006946	Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG	Metagenome	Nodule
81	3300006948	Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15	Metagenome	Nodule
82	3300009011	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG	Metagenome	Rhizosphere
83	3300009036	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG	Metagenome	Rhizosphere
84	3300009092	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG	Metagenome	Rhizosphere
85	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
86	3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Metagenome	Rhizosphere
87	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
88	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
89	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
90	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
91	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
92	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
93	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
94	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
95	3300012498	Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410	Metagenome	Rhizosphere
96	3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Metagenome	Rhizosphere
97	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
98	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
99	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
100	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
101	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
102	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
103	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
104	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
105	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
106	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
107	3300014497	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG	Metagenome	Rhizosphere
108	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
109	3300015261	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG	Metagenome	Rhizosphere
110	3300015262	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG	Metagenome	Rhizosphere
111	3300015265	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG	Metagenome	Rhizosphere
112	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
113	3300021361	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2	Metagenome	Rhizosphere
114	3300025206	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2)	Metagenome	Unclassified
115	3300025207	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2)	Metagenome	Endosphere
116	3300025224	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
117	3300025225	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
118	3300025226	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
119	3300025229	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
120	3300025230	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2)	Metagenome	Endosphere
121	3300025231	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2)	Metagenome	Endosphere
122	3300025233	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2)	Metagenome	Endosphere
123	3300025242	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
124	3300025246	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2)	Metagenome	Unclassified
125	3300025253	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
126	3300025256	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2)	Metagenome	Unclassified
127	3300025261	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2)	Metagenome	Endosphere
128	3300025284	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2)	Metagenome	Endosphere
129	3300025292	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
130	3300025298	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
131	3300025303	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
132	3300025304	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
133	3300025321	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
134	3300025711	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
135	3300025728	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
136	3300025735	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
137	3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
138	3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
139	3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
140	3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
141	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
142	3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
143	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
144	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
145	3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
146	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
147	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
148	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
149	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
150	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
151	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
152	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
153	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
154	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
155	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
156	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
157	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
158	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
159	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
160	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
161	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
162	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
163	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
164	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
165	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
166	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
167	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
168	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
169	3300027111	Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2)	Metagenome	Nodule
170	3300027296	Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2)	Metagenome	Nodule
171	3300027312	Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2)	Metagenome	Rhizosphere
172	3300027424	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2)	Metagenome	Rhizosphere
173	3300027471	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2)	Metagenome	Rhizosphere
174	3300027543	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2)	Metagenome	Rhizosphere
175	3300027665	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2)	Metagenome	Rhizosphere
176	3300027876	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2)	Metagenome	Rhizosphere
177	3300027907	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3)	Metagenome	Rhizosphere
178	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
179	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
180	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
181	3300028577	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG	Metagenome	Rhizosphere
182	3300028666	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG	Metagenome	Rhizosphere
183	3300028786	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM	Metagenome	Unclassified
184	3300028800	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG	Metagenome	Rhizosphere
185	3300029957	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG	Metagenome	Rhizosphere
186	3300030500	Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3)	Metagenome	Rhizosphere
187	3300030521	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM	Metagenome	Unclassified
188	3300030733	Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2	Metagenome	Rhizosphere
189	3300030735	Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4	Metagenome	Rhizosphere
190	3300030742	Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9	Metagenome	Rhizosphere
191	3300031235	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG	Metagenome	Rhizosphere
192	3300031238	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG	Metagenome	Rhizosphere
193	3300031239	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG	Metagenome	Rhizosphere
194	3300031240	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG	Metagenome	Rhizosphere
195	3300031241	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG	Metagenome	Rhizosphere
196	3300031249	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG	Metagenome	Rhizosphere
197	3300031250	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG	Metagenome	Rhizosphere
198	3300031251	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG	Metagenome	Rhizosphere
199	3300031344	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG	Metagenome	Rhizosphere
200	3300031456	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM	Metagenome	Unclassified
201	3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Metagenome	Rhizosphere
202	3300031665	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3	Metagenome	Rhizosphere
203	3300031691	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA	Metagenome	Rhizosphere
204	3300031711	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG	Metagenome	Rhizosphere
205	3300031712	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG	Metagenome	Rhizosphere
206	3300031727	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5	Metagenome	Rhizosphere
207	3300031728	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC	Metagenome	Rhizosphere
208	3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Metagenome	Rhizosphere
209	3300031733	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1	Metagenome	Rhizosphere
210	3300031824	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2	Metagenome	Rhizosphere
211	3300031852	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3	Metagenome	Rhizosphere
212	3300031901	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2	Metagenome	Rhizosphere
213	3300031903	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1	Metagenome	Rhizosphere
214	3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Metagenome	Rhizosphere
215	3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Metagenome	Rhizosphere
216	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
217	3300032004	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3	Metagenome	Rhizosphere
218	3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Metagenome	Rhizosphere
219	3300032133	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA	Metagenome	Rhizosphere
220	3300032168	Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
221	3300033180	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM	Metagenome	Unclassified
222	3300035172	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3	Metagenome	Rhizosphere
223	3300035398	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1	Metagenome	Rhizosphere
224	3300035695	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19	Metagenome	Rhizosphere
225	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
226	3300036647	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA	Metagenome	Rhizosphere
227	3300036712	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA	Metagenome	Rhizosphere
228	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
229	3300037471	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11	Metagenome	Rhizosphere
230	3300037588	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA	Metagenome	Rhizosphere
231	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
232	3300038705	Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1	Metagenome	Unclassified
233	3300038725	Seagrass microbial communities from Seahorse Key, FL, USA - HV0818	Metagenome	Unclassified
234	3300038726	Seagrass microbial communities from Seahorse Key, FL, USA - TH0319	Metagenome	Unclassified
235	3300038727	Seagrass microbial communities from Seahorse Key, FL, USA - TV0818	Metagenome	Unclassified
236	3300038735	Seagrass microbial communities from Seahorse Key, FL, USA - SH0319	Metagenome	Unclassified
237	3300038741	Seagrass microbial communities from Seahorse Key, FL, USA - SV0818	Metagenome	Unclassified
238	3300038742	Seagrass microbial communities from Seahorse Key, FL, USA - SH0818	Metagenome	Unclassified
239	3300039062	Seagrass microbial communities from Seahorse Key, FL, USA - HH0818	Metagenome	Unclassified
240	3300039093	Seagrass microbial communities from Seahorse Key, FL, USA - TH0818	Metagenome	Unclassified
241	3300039110	Seagrass microbial communities from Seahorse Key, FL, USA - SV0319	Metagenome	Unclassified
242	3300039437	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2	Metagenome	Unclassified
243	3300039447	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2	Metagenome	Rhizosphere
244	3300041404	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272	Metagenome	Rhizosphere
245	3300041405	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414	Metagenome	Rhizosphere
246	3300041407	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416	Metagenome	Rhizosphere
247	3300041411	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708	Metagenome	Rhizosphere
248	3300041413	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839	Metagenome	Rhizosphere
249	3300041997	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607	Metagenome	Rhizosphere
250	3300042000	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539	Metagenome	Rhizosphere
251	3300042003	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551	Metagenome	Rhizosphere
252	3300042004	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619	Metagenome	Rhizosphere
253	3300042006	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437	Metagenome	Rhizosphere
254	3300042009	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348	Metagenome	Rhizosphere
255	3300042010	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431	Metagenome	Rhizosphere
256	3300042012	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213	Metagenome	Rhizosphere
257	3300042013	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339	Metagenome	Rhizosphere
258	3300042016	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357	Metagenome	Rhizosphere
259	3300042115	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642	Metagenome	Rhizosphere
260	3300042121	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398	Metagenome	Rhizosphere
261	3300042136	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294	Metagenome	Rhizosphere
262	3300042137	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519	Metagenome	Rhizosphere
263	3300042138	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379	Metagenome	Rhizosphere
264	3300042139	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442	Metagenome	Rhizosphere
265	3300042142	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610	Metagenome	Rhizosphere
266	3300042145	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581	Metagenome	Rhizosphere
267	3300042146	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979	Metagenome	Rhizosphere
268	3300042147	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618	Metagenome	Rhizosphere
269	3300042156	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593	Metagenome	Rhizosphere
270	3300042184	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630	Metagenome	Rhizosphere
271	3300042185	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592	Metagenome	Rhizosphere
272	3300042435	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613	Metagenome	Rhizosphere
273	3300042438	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533	Metagenome	Rhizosphere
274	3300042439	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363	Metagenome	Rhizosphere
275	3300042461	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366	Metagenome	Rhizosphere
276	3300042530	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047	Metagenome	Rhizosphere
277	3300042531	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253	Metagenome	Rhizosphere
278	3300042532	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92	Metagenome	Rhizosphere
279	3300042533	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472	Metagenome	Rhizosphere
280	3300042876	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED	Metagenome	Rhizosphere
281	3300044658	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R	Metagenome	Rhizosphere
282	3300044666	Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1E	Metagenome	Unclassified
283	3300044673	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED	Metagenome	Rhizosphere
284	3300044693	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R	Metagenome	Rhizosphere
285	3300044712	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED	Metagenome	Rhizosphere
286	3300044765	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R	Metagenome	Rhizosphere
287	3300045051	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED	Metagenome	Rhizosphere
288	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
289	3300046452	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere	Metagenome	Rhizosphere
290	3300046453	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere	Metagenome	Rhizosphere
291	3300046454	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere	Metagenome	Rhizosphere
292	3300046455	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere	Metagenome	Rhizosphere
293	3300046457	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere	Metagenome	Rhizosphere
294	3300046458	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere	Metagenome	Rhizosphere
295	3300046460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere	Metagenome	Rhizosphere
296	3300046463	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere	Metagenome	Rhizosphere
297	3300046471	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere	Metagenome	Rhizosphere
298	3300046474	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere	Metagenome	Rhizosphere
299	3300046475	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere	Metagenome	Rhizosphere
300	3300046491	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere	Metagenome	Rhizosphere
301	3300046492	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere	Metagenome	Rhizosphere
302	3300046499	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere	Metagenome	Rhizosphere
303	3300046500	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere	Metagenome	Rhizosphere
304	3300046501	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere	Metagenome	Rhizosphere
305	3300046506	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere	Metagenome	Rhizosphere
306	3300046507	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere	Metagenome	Rhizosphere
307	3300046512	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere	Metagenome	Rhizosphere
308	3300046513	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere	Metagenome	Rhizosphere
309	3300046515	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere	Metagenome	Rhizosphere
310	3300046516	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere	Metagenome	Rhizosphere
311	3300046517	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere	Metagenome	Rhizosphere
312	3300046518	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere	Metagenome	Rhizosphere
313	3300046519	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere	Metagenome	Rhizosphere
314	3300046520	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere	Metagenome	Rhizosphere
315	3300046522	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere	Metagenome	Rhizosphere
316	3300046523	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere	Metagenome	Rhizosphere
317	3300046524	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere	Metagenome	Rhizosphere
318	3300046526	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere	Metagenome	Rhizosphere
319	3300046528	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere	Metagenome	Rhizosphere
320	3300046529	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere	Metagenome	Rhizosphere
321	3300046530	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere	Metagenome	Rhizosphere
322	3300046533	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere	Metagenome	Rhizosphere
323	3300046535	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere	Metagenome	Rhizosphere
324	3300046536	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere	Metagenome	Rhizosphere
325	3300046538	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere	Metagenome	Rhizosphere
326	3300046542	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere	Metagenome	Rhizosphere
327	3300046543	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere	Metagenome	Rhizosphere
328	3300046557	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere	Metagenome	Rhizosphere
329	3300046558	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere	Metagenome	Rhizosphere
330	3300046615	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere	Metagenome	Rhizosphere
331	3300046616	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere	Metagenome	Rhizosphere
332	3300046642	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere	Metagenome	Rhizosphere
333	3300046648	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere	Metagenome	Rhizosphere
334	3300046660	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere	Metagenome	Rhizosphere
335	3300046663	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere	Metagenome	Rhizosphere
336	3300046664	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere	Metagenome	Rhizosphere
337	3300046665	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere	Metagenome	Rhizosphere
338	3300046674	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere	Metagenome	Rhizosphere
339	3300046679	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere	Metagenome	Rhizosphere
340	3300046683	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere	Metagenome	Rhizosphere
341	3300046684	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere	Metagenome	Rhizosphere
342	3300046689	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere	Metagenome	Rhizosphere
343	3300046690	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere	Metagenome	Rhizosphere
344	3300046691	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere	Metagenome	Rhizosphere
345	3300046692	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere	Metagenome	Rhizosphere
346	3300046694	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere	Metagenome	Rhizosphere
347	3300046794	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere	Metagenome	Rhizosphere
348	3300046809	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere	Metagenome	Rhizosphere
349	3300046810	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere	Metagenome	Rhizosphere
350	3300047317	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere	Metagenome	Rhizosphere
351	3300047318	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere	Metagenome	Rhizosphere
352	3300047319	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere	Metagenome	Rhizosphere
353	3300047320	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere	Metagenome	Rhizosphere
354	3300047321	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere	Metagenome	Rhizosphere
355	3300047322	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere	Metagenome	Rhizosphere
356	3300047323	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere	Metagenome	Rhizosphere
357	3300047443	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere	Metagenome	Rhizosphere
358	3300047445	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere	Metagenome	Rhizosphere
359	3300047446	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere	Metagenome	Rhizosphere
360	3300047469	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere	Metagenome	Rhizosphere
361	3300047470	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere	Metagenome	Rhizosphere
362	3300047472	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere	Metagenome	Rhizosphere
363	3300047673	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere	Metagenome	Rhizosphere
364	3300048088	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere	Metagenome	Rhizosphere
365	3300048091	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere	Metagenome	Rhizosphere
366	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
367	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
368	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
369	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
370	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
371	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
372	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
373	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
374	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
375	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
376	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
377	3300048919	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled	Metagenome	Unclassified
378	3300048920	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15	Metagenome	Unclassified
379	3300048921	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15	Metagenome	Unclassified
380	3300048922	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15	Metagenome	Unclassified
381	3300048923	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15	Metagenome	Unclassified
382	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
383	3300048925	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled	Metagenome	Unclassified
384	3300048926	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled	Metagenome	Unclassified
385	3300048927	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15	Metagenome	Unclassified
386	3300048928	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15	Metagenome	Unclassified
387	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
388	3300049459	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere	Metagenome	Rhizosphere
389	3300049460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere	Metagenome	Rhizosphere
390	3300049569	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02	Metagenome	Rhizosphere
391	3300049570	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03	Metagenome	Rhizosphere
392	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
393	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
394	3300049573	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01	Metagenome	Rhizosphere
395	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
396	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
397	3300049576	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01	Metagenome	Rhizosphere
398	3300049578	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03	Metagenome	Rhizosphere
399	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
400	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
401	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
402	3300049584	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02	Metagenome	Rhizosphere
403	3300049589	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01	Metagenome	Rhizosphere
404	3300049741	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01	Metagenome	Rhizosphere
405	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
406	3300049744	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02	Metagenome	Rhizosphere
407	3300049758	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought	Metagenome	Rhizosphere
408	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
409	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
410	3300049824	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03	Metagenome	Rhizosphere
411	3300049853	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought	Metagenome	Rhizosphere
412	3300050489	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation	Metagenome	Endosphere
413	3300050508	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation	Metagenome	Rhizosphere
414	3300050509	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation	Metagenome	Rhizosphere
415	3300050510	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation	Metagenome	Rhizosphere
416	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
417	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
418	3300050514	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation	Metagenome	Rhizosphere
419	3300053078	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere	Metagenome	Rhizosphere
420	3300053111	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere	Metagenome	Endosphere
421	3300053125	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere	Metagenome	Endosphere
422	3300053135	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere	Metagenome	Endosphere
423	3300053138	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere	Metagenome	Endosphere
424	3300053145	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere	Metagenome	Endosphere
425	3300054114	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03	Metagenome	Rhizosphere
426	3300059421	Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810	Metagenome	Rhizosphere
427	3300059423	Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810	Metagenome	Rhizosphere
428	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere
429	2510065053	Pseudomonas sp. MOIL14HWK12:I1	Isolate	Rhizosphere
430	2510065055	Pseudomonas sp. MOIL14HWK12:I2	Isolate	Rhizosphere
431	2510065058	Pseudomonas oleovorans MOIL14HWK12	Isolate	Rhizosphere
432	2511231004	Pseudomonas sp. GM102	Isolate	Nodule
433	2511231006	Pseudomonas sp. GM17	Isolate	Nodule
434	2511231007	Pseudomonas sp. GM18	Isolate	Nodule
435	2511231008	Pseudomonas sp. GM21	Isolate	Nodule
436	2511231010	Pseudomonas sp. GM25	Isolate	Nodule
437	2511231011	Pseudomonas sp. GM30	Isolate	Nodule
438	2511231012	Pseudomonas sp. GM33	Isolate	Nodule
439	2511231014	Pseudomonas sp. GM48	Isolate	Nodule
440	2511231015	Pseudomonas sp. GM49	Isolate	Nodule
441	2511231016	Pseudomonas sp. GM50	Isolate	Nodule
442	2511231017	Pseudomonas sp. GM55	Isolate	Nodule
443	2511231018	Pseudomonas sp. GM60	Isolate	Nodule
444	2511231019	Pseudomonas sp. GM67	Isolate	Nodule
445	2511231020	Pseudomonas sp. GM74	Isolate	Nodule
446	2511231021	Pseudomonas sp. GM78	Isolate	Nodule
447	2511231022	Pseudomonas sp. GM79	Isolate	Nodule
448	2511231023	Pseudomonas sp. GM80	Isolate	Nodule
449	2511231024	Pseudomonas sp. GM84	Isolate	Nodule
450	2511231031	Pseudomonas sp. GM16	Isolate	Nodule
451	2511231156	Pseudomonas ogarae F113	Isolate	Rhizosphere
452	2512047018	Pseudomonas chlororaphis chlororaphis GP72	Isolate	Rhizosphere
453	2554235132	Pseudomonas aeruginosa PGPR2	Isolate	Unclassified
454	2554235231	Pseudomonas putida MTCC 5279	Isolate	Unclassified
455	2554235341	Pseudomonas protegens CHA0	Isolate	Rhizosphere
456	2565956521	Vibrio rhizosphaerae DSM 18581	Isolate	Rhizosphere
457	2582580891	Pseudomonas chlororaphis YL-1	Isolate	Unclassified
458	2597489887	Pseudomonas chlororaphis aureofaciens 30-84	Isolate	Rhizosphere
459	2597489888	Pseudomonas fluorescens SS101	Isolate	Rhizosphere
460	2597489889	Pseudomonas synxantha BG33R	Isolate	Rhizosphere
461	2599185155	Pseudomonas sp. NFACC10-1	Isolate	Rhizoplane
462	2599185160	Pseudomonas sp. NFPP25	Isolate	Rhizoplane
463	2599185161	Pseudomonas sp. NFPP09	Isolate	Rhizoplane
464	2599185162	Pseudomonas sp. NFPP10	Isolate	Rhizoplane
465	2599185163	Pseudomonas sp. NFPP12	Isolate	Rhizoplane
466	2599185164	Pseudomonas sp. NFPP13	Isolate	Rhizoplane
467	2599185165	Pseudomonas sp. NFPP18	Isolate	Rhizoplane
468	2599185166	Pseudomonas sp. NFPP08	Isolate	Rhizoplane
469	2599185167	Pseudomonas sp. NFPP28	Isolate	Rhizoplane
470	2599185168	Pseudomonas sp. NFPP05	Isolate	Rhizoplane
471	2599185179	Pseudomonas sp. NFR09	Isolate	Rhizoplane
472	2599185181	Pseudomonas sp. NFPP17	Isolate	Rhizoplane
473	2599185182	Pseudomonas sp. NFPP19	Isolate	Rhizoplane
474	2599185185	Pseudomonas sp. NFPP07	Isolate	Rhizoplane
475	2599185186	Pseudomonas sp. NFPP15	Isolate	Rhizoplane
476	2599185188	Pseudomonas sp. NFACC45	Isolate	Rhizoplane
477	2599185189	Pseudomonas sp. NFPP02	Isolate	Rhizoplane
478	2599185190	Pseudomonas sp. NFPP04	Isolate	Rhizoplane
479	2599185191	Pseudomonas sp. NFPP24	Isolate	Rhizoplane
480	2599185212	Pseudomonas sp. NFACC15-1	Isolate	Rhizoplane
481	2599185248	Pseudomonas sp. NFACC08-1	Isolate	Rhizoplane
482	2599185257	Pseudomonas sp. NFACC41-3	Isolate	Rhizoplane
483	2599185288	Pseudomonas sp. NFACC25	Isolate	Rhizoplane
484	2599185289	Pseudomonas sp. NFACC51	Isolate	Rhizoplane
485	2599185290	Pseudomonas sp. NFPP11	Isolate	Rhizoplane
486	2599185291	Pseudomonas sp. NFACC48-1	Isolate	Rhizoplane
487	2599185300	Pseudomonas sp. NFACC39-1	Isolate	Rhizoplane
488	2599185302	Pseudomonas sp. NFACC43	Isolate	Rhizoplane
489	2599185303	Pseudomonas sp. NFACC42-2	Isolate	Rhizoplane
490	2599185304	Pseudomonas sp. NFACC47-1	Isolate	Rhizoplane
491	2599185305	Pseudomonas sp. NFACC07-1	Isolate	Rhizoplane
492	2599185306	Pseudomonas sp. NFACC16-2	Isolate	Rhizoplane
493	2599185307	Pseudomonas sp. NFACC02	Isolate	Rhizoplane
494	2599185308	Pseudomonas sp. NFACC17-2	Isolate	Rhizoplane
495	2599185309	Pseudomonas sp. NFACC49-2	Isolate	Rhizoplane
496	2599185310	Pseudomonas sp. NFACC09-4	Isolate	Rhizoplane
497	2599185311	Pseudomonas sp. NFACC04-2	Isolate	Rhizoplane
498	2599185312	Pseudomonas sp. NFACC32-1	Isolate	Rhizoplane
499	2599185313	Pseudomonas sp. NFACC05-1	Isolate	Rhizoplane
500	2599185314	Pseudomonas sp. NFACC23-1	Isolate	Rhizoplane
501	2599185315	Pseudomonas sp. NFACC44-2	Isolate	Rhizoplane
502	2599185316	Pseudomonas sp. NFACC52	Isolate	Rhizoplane
503	2599185317	Pseudomonas sp. NFACC06-1	Isolate	Rhizoplane
504	2599185318	Pseudomonas sp. NFACC13-1	Isolate	Rhizoplane
505	2599185319	Pseudomonas sp. NFACC24-1	Isolate	Rhizoplane
506	2599185320	Pseudomonas sp. NFACC36	Isolate	Rhizoplane
507	2599185321	Pseudomonas sp. NFACC54	Isolate	Rhizoplane
508	2599185322	Pseudomonas sp. NFACC14	Isolate	Rhizoplane
509	2599185323	Pseudomonas sp. NFACC37-1	Isolate	Rhizoplane
510	2599185324	Pseudomonas sp. NFACC46-3	Isolate	Rhizoplane
511	2599185325	Pseudomonas sp. NFACC56-3	Isolate	Rhizoplane
512	2599185356	Pseudomonas sp. NFPP14	Isolate	Rhizoplane
513	2600254930	Pseudomonas sp. NFIX10	Isolate	Rhizoplane
514	2600254931	Pseudomonas sp. NFIX28	Isolate	Rhizoplane
515	2600254954	Pseudomonas sp. NFACC19-2	Isolate	Rhizoplane
516	2600255283	Pseudomonas sp. NFR16	Isolate	Rhizoplane
517	2600255296	Pseudomonas sp. NFR02	Isolate	Rhizoplane
518	2600255313	Pseudomonas sp. NFPP16	Isolate	Rhizoplane
519	2600255318	Pseudomonas putida NFIX47	Isolate	Rhizoplane
520	2600255389	Pseudomonas sp. NFPP33	Isolate	Rhizoplane
521	2603880185	Pseudomonas sp. NFIX46	Isolate	Rhizoplane
522	2603880199	Pseudomonas sp. NFIX49	Isolate	Rhizoplane
523	2606217733	Pseudomonas aeruginosa NFHH01	Isolate	Rhizoplane
524	2619619299	Pseudomonas veronii R4 Genome sequencing	Isolate	Unclassified
525	2623620443	Pseudomonas sp. DR 5-09	Isolate	Unclassified
526	2623620446	Pseudomonas sp. GR 6-02	Isolate	Unclassified
527	2643221565	Pseudomonas sp. Root562	Isolate	Unclassified
528	2643221571	Pseudomonas sp. Root569	Isolate	Unclassified
529	2643221589	Pseudomonas sp. Root68	Isolate	Unclassified
530	2643221602	Pseudomonas sp. Root71	Isolate	Unclassified
531	2643221633	Pseudomonas sp. Root329	Isolate	Unclassified
532	2643221650	Pseudomonas sp. Root401	Isolate	Unclassified
533	2643221713	Pseudomonas sp. Root9	Isolate	Unclassified
534	2648501241	Vibrio splendidus UCD-SED7	Isolate	Rhizosphere
535	2651869719	Genome Sequence of Pseudomonas fluorescens UM270	Isolate	Rhizosphere
536	2651869818	Vibrio splendidus UCD-SED10	Isolate	Rhizosphere
537	2667528170	Pseudomonas sp. NFACC50-1	Isolate	Rhizoplane
538	2667528171	Pseudomonas sp. NFPP22	Isolate	Rhizoplane
539	2667528176	Pseudomonas sp. NFACC11-2	Isolate	Rhizoplane
540	2671180172	Pseudomonas sp. NFIX51	Isolate	Rhizoplane
541	2675903420	Pseudomonas fluorescens Ps006	Isolate	Unclassified
542	2675903515	Pseudomonas thivervalensis DSM 13194	Isolate	Unclassified
543	2690315857	Rheinheimera sp. EpRS3	Isolate	Unclassified
544	2713897148	Pseudomonas fluorescens SF39a	Isolate	Rhizosphere
545	2713897149	Pseudomonas fluorescens SF4c	Isolate	Rhizosphere
546	2718217725	Pseudomonas fluorescens CREA-C16	Isolate	Rhizosphere
547	2721755607	Pseudomonas fluorescens Pt14	Isolate	Rhizosphere
548	2721755763	Pandoraea thiooxydans ATSB16	Isolate	Rhizosphere
549	2728369097	Stutzerimonas balearica st101	Isolate	Unclassified
550	2738541265	Pseudomonas sp. GV077	Isolate	Unclassified
551	2738541271	Pseudomonas sp. GV021	Isolate	Unclassified
552	2738541282	Pseudomonas sp. GV058	Isolate	Unclassified
553	2738541294	Pseudomonas sp. GV087	Isolate	Unclassified
554	2738541303	Pseudomonas sp. GV105	Isolate	Unclassified
555	2738541309	Pseudomonas sp. GV047	Isolate	Unclassified
556	2738543004	Pseudomonas sp. GV085	Isolate	Unclassified
557	2738543015	Pseudomonas sp. GV041	Isolate	Unclassified
558	2738543016	Pseudomonas sp. GV012	Isolate	Unclassified
559	2738543020	Pseudomonas sp. GV054	Isolate	Unclassified
560	2738543021	Pseudomonas sp. GV071	Isolate	Unclassified
561	2738543025	Pseudomonas sp. GV091	Isolate	Unclassified
562	2740892503	Pseudomonas chlororaphis piscium PCL1391	Isolate	Unclassified
563	2744054620	Pseudomonas thivervalensis LMG 21626	Isolate	Unclassified
564	2765235841	Pseudomonas putida AA7	Isolate	Unclassified
565	2773857670	Pseudomonas sp. 478	Isolate	Unclassified
566	2773857672	Pseudomonas sp. 1766	Isolate	Unclassified
567	2773857673	Pseudomonas sp. 443	Isolate	Unclassified
568	2784132063	Pseudomonas sp. 424	Isolate	Unclassified
569	2784132072	Pseudomonas sp. 460	Isolate	Unclassified
570	2791355520	Pseudomonas sp. s211(2017)	Isolate	Unclassified
571	2806310737	Pseudomonas mosselii BS011	Isolate	Unclassified
572	2806310745	Pseudomonas mosselii PtA1	Isolate	Unclassified
573	2808606361	Pseudomonas sp. SJZ075	Isolate	Rhizosphere
574	2808606373	Pseudomonas sp. SLBN-2	Isolate	Unclassified
575	2808606376	Pseudomonas sp. SJZ074	Isolate	Rhizosphere
576	2808606377	Pseudomonas sp. SJZ083	Isolate	Rhizosphere
577	2808606378	Pseudomonas sp. SJZ078	Isolate	Rhizosphere
578	2808606379	Pseudomonas sp. SJZ079	Isolate	Rhizosphere
579	2808606380	Pseudomonas sp. SJZ085	Isolate	Rhizosphere
580	2808606381	Pseudomonas sp. SJZ077	Isolate	Rhizosphere
581	2808606382	Pseudomonas sp. SJZ080	Isolate	Rhizosphere
582	2808606383	Pseudomonas sp. SJZ124	Isolate	Rhizosphere
583	2808606384	Burkholderia sp. SJZ089	Isolate	Rhizosphere
584	2808606385	Pseudomonas sp. SJZ103	Isolate	Rhizosphere
585	2808606388	Pseudomonas sp. SJZ094	Isolate	Rhizosphere
586	2808606389	Pseudomonas sp. SJZ101	Isolate	Rhizosphere
587	2808606390	Burkholderia sp. SJZ115	Isolate	Rhizosphere
588	2808606391	Burkholderia sp. SJZ091	Isolate	Rhizosphere
589	2808606445	Pseudomonas sp. SJZ131	Isolate	Rhizosphere
590	2811994881	Pseudomonas sp. SLBN-26	Isolate	Unclassified
591	2816332298	Pseudomonas veronii R02	Isolate	Rhizosphere
592	2818991456	Pseudomonas koreensis 3286	Isolate	Rhizosphere
593	2818991464	Pseudomonas protegens 3295	Isolate	Rhizosphere
594	2823421272	Pseudomonas mendocina S5.2	Isolate	Rhizoplane
595	2825651385	Pseudomonas brassicacearum L13-6-12	Isolate	Rhizosphere
596	2826581358	Pseudomonas viridiflava CDRTc14	Isolate	Unclassified
597	2834028612	Pseudomonas fluorescens 513	Isolate	Unclassified
598	2842805378	Pseudomonas sp. R-72599	Isolate	Unclassified
599	2842815866	Pseudomonas sp. R-72210	Isolate	Unclassified
600	2842826826	Pseudomonas sp. R-72172	Isolate	Unclassified
601	2842832357	Pseudomonas sp. R-72164	Isolate	Unclassified
602	2842837860	Pseudomonas sp. R-72102	Isolate	Unclassified
603	2842843487	Pseudomonas sp. R-72074	Isolate	Unclassified
604	2842849001	Pseudomonas sp. R-72008	Isolate	Unclassified
605	2842854478	Pseudomonas sp. R-71998	Isolate	Unclassified
606	2844665904	Pseudomonas protegens H1F10C	Isolate	Unclassified
607	2852612431	Pseudomonas sp. SJZ073	Isolate	Rhizosphere
608	2852657418	Pseudomonas sp. JAI115	Isolate	Rhizosphere
609	2852667396	Pseudomonas sp. JAI120	Isolate	Rhizosphere
610	2860339153	Pseudomonas sp. JAI111	Isolate	Rhizosphere
611	2860867994	Pseudomonas sp. R1-43-08	Isolate	Rhizosphere
612	2878029506	Pseudomonas fluorescens DR397	Isolate	Rhizosphere
613	2880230671	Pseudomonas fluorescens LBUM677	Isolate	Unclassified
614	2887630918	Psychrosphaera haliotis UCD-MCMsp1aY	Isolate	Unclassified
615	2904518522	Pseudomonas fluorescens 4488	Isolate	Rhizosphere
616	2904550169	Stutzerimonas stutzeri 1099	Isolate	Rhizosphere
617	2908446538	Pseudomonas sp. R76	Isolate	Rhizosphere
618	2912963787	Pseudomonas sp. R32	Isolate	Rhizosphere
619	2913036834	Pseudomonas viciae 11K1	Isolate	Rhizosphere
620	2916178963	Pseudoalteromonas rhizosphaerae RA15	Isolate	Rhizosphere
621	2917070673	Pseudomonas protegens CHA0	Isolate	Rhizosphere
622	2917832318	Pseudomonas rhizoryzae RY24	Isolate	Unclassified
623	2919063839	Pseudomonas pharyngis 1098	Isolate	Rhizosphere
624	2919125081	Pseudomonas psychrotolerans 1545	Isolate	Rhizosphere
625	2919155634	Pseudomonas fulva 1992	Isolate	Unclassified
626	2919385768	Pseudomonas sp. 2957	Isolate	Unclassified
627	2919456309	Pseudomonas sp. 3296	Isolate	Rhizosphere
628	2919481497	Pseudomonas brassicacearum 3432	Isolate	Unclassified
629	2919487758	Pseudomonas koreensis 3441	Isolate	Unclassified
630	2919493220	Aeromonas salmonicida salmonicida 3466	Isolate	Unclassified
631	2919497567	Shewanella putrefaciens 3469	Isolate	Unclassified
632	2919501602	Pseudomonas alcaliphila 3512	Isolate	Unclassified
633	2919534386	Rheinheimera pacifica 3879	Isolate	Unclassified
634	2919543075	Aeromonas salmonicida masoucida 4076	Isolate	Unclassified
635	2919688452	Pararheinheimera soli 4138	Isolate	Unclassified
636	2919697872	Pseudomonas frederiksbergensis 4169	Isolate	Unclassified
637	2923153595	Pseudomonas chlororaphis piscium PCL1391	Isolate	Unclassified
638	2923519811	Pseudomonas otitidis SLBN-103	Isolate	Rhizosphere
639	2923525760	Aeromonas caviae SLBN-129	Isolate	Rhizosphere
640	2923586266	Pseudomonas fluorescens 1550	Isolate	Rhizosphere
641	2926063275	Pseudomonas sp. 3400	Isolate	Unclassified
642	2929144301	Pseudomonas sp. R-71838 Hybrid assembly	Isolate	Unclassified
643	2929189879	Pseudomonas sp. R-71842 Hybrid assembly	Isolate	Unclassified
644	2931369376	Pseudomonas fluorescens DR133	Isolate	Rhizosphere
645	2931390751	Pseudomonas sp. DR208	Isolate	Rhizosphere
646	2931396565	Pseudomonas sp. DR48	Isolate	Rhizosphere
647	2935353572	Pseudomonas protegens TECH19	Isolate	Unclassified
648	2939636861	Pseudomonas sp. 2725	Isolate	Rhizosphere
649	2939651529	Pseudomonas sp. 2835	Isolate	Rhizosphere
650	2945928738	Pseudomonas cedrina W1I11	Isolate	Rhizosphere
651	2945961074	Pseudomonas sp. W2I6	Isolate	Rhizosphere
652	2946006987	Pseudomonas sp. W3I7	Isolate	Rhizosphere
653	2946027586	Pseudomonas sp. W4I3	Isolate	Rhizosphere
654	2947233263	Pseudomonas synxantha W2I4	Isolate	Rhizosphere
655	2952252522	Salinicola sp. DM10	Isolate	Unclassified
656	2969304461	Pseudomonas sp. R84	Isolate	Rhizosphere
657	2974289157	Pseudomonas fluorescens SORGH_AS 191	Isolate	Unclassified
658	2974298342	Pseudomonas sp. SORGH_AS 211	Isolate	Unclassified
659	2984286254	Pseudomonas chlororaphis aurantiaca JD37	Isolate	Rhizosphere
660	2984499530	Pseudomonas sp. SORGH_AS199	Isolate	Aerial Root
661	2984504281	Pseudomonas psychrotolerans SORGH_AS201	Isolate	Aerial Root
662	2988728565	Pseudomonas corrugata RM1-1-4	Isolate	Rhizosphere
663	2990196909	Pseudomonas mangrovi TC-11	Isolate	Unclassified
664	2998139840	Pseudomonas iranensis SWRI54	Isolate	Rhizosphere
665	3007252601	Pseudomonas punonensis D1-6	Isolate	Unclassified
666	3007315729	Pseudomonas argentinensis SA190	Isolate	Unclassified
667	3007395558	Pseudomonas chlororaphis PCL1601	Isolate	Rhizosphere
668	3007419365	Pseudomonas vanderleydeniana RW8P3	Isolate	Unclassified
669	3007511990	Pseudomonas fluorescens G20-18	Isolate	Rhizosphere
670	3007614139	Pseudomonas sp. PB106	Isolate	Unclassified
671	3007619802	Pseudomonas sp. PB120	Isolate	Unclassified
672	3007718800	Pseudomonas fluorescens BW11P2	Isolate	Rhizosphere
673	3007803356	Pseudomonas sp. CM27	Isolate	Unclassified
674	3007855910	Pseudomonas khorasanensis SWRI153	Isolate	Rhizosphere
675	3007861166	Pseudomonas hamedanensis SWRI65	Isolate	Rhizosphere
676	3007866637	Pseudomonas marvdashtae SWRI102	Isolate	Rhizosphere
677	3007872151	Pseudomonas sp. SWRI51	Isolate	Rhizosphere
678	637000220	Pseudomonas protegens Pf-5	Isolate	Rhizoplane
679	640427133	Stutzerimonas stutzeri A1501	Isolate	Rhizosphere
680	651053060	Stutzerimonas stutzeri CMT.A.9	Isolate	Rhizosphere
681	8001522603	Methylomicrobium sp. RS1	Isolate	Unclassified
682	8002745576	Marinomonas spartinae USM8	Isolate	Rhizosphere
683	8011350971	Pseudomonas sp. 30_B	Isolate	Rhizosphere
684	8015687852	Pseudomonas chlororaphis aurantiaca RP4	Isolate	Rhizosphere
685	8016728285	Pseudomonas psychrotolerans SORGH_AS 227	Isolate	Unclassified
686	8019769354	Pseudomonas sp. MSSRFD41	Isolate	Rhizosphere
687	8019775933	Pseudomonas sp. PvR083	Isolate	Rhizosphere
688	8029995093	Pseudomonas atacamensis SM1	Isolate	Rhizosphere
689	8034962539	Pseudomonas sediminis PI11	Isolate	Rhizosphere
690	8052494512	Pseudomonas putida LD6	Isolate	Unclassified
691	8054285046	Pseudomonas petroselini MAFF 311096	Isolate	Nodule
692	8054347763	Pseudomonas carnis NWU Be30	Isolate	Unclassified
693	8054357960	Idiomarina rhizosphaerae M1R2S28	Isolate	Rhizosphere
694	8054503363	Pseudomonas sivasensis BsEB-1	Isolate	Unclassified
695	8054929484	Pseudomonas vlassakiae RW4S1	Isolate	Rhizosphere
696	8055770955	Pseudomonas chlororaphis qlu-1	Isolate	Rhizosphere
697	8055817908	Pseudomonas pergaminensis 1008	Isolate	Rhizosphere
698	8055878733	Pseudomonas palmensis BBB001	Isolate	Rhizosphere
699	8056115690	Pseudomonas muyukensis COW39	Isolate	Rhizosphere
700	8056120720	Pseudomonas maumuensis COW77	Isolate	Rhizosphere
701	8056125926	Pseudomonas azerbaijanorientalis SWRI123	Isolate	Rhizosphere
702	8056131705	Pseudomonas asgharzadehiana SWRI132	Isolate	Rhizosphere
703	8056137416	Pseudomonas fakonensis COW40	Isolate	Rhizosphere
704	8056143049	Pseudomonas alvandae SWRI17	Isolate	Rhizosphere
705	8056148874	Pseudomonas khavaziana SWRI124	Isolate	Rhizosphere
706	8056155041	Pseudomonas farris SWRI79	Isolate	Rhizosphere
707	8056161164	Pseudomonas azadiae SWRI103	Isolate	Rhizosphere
708	8056166840	Pseudomonas triticicola SWRI88	Isolate	Rhizosphere
709	8056172158	Pseudomonas ekonensis COR58	Isolate	Rhizosphere
710	8056177738	Pseudomonas azerbaijanoccidentalis SWRI74	Isolate	Rhizosphere
711	8056569372	Pseudomonas serboccidentalis IT-P374	Isolate	Rhizosphere
712	8057798959	Pseudomonas piscis BW16M1	Isolate	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	84.02
Metatranscriptomes	0.06
Isolates	15.93

Biome Distribution

Category	Percentage (%)
Aerial Root	0.11
Bulb	0
Endosphere	4.04
Nodule	1.63
Rhizoplane	5.05
Rhizosphere	74.59
Stem	0
Stem Tuber	0
Unclassified	0.34

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	Ga0068856_100717839	3300005614	Bacteria	1020
2	MRS2a_Contig_7216	2124908027	Bacteria	6618
3	MRS2a_Contig_746	2124908027	Bacteria	35830
4	SwRhRL2b_contig_3653603	2162886007	Bacteria	1324
5	MBSR1b_contig_12794323	2162886012	Bacteria	1153
6	JGI24741J21665_1007627	3300001915	Bacteria	2090
7	JGI25162J39368_1000037	3300002737	Bacteria	179339
8	JGI25162J39368_1000087	3300002737	Bacteria	107005
9	JGI25154J39366_1012078	3300002738	Bacteria	965
10	JGI25163J39215_1000594	3300002771	Bacteria	10093
11	JGI25163J39215_1001754	3300002771	Bacteria	3012
12	JGI25164J39214_1000020	3300002772	Bacteria	179339
13	JGI25164J39214_1000051	3300002772	Bacteria	122377
14	JGI25164J39214_1000065	3300002772	Bacteria	107006
15	JGI25151J46595_10008885	3300003187	Bacteria	4797
16	JGI25165J46597_1000077	3300003214	Bacteria	179339
17	JGI25165J46597_1000091	3300003214	Bacteria	167941
18	JGI26128J50194_1000847	3300003347	Bacteria	1832
19	Ga0055538_1000086	3300003751	Bacteria	80460
20	Ga0055539_1000128	3300003752	Bacteria	80565
21	Ga0055533_1000185	3300003756	Bacteria	52131
22	Ga0055532_1000188	3300003758	Bacteria	51859
23	Ga0055525_1000195	3300003759	Bacteria	71342
24	Ga0055536_1000042	3300003781	Bacteria	125029
25	Ga0055536_1000571	3300003781	Bacteria	25135
26	Ga0055536_1001274	3300003781	Bacteria	15527
27	Ga0055536_1001447	3300003781	Bacteria	14293
28	Ga0055536_1030982	3300003781	Bacteria	1407
29	Ga0055530_10000304	3300003791	Bacteria	44740
30	Ga0055530_10000870	3300003791	Bacteria	24846
31	Ga0055530_10001489	3300003791	Bacteria	17002
32	Ga0055530_10003180	3300003791	Bacteria	9640
33	Ga0055540_1000292	3300003792	Bacteria	44683
34	Ga0055540_1000438	3300003792	Bacteria	33046
35	Ga0055540_1000634	3300003792	Bacteria	24951
36	Ga0055531_10000581	3300003794	Bacteria	31889
37	Ga0055541_1000120	3300003841	Bacteria	52131
38	Ga0065165_1003619	3300005262	Bacteria	10607
39	Ga0065714_10000179	3300005288	Bacteria	8024
40	Ga0065714_10002698	3300005288	Bacteria	12001
41	Ga0065714_10003663	3300005288	Bacteria	6434
42	Ga0065714_10007886	3300005288	Bacteria	7701
43	Ga0065714_10008639	3300005288	Bacteria	3234
44	Ga0065714_10008889	3300005288	Bacteria	2642
45	Ga0065714_10009867	3300005288	Bacteria	4131
46	Ga0065714_10017446	3300005288	Bacteria	2372
47	Ga0065714_10066581	3300005288	Bacteria	6615
48	Ga0065714_10066919	3300005288	Bacteria	6089
49	Ga0065714_10070393	3300005288	Bacteria	3881
50	Ga0065714_10072608	3300005288	Bacteria	3336
51	Ga0065714_10074017	3300005288	Bacteria	3094
52	Ga0065714_10083987	3300005288	Bacteria	2221
53	Ga0065704_10003480	3300005289	Bacteria	4536
54	Ga0065704_10007662	3300005289	Bacteria	5893
55	Ga0065704_10008162	3300005289	Bacteria	2208
56	Ga0065704_10081604	3300005289	Bacteria	3706
57	Ga0065704_10120554	3300005289	Bacteria	1768
58	Ga0065704_10313138	3300005289	Bacteria	865
59	Ga0065712_10004906	3300005290	Bacteria	4330
60	Ga0065712_10006839	3300005290	Bacteria	4786
61	Ga0065712_10067744	3300005290	Bacteria	68998
62	Ga0065715_10129124	3300005293	Bacteria	2051
63	Ga0070670_100000001	3300005331	Bacteria	728788
64	Ga0070670_100001830	3300005331	Bacteria	17312
65	Ga0070670_100053412	3300005331	Bacteria	3470
66	Ga0068869_100092375	3300005334	Bacteria	2278
67	Ga0070666_10108059	3300005335	Bacteria	1922
68	Ga0070661_100000008	3300005344	Bacteria	183494
69	Ga0070668_100075816	3300005347	Bacteria	2626
70	Ga0070669_100006984	3300005353	Bacteria	8113
71	Ga0070669_100017801	3300005353	Bacteria	5072
72	Ga0070669_100272577	3300005353	Bacteria	1354
73	Ga0070671_100000018	3300005355	Bacteria	147427
74	Ga0070674_100021390	3300005356	Bacteria	4152
75	Ga0070659_100404846	3300005366	Bacteria	1152
76	Ga0070659_100543038	3300005366	Bacteria	994
77	Ga0070667_100000331	3300005367	Bacteria	52620
78	Ga0070714_100035000	3300005435	Bacteria	4207
79	Ga0070663_100161473	3300005455	Bacteria	1725
80	Ga0070662_100000056	3300005457	Bacteria	60234
81	Ga0070681_10170120	3300005458	Bacteria	2101
82	Ga0068867_100023879	3300005459	Bacteria	4379
83	Ga0070685_10000049	3300005466	Bacteria	72567
84	Ga0070707_100192415	3300005468	Bacteria	1989
85	Ga0070684_100181994	3300005535	Bacteria	1911
86	Ga0070697_100572080	3300005536	Bacteria	992
87	Ga0068853_100000855	3300005539	Bacteria	21216
88	Ga0068853_100007795	3300005539	Bacteria	8588
89	Ga0070672_100021732	3300005543	Bacteria	4699
90	Ga0070693_100070863	3300005547	Bacteria	2052
91	Ga0070665_100011945	3300005548	Bacteria	8771
92	Ga0070665_100094764	3300005548	Bacteria	2990
93	Ga0070665_100347830	3300005548	Bacteria	1487
94	Ga0070704_100261885	3300005549	Bacteria	1425
95	Ga0070704_100723460	3300005549	Bacteria	884
96	Ga0068855_100015899	3300005563	Bacteria	9053
97	Ga0068855_100140638	3300005563	Bacteria	2752
98	Ga0070664_100000466	3300005564	Bacteria	30705
99	Ga0070664_100207741	3300005564	Bacteria	1749
100	Ga0070664_100421828	3300005564	Bacteria	1222
101	Ga0068857_100135404	3300005577	Bacteria	2224
102	Ga0068857_100220281	3300005577	Bacteria	1733
103	Ga0068854_100006137	3300005578	Bacteria	7626
104	Ga0068854_100187329	3300005578	Bacteria	1620
105	Ga0068856_100331595	3300005614	Bacteria	1539
106	Ga0070702_100388122	3300005615	Unclassified	995
107	Ga0068859_100027399	3300005617	Bacteria	5715
108	Ga0068864_100000012	3300005618	Bacteria	335070
109	Ga0068866_10002548	3300005718	Bacteria	7508
110	Ga0068866_10046005	3300005718	Bacteria	2192
111	Ga0068861_100010826	3300005719	Bacteria	6339
112	Ga0068851_10000028	3300005834	Bacteria	117106
113	Ga0068863_100130245	3300005841	Bacteria	2402
114	Ga0068858_100009868	3300005842	Bacteria	9073
115	Ga0068858_100118037	3300005842	Bacteria	2480
116	Ga0068858_100205480	3300005842	Bacteria	1863
117	Ga0068858_100427408	3300005842	Bacteria	1274
118	Ga0068860_100001710	3300005843	Bacteria	23445
119	Ga0068862_100005719	3300005844	Bacteria	10373
120	Ga0068862_100031831	3300005844	Bacteria	4455
121	Ga0068862_100036098	3300005844	Bacteria	4188
122	Ga0068862_100157422	3300005844	Bacteria	2026
123	Ga0075364_10105605	3300006051	Bacteria	1876
124	Ga0075432_10002375	3300006058	Bacteria	6272
125	Ga0075432_10005427	3300006058	Bacteria	4346
126	Ga0075432_10048795	3300006058	Bacteria	1490
127	Ga0070716_100438116	3300006173	Bacteria	949
128	Ga0075362_10057084	3300006177	Bacteria	1758
129	Ga0075362_10117077	3300006177	Bacteria	1258
130	Ga0075370_10000524	3300006353	Bacteria	14643
131	Ga0068871_100224738	3300006358	Bacteria	1628
132	Ga0075430_100109826	3300006846	Bacteria	2300
133	Ga0075431_100003695	3300006847	Bacteria	14869
134	Ga0075434_100487026	3300006871	Bacteria	1254
135	Ga0075429_100007951	3300006880	Bacteria	9215
136	Ga0068865_100193502	3300006881	Bacteria	1574
137	Ga0075436_100136468	3300006914	Bacteria	1722
138	Ga0097620_100027400	3300006931	Bacteria	5715
139	Ga0099823_1000024	3300006944	Bacteria	74134
140	Ga0079104_1000543	3300006946	Bacteria	39536
141	Ga0079104_1001214	3300006946	Bacteria	18272
142	Ga0079104_1040972	3300006946	Bacteria	1081
143	Ga0099826_10008026	3300006948	Bacteria	7817
144	Ga0105251_10000060	3300009011	Bacteria	102799
145	Ga0105251_10000221	3300009011	Bacteria	57628
146	Ga0105251_10001570	3300009011	Bacteria	19543
147	Ga0105251_10003052	3300009011	Bacteria	12458
148	Ga0105251_10006170	3300009011	Bacteria	7703
149	Ga0105251_10009446	3300009011	Bacteria	5758
150	Ga0105251_10017278	3300009011	Bacteria	3871
151	Ga0105251_10018136	3300009011	Bacteria	3751
152	Ga0105251_10020075	3300009011	Bacteria	3516
153	Ga0105251_10020386	3300009011	Bacteria	3485
154	Ga0105251_10027627	3300009011	Bacteria	2874
155	Ga0105251_10049315	3300009011	Bacteria	2015
156	Ga0105251_10160853	3300009011	Bacteria	1012
157	Ga0105251_10206034	3300009011	Bacteria	886
158	Ga0105244_10004756	3300009036	Bacteria	9243
159	Ga0105244_10005482	3300009036	Bacteria	8426
160	Ga0105244_10005859	3300009036	Bacteria	8070
161	Ga0105244_10008923	3300009036	Bacteria	6208
162	Ga0105244_10018991	3300009036	Bacteria	3847
163	Ga0105244_10024650	3300009036	Bacteria	3281
164	Ga0105244_10025625	3300009036	Bacteria	3203
165	Ga0105244_10036162	3300009036	Bacteria	2589
166	Ga0105244_10036811	3300009036	Bacteria	2561
167	Ga0105244_10045914	3300009036	Bacteria	2246
168	Ga0105244_10046553	3300009036	Bacteria	2228
169	Ga0105244_10077645	3300009036	Bacteria	1647
170	Ga0105244_10084332	3300009036	Bacteria	1569
171	Ga0105244_10106675	3300009036	Bacteria	1366
172	Ga0105244_10139521	3300009036	Bacteria	1167
173	Ga0105244_10152739	3300009036	Bacteria	1106
174	Ga0105250_10000215	3300009092	Bacteria	47921
175	Ga0105250_10002063	3300009092	Bacteria	10309
176	Ga0105250_10008731	3300009092	Bacteria	4291
177	Ga0105250_10012494	3300009092	Bacteria	3504
178	Ga0105250_10017250	3300009092	Bacteria	2935
179	Ga0105250_10021202	3300009092	Bacteria	2623
180	Ga0105250_10029354	3300009092	Bacteria	2213
181	Ga0105250_10038991	3300009092	Bacteria	1905
182	Ga0105250_10092963	3300009092	Bacteria	1228
183	Ga0111539_10019233	3300009094	Bacteria	8434
184	Ga0111539_10040342	3300009094	Bacteria	5621
185	Ga0105247_10155629	3300009101	Bacteria	1510
186	Ga0105243_10000158	3300009148	Bacteria	77305
187	Ga0105243_10001567	3300009148	Bacteria	19974
188	Ga0105243_10040342	3300009148	Bacteria	3645
189	Ga0105243_10056668	3300009148	Bacteria	3117
190	Ga0105243_10107737	3300009148	Bacteria	2325
191	Ga0105243_10111102	3300009148	Bacteria	2293
192	Ga0105243_10215079	3300009148	Bacteria	1695
193	Ga0105243_10364349	3300009148	Bacteria	1331
194	Ga0105243_10440538	3300009148	Bacteria	1220
195	Ga0105241_10086637	3300009174	Bacteria	2463
196	Ga0105242_10001027	3300009176	Bacteria	21973
197	Ga0105242_10140834	3300009176	Bacteria	2092
198	Ga0105248_10104051	3300009177	Bacteria	3200
199	Ga0105237_10000944	3300009545	Bacteria	39047
200	Ga0105249_10042407	3300009553	Bacteria	4138
201	Ga0105249_10097062	3300009553	Bacteria	2766
202	Ga0105239_10242600	3300010375	Bacteria	2022
203	Ga0105246_10001106	3300011119	Bacteria	15659
204	Ga0105246_10009697	3300011119	Bacteria	5934
205	Ga0105246_10032515	3300011119	Bacteria	3460
206	Ga0105246_10130349	3300011119	Bacteria	1877
207	Ga0105246_10214448	3300011119	Bacteria	1505
208	Ga0157345_1000337	3300012498	Bacteria	5588
209	Ga0157373_10001402	3300013100	Bacteria	18435
210	Ga0157373_10001490	3300013100	Bacteria	17849
211	Ga0157373_10006835	3300013100	Bacteria	8493
212	Ga0157373_10011111	3300013100	Bacteria	6628
213	Ga0157373_10033327	3300013100	Bacteria	3706
214	Ga0157373_10042291	3300013100	Bacteria	3257
215	Ga0157373_10183690	3300013100	Bacteria	1473
216	Ga0157373_10257054	3300013100	Bacteria	1236
217	Ga0157371_10000203	3300013102	Bacteria	87175
218	Ga0157371_10001725	3300013102	Bacteria	22189
219	Ga0157371_10006553	3300013102	Bacteria	9574
220	Ga0157371_10011640	3300013102	Bacteria	6761
221	Ga0157371_10106710	3300013102	Bacteria	1987
222	Ga0157371_10130218	3300013102	Bacteria	1790
223	Ga0157371_10201688	3300013102	Bacteria	1426
224	Ga0157370_10005599	3300013104	Bacteria	14064
225	Ga0157370_10018541	3300013104	Bacteria	6996
226	Ga0157370_10033549	3300013104	Bacteria	5005
227	Ga0157370_10059116	3300013104	Bacteria	3643
228	Ga0157370_10070971	3300013104	Bacteria	3287
229	Ga0157370_10092212	3300013104	Bacteria	2843
230	Ga0157370_10096674	3300013104	Bacteria	2771
231	Ga0157370_10100556	3300013104	Bacteria	2709
232	Ga0157369_10020226	3300013105	Bacteria	7442
233	Ga0157369_10030498	3300013105	Bacteria	5946
234	Ga0157369_10035558	3300013105	Bacteria	5461
235	Ga0157369_10037127	3300013105	Bacteria	5335
236	Ga0157369_10207212	3300013105	Bacteria	2056
237	Ga0157369_10693635	3300013105	Bacteria	1049
238	Ga0157369_10884198	3300013105	Bacteria	917
239	Ga0157374_10051401	3300013296	Bacteria	3835
240	Ga0157378_10020973	3300013297	Bacteria	5749
241	Ga0163162_10024300	3300013306	Bacteria	5980
242	Ga0163162_10025717	3300013306	Bacteria	5820
243	Ga0163162_10143382	3300013306	Bacteria	2503
244	Ga0163162_10204447	3300013306	Bacteria	2104
245	Ga0163162_10441608	3300013306	Bacteria	1433
246	Ga0163162_10996033	3300013306	Bacteria	947
247	Ga0157372_10002134	3300013307	Bacteria	21497
248	Ga0157372_10014583	3300013307	Bacteria	8406
249	Ga0157372_10025911	3300013307	Bacteria	6378
250	Ga0157372_10498152	3300013307	Bacteria	1421
251	Ga0157372_10507343	3300013307	Bacteria	1406
252	Ga0157375_10096089	3300013308	Bacteria	3035
253	Ga0157375_10288007	3300013308	Bacteria	1805
254	Ga0163163_10000162	3300014325	Bacteria	69827
255	Ga0163163_10008768	3300014325	Bacteria	9000
256	Ga0157380_10067995	3300014326	Bacteria	2870
257	Ga0182008_10000040	3300014497	Bacteria	120886
258	Ga0182008_10021673	3300014497	Bacteria	3299
259	Ga0182008_10030495	3300014497	Bacteria	2718
260	Ga0182008_10037326	3300014497	Bacteria	2430
261	Ga0182008_10040588	3300014497	Bacteria	2323
262	Ga0182008_10054247	3300014497	Bacteria	1983
263	Ga0182008_10069304	3300014497	Bacteria	1735
264	Ga0157379_10086468	3300014968	Bacteria	2811
265	Ga0157379_10096959	3300014968	Bacteria	2646
266	Ga0182006_1002164	3300015261	Bacteria	10899
267	Ga0182006_1004779	3300015261	Bacteria	6598
268	Ga0182006_1015511	3300015261	Bacteria	3265
269	Ga0182006_1016346	3300015261	Bacteria	3165
270	Ga0182006_1045947	3300015261	Bacteria	1697
271	Ga0182006_1047799	3300015261	Bacteria	1656
272	Ga0182006_1048133	3300015261	Bacteria	1650
273	Ga0182007_10003128	3300015262	Bacteria	7958
274	Ga0182007_10027337	3300015262	Bacteria	1968
275	Ga0182007_10033666	3300015262	Bacteria	1735
276	Ga0182005_1003063	3300015265	Bacteria	5766
277	Ga0182005_1022297	3300015265	Bacteria	1735
278	Ga0182005_1036184	3300015265	Bacteria	1342
279	Ga0182005_1050825	3300015265	Bacteria	1127
280	Ga0182005_1052122	3300015265	Bacteria	1114
281	Ga0163161_10012274	3300017792	Bacteria	5945
282	Ga0163161_10017846	3300017792	Bacteria	4972
283	Ga0163161_10023635	3300017792	Bacteria	4337
284	Ga0163161_10093843	3300017792	Bacteria	2224
285	Ga0163161_10278306	3300017792	Bacteria	1312
286	Ga0213872_10001215	3300021361	Bacteria	17431
287	Ga0213872_10035315	3300021361	Bacteria	2286
288	Ga0209435_100812	3300025206	Bacteria	4981
289	Ga0209760_100022	3300025207	Bacteria	159218
290	Ga0209760_100053	3300025207	Bacteria	103438
291	Ga0209784_100017	3300025224	Bacteria	472003
292	Ga0209566_100014	3300025225	Bacteria	472003
293	Ga0209674_100028	3300025226	Bacteria	472003
294	Ga0209147_100038	3300025229	Bacteria	314497
295	Ga0209563_100032	3300025230	Bacteria	472003
296	Ga0209563_100367	3300025230	Bacteria	16634
297	Ga0207427_100001	3300025231	Bacteria	1410763
298	Ga0207427_100047	3300025231	Bacteria	240409
299	Ga0209437_100003	3300025233	Bacteria	1517827
300	Ga0209437_100009	3300025233	Bacteria	915954
301	Ga0209258_100409	3300025242	Bacteria	51954
302	Ga0209646_1001371	3300025246	Bacteria	6709
303	Ga0209677_100018	3300025253	Bacteria	472003
304	Ga0209759_1002719	3300025256	Bacteria	7534
305	Ga0209233_1000007	3300025261	Bacteria	1411234
306	Ga0209233_1000032	3300025261	Bacteria	623596
307	Ga0209130_1025347	3300025284	Bacteria	1285
308	Ga0209676_1000016	3300025292	Bacteria	655561
309	Ga0209676_1000021	3300025292	Bacteria	609534
310	Ga0209676_1000033	3300025292	Bacteria	463236
311	Ga0209676_1000753	3300025292	Bacteria	43895
312	Ga0209050_1000009	3300025298	Bacteria	1047265
313	Ga0209050_1000036	3300025298	Bacteria	423070
314	Ga0209050_1000107	3300025298	Bacteria	223303
315	Ga0209050_1020305	3300025298	Bacteria	2477
316	Ga0209051_1000043	3300025303	Bacteria	305473
317	Ga0209051_1000053	3300025303	Bacteria	281564
318	Ga0209051_1000474	3300025303	Bacteria	52139
319	Ga0209051_1004467	3300025303	Bacteria	8607
320	Ga0209257_1000098	3300025304	Bacteria	256390
321	Ga0209257_1009275	3300025304	Bacteria	5319
322	Ga0207656_10000119	3300025321	Bacteria	29990
323	Ga0207696_1000010	3300025711	Bacteria	534681
324	Ga0207696_1000043	3300025711	Bacteria	307112
325	Ga0207696_1000101	3300025711	Bacteria	170899
326	Ga0207696_1000175	3300025711	Bacteria	102142
327	Ga0207696_1003416	3300025711	Bacteria	7251
328	Ga0207696_1005667	3300025711	Bacteria	5147
329	Ga0207696_1007727	3300025711	Bacteria	4180
330	Ga0207696_1015790	3300025711	Bacteria	2546
331	Ga0207696_1030543	3300025711	Bacteria	1636
332	Ga0207696_1044334	3300025711	Bacteria	1290
333	Ga0207655_1000019	3300025728	Bacteria	536324
334	Ga0207655_1000095	3300025728	Bacteria	195899
335	Ga0207655_1000402	3300025728	Bacteria	59961
336	Ga0207655_1000562	3300025728	Bacteria	46223
337	Ga0207655_1000619	3300025728	Bacteria	42670
338	Ga0207655_1000670	3300025728	Bacteria	40330
339	Ga0207655_1000825	3300025728	Bacteria	33516
340	Ga0207655_1005875	3300025728	Bacteria	8229
341	Ga0207655_1007976	3300025728	Bacteria	6794
342	Ga0207655_1008317	3300025728	Bacteria	6601
343	Ga0207655_1010144	3300025728	Bacteria	5754
344	Ga0207655_1011027	3300025728	Bacteria	5423
345	Ga0207655_1015056	3300025728	Bacteria	4327
346	Ga0207655_1022350	3300025728	Bacteria	3174
347	Ga0207655_1022468	3300025728	Bacteria	3161
348	Ga0207655_1024406	3300025728	Bacteria	2965
349	Ga0207655_1025777	3300025728	Bacteria	2844
350	Ga0207655_1037736	3300025728	Bacteria	2123
351	Ga0207713_1000150	3300025735	Bacteria	105170
352	Ga0207713_1000207	3300025735	Bacteria	79895
353	Ga0207713_1002393	3300025735	Bacteria	13709
354	Ga0207713_1002430	3300025735	Bacteria	13588
355	Ga0207713_1003445	3300025735	Bacteria	10769
356	Ga0207713_1003756	3300025735	Bacteria	10196
357	Ga0207713_1004068	3300025735	Bacteria	9646
358	Ga0207713_1004396	3300025735	Bacteria	9158
359	Ga0207713_1006140	3300025735	Bacteria	7379
360	Ga0207713_1008180	3300025735	Bacteria	6052
361	Ga0207713_1008868	3300025735	Bacteria	5729
362	Ga0207713_1009854	3300025735	Bacteria	5346
363	Ga0207713_1011406	3300025735	Bacteria	4834
364	Ga0207713_1015726	3300025735	Bacteria	3868
365	Ga0207713_1017866	3300025735	Bacteria	3532
366	Ga0207713_1028157	3300025735	Bacteria	2539
367	Ga0207713_1035664	3300025735	Bacteria	2144
368	Ga0207713_1039634	3300025735	Bacteria	1985
369	Ga0207642_10002846	3300025899	Bacteria	5403
370	Ga0207680_10082488	3300025903	Bacteria	2023
371	Ga0207645_10132647	3300025907	Bacteria	1622
372	Ga0207654_10082391	3300025911	Bacteria	1940
373	Ga0207671_10000035	3300025914	Bacteria	237603
374	Ga0207671_10010328	3300025914	Bacteria	7713
375	Ga0207649_10000017	3300025920	Bacteria	225193
376	Ga0207681_10001458	3300025923	Bacteria	15232
377	Ga0207681_10304370	3300025923	Bacteria	1262
378	Ga0207650_10000002	3300025925	Bacteria	1439222
379	Ga0207650_10000180	3300025925	Bacteria	74406
380	Ga0207650_10000181	3300025925	Bacteria	73955
381	Ga0207664_10076600	3300025929	Bacteria	2708
382	Ga0207644_10000065	3300025931	Bacteria	76549
383	Ga0207690_10429874	3300025932	Bacteria	1058
384	Ga0207706_10003017	3300025933	Bacteria	16230
385	Ga0207706_10014450	3300025933	Bacteria	7156
386	Ga0207706_10030654	3300025933	Bacteria	4796
387	Ga0207686_10001754	3300025934	Bacteria	12056
388	Ga0207686_10308102	3300025934	Bacteria	1178
389	Ga0207709_10000053	3300025935	Bacteria	225514
390	Ga0207709_10003120	3300025935	Bacteria	9965
391	Ga0207709_10027125	3300025935	Bacteria	3296
392	Ga0207709_10041754	3300025935	Bacteria	2754
393	Ga0207709_10081037	3300025935	Bacteria	2091
394	Ga0207709_10094870	3300025935	Bacteria	1959
395	Ga0207709_10170426	3300025935	Bacteria	1527
396	Ga0207709_10217202	3300025935	Bacteria	1376
397	Ga0207669_10268812	3300025937	Bacteria	1279
398	Ga0207704_10026295	3300025938	Bacteria	3191
399	Ga0207691_10012813	3300025940	Bacteria	8026
400	Ga0207711_10001164	3300025941	Bacteria	25047
401	Ga0207679_10000005	3300025945	Bacteria	525011
402	Ga0207679_10073297	3300025945	Bacteria	2590
403	Ga0207679_10168035	3300025945	Bacteria	1803
404	Ga0207712_10057455	3300025961	Bacteria	2745
405	Ga0207668_10061346	3300025972	Bacteria	2644
406	Ga0207640_10071381	3300025981	Bacteria	2339
407	Ga0207658_10000001	3300025986	Bacteria	1439333
408	Ga0207703_10023685	3300026035	Bacteria	4828
409	Ga0207703_10228664	3300026035	Bacteria	1667
410	Ga0207703_10698584	3300026035	Bacteria	964
411	Ga0207639_10001808	3300026041	Bacteria	14378
412	Ga0207639_10005439	3300026041	Bacteria	8600
413	Ga0207678_10073289	3300026067	Bacteria	2935
414	Ga0207678_10270830	3300026067	Bacteria	1456
415	Ga0207702_10277184	3300026078	Bacteria	1584
416	Ga0207702_10673767	3300026078	Bacteria	1018
417	Ga0207648_10000439	3300026089	Bacteria	46028
418	Ga0207676_10000001	3300026095	Bacteria	1439222
419	Ga0207674_10238100	3300026116	Bacteria	1767
420	Ga0207675_100013133	3300026118	Bacteria	7730
421	Ga0207675_100337700	3300026118	Bacteria	1474
422	Ga0207683_10096050	3300026121	Bacteria	2643
423	Ga0209281_1000018	3300027111	Bacteria	579091
424	Ga0209281_1000174	3300027111	Bacteria	151659
425	Ga0209281_1015909	3300027111	Bacteria	1558
426	Ga0209389_1000018	3300027296	Bacteria	179898
427	Ga0209371_1001864	3300027312	Bacteria	12953
428	Ga0209371_1003258	3300027312	Bacteria	8081
429	Ga0209371_1014573	3300027312	Bacteria	2150
430	Ga0209984_1000270	3300027424	Bacteria	5912
431	Ga0209995_1002759	3300027471	Bacteria	2783
432	Ga0209999_1005222	3300027543	Bacteria	2336
433	Ga0209983_1003420	3300027665	Bacteria	3394
434	Ga0209974_10003574	3300027876	Bacteria	5592
435	Ga0207428_10028426	3300027907	Bacteria	4646
436	Ga0207428_10124641	3300027907	Bacteria	1973
437	Ga0207428_10223990	3300027907	Bacteria	1409
438	Ga0207428_10259802	3300027907	Bacteria	1294
439	Ga0268266_10048922	3300028379	Bacteria	3624
440	Ga0268266_10264200	3300028379	Bacteria	1596
441	Ga0268265_10000388	3300028380	Bacteria	46960
442	Ga0268265_10030477	3300028380	Bacteria	3885
443	Ga0268265_10122583	3300028380	Bacteria	2144
444	Ga0268265_10141061	3300028380	Bacteria	2018
445	Ga0268264_10000061	3300028381	Bacteria	303123
446	Ga0268264_10013375	3300028381	Bacteria	6753
447	Ga0268264_10176392	3300028381	Bacteria	1937
448	Ga0265318_10055317	3300028577	Bacteria	1485
449	Ga0265336_10001365	3300028666	Bacteria	11262
450	Ga0307517_10026165	3300028786	Bacteria	7086
451	Ga0265338_10044219	3300028800	Bacteria	4116
452	Ga0265338_10288666	3300028800	Bacteria	1196
453	Ga0265324_10000023	3300029957	Bacteria	164128
454	Ga0265324_10000557	3300029957	Bacteria	25533
455	Ga0268256_1001635	3300030500	Bacteria	12954
456	Ga0268256_1001974	3300030500	Bacteria	11164
457	Ga0268256_1006182	3300030500	Bacteria	4507
458	Ga0307511_10059309	3300030521	Bacteria	2945
459	Ga0314311_1190454	3300030733	Bacteria	7663
460	Ga0316178_1017517	3300030735	Bacteria	19545
461	Ga0316183_1151755	3300030742	Bacteria	1013
462	Ga0265330_10021565	3300031235	Bacteria	2938
463	Ga0265330_10122342	3300031235	Bacteria	1108
464	Ga0265332_10023424	3300031238	Bacteria	2722
465	Ga0265328_10011375	3300031239	Bacteria	3557
466	Ga0265320_10015761	3300031240	Bacteria	4260
467	Ga0265325_10000099	3300031241	Bacteria	61211
468	Ga0265325_10018111	3300031241	Bacteria	3906
469	Ga0265339_10172373	3300031249	Bacteria	1082
470	Ga0265331_10003774	3300031250	Bacteria	9612
471	Ga0265331_10005247	3300031250	Bacteria	7851
472	Ga0265331_10012115	3300031250	Bacteria	4687
473	Ga0265331_10018195	3300031250	Bacteria	3649
474	Ga0265331_10019217	3300031250	Bacteria	3530
475	Ga0265331_10033698	3300031250	Bacteria	2532
476	Ga0265331_10115008	3300031250	Bacteria	1232
477	Ga0265331_10151819	3300031250	Bacteria	1051
478	Ga0265327_10000065	3300031251	Bacteria	225004
479	Ga0265327_10000257	3300031251	Bacteria	105278
480	Ga0265327_10000384	3300031251	Bacteria	83284
481	Ga0265327_10010769	3300031251	Bacteria	6379
482	Ga0265327_10011016	3300031251	Bacteria	6288
483	Ga0265316_10035418	3300031344	Bacteria	4046
484	Ga0265316_10132060	3300031344	Bacteria	1880
485	Ga0307513_10020857	3300031456	Bacteria	7755
486	Ga0307408_100000018	3300031548	Bacteria	346872
487	Ga0307408_100015942	3300031548	Bacteria	5010
488	Ga0307408_100025025	3300031548	Bacteria	4083
489	Ga0307408_100080623	3300031548	Bacteria	2431
490	Ga0307408_100081707	3300031548	Bacteria	2416
491	Ga0307408_100139478	3300031548	Bacteria	1901
492	Ga0307408_100283138	3300031548	Bacteria	1381
493	Ga0307408_100514716	3300031548	Unclassified	1050
494	Ga0316575_10015090	3300031665	Bacteria	2910
495	Ga0316579_10006065	3300031691	Bacteria	4912
496	Ga0316579_10025457	3300031691	Bacteria	2671
497	Ga0265314_10000433	3300031711	Bacteria	55939
498	Ga0265314_10001396	3300031711	Bacteria	27081
499	Ga0265314_10020614	3300031711	Bacteria	5089
500	Ga0265342_10018541	3300031712	Bacteria	4505
501	Ga0316576_10002240	3300031727	Bacteria	10939
502	Ga0316576_10005681	3300031727	Bacteria	7667
503	Ga0316576_10332176	3300031727	Bacteria	1133
504	Ga0316578_10025352	3300031728	Bacteria	3333
505	Ga0316578_10054629	3300031728	Bacteria	2343
506	Ga0307405_10005593	3300031731	Bacteria	6077
507	Ga0307405_10020268	3300031731	Bacteria	3712
508	Ga0307405_10057573	3300031731	Bacteria	2442
509	Ga0307405_10201871	3300031731	Bacteria	1444
510	Ga0316577_10115592	3300031733	Bacteria	1506
511	Ga0307413_10007830	3300031824	Bacteria	4996
512	Ga0307413_10170869	3300031824	Bacteria	1538
513	Ga0307410_10093591	3300031852	Bacteria	2139
514	Ga0307406_10030398	3300031901	Bacteria	3279
515	Ga0307407_10231779	3300031903	Bacteria	1254
516	Ga0307407_10440503	3300031903	Bacteria	943
517	Ga0307412_10026009	3300031911	Bacteria	3632
518	Ga0307412_10069236	3300031911	Bacteria	2401
519	Ga0307412_10169828	3300031911	Bacteria	1629
520	Ga0307412_10204624	3300031911	Bacteria	1501
521	Ga0307409_100027501	3300031995	Bacteria	4032
522	Ga0307409_100169363	3300031995	Bacteria	1921
523	Ga0307416_100151409	3300032002	Bacteria	2128
524	Ga0307416_100315019	3300032002	Bacteria	1563
525	Ga0307414_10074088	3300032004	Bacteria	2465
526	Ga0307414_10234268	3300032004	Bacteria	1516
527	Ga0307411_10013117	3300032005	Bacteria	4556
528	Ga0307411_10022065	3300032005	Bacteria	3740
529	Ga0307411_10070087	3300032005	Bacteria	2371
530	Ga0307411_10124138	3300032005	Bacteria	1874
531	Ga0307411_10447515	3300032005	Bacteria	1080
532	Ga0316583_10006991	3300032133	Bacteria	4060
533	Ga0316593_10002164	3300032168	Bacteria	4583
534	Ga0307510_10017682	3300033180	Bacteria	8403
535	Ga0307510_10091006	3300033180	Bacteria	2895
536	Ga0373955_0045391	3300035172	Bacteria	2371
537	Ga0316574_0008371	3300035398	Bacteria	5743
538	Ga0373927_0299370	3300035695	Bacteria	1058
539	Ga0373937_0042829	3300036401	Bacteria	4132
540	Ga0316582_0011144	3300036647	Bacteria	4961
541	Ga0316582_0095316	3300036647	Bacteria	1964
542	Ga0316582_0101983	3300036647	Bacteria	1902
543	Ga0316582_0210710	3300036647	Bacteria	1328
544	Ga0316584_0035907	3300036712	Bacteria	3677
545	Ga0316584_0068479	3300036712	Bacteria	2660
546	Ga0316584_0078325	3300036712	Bacteria	2475
547	Ga0316584_0205958	3300036712	Bacteria	1450
548	Ga0373925_0034844	3300037068	Bacteria	3712
549	Ga0373925_0642923	3300037068	Bacteria	874
550	Ga0395905_0002001	3300037471	Bacteria	23293
551	Ga0316581_0005837	3300037588	Bacteria	3234
552	Ga0316581_0067070	3300037588	Bacteria	1102
553	Ga0395901_0555632	3300038443	Bacteria	1163
554	Ga0237819_00758	3300038705	Bacteria	10376
555	Ga0400484_02420	3300038725	Bacteria	21755
556	Ga0400484_05024	3300038725	Bacteria	33998
557	Ga0400484_09242	3300038725	Bacteria	12034
558	Ga0400484_17083	3300038725	Bacteria	5833
559	Ga0400484_27281	3300038725	Bacteria	4909
560	Ga0400490_00409	3300038726	Bacteria	12140
561	Ga0400490_00629	3300038726	Bacteria	48863
562	Ga0400490_19114	3300038726	Bacteria	3040
563	Ga0400490_34188	3300038726	Bacteria	18647
564	Ga0400490_41636	3300038726	Bacteria	34374
565	Ga0400490_42931	3300038726	Bacteria	25734
566	Ga0400490_47827	3300038726	Bacteria	7935
567	Ga0400490_56758	3300038726	Bacteria	42832
568	Ga0400491_18134	3300038727	Bacteria	4680
569	Ga0400491_24212	3300038727	Bacteria	1628
570	Ga0400491_26290	3300038727	Bacteria	3634
571	Ga0400485_01446	3300038735	Bacteria	3129
572	Ga0400485_04007	3300038735	Bacteria	30990
573	Ga0400485_07089	3300038735	Bacteria	55387
574	Ga0400485_08390	3300038735	Bacteria	1839
575	Ga0400485_12289	3300038735	Bacteria	1971
576	Ga0400488_08357	3300038741	Bacteria	1318
577	Ga0400488_15610	3300038741	Bacteria	1744
578	Ga0400488_24090	3300038741	Bacteria	17246
579	Ga0400488_35305	3300038741	Bacteria	3369
580	Ga0400488_35681	3300038741	Bacteria	3759
581	Ga0400488_37280	3300038741	Bacteria	3351
582	Ga0400488_38081	3300038741	Bacteria	3210
583	Ga0400488_42106	3300038741	Bacteria	1579
584	Ga0400488_45799	3300038741	Bacteria	4365
585	Ga0400488_46833	3300038741	Bacteria	2211
586	Ga0400488_51714	3300038741	Bacteria	2715
587	Ga0400488_59122	3300038741	Bacteria	1798
588	Ga0400488_59901	3300038741	Bacteria	2885
589	Ga0400486_00610	3300038742	Bacteria	18322
590	Ga0400486_00736	3300038742	Bacteria	47794
591	Ga0400486_11633	3300038742	Bacteria	1179
592	Ga0400486_17202	3300038742	Bacteria	6257
593	Ga0400486_21916	3300038742	Bacteria	3781
594	Ga0400483_015059	3300039062	Unclassified	1338
595	Ga0400483_036281	3300039062	Bacteria	1697
596	Ga0400483_050487	3300039062	Bacteria	45898
597	Ga0400483_061608	3300039062	Bacteria	4113
598	Ga0400483_072960	3300039062	Bacteria	14885
599	Ga0400483_078562	3300039062	Bacteria	1349
600	Ga0400483_082194	3300039062	Bacteria	1560
601	Ga0400483_088943	3300039062	Bacteria	9451
602	Ga0400483_091971	3300039062	Bacteria	2200
603	Ga0400483_117917	3300039062	Bacteria	2224
604	Ga0400483_128929	3300039062	Bacteria	34455
605	Ga0400483_132309	3300039062	Bacteria	2507
606	Ga0400483_141043	3300039062	Bacteria	14921
607	Ga0400483_145588	3300039062	Bacteria	1338
608	Ga0400483_147621	3300039062	Bacteria	10623
609	Ga0400483_153623	3300039062	Bacteria	2073
610	Ga0400483_161094	3300039062	Bacteria	1907
611	Ga0400483_163278	3300039062	Bacteria	2836
612	Ga0400483_170536	3300039062	Bacteria	20327
613	Ga0400483_172133	3300039062	Bacteria	2466
614	Ga0400483_173670	3300039062	Bacteria	14071
615	Ga0400483_176269	3300039062	Bacteria	4804
616	Ga0400483_180135	3300039062	Bacteria	8660
617	Ga0400483_210780	3300039062	Bacteria	10470
618	Ga0400483_219056	3300039062	Bacteria	2595
619	Ga0400483_228091	3300039062	Bacteria	14906
620	Ga0400483_256324	3300039062	Bacteria	3100
621	Ga0400483_266740	3300039062	Bacteria	30755
622	Ga0400483_275518	3300039062	Bacteria	1932
623	Ga0400483_283418	3300039062	Bacteria	4217
624	Ga0400489_00591	3300039093	Bacteria	1958
625	Ga0400489_40355	3300039093	Bacteria	9964
626	Ga0400489_65224	3300039093	Bacteria	3524
627	Ga0400487_02857	3300039110	Bacteria	12480
628	Ga0400487_07641	3300039110	Bacteria	1262
629	Ga0400487_22307	3300039110	Bacteria	3115
630	Ga0400487_24442	3300039110	Bacteria	38481
631	Ga0400487_26069	3300039110	Bacteria	54334
632	Ga0400487_31982	3300039110	Bacteria	24104
633	Ga0400487_36190	3300039110	Bacteria	1460
634	Ga0400487_43518	3300039110	Bacteria	8016
635	Ga0400487_65155	3300039110	Bacteria	2349
636	Ga0436365_1279657	3300039437	Bacteria	8019
637	Ga0436361_0880017	3300039447	Bacteria	8784
638	Ga0439436_0009859	3300041404	Bacteria	2922
639	Ga0439438_001091	3300041405	Bacteria	12109
640	Ga0439438_003173	3300041405	Bacteria	6739
641	Ga0439438_003183	3300041405	Bacteria	6720
642	Ga0439438_004345	3300041405	Bacteria	5461
643	Ga0439438_006363	3300041405	Bacteria	4181
644	Ga0439438_006824	3300041405	Bacteria	3981
645	Ga0439438_006855	3300041405	Bacteria	3967
646	Ga0439438_008224	3300041405	Bacteria	3483
647	Ga0439438_009560	3300041405	Bacteria	3130
648	Ga0439438_014690	3300041405	Bacteria	2324
649	Ga0439438_025999	3300041405	Bacteria	1589
650	Ga0439447_004549	3300041407	Bacteria	4744
651	Ga0439447_004599	3300041407	Bacteria	4706
652	Ga0439447_006753	3300041407	Bacteria	3690
653	Ga0439447_008342	3300041407	Bacteria	3213
654	Ga0439447_029549	3300041407	Bacteria	1386
655	Ga0439447_066602	3300041407	Bacteria	841
656	Ga0439466_0002465	3300041411	Bacteria	7254
657	Ga0439466_0002955	3300041411	Bacteria	6638
658	Ga0439466_0005271	3300041411	Bacteria	4947
659	Ga0439466_0007281	3300041411	Bacteria	4189
660	Ga0439466_0007700	3300041411	Bacteria	4068
661	Ga0439466_0008897	3300041411	Bacteria	3775
662	Ga0439466_0009853	3300041411	Bacteria	3559
663	Ga0439466_0015396	3300041411	Bacteria	2777
664	Ga0439466_0032588	3300041411	Bacteria	1775
665	Ga0439466_0035546	3300041411	Bacteria	1685
666	Ga0439465_0100680	3300041413	Bacteria	997
667	Ga0439431_0009622	3300041997	Bacteria	2183
668	Ga0439431_0026517	3300041997	Bacteria	1420
669	Ga0439431_0061687	3300041997	Bacteria	987
670	Ga0439437_005367	3300042000	Bacteria	1408
671	Ga0439443_015839	3300042003	Bacteria	1147
672	Ga0439445_0019725	3300042004	Bacteria	1682
673	Ga0439432_001383	3300042006	Bacteria	9183
674	Ga0439432_004872	3300042006	Bacteria	4870
675	Ga0439432_005314	3300042006	Bacteria	4648
676	Ga0439432_006716	3300042006	Bacteria	4099
677	Ga0439432_008662	3300042006	Bacteria	3568
678	Ga0439432_045194	3300042006	Bacteria	1385
679	Ga0439432_059236	3300042006	Bacteria	1183
680	Ga0439451_001033	3300042009	Bacteria	5407
681	Ga0439451_002013	3300042009	Bacteria	4079
682	Ga0439451_002283	3300042009	Bacteria	3866
683	Ga0439451_006038	3300042009	Bacteria	2474
684	Ga0439452_000753	3300042010	Bacteria	15525
685	Ga0439452_000764	3300042010	Bacteria	15369
686	Ga0439452_001071	3300042010	Bacteria	12090
687	Ga0439452_004297	3300042010	Bacteria	4807
688	Ga0439452_006545	3300042010	Bacteria	3644
689	Ga0439452_008266	3300042010	Bacteria	3143
690	Ga0439452_011131	3300042010	Bacteria	2593
691	Ga0439452_026007	3300042010	Bacteria	1480
692	Ga0439455_0031169	3300042012	Bacteria	1326
693	Ga0439456_000166	3300042013	Bacteria	19446
694	Ga0439456_001408	3300042013	Bacteria	4826
695	Ga0439456_002609	3300042013	Bacteria	3630
696	Ga0439456_008235	3300042013	Bacteria	2151
697	Ga0439456_016830	3300042013	Bacteria	1530
698	Ga0439456_020087	3300042013	Bacteria	1408
699	Ga0439463_001311	3300042016	Bacteria	6623
700	Ga0439463_002590	3300042016	Bacteria	4584
701	Ga0439463_008995	3300042016	Bacteria	2460
702	Ga0439463_016231	3300042016	Bacteria	1841
703	Ga0450911_000001	3300042115	Bacteria	311012
704	Ga0450911_000864	3300042115	Bacteria	8248
705	Ga0450911_003967	3300042115	Bacteria	2495
706	Ga0450919_004555	3300042121	Bacteria	1690
707	Ga0450900_005266	3300042136	Bacteria	1521
708	Ga0450900_010069	3300042136	Bacteria	1207
709	Ga0450902_002765	3300042137	Bacteria	2507
710	Ga0450902_030102	3300042137	Bacteria	912
711	Ga0450903_002630	3300042138	Bacteria	3171
712	Ga0450903_003594	3300042138	Bacteria	2675
713	Ga0450903_007456	3300042138	Bacteria	1800
714	Ga0450904_000136	3300042139	Bacteria	16261
715	Ga0450905_001380	3300042142	Bacteria	3088
716	Ga0450905_003212	3300042142	Bacteria	2144
717	Ga0450905_012685	3300042142	Bacteria	1188
718	Ga0450906_001310	3300042145	Bacteria	5461
719	Ga0450907_000921	3300042146	Bacteria	7009
720	Ga0450907_002184	3300042146	Bacteria	3834
721	Ga0450907_002615	3300042146	Bacteria	3372
722	Ga0450907_020453	3300042146	Bacteria	1111
723	Ga0450910_002467	3300042147	Bacteria	2429
724	Ga0450910_005672	3300042147	Bacteria	1709
725	Ga0439446_0011393	3300042156	Bacteria	2414
726	Ga0439446_0037950	3300042156	Bacteria	1411
727	Ga0450908_012579	3300042184	Bacteria	1534
728	Ga0450909_001993	3300042185	Bacteria	2880
729	Ga0450909_002887	3300042185	Bacteria	2440
730	Ga0439434_0005074	3300042435	Bacteria	3848
731	Ga0439434_0007032	3300042435	Bacteria	3288
732	Ga0439459_0002611	3300042438	Bacteria	2792
733	Ga0439464_0000157	3300042439	Bacteria	11190
734	Ga0439460_0000703	3300042461	Bacteria	7442
735	Ga0439460_0001560	3300042461	Bacteria	5402
736	Ga0439460_0006439	3300042461	Bacteria	2912
737	Ga0450916_002557	3300042530	Bacteria	1942
738	Ga0450918_008548	3300042531	Bacteria	1798
739	Ga0450918_027855	3300042531	Bacteria	994
740	Ga0450893_0005568	3300042532	Bacteria	2023
741	Ga0450893_0014720	3300042532	Bacteria	1314
742	Ga0450901_001308	3300042533	Bacteria	2869
743	Ga0451577_0000013	3300042876	Bacteria	550689
744	Ga0451577_0055837	3300042876	Bacteria	3522
745	Ga0451577_0094281	3300042876	Bacteria	2673
746	Ga0451577_0190883	3300042876	Bacteria	1848
747	Ga0451577_0213673	3300042876	Bacteria	1743
748	Ga0451577_0219365	3300042876	Bacteria	1719
749	Ga0466972_0046599	3300044658	Bacteria	2098
750	Ga0466977_0000151	3300044666	Bacteria	16992
751	Ga0453683_0000033	3300044673	Bacteria	241479
752	Ga0466961_0043879	3300044693	Bacteria	2863
753	Ga0453684_0000029	3300044712	Bacteria	757969
754	Ga0453684_0000085	3300044712	Bacteria	397817
755	Ga0453684_0006406	3300044712	Bacteria	22410
756	Ga0453684_0014629	3300044712	Bacteria	12524
757	Ga0453684_0131943	3300044712	Bacteria	2996
758	Ga0453684_0332819	3300044712	Bacteria	1717
759	Ga0466970_0074937	3300044765	Bacteria	1822
760	Ga0451576_0000018	3300045051	Bacteria	550689
761	Ga0451576_0000320	3300045051	Bacteria	116612
762	Ga0451576_0001448	3300045051	Bacteria	40341
763	Ga0451576_0016908	3300045051	Bacteria	8033
764	Ga0451576_0025846	3300045051	Bacteria	6324
765	Ga0466967_0770704	3300045976	Bacteria	954
766	Ga0495617_002271	3300046452	Bacteria	7782
767	Ga0495617_005844	3300046452	Bacteria	4340
768	Ga0495617_013432	3300046452	Bacteria	2787
769	Ga0495617_019513	3300046452	Bacteria	2293
770	Ga0495617_035856	3300046452	Bacteria	1664
771	Ga0495617_041863	3300046452	Bacteria	1530
772	Ga0495627_000013	3300046453	Bacteria	332765
773	Ga0495627_001540	3300046453	Bacteria	13194
774	Ga0495627_001543	3300046453	Bacteria	13164
775	Ga0495627_002603	3300046453	Bacteria	8507
776	Ga0495627_005677	3300046453	Bacteria	4984
777	Ga0495627_006905	3300046453	Bacteria	4410
778	Ga0495627_008854	3300046453	Bacteria	3732
779	Ga0495627_028737	3300046453	Bacteria	1775
780	Ga0495627_033024	3300046453	Bacteria	1625
781	Ga0495627_045155	3300046453	Bacteria	1343
782	Ga0495592_0203159	3300046454	Bacteria	1336
783	Ga0495603_0044895	3300046455	Bacteria	2636
784	Ga0495603_0087342	3300046455	Bacteria	1825
785	Ga0495603_0147459	3300046455	Bacteria	1367
786	Ga0495590_0003161	3300046457	Bacteria	6733
787	Ga0495590_0006189	3300046457	Bacteria	4687
788	Ga0495590_0031095	3300046457	Bacteria	1869
789	Ga0495590_0038108	3300046457	Bacteria	1675
790	Ga0495590_0065604	3300046457	Bacteria	1271
791	Ga0495590_0101052	3300046457	Bacteria	1024
792	Ga0495591_000020	3300046458	Bacteria	217845
793	Ga0495591_000376	3300046458	Bacteria	37950
794	Ga0495591_000959	3300046458	Bacteria	19736
795	Ga0495591_003817	3300046458	Bacteria	7618
796	Ga0495591_003863	3300046458	Bacteria	7571
797	Ga0495591_003878	3300046458	Bacteria	7539
798	Ga0495591_004517	3300046458	Bacteria	6762
799	Ga0495591_008934	3300046458	Bacteria	4040
800	Ga0495591_009968	3300046458	Bacteria	3727
801	Ga0495591_010153	3300046458	Bacteria	3673
802	Ga0495591_012752	3300046458	Bacteria	3111
803	Ga0495591_013718	3300046458	Bacteria	2948
804	Ga0495591_015190	3300046458	Bacteria	2730
805	Ga0495591_016860	3300046458	Bacteria	2527
806	Ga0495638_0010589	3300046460	Bacteria	6389
807	Ga0495638_0013958	3300046460	Bacteria	5447
808	Ga0495638_0016718	3300046460	Bacteria	4905
809	Ga0495638_0017681	3300046460	Bacteria	4747
810	Ga0495638_0020383	3300046460	Bacteria	4381
811	Ga0495638_0022970	3300046460	Bacteria	4086
812	Ga0495638_0026186	3300046460	Bacteria	3783
813	Ga0495638_0056369	3300046460	Bacteria	2438
814	Ga0495638_0056709	3300046460	Bacteria	2430
815	Ga0495638_0063189	3300046460	Bacteria	2283
816	Ga0495638_0091879	3300046460	Bacteria	1827
817	Ga0495653_0002537	3300046463	Bacteria	14547
818	Ga0495653_0031492	3300046463	Bacteria	4215
819	Ga0495653_0043635	3300046463	Bacteria	3485
820	Ga0495650_0000221	3300046471	Bacteria	118284
821	Ga0495650_0010761	3300046471	Bacteria	5080
822	Ga0495650_0015410	3300046471	Bacteria	3921
823	Ga0495650_0015935	3300046471	Bacteria	3831
824	Ga0495650_0016280	3300046471	Bacteria	3773
825	Ga0495650_0017300	3300046471	Bacteria	3618
826	Ga0495650_0017951	3300046471	Bacteria	3531
827	Ga0495650_0022429	3300046471	Bacteria	3027
828	Ga0495650_0026218	3300046471	Bacteria	2715
829	Ga0495650_0044939	3300046471	Bacteria	1863
830	Ga0495650_0053516	3300046471	Bacteria	1652
831	Ga0495650_0069701	3300046471	Bacteria	1382
832	Ga0495605_0000032	3300046474	Bacteria	210550
833	Ga0495605_0000047	3300046474	Bacteria	171270
834	Ga0495605_0001592	3300046474	Bacteria	14699
835	Ga0495605_0007134	3300046474	Bacteria	6359
836	Ga0495605_0016876	3300046474	Bacteria	3944
837	Ga0495605_0017142	3300046474	Bacteria	3908
838	Ga0495605_0020200	3300046474	Bacteria	3542
839	Ga0495605_0025388	3300046474	Bacteria	3087
840	Ga0495605_0029459	3300046474	Bacteria	2824
841	Ga0495605_0034743	3300046474	Bacteria	2551
842	Ga0495605_0035412	3300046474	Bacteria	2522
843	Ga0495605_0050199	3300046474	Bacteria	2036
844	Ga0495605_0050995	3300046474	Bacteria	2016
845	Ga0495605_0051001	3300046474	Bacteria	2016
846	Ga0495605_0067482	3300046474	Bacteria	1697
847	Ga0495639_0001688	3300046475	Bacteria	9795
848	Ga0495639_0021967	3300046475	Bacteria	2796
849	Ga0495639_0117623	3300046475	Bacteria	1266
850	Ga0495584_0005692	3300046491	Bacteria	6582
851	Ga0495584_0007770	3300046491	Bacteria	5580
852	Ga0495584_0011026	3300046491	Bacteria	4634
853	Ga0495584_0014019	3300046491	Bacteria	4083
854	Ga0495584_0021856	3300046491	Bacteria	3248
855	Ga0495584_0023054	3300046491	Bacteria	3157
856	Ga0495584_0027603	3300046491	Bacteria	2876
857	Ga0495584_0031122	3300046491	Bacteria	2701
858	Ga0495584_0075348	3300046491	Bacteria	1696
859	Ga0495584_0088276	3300046491	Bacteria	1563
860	Ga0495584_0121597	3300046491	Bacteria	1322
861	Ga0495585_0000483	3300046492	Bacteria	37827
862	Ga0495585_0008886	3300046492	Bacteria	6062
863	Ga0495585_0011164	3300046492	Bacteria	5323
864	Ga0495585_0011393	3300046492	Bacteria	5263
865	Ga0495585_0013809	3300046492	Bacteria	4719
866	Ga0495585_0022993	3300046492	Bacteria	3578
867	Ga0495585_0025024	3300046492	Bacteria	3420
868	Ga0495585_0102150	3300046492	Bacteria	1532
869	Ga0495585_0129285	3300046492	Bacteria	1330
870	Ga0495594_0000489	3300046499	Bacteria	20211
871	Ga0495594_0012490	3300046499	Bacteria	4424
872	Ga0495594_0022396	3300046499	Bacteria	3379
873	Ga0495594_0259413	3300046499	Bacteria	990
874	Ga0495596_0000231	3300046500	Bacteria	37776
875	Ga0495596_0015010	3300046500	Bacteria	3254
876	Ga0495607_0000129	3300046501	Bacteria	80548
877	Ga0495607_0000281	3300046501	Bacteria	54632
878	Ga0495607_0002338	3300046501	Bacteria	15520
879	Ga0495607_0003653	3300046501	Bacteria	11680
880	Ga0495607_0003762	3300046501	Bacteria	11471
881	Ga0495607_0006147	3300046501	Bacteria	8493
882	Ga0495607_0007868	3300046501	Bacteria	7335
883	Ga0495607_0009865	3300046501	Bacteria	6438
884	Ga0495607_0009959	3300046501	Bacteria	6400
885	Ga0495607_0012067	3300046501	Bacteria	5718
886	Ga0495607_0018409	3300046501	Bacteria	4453
887	Ga0495607_0020217	3300046501	Bacteria	4214
888	Ga0495607_0022260	3300046501	Bacteria	3982
889	Ga0495607_0057665	3300046501	Bacteria	2224
890	Ga0495607_0059064	3300046501	Bacteria	2189
891	Ga0495607_0072070	3300046501	Bacteria	1924
892	Ga0495607_0095090	3300046501	Bacteria	1606
893	Ga0495607_0100857	3300046501	Bacteria	1546
894	Ga0495607_0150582	3300046501	Bacteria	1191
895	Ga0495607_0152553	3300046501	Bacteria	1181
896	Ga0495607_0159233	3300046501	Bacteria	1148
897	Ga0495607_0172156	3300046501	Bacteria	1092
898	Ga0495607_0202809	3300046501	Bacteria	980
899	Ga0495583_0000052	3300046506	Bacteria	211902
900	Ga0495583_0001185	3300046506	Bacteria	28074
901	Ga0495583_0005780	3300046506	Bacteria	8271
902	Ga0495583_0008659	3300046506	Bacteria	6190
903	Ga0495583_0009370	3300046506	Bacteria	5859
904	Ga0495583_0011883	3300046506	Bacteria	4969
905	Ga0495583_0023592	3300046506	Bacteria	3109
906	Ga0495583_0023648	3300046506	Bacteria	3104
907	Ga0495583_0085198	3300046506	Bacteria	1368
908	Ga0495583_0108403	3300046506	Bacteria	1178
909	Ga0495606_0000669	3300046507	Bacteria	53621
910	Ga0495606_0002501	3300046507	Bacteria	21231
911	Ga0495606_0003264	3300046507	Bacteria	17392
912	Ga0495606_0005069	3300046507	Bacteria	12815
913	Ga0495606_0014464	3300046507	Bacteria	6155
914	Ga0495606_0021674	3300046507	Bacteria	4701
915	Ga0495606_0025275	3300046507	Bacteria	4256
916	Ga0495606_0028239	3300046507	Bacteria	3962
917	Ga0495606_0042575	3300046507	Bacteria	3035
918	Ga0495606_0045629	3300046507	Bacteria	2903
919	Ga0495606_0045634	3300046507	Bacteria	2902
920	Ga0495606_0061965	3300046507	Bacteria	2390
921	Ga0495606_0078029	3300046507	Bacteria	2066
922	Ga0495606_0170421	3300046507	Bacteria	1263
923	Ga0495610_0008711	3300046512	Bacteria	6525
924	Ga0495610_0009928	3300046512	Bacteria	5954
925	Ga0495610_0011456	3300046512	Bacteria	5420
926	Ga0495610_0014936	3300046512	Bacteria	4538
927	Ga0495610_0021977	3300046512	Bacteria	3498
928	Ga0495610_0023134	3300046512	Bacteria	3385
929	Ga0495610_0026436	3300046512	Bacteria	3098
930	Ga0495610_0033337	3300046512	Bacteria	2664
931	Ga0495610_0040827	3300046512	Bacteria	2334
932	Ga0495610_0044649	3300046512	Bacteria	2198
933	Ga0495610_0127116	3300046512	Bacteria	1110
934	Ga0495610_0132532	3300046512	Bacteria	1080
935	Ga0495616_0004932	3300046513	Bacteria	8334
936	Ga0495616_0006463	3300046513	Bacteria	7088
937	Ga0495616_0010373	3300046513	Bacteria	5397
938	Ga0495616_0015102	3300046513	Bacteria	4297
939	Ga0495616_0018806	3300046513	Bacteria	3782
940	Ga0495616_0032842	3300046513	Bacteria	2708
941	Ga0495620_0000002	3300046515	Bacteria	373737
942	Ga0495620_0000019	3300046515	Bacteria	150014
943	Ga0495620_0001475	3300046515	Bacteria	14075
944	Ga0495620_0002415	3300046515	Bacteria	10822
945	Ga0495620_0008232	3300046515	Bacteria	5606
946	Ga0495620_0013369	3300046515	Bacteria	4203
947	Ga0495620_0017199	3300046515	Bacteria	3610
948	Ga0495620_0025420	3300046515	Bacteria	2801
949	Ga0495620_0037121	3300046515	Bacteria	2173
950	Ga0495620_0097952	3300046515	Bacteria	1171
951	Ga0495620_0126572	3300046515	Bacteria	1004
952	Ga0495628_0014937	3300046516	Bacteria	6494
953	Ga0495628_0124008	3300046516	Bacteria	1980
954	Ga0495630_0060721	3300046517	Bacteria	2838
955	Ga0495630_0064876	3300046517	Bacteria	2744
956	Ga0495631_0003575	3300046518	Bacteria	8481
957	Ga0495631_0004375	3300046518	Bacteria	7528
958	Ga0495631_0019406	3300046518	Bacteria	3188
959	Ga0495631_0021543	3300046518	Bacteria	3001
960	Ga0495631_0035235	3300046518	Bacteria	2240
961	Ga0495631_0063462	3300046518	Bacteria	1599
962	Ga0495631_0084006	3300046518	Bacteria	1372
963	Ga0495632_0001503	3300046519	Bacteria	19285
964	Ga0495632_0005232	3300046519	Bacteria	8643
965	Ga0495632_0006113	3300046519	Bacteria	7804
966	Ga0495632_0006454	3300046519	Bacteria	7539
967	Ga0495632_0006699	3300046519	Bacteria	7365
968	Ga0495632_0006844	3300046519	Bacteria	7270
969	Ga0495632_0009876	3300046519	Bacteria	5707
970	Ga0495632_0012140	3300046519	Bacteria	4979
971	Ga0495632_0013249	3300046519	Bacteria	4713
972	Ga0495632_0019096	3300046519	Bacteria	3741
973	Ga0495632_0022612	3300046519	Bacteria	3367
974	Ga0495632_0022985	3300046519	Bacteria	3335
975	Ga0495632_0031695	3300046519	Bacteria	2729
976	Ga0495632_0047460	3300046519	Bacteria	2129
977	Ga0495632_0063457	3300046519	Bacteria	1788
978	Ga0495632_0075076	3300046519	Bacteria	1618
979	Ga0495632_0077643	3300046519	Bacteria	1587
980	Ga0495632_0143206	3300046519	Bacteria	1108
981	Ga0495637_0000594	3300046520	Bacteria	25884
982	Ga0495637_0001738	3300046520	Bacteria	12494
983	Ga0495637_0004300	3300046520	Bacteria	7395
984	Ga0495637_0004996	3300046520	Bacteria	6823
985	Ga0495637_0006530	3300046520	Bacteria	5842
986	Ga0495637_0015582	3300046520	Bacteria	3566
987	Ga0495637_0018438	3300046520	Bacteria	3236
988	Ga0495637_0018494	3300046520	Bacteria	3231
989	Ga0495637_0018614	3300046520	Bacteria	3219
990	Ga0495637_0023034	3300046520	Bacteria	2835
991	Ga0495637_0027077	3300046520	Bacteria	2568
992	Ga0495637_0027372	3300046520	Bacteria	2551
993	Ga0495637_0034309	3300046520	Bacteria	2222
994	Ga0495637_0040098	3300046520	Bacteria	2017
995	Ga0495637_0041085	3300046520	Bacteria	1986
996	Ga0495637_0058651	3300046520	Bacteria	1586
997	Ga0495637_0076474	3300046520	Bacteria	1341
998	Ga0495643_0000272	3300046522	Bacteria	75135
999	Ga0495643_0000640	3300046522	Bacteria	41491
1000	Ga0495643_0003942	3300046522	Bacteria	10627
1001	Ga0495643_0004751	3300046522	Bacteria	9389
1002	Ga0495643_0012511	3300046522	Bacteria	5116
1003	Ga0495643_0019888	3300046522	Bacteria	3880
1004	Ga0495643_0022853	3300046522	Bacteria	3561
1005	Ga0495643_0028918	3300046522	Bacteria	3103
1006	Ga0495643_0032593	3300046522	Bacteria	2891
1007	Ga0495643_0035123	3300046522	Bacteria	2761
1008	Ga0495643_0048043	3300046522	Bacteria	2308
1009	Ga0495643_0071049	3300046522	Bacteria	1827
1010	Ga0495643_0110464	3300046522	Bacteria	1398
1011	Ga0495644_0003180	3300046523	Bacteria	6490
1012	Ga0495644_0008888	3300046523	Bacteria	3863
1013	Ga0495644_0022160	3300046523	Bacteria	2421
1014	Ga0495644_0076496	3300046523	Bacteria	1261
1015	Ga0495644_0144380	3300046523	Bacteria	909
1016	Ga0495648_0001346	3300046524	Bacteria	24261
1017	Ga0495648_0002370	3300046524	Bacteria	17496
1018	Ga0495648_0004086	3300046524	Bacteria	12590
1019	Ga0495648_0008572	3300046524	Bacteria	8027
1020	Ga0495648_0009557	3300046524	Bacteria	7485
1021	Ga0495648_0011579	3300046524	Bacteria	6633
1022	Ga0495648_0019025	3300046524	Bacteria	4843
1023	Ga0495648_0019797	3300046524	Bacteria	4715
1024	Ga0495648_0032635	3300046524	Bacteria	3413
1025	Ga0495648_0038460	3300046524	Bacteria	3059
1026	Ga0495648_0043477	3300046524	Bacteria	2815
1027	Ga0495648_0047808	3300046524	Bacteria	2640
1028	Ga0495648_0064471	3300046524	Bacteria	2158
1029	Ga0495648_0067937	3300046524	Bacteria	2082
1030	Ga0495648_0074826	3300046524	Bacteria	1949
1031	Ga0495648_0090667	3300046524	Bacteria	1712
1032	Ga0495648_0117279	3300046524	Bacteria	1437
1033	Ga0495648_0196486	3300046524	Bacteria	1013
1034	Ga0495666_0013202	3300046526	Bacteria	4118
1035	Ga0495666_0028873	3300046526	Bacteria	2728
1036	Ga0495666_0072634	3300046526	Bacteria	1633
1037	Ga0495642_0001439	3300046528	Bacteria	10672
1038	Ga0495642_0001517	3300046528	Bacteria	10320
1039	Ga0495642_0007727	3300046528	Bacteria	4120
1040	Ga0495642_0008591	3300046528	Bacteria	3906
1041	Ga0495652_0143017	3300046529	Bacteria	1879
1042	Ga0495654_0000925	3300046530	Bacteria	21823
1043	Ga0495654_0001885	3300046530	Bacteria	13938
1044	Ga0495654_0007272	3300046530	Bacteria	6202
1045	Ga0495654_0007276	3300046530	Bacteria	6199
1046	Ga0495654_0010122	3300046530	Bacteria	5143
1047	Ga0495654_0010429	3300046530	Bacteria	5056
1048	Ga0495654_0015766	3300046530	Bacteria	4008
1049	Ga0495654_0016015	3300046530	Bacteria	3972
1050	Ga0495654_0038557	3300046530	Bacteria	2388
1051	Ga0495654_0043519	3300046530	Bacteria	2225
1052	Ga0495654_0045201	3300046530	Bacteria	2173
1053	Ga0495654_0047960	3300046530	Bacteria	2098
1054	Ga0495654_0061945	3300046530	Bacteria	1794
1055	Ga0495654_0102643	3300046530	Bacteria	1314
1056	Ga0495654_0104369	3300046530	Bacteria	1300
1057	Ga0495654_0106785	3300046530	Bacteria	1281
1058	Ga0495654_0251481	3300046530	Bacteria	736
1059	Ga0495640_0049330	3300046533	Bacteria	2904
1060	Ga0495586_0002705	3300046535	Bacteria	9587
1061	Ga0495586_0020317	3300046535	Bacteria	3537
1062	Ga0495587_0009417	3300046536	Bacteria	6259
1063	Ga0495587_0064163	3300046536	Bacteria	2146
1064	Ga0495609_0000032	3300046538	Bacteria	211021
1065	Ga0495609_0000187	3300046538	Bacteria	61967
1066	Ga0495609_0000563	3300046538	Bacteria	29276
1067	Ga0495609_0003267	3300046538	Bacteria	9367
1068	Ga0495609_0005350	3300046538	Bacteria	6776
1069	Ga0495609_0022356	3300046538	Bacteria	2912
1070	Ga0495609_0029563	3300046538	Bacteria	2495
1071	Ga0495609_0048994	3300046538	Bacteria	1886
1072	Ga0495609_0052289	3300046538	Bacteria	1817
1073	Ga0495597_0000004	3300046542	Bacteria	307496
1074	Ga0495597_0005721	3300046542	Bacteria	6532
1075	Ga0495597_0006383	3300046542	Bacteria	6102
1076	Ga0495597_0010493	3300046542	Bacteria	4525
1077	Ga0495597_0012939	3300046542	Bacteria	4007
1078	Ga0495597_0019019	3300046542	Bacteria	3218
1079	Ga0495597_0027400	3300046542	Bacteria	2612
1080	Ga0495597_0061997	3300046542	Bacteria	1628
1081	Ga0495597_0068452	3300046542	Bacteria	1534
1082	Ga0495597_0123804	3300046542	Bacteria	1076
1083	Ga0495645_0131802	3300046543	Bacteria	1751
1084	Ga0495622_0001828	3300046557	Bacteria	10497
1085	Ga0495622_0002145	3300046557	Bacteria	9616
1086	Ga0495622_0002533	3300046557	Bacteria	8825
1087	Ga0495622_0020085	3300046557	Bacteria	3110
1088	Ga0495622_0031561	3300046557	Bacteria	2475
1089	Ga0495622_0161187	3300046557	Bacteria	1011
1090	Ga0495633_0000040	3300046558	Bacteria	177876
1091	Ga0495633_0010871	3300046558	Bacteria	4948
1092	Ga0495633_0019399	3300046558	Bacteria	3439
1093	Ga0495633_0079139	3300046558	Bacteria	1530
1094	Ga0495656_0059682	3300046615	Bacteria	1660
1095	Ga0495668_0017610	3300046616	Bacteria	4140
1096	Ga0495668_0019466	3300046616	Bacteria	3911
1097	Ga0495668_0019934	3300046616	Bacteria	3858
1098	Ga0495668_0036480	3300046616	Bacteria	2754
1099	Ga0495668_0082868	3300046616	Bacteria	1759
1100	Ga0495668_0102069	3300046616	Bacteria	1569
1101	Ga0495634_0048385	3300046642	Bacteria	2863
1102	Ga0495634_0153915	3300046642	Bacteria	1452
1103	Ga0495611_0000814	3300046648	Bacteria	17283
1104	Ga0495611_0001050	3300046648	Bacteria	14600
1105	Ga0495611_0004555	3300046648	Bacteria	5977
1106	Ga0495611_0021523	3300046648	Bacteria	2785
1107	Ga0495611_0038974	3300046648	Bacteria	2115
1108	Ga0495611_0081260	3300046648	Bacteria	1490
1109	Ga0495625_0000010	3300046660	Bacteria	381775
1110	Ga0495625_0028113	3300046660	Bacteria	4220
1111	Ga0495625_0028954	3300046660	Bacteria	4146
1112	Ga0495625_0032031	3300046660	Bacteria	3904
1113	Ga0495625_0034383	3300046660	Bacteria	3741
1114	Ga0495625_0048330	3300046660	Bacteria	3064
1115	Ga0495625_0103159	3300046660	Bacteria	1956
1116	Ga0495625_0304113	3300046660	Bacteria	1019
1117	Ga0495625_0339840	3300046660	Bacteria	951
1118	Ga0495635_0007004	3300046663	Bacteria	7874
1119	Ga0495635_0051084	3300046663	Bacteria	2850
1120	Ga0495659_0001077	3300046664	Bacteria	9502
1121	Ga0495659_0007439	3300046664	Bacteria	3474
1122	Ga0495661_0000037	3300046665	Bacteria	164234
1123	Ga0495661_0000095	3300046665	Bacteria	109100
1124	Ga0495661_0000208	3300046665	Bacteria	67762
1125	Ga0495661_0001285	3300046665	Bacteria	21497
1126	Ga0495661_0005778	3300046665	Bacteria	8749
1127	Ga0495661_0020607	3300046665	Bacteria	4302
1128	Ga0495661_0037263	3300046665	Bacteria	3037
1129	Ga0495661_0042258	3300046665	Bacteria	2810
1130	Ga0495661_0052498	3300046665	Bacteria	2456
1131	Ga0495661_0108991	3300046665	Bacteria	1546
1132	Ga0495661_0113929	3300046665	Bacteria	1503
1133	Ga0495661_0227440	3300046665	Bacteria	963
1134	Ga0495661_0261593	3300046665	Bacteria	879
1135	Ga0495588_0021148	3300046674	Bacteria	3202
1136	Ga0495588_0077324	3300046674	Bacteria	1735
1137	Ga0495623_0024631	3300046679	Bacteria	3875
1138	Ga0495658_0074888	3300046683	Bacteria	1974
1139	Ga0495669_0008510	3300046684	Bacteria	4316
1140	Ga0495613_0099630	3300046689	Bacteria	2099
1141	Ga0495613_0407986	3300046689	Bacteria	926
1142	Ga0495624_0011291	3300046690	Bacteria	6140
1143	Ga0495670_0001570	3300046691	Bacteria	11169
1144	Ga0495670_0004104	3300046691	Bacteria	7147
1145	Ga0495670_0025568	3300046691	Bacteria	2920
1146	Ga0495670_0027884	3300046691	Bacteria	2799
1147	Ga0495670_0065527	3300046691	Bacteria	1831
1148	Ga0495670_0117768	3300046691	Bacteria	1378
1149	Ga0495671_0001786	3300046692	Bacteria	13910
1150	Ga0495671_0002715	3300046692	Bacteria	11076
1151	Ga0495671_0008100	3300046692	Bacteria	5931
1152	Ga0495671_0012661	3300046692	Bacteria	4598
1153	Ga0495671_0014408	3300046692	Bacteria	4256
1154	Ga0495671_0016365	3300046692	Bacteria	3960
1155	Ga0495671_0020690	3300046692	Bacteria	3465
1156	Ga0495671_0024151	3300046692	Bacteria	3169
1157	Ga0495671_0025353	3300046692	Bacteria	3083
1158	Ga0495671_0028131	3300046692	Bacteria	2898
1159	Ga0495671_0028202	3300046692	Bacteria	2894
1160	Ga0495671_0029075	3300046692	Bacteria	2841
1161	Ga0495671_0032166	3300046692	Bacteria	2678
1162	Ga0495671_0053335	3300046692	Bacteria	2007
1163	Ga0495671_0157130	3300046692	Bacteria	1106
1164	Ga0495649_0000947	3300046694	Bacteria	22926
1165	Ga0495649_0009366	3300046694	Bacteria	5827
1166	Ga0495649_0010080	3300046694	Bacteria	5584
1167	Ga0495649_0012004	3300046694	Bacteria	5059
1168	Ga0495649_0019023	3300046694	Bacteria	3858
1169	Ga0495649_0020998	3300046694	Bacteria	3660
1170	Ga0495649_0021252	3300046694	Bacteria	3636
1171	Ga0495649_0027552	3300046694	Bacteria	3151
1172	Ga0495649_0040077	3300046694	Bacteria	2566
1173	Ga0495649_0056458	3300046694	Bacteria	2119
1174	Ga0495649_0060394	3300046694	Bacteria	2039
1175	Ga0495649_0127404	3300046694	Bacteria	1344
1176	Ga0495589_0002228	3300046794	Bacteria	10902
1177	Ga0495589_0002536	3300046794	Bacteria	10164
1178	Ga0495589_0003006	3300046794	Bacteria	9276
1179	Ga0495589_0012264	3300046794	Bacteria	4444
1180	Ga0495589_0026864	3300046794	Bacteria	2914
1181	Ga0495589_0040630	3300046794	Bacteria	2321
1182	Ga0495589_0051265	3300046794	Bacteria	2040
1183	Ga0495589_0081462	3300046794	Bacteria	1575
1184	Ga0495589_0083315	3300046794	Bacteria	1554
1185	Ga0495600_0060791	3300046809	Bacteria	2467
1186	Ga0495600_0175113	3300046809	Bacteria	1383
1187	Ga0495660_0001556	3300046810	Bacteria	15425
1188	Ga0495660_0010294	3300046810	Bacteria	5436
1189	Ga0495660_0010989	3300046810	Bacteria	5258
1190	Ga0495660_0011476	3300046810	Bacteria	5141
1191	Ga0495660_0014523	3300046810	Bacteria	4555
1192	Ga0495660_0014720	3300046810	Bacteria	4524
1193	Ga0495660_0014764	3300046810	Bacteria	4516
1194	Ga0495660_0022502	3300046810	Bacteria	3599
1195	Ga0495660_0022655	3300046810	Bacteria	3585
1196	Ga0495660_0038528	3300046810	Bacteria	2657
1197	Ga0495660_0041184	3300046810	Bacteria	2559
1198	Ga0495660_0060826	3300046810	Bacteria	2027
1199	Ga0495660_0142667	3300046810	Bacteria	1190
1200	Ga0495660_0189361	3300046810	Bacteria	989
1201	Ga0495660_0209456	3300046810	Bacteria	925
1202	Ga0495604_0026431	3300047317	Bacteria	4620
1203	Ga0495604_0036787	3300047317	Bacteria	3858
1204	Ga0495604_0074966	3300047317	Bacteria	2548
1205	Ga0495604_0300872	3300047317	Bacteria	1077
1206	Ga0495636_0008220	3300047318	Bacteria	4116
1207	Ga0495674_0095378	3300047319	Bacteria	2536
1208	Ga0495672_0002942	3300047320	Bacteria	15019
1209	Ga0495672_0010001	3300047320	Bacteria	6802
1210	Ga0495672_0011385	3300047320	Bacteria	6283
1211	Ga0495672_0012759	3300047320	Bacteria	5841
1212	Ga0495672_0014999	3300047320	Bacteria	5279
1213	Ga0495672_0016828	3300047320	Bacteria	4907
1214	Ga0495672_0017581	3300047320	Bacteria	4779
1215	Ga0495672_0023302	3300047320	Bacteria	4008
1216	Ga0495672_0029537	3300047320	Bacteria	3451
1217	Ga0495672_0031749	3300047320	Bacteria	3295
1218	Ga0495672_0045762	3300047320	Bacteria	2615
1219	Ga0495672_0051231	3300047320	Bacteria	2432
1220	Ga0495672_0082673	3300047320	Bacteria	1785
1221	Ga0495672_0122856	3300047320	Bacteria	1377
1222	Ga0495672_0160839	3300047320	Bacteria	1155
1223	Ga0495676_0000002	3300047321	Bacteria	373918
1224	Ga0495676_0013290	3300047321	Bacteria	7399
1225	Ga0495676_0126713	3300047321	Bacteria	1849
1226	Ga0495680_0024428	3300047322	Bacteria	5013
1227	Ga0495680_0039482	3300047322	Bacteria	3765
1228	Ga0495680_0051783	3300047322	Bacteria	3203
1229	Ga0495680_0062937	3300047322	Bacteria	2850
1230	Ga0495680_0085465	3300047322	Bacteria	2375
1231	Ga0495683_0000011	3300047323	Bacteria	212053
1232	Ga0495683_0000089	3300047323	Bacteria	92081
1233	Ga0495683_0003963	3300047323	Bacteria	8517
1234	Ga0495683_0007287	3300047323	Bacteria	5998
1235	Ga0495683_0014227	3300047323	Bacteria	4144
1236	Ga0495683_0021191	3300047323	Bacteria	3350
1237	Ga0495683_0050460	3300047323	Bacteria	2082
1238	Ga0495683_0069872	3300047323	Bacteria	1725
1239	Ga0495683_0166114	3300047323	Bacteria	1017
1240	Ga0495687_010990	3300047443	Bacteria	4907
1241	Ga0495687_013802	3300047443	Bacteria	4192
1242	Ga0495687_032472	3300047443	Bacteria	2381
1243	Ga0495687_033653	3300047443	Bacteria	2322
1244	Ga0495677_0008561	3300047445	Bacteria	3798
1245	Ga0495679_002295	3300047446	Bacteria	9852
1246	Ga0495679_002642	3300047446	Bacteria	8998
1247	Ga0495679_003615	3300047446	Bacteria	7385
1248	Ga0495679_011865	3300047446	Bacteria	3346
1249	Ga0495679_013862	3300047446	Bacteria	3007
1250	Ga0495679_014617	3300047446	Bacteria	2900
1251	Ga0495679_021746	3300047446	Bacteria	2207
1252	Ga0495679_051669	3300047446	Bacteria	1232
1253	Ga0495679_056153	3300047446	Bacteria	1167
1254	Ga0495673_0000573	3300047469	Bacteria	37094
1255	Ga0495673_0003056	3300047469	Bacteria	11246
1256	Ga0495673_0004805	3300047469	Bacteria	8360
1257	Ga0495673_0005998	3300047469	Bacteria	7224
1258	Ga0495673_0007572	3300047469	Bacteria	6214
1259	Ga0495673_0007854	3300047469	Bacteria	6066
1260	Ga0495673_0009619	3300047469	Bacteria	5331
1261	Ga0495673_0012468	3300047469	Bacteria	4504
1262	Ga0495673_0013191	3300047469	Bacteria	4351
1263	Ga0495673_0015791	3300047469	Bacteria	3879
1264	Ga0495673_0025079	3300047469	Bacteria	2869
1265	Ga0495673_0030569	3300047469	Bacteria	2528
1266	Ga0495673_0032618	3300047469	Bacteria	2425
1267	Ga0495673_0040500	3300047469	Bacteria	2104
1268	Ga0495673_0042538	3300047469	Bacteria	2038
1269	Ga0495673_0086144	3300047469	Bacteria	1291
1270	Ga0495673_0123847	3300047469	Bacteria	1021
1271	Ga0495673_0148604	3300047469	Bacteria	907
1272	Ga0495681_0002515	3300047470	Bacteria	13058
1273	Ga0495681_0004285	3300047470	Bacteria	9772
1274	Ga0495681_0006105	3300047470	Bacteria	7961
1275	Ga0495681_0006355	3300047470	Bacteria	7778
1276	Ga0495681_0007065	3300047470	Bacteria	7247
1277	Ga0495681_0007894	3300047470	Bacteria	6730
1278	Ga0495681_0009655	3300047470	Bacteria	5925
1279	Ga0495681_0011886	3300047470	Bacteria	5146
1280	Ga0495681_0014289	3300047470	Bacteria	4558
1281	Ga0495681_0019776	3300047470	Bacteria	3667
1282	Ga0495681_0027875	3300047470	Bacteria	2916
1283	Ga0495681_0041553	3300047470	Bacteria	2231
1284	Ga0495681_0050320	3300047470	Bacteria	1964
1285	Ga0495681_0083805	3300047470	Bacteria	1418
1286	Ga0495686_0003332	3300047472	Bacteria	14020
1287	Ga0495686_0017065	3300047472	Bacteria	4901
1288	Ga0495686_0021370	3300047472	Bacteria	4299
1289	Ga0495686_0047518	3300047472	Bacteria	2709
1290	Ga0495686_0110888	3300047472	Bacteria	1645
1291	Ga0495686_0155524	3300047472	Bacteria	1339
1292	Ga0495686_0203436	3300047472	Bacteria	1135
1293	Ga0495593_0022979	3300047673	Bacteria	3469
1294	Ga0495593_0032827	3300047673	Bacteria	2828
1295	Ga0495593_0243870	3300047673	Bacteria	900
1296	Ga0495593_0245923	3300047673	Bacteria	896
1297	Ga0495602_0087907	3300048088	Bacteria	2588
1298	Ga0495626_0000007	3300048091	Bacteria	276374
1299	Ga0495626_0000246	3300048091	Bacteria	62872
1300	Ga0495626_0003502	3300048091	Bacteria	10051
1301	Ga0495626_0009950	3300048091	Bacteria	5111
1302	Ga0495626_0010191	3300048091	Bacteria	5038
1303	Ga0495626_0010869	3300048091	Bacteria	4834
1304	Ga0495626_0014076	3300048091	Bacteria	4137
1305	Ga0495626_0019958	3300048091	Bacteria	3343
1306	Ga0495626_0058363	3300048091	Bacteria	1763
1307	Ga0495626_0064015	3300048091	Bacteria	1666
1308	Ga0495626_0072012	3300048091	Bacteria	1551
1309	Ga0496100_0462024	3300048903	Bacteria	974
1310	Ga0496101_0216052	3300048904	Bacteria	1487
1311	Ga0496101_0336456	3300048904	Bacteria	1185
1312	Ga0496102_0018098	3300048905	Bacteria	6184
1313	Ga0496102_0335475	3300048905	Bacteria	1424
1314	Ga0496102_0572291	3300048905	Bacteria	1052
1315	Ga0496104_0234067	3300048907	Bacteria	1749
1316	Ga0496104_0410133	3300048907	Bacteria	1267
1317	Ga0496105_0260500	3300048908	Bacteria	1402
1318	Ga0496108_0466655	3300048911	Unclassified	1103
1319	Ga0496109_0240926	3300048912	Bacteria	1702
1320	Ga0496109_0454706	3300048912	Unclassified	1209
1321	Ga0496110_0328304	3300048913	Bacteria	1393
1322	Ga0496111_0098269	3300048914	Bacteria	2150
1323	Ga0496111_0113818	3300048914	Bacteria	1994
1324	Ga0496114_0000303	3300048917	Bacteria	36267
1325	Ga0496114_0006503	3300048917	Bacteria	9207
1326	Ga0496114_0014654	3300048917	Bacteria	6300
1327	Ga0496114_0086640	3300048917	Bacteria	2655
1328	Ga0496114_0124852	3300048917	Bacteria	2218
1329	Ga0496115_0174592	3300048918	Bacteria	1777
1330	Ga0496116_0000085	3300048919	Bacteria	219553
1331	Ga0496116_0001765	3300048919	Bacteria	23575
1332	Ga0496116_0006943	3300048919	Bacteria	10149
1333	Ga0496116_0009249	3300048919	Bacteria	8430
1334	Ga0496116_0026314	3300048919	Bacteria	4259
1335	Ga0496116_0034158	3300048919	Bacteria	3593
1336	Ga0496116_0131054	3300048919	Bacteria	1429
1337	Ga0496117_0002373	3300048920	Bacteria	24010
1338	Ga0496117_0007298	3300048920	Bacteria	10860
1339	Ga0496117_0018516	3300048920	Bacteria	5762
1340	Ga0496117_0018978	3300048920	Bacteria	5668
1341	Ga0496117_0023927	3300048920	Bacteria	4849
1342	Ga0496117_0036246	3300048920	Bacteria	3693
1343	Ga0496117_0047138	3300048920	Bacteria	3094
1344	Ga0496117_0118652	3300048920	Bacteria	1630
1345	Ga0496117_0144823	3300048920	Bacteria	1416
1346	Ga0496117_0236909	3300048920	Bacteria	1004
1347	Ga0496118_0004346	3300048921	Bacteria	16869
1348	Ga0496118_0019359	3300048921	Bacteria	6086
1349	Ga0496118_0031366	3300048921	Bacteria	4407
1350	Ga0496118_0034014	3300048921	Bacteria	4169
1351	Ga0496118_0041389	3300048921	Bacteria	3648
1352	Ga0496118_0064444	3300048921	Bacteria	2689
1353	Ga0496118_0085212	3300048921	Bacteria	2201
1354	Ga0496118_0147697	3300048921	Bacteria	1477
1355	Ga0496118_0150084	3300048921	Bacteria	1460
1356	Ga0496119_0000536	3300048922	Bacteria	51614
1357	Ga0496119_0183550	3300048922	Bacteria	1095
1358	Ga0496120_0002323	3300048923	Bacteria	19584
1359	Ga0496120_0076845	3300048923	Bacteria	1818
1360	Ga0496120_0204234	3300048923	Bacteria	954
1361	Ga0496121_0000505	3300048924	Bacteria	74599
1362	Ga0496121_0015365	3300048924	Bacteria	8028
1363	Ga0496121_0020861	3300048924	Bacteria	6455
1364	Ga0496121_0052342	3300048924	Bacteria	3430
1365	Ga0496121_0066940	3300048924	Bacteria	2914
1366	Ga0496121_0117410	3300048924	Bacteria	2016
1367	Ga0496121_0166028	3300048924	Bacteria	1609
1368	Ga0496121_0176115	3300048924	Bacteria	1548
1369	Ga0496122_0000945	3300048925	Bacteria	52642
1370	Ga0496122_0005538	3300048925	Bacteria	14992
1371	Ga0496122_0006020	3300048925	Bacteria	14148
1372	Ga0496122_0007437	3300048925	Bacteria	12172
1373	Ga0496122_0060147	3300048925	Bacteria	2800
1374	Ga0496122_0123740	3300048925	Bacteria	1661
1375	Ga0496122_0126741	3300048925	Bacteria	1632
1376	Ga0496123_0000437	3300048926	Bacteria	74882
1377	Ga0496123_0000888	3300048926	Bacteria	47314
1378	Ga0496123_0003233	3300048926	Bacteria	18540
1379	Ga0496123_0025952	3300048926	Bacteria	4403
1380	Ga0496123_0060800	3300048926	Bacteria	2432
1381	Ga0496123_0100683	3300048926	Bacteria	1682
1382	Ga0496123_0137759	3300048926	Bacteria	1340
1383	Ga0496124_0000807	3300048927	Bacteria	50885
1384	Ga0496124_0004554	3300048927	Bacteria	16116
1385	Ga0496124_0008283	3300048927	Bacteria	10891
1386	Ga0496124_0010386	3300048927	Bacteria	9434
1387	Ga0496124_0010673	3300048927	Bacteria	9268
1388	Ga0496124_0018964	3300048927	Bacteria	6422
1389	Ga0496124_0078335	3300048927	Bacteria	2724
1390	Ga0496124_0095099	3300048927	Bacteria	2422
1391	Ga0496124_0095644	3300048927	Bacteria	2414
1392	Ga0496124_0156018	3300048927	Bacteria	1785
1393	Ga0496124_0160210	3300048927	Bacteria	1754
1394	Ga0496124_0173286	3300048927	Bacteria	1668
1395	Ga0496124_0182327	3300048927	Bacteria	1614
1396	Ga0496124_0321103	3300048927	Bacteria	1108
1397	Ga0496125_0000861	3300048928	Bacteria	48649
1398	Ga0496125_0016758	3300048928	Bacteria	7025
1399	Ga0496125_0041313	3300048928	Bacteria	3944
1400	Ga0496125_0049834	3300048928	Bacteria	3474
1401	Ga0496125_0082868	3300048928	Bacteria	2442
1402	Ga0496125_0097371	3300048928	Bacteria	2180
1403	Ga0496125_0137948	3300048928	Bacteria	1702
1404	Ga0496125_0172347	3300048928	Bacteria	1452
1405	Ga0496125_0179356	3300048928	Bacteria	1413
1406	Ga0496125_0309013	3300048928	Bacteria	964
1407	Ga0496126_0031973	3300048929	Bacteria	4964
1408	Ga0496126_0256089	3300048929	Bacteria	1457
1409	Ga0496126_0283466	3300048929	Bacteria	1372
1410	Ga0495678_000033	3300049459	Bacteria	211804
1411	Ga0495678_002996	3300049459	Bacteria	10766
1412	Ga0495678_007050	3300049459	Bacteria	5887
1413	Ga0495678_007571	3300049459	Bacteria	5608
1414	Ga0495678_008995	3300049459	Bacteria	4987
1415	Ga0495678_012399	3300049459	Bacteria	4045
1416	Ga0495678_015114	3300049459	Bacteria	3564
1417	Ga0495678_015250	3300049459	Bacteria	3543
1418	Ga0495678_016562	3300049459	Bacteria	3365
1419	Ga0495678_040305	3300049459	Bacteria	1878
1420	Ga0495678_044785	3300049459	Bacteria	1748
1421	Ga0495678_045075	3300049459	Bacteria	1741
1422	Ga0495678_048426	3300049459	Bacteria	1657
1423	Ga0495678_067619	3300049459	Bacteria	1319
1424	Ga0495678_089914	3300049459	Bacteria	1083
1425	Ga0495682_0000072	3300049460	Bacteria	93119
1426	Ga0495682_0000213	3300049460	Bacteria	46502
1427	Ga0495682_0001612	3300049460	Bacteria	11625
1428	Ga0495682_0022268	3300049460	Bacteria	2370
1429	Ga0495682_0024940	3300049460	Bacteria	2226
1430	Ga0495682_0026801	3300049460	Bacteria	2138
1431	Ga0495682_0032643	3300049460	Bacteria	1923
1432	Ga0501032_0000544	3300049569	Bacteria	30544
1433	Ga0501032_0015477	3300049569	Bacteria	5379
1434	Ga0501032_0074656	3300049569	Bacteria	2259
1435	Ga0501032_0103378	3300049569	Bacteria	1887
1436	Ga0501033_0010735	3300049570	Bacteria	7021
1437	Ga0501033_0113376	3300049570	Bacteria	1971
1438	Ga0501033_0300594	3300049570	Bacteria	1130
1439	Ga0501034_0000041	3300049571	Bacteria	229264
1440	Ga0501034_0022786	3300049571	Bacteria	6380
1441	Ga0501036_0027523	3300049572	Bacteria	4803
1442	Ga0501036_0034801	3300049572	Bacteria	4261
1443	Ga0501036_0181536	3300049572	Bacteria	1771
1444	Ga0501037_0002860	3300049573	Bacteria	12517
1445	Ga0501037_0020086	3300049573	Bacteria	4931
1446	Ga0501037_0049458	3300049573	Bacteria	3078
1447	Ga0501037_0116790	3300049573	Bacteria	1920
1448	Ga0501037_0145203	3300049573	Bacteria	1697
1449	Ga0501038_0003152	3300049574	Bacteria	15392
1450	Ga0501038_0023378	3300049574	Bacteria	5526
1451	Ga0501038_0036619	3300049574	Bacteria	4305
1452	Ga0501038_0069163	3300049574	Bacteria	2999
1453	Ga0501038_0231891	3300049574	Bacteria	1469
1454	Ga0501038_0344047	3300049574	Unclassified	1162
1455	Ga0501039_0012138	3300049575	Bacteria	6569
1456	Ga0501039_0204654	3300049575	Bacteria	1552
1457	Ga0501039_0262791	3300049575	Bacteria	1357
1458	Ga0501040_0000770	3300049576	Bacteria	19940
1459	Ga0501042_0069563	3300049578	Bacteria	2517
1460	Ga0501043_0040439	3300049579	Bacteria	3664
1461	Ga0501043_0072241	3300049579	Bacteria	2710
1462	Ga0501046_0032971	3300049580	Bacteria	4190
1463	Ga0501046_0058657	3300049580	Bacteria	3017
1464	Ga0501047_0028905	3300049581	Bacteria	5347
1465	Ga0501047_0159945	3300049581	Bacteria	2124
1466	Ga0501047_0411821	3300049581	Bacteria	1184
1467	Ga0501068_0178444	3300049584	Bacteria	1342
1468	Ga0501073_0004960	3300049589	Bacteria	9984
1469	Ga0501079_0105110	3300049741	Bacteria	2191
1470	Ga0501080_0002132	3300049742	Bacteria	17194
1471	Ga0501083_0011559	3300049744	Bacteria	6192
1472	Ga0501241_000578	3300049758	Bacteria	7863
1473	Ga0501035_0007405	3300049822	Bacteria	10254
1474	Ga0501035_0025130	3300049822	Bacteria	5461
1475	Ga0501035_0230568	3300049822	Bacteria	1578
1476	Ga0501044_0001523	3300049823	Bacteria	27175
1477	Ga0501044_0004461	3300049823	Bacteria	15650
1478	Ga0501044_0015312	3300049823	Bacteria	8260
1479	Ga0501045_0110258	3300049824	Bacteria	2040
1480	Ga0501226_000014	3300049853	Bacteria	166091
1481	nmdc:mga03683_43263_c1	3300050489	Bacteria	1857
1482	nmdc:mga09592_35615_c1	3300050508	Bacteria	4167
1483	nmdc:mga0qj67_42002_c1	3300050509	Bacteria	3599
1484	nmdc:mga06r32_4263_c1	3300050510	Bacteria	12804
1485	nmdc:mga08y16_8514_c1	3300050511	Bacteria	10743
1486	nmdc:mga08y16_95174_c1	3300050511	Bacteria	3102
1487	nmdc:mga0n895_670605_c1	3300050512	Bacteria	1034
1488	nmdc:mga08x19_277914_c1	3300050514	Bacteria	1160
1489	Ga0495612_0126842	3300053078	Bacteria	1100
1490	Ga0500572_026825	3300053111	Bacteria	1573
1491	Ga0500618_003225	3300053125	Bacteria	5682
1492	Ga0500618_022347	3300053125	Bacteria	1537
1493	Ga0500659_0013561	3300053135	Bacteria	4447
1494	Ga0500564_032295	3300053138	Bacteria	2414
1495	Ga0500586_171215	3300053145	Bacteria	730
1496	Ga0501084_0057454	3300054114	Bacteria	3256
1497	Ga0590071_005784	3300059421	Bacteria	2964
1498	Ga0590074_013959	3300059423	Bacteria	1358
1499	Ga0501082_0074396	3300060353	Bacteria	2926
1500	2510281295	2510065053	Bacteria	5005518
1501	2510294419	2510065055	Bacteria	5037935
1502	2510309443	2510065058	Bacteria	5005894
1503	2511252459	2511231004	Bacteria	6669789
1504	2511263917	2511231006	Bacteria	6794709
1505	2511272065	2511231007	Bacteria	6306603
1506	2511280524	2511231008	Bacteria	6624100
1507	2511288565	2511231010	Bacteria	6373152
1508	2511296783	2511231011	Bacteria	6149768
1509	2511302176	2511231012	Bacteria	6738011
1510	2511312199	2511231014	Bacteria	6462302
1511	2511321983	2511231015	Bacteria	6598026
1512	2511324521	2511231016	Bacteria	6704427
1513	2511334399	2511231017	Bacteria	6503007
1514	2511336029	2511231018	Bacteria	6436256
1515	2511344255	2511231019	Bacteria	6520662
1516	2511352325	2511231020	Bacteria	6115223
1517	2511356212	2511231021	Bacteria	7302637
1518	2511363648	2511231022	Bacteria	6719296
1519	2511366860	2511231023	Bacteria	6808468
1520	2511374725	2511231024	Bacteria	5835885
1521	2511416326	2511231031	Bacteria	6558529
1522	2511823566	2511231156	Bacteria	6845832
1523	2512324920	2512047018	Bacteria	6663241
1524	2554816288	2554235132	Bacteria	6772433
1525	2555247903	2554235231	Bacteria	5215788
1526	2555668634	2554235341	Bacteria	6867980
1527	2566035718	2565956521	Bacteria	4468993
1528	2583791045	2582580891	Bacteria	6800976
1529	2597856810	2597489887	Bacteria	6666321
1530	2597865114	2597489888	Bacteria	6179543
1531	2597870973	2597489889	Bacteria	6297495
1532	2599330433	2599185155	Bacteria	5827168
1533	2599357004	2599185160	Bacteria	6844013
1534	2599362209	2599185161	Bacteria	6960462
1535	2599368529	2599185162	Bacteria	6957254
1536	2599375318	2599185163	Bacteria	6995158
1537	2599382109	2599185164	Bacteria	6841688
1538	2599388556	2599185165	Bacteria	6843250
1539	2599394176	2599185166	Bacteria	6959206
1540	2599400244	2599185167	Bacteria	6353609
1541	2599405941	2599185168	Bacteria	6997636
1542	2599451425	2599185179	Bacteria	6611171
1543	2599464491	2599185181	Bacteria	6844519
1544	2599468815	2599185182	Bacteria	6883168
1545	2599483833	2599185185	Bacteria	6652270
1546	2599493514	2599185186	Bacteria	6831633
1547	2599504057	2599185188	Bacteria	6164180
1548	2599508738	2599185189	Bacteria	5862825
1549	2599512598	2599185190	Bacteria	6285678
1550	2599519948	2599185191	Bacteria	6297582
1551	2599615680	2599185212	Bacteria	6765997
1552	2599770157	2599185248	Bacteria	6696816
1553	2599801479	2599185257	Bacteria	6492581
1554	2599878456	2599185288	Bacteria	6666191
1555	2599887643	2599185289	Bacteria	6778765
1556	2599891274	2599185290	Bacteria	6289611
1557	2599899878	2599185291	Bacteria	6775623
1558	2599932018	2599185300	Bacteria	6062622
1559	2599941916	2599185302	Bacteria	5954930
1560	2599947659	2599185303	Bacteria	6512725
1561	2599952564	2599185304	Bacteria	5951361
1562	2599960455	2599185305	Bacteria	6748700
1563	2599965361	2599185306	Bacteria	6637356
1564	2599971570	2599185307	Bacteria	6194719
1565	2599978500	2599185308	Bacteria	6621546
1566	2599982080	2599185309	Bacteria	5969593
1567	2599987990	2599185310	Bacteria	6014457
1568	2599995692	2599185311	Bacteria	6354990
1569	2599998120	2599185312	Bacteria	5912071
1570	2600008597	2599185313	Bacteria	6658188
1571	2600010593	2599185314	Bacteria	6621749
1572	2600017505	2599185315	Bacteria	6771107
1573	2600025488	2599185316	Bacteria	6320029
1574	2600030372	2599185317	Bacteria	6435722
1575	2600034527	2599185318	Bacteria	6961590
1576	2600041634	2599185319	Bacteria	6637840
1577	2600046318	2599185320	Bacteria	5963263
1578	2600052329	2599185321	Bacteria	6764560
1579	2600057695	2599185322	Bacteria	6763055
1580	2600065098	2599185323	Bacteria	6688755
1581	2600073725	2599185324	Bacteria	6590677
1582	2600078806	2599185325	Bacteria	6324919
1583	2600216768	2599185356	Bacteria	6843884
1584	2600360804	2600254930	Bacteria	6431253
1585	2600365780	2600254931	Bacteria	6734225
1586	2600446778	2600254954	Bacteria	5100516
1587	2601625188	2600255283	Bacteria	6061572
1588	2601689629	2600255296	Bacteria	5784754
1589	2601776635	2600255313	Bacteria	6842543
1590	2601795462	2600255318	Bacteria	6383414
1591	2602010684	2600255389	Bacteria	5275336
1592	2606075531	2603880185	Bacteria	6379190
1593	2606128557	2603880199	Bacteria	6377649
1594	2608380312	2606217733	Bacteria	6360972
1595	2621298329	2619619299	Bacteria	6649820
1596	2624479397	2623620443	Bacteria	6427864
1597	2624493608	2623620446	Bacteria	6500345
1598	2643841796	2643221565	Bacteria	6216018
1599	2643874287	2643221571	Bacteria	6228673
1600	2643952537	2643221589	Bacteria	6250934
1601	2644022299	2643221602	Bacteria	6249926
1602	2644187191	2643221633	Bacteria	6733554
1603	2644281748	2643221650	Bacteria	7029547
1604	2644621947	2643221713	Bacteria	6554480
1605	2649122610	2648501241	Bacteria	5312320
1606	2652544712	2651869719	Bacteria	6047974
1607	2652974066	2651869818	Bacteria	5864031
1608	2671090304	2667528170	Bacteria	6786960
1609	2671098848	2667528171	Bacteria	6900659
1610	2671125889	2667528176	Bacteria	6724917
1611	2671768428	2671180172	Bacteria	6495783
1612	2677899898	2675903420	Bacteria	6247433
1613	2678262487	2675903515	Bacteria	6580491
1614	2691331740	2690315857	Bacteria	4396207
1615	2715751917	2713897148	Bacteria	5883533
1616	2715754964	2713897149	Bacteria	6506249
1617	2718633243	2718217725	Bacteria	5758958
1618	2723249868	2721755607	Bacteria	5841722
1619	2723879815	2721755763	Bacteria	4464185
1620	2729148349	2728369097	Bacteria	4333476
1621	2738671286	2738541265	Bacteria	6594665
1622	2738691771	2738541271	Bacteria	5657310
1623	2738749680	2738541282	Bacteria	6593925
1624	2738808459	2738541294	Bacteria	6925949
1625	2738858720	2738541303	Bacteria	6591772
1626	2738895819	2738541309	Bacteria	6926455
1627	2739200822	2738543004	Bacteria	6381073
1628	2739261072	2738543015	Bacteria	6750701
1629	2739267545	2738543016	Bacteria	5657564
1630	2739287783	2738543020	Bacteria	5718238
1631	2739293095	2738543021	Bacteria	5718241
1632	2739316065	2738543025	Bacteria	6600348
1633	2743736238	2740892503	Bacteria	6855563
1634	2745008830	2744054620	Bacteria	6551379
1635	2765582795	2765235841	Bacteria	6137024
1636	2774122840	2773857670	Bacteria	6407454
1637	2774131676	2773857672	Bacteria	4993178
1638	2774137555	2773857673	Bacteria	6513460
1639	2784265697	2784132063	Bacteria	6262788
1640	2784315198	2784132072	Bacteria	6596533
1641	2794596295	2791355520	Bacteria	5948615
1642	2807409461	2806310737	Bacteria	5751088
1643	2807457762	2806310745	Bacteria	5742165
1644	2808856107	2808606361	Bacteria	6136259
1645	2808904073	2808606373	Bacteria	4423627
1646	2808923575	2808606376	Bacteria	6248667
1647	2808927329	2808606377	Bacteria	6646337
1648	2808936142	2808606378	Bacteria	6177535
1649	2808939219	2808606379	Bacteria	5022697
1650	2808945662	2808606380	Bacteria	6248705
1651	2808950132	2808606381	Bacteria	6646461
1652	2808957653	2808606382	Bacteria	6841132
1653	2808964612	2808606383	Bacteria	6138645
1654	2808971279	2808606384	Bacteria	8474373
1655	2808977823	2808606385	Bacteria	6711065
1656	2808993303	2808606388	Bacteria	6706662
1657	2808999500	2808606389	Bacteria	6138126
1658	2809006337	2808606390	Bacteria	8476311
1659	2809013246	2808606391	Bacteria	8308166
1660	2809216335	2808606445	Bacteria	6057339
1661	2812365888	2811994881	Bacteria	6298475
1662	2817492526	2816332298	Bacteria	6852809
1663	2819654047	2818991456	Bacteria	6123676
1664	2819703969	2818991464	Bacteria	6907494
1665	2823423247	2823421272	Bacteria	5372474
1666	2825653154	2825651385	Bacteria	6715909
1667	2826583340	2826581358	Bacteria	5963467
1668	2834031881	2834028612	Bacteria	6354979
1669	2842809578	2842805378	Bacteria	5385175
1670	2842817336	2842815866	Bacteria	5947510
1671	2842827660	2842826826	Bacteria	5974129
1672	2842832732	2842832357	Bacteria	5959113
1673	2842841230	2842837860	Bacteria	6066181
1674	2842848180	2842843487	Bacteria	6004777
1675	2842850414	2842849001	Bacteria	5924277
1676	2842854541	2842854478	Bacteria	6143501
1677	2844669142	2844665904	Bacteria	6817974
1678	2852613106	2852612431	Bacteria	6885235
1679	2852658878	2852657418	Bacteria	6472974
1680	2852669159	2852667396	Bacteria	6885555
1681	2860340056	2860339153	Bacteria	6846989
1682	2860871618	2860867994	Bacteria	5645326
1683	2878031402	2878029506	Bacteria	6418441
1684	2880232267	2880230671	Bacteria	6140320
1685	2887632366	2887630918	Bacteria	3239855
1686	2904521837	2904518522	Bacteria	6068986
1687	2904553235	2904550169	Bacteria	6221258
1688	2908451023	2908446538	Bacteria	6829095
1689	2912965338	2912963787	Bacteria	5646108
1690	2913038459	2913036834	Bacteria	6704877
1691	2916181165	2916178963	Bacteria	5265078
1692	2917072405	2917070673	Bacteria	6868303
1693	2917833536	2917832318	Bacteria	5346010
1694	2919064126	2919063839	Bacteria	6302690
1695	2919129438	2919125081	Bacteria	5385106
1696	2919157730	2919155634	Bacteria	4860545
1697	2919386363	2919385768	Bacteria	5897293
1698	2919457145	2919456309	Bacteria	6586567
1699	2919481743	2919481497	Bacteria	6907839
1700	2919491360	2919487758	Bacteria	5929766
1701	2919494181	2919493220	Bacteria	4598500
1702	2919498514	2919497567	Bacteria	4408621
1703	2919505399	2919501602	Bacteria	5286340
1704	2919536999	2919534386	Bacteria	4577686
1705	2919543813	2919543075	Bacteria	4728703
1706	2919688611	2919688452	Bacteria	4595932
1707	2919702908	2919697872	Bacteria	6553725
1708	2923155252	2923153595	Bacteria	6870622
1709	2923519909	2923519811	Bacteria	6298479
1710	2923527663	2923525760	Bacteria	4472324
1711	2923587421	2923586266	Bacteria	6565975
1712	2926067076	2926063275	Bacteria	5285848
1713	2929145917	2929144301	Bacteria	6622272
1714	2929193655	2929189879	Bacteria	5930554
1715	2931370742	2931369376	Bacteria	6847892
1716	2931394979	2931390751	Bacteria	6273349
1717	2931400052	2931396565	Bacteria	7251677
1718	2935354569	2935353572	Unclassified	6955622
1719	2939639775	2939636861	Bacteria	6297853
1720	2939655162	2939651529	Bacteria	5895393
1721	2945932328	2945928738	Bacteria	6053221
1722	2945965212	2945961074	Bacteria	7342064
1723	2946008518	2946006987	Bacteria	6705746
1724	2946032120	2946027586	Bacteria	6049274
1725	2947238954	2947233263	Bacteria	6439278
1726	2952252975	2952252522	Bacteria	4171745
1727	2969306185	2969304461	Bacteria	6601805
1728	2974292167	2974289157	Bacteria	6080362
1729	2974300796	2974298342	Bacteria	4840922
1730	2984290786	2984286254	Bacteria	6702062
1731	2984503266	2984499530	Bacteria	5020881
1732	2984508260	2984504281	Bacteria	5262371
1733	2988733455	2988728565	Bacteria	6124362
1734	2990198870	2990196909	Bacteria	4054280
1735	2998141575	2998139840	Bacteria	6073514
1736	3007256784	3007252601	Bacteria	4559114
1737	3007318976	3007315729	Bacteria	5076637
1738	3007400793	3007395558	Bacteria	6755444
1739	3007421250	3007419365	Bacteria	7026924
1740	3007512968	3007511990	Bacteria	6481491
1741	3007617093	3007614139	Bacteria	6053559
1742	3007622380	3007619802	Bacteria	6411688
1743	3007722831	3007718800	Bacteria	5971527
1744	3007805274	3007803356	Bacteria	5931491
1745	3007856173	3007855910	Bacteria	5637581
1746	3007863185	3007861166	Bacteria	6045338
1747	3007870445	3007866637	Bacteria	5899198
1748	3007875615	3007872151	Bacteria	5268868
1749	637318992	637000220	Bacteria	7074893
1750	640488519	640427133	Bacteria	4567418
1751	651176556	651053060	Bacteria	4689946
1752	8001523369	8001522603	Bacteria	4726425
1753	8002746424	8002745576	Bacteria	4840272
1754	8011354418	8011350971	Bacteria	6158957
1755	8015689473	8015687852	Bacteria	6613826
1756	8016729533	8016728285	Bacteria	5263933
1757	8019774124	8019769354	Bacteria	6924660
1758	8019780211	8019775933	Bacteria	6858656
1759	8029999173	8029995093	Bacteria	5990776
1760	8034963836	8034962539	Bacteria	4884839
1761	8052498477	8052494512	Bacteria	5765634
1762	8054289118	8054285046	Bacteria	6919322
1763	8054350761	8054347763	Bacteria	5901107
1764	8054358469	8054357960	Bacteria	2867777
1765	8054507487	8054503363	Bacteria	6101651
1766	8054930120	8054929484	Bacteria	5599761
1767	8055772607	8055770955	Bacteria	6827675
1768	8055822427	8055817908	Bacteria	6609162
1769	8055879022	8055878733	Bacteria	5907058
1770	8056119782	8056115690	Bacteria	5527654
1771	8056122383	8056120720	Bacteria	5758328
1772	8056130224	8056125926	Bacteria	6228218
1773	8056135884	8056131705	Bacteria	6107031
1774	8056141409	8056137416	Bacteria	6147080
1775	8056147373	8056143049	Bacteria	6307666
1776	8056153208	8056148874	Bacteria	6479865
1777	8056156268	8056155041	Bacteria	6486948
1778	8056162093	8056161164	Bacteria	6106669
1779	8056169412	8056166840	Bacteria	5820959
1780	8056175590	8056172158	Bacteria	6133900
1781	8056181096	8056177738	Bacteria	6748268
1782	8056573263	8056569372	Bacteria	5997322
1783	8057799034	8057798959	Bacteria	6713499
1784	Ga0068856_100717839
1785	MRS2a_Contig_7216
1786	MRS2a_Contig_746
1787	SwRhRL2b_contig_3653603
1788	MBSR1b_contig_12794323
1789	JGI24741J21665_1007627
1790	JGI25162J39368_1000037
1791	JGI25162J39368_1000087
1792	JGI25154J39366_1012078
1793	JGI25163J39215_1000594
1794	JGI25163J39215_1001754
1795	JGI25164J39214_1000020
1796	JGI25164J39214_1000051
1797	JGI25164J39214_1000065
1798	JGI25151J46595_10008885
1799	JGI25165J46597_1000077
1800	JGI25165J46597_1000091
1801	JGI26128J50194_1000847
1802	Ga0055538_1000086
1803	Ga0055539_1000128
1804	Ga0055533_1000185
1805	Ga0055532_1000188
1806	Ga0055525_1000195
1807	Ga0055536_1000042
1808	Ga0055536_1000571
1809	Ga0055536_1001274
1810	Ga0055536_1001447
1811	Ga0055536_1030982
1812	Ga0055530_10000304
1813	Ga0055530_10000870
1814	Ga0055530_10001489
1815	Ga0055530_10003180
1816	Ga0055540_1000292
1817	Ga0055540_1000438
1818	Ga0055540_1000634
1819	Ga0055531_10000581
1820	Ga0055541_1000120
1821	Ga0065165_1003619
1822	Ga0065714_10000179
1823	Ga0065714_10002698
1824	Ga0065714_10003663
1825	Ga0065714_10007886
1826	Ga0065714_10008639
1827	Ga0065714_10008889
1828	Ga0065714_10009867
1829	Ga0065714_10017446
1830	Ga0065714_10066581
1831	Ga0065714_10066919
1832	Ga0065714_10070393
1833	Ga0065714_10072608
1834	Ga0065714_10074017
1835	Ga0065714_10083987
1836	Ga0065704_10003480
1837	Ga0065704_10007662
1838	Ga0065704_10008162
1839	Ga0065704_10081604
1840	Ga0065704_10120554
1841	Ga0065704_10313138
1842	Ga0065712_10004906
1843	Ga0065712_10006839
1844	Ga0065712_10067744
1845	Ga0065715_10129124
1846	Ga0070670_100000001
1847	Ga0070670_100001830
1848	Ga0070670_100053412
1849	Ga0068869_100092375
1850	Ga0070666_10108059
1851	Ga0070661_100000008
1852	Ga0070668_100075816
1853	Ga0070669_100006984
1854	Ga0070669_100017801
1855	Ga0070669_100272577
1856	Ga0070671_100000018
1857	Ga0070674_100021390
1858	Ga0070659_100404846
1859	Ga0070659_100543038
1860	Ga0070667_100000331
1861	Ga0070714_100035000
1862	Ga0070663_100161473
1863	Ga0070662_100000056
1864	Ga0070681_10170120
1865	Ga0068867_100023879
1866	Ga0070685_10000049
1867	Ga0070707_100192415
1868	Ga0070684_100181994
1869	Ga0070697_100572080
1870	Ga0068853_100000855
1871	Ga0068853_100007795
1872	Ga0070672_100021732
1873	Ga0070693_100070863
1874	Ga0070665_100011945
1875	Ga0070665_100094764
1876	Ga0070665_100347830
1877	Ga0070704_100261885
1878	Ga0070704_100723460
1879	Ga0068855_100015899
1880	Ga0068855_100140638
1881	Ga0070664_100000466
1882	Ga0070664_100207741
1883	Ga0070664_100421828
1884	Ga0068857_100135404
1885	Ga0068857_100220281
1886	Ga0068854_100006137
1887	Ga0068854_100187329
1888	Ga0068856_100331595
1889	Ga0070702_100388122
1890	Ga0068859_100027399
1891	Ga0068864_100000012
1892	Ga0068866_10002548
1893	Ga0068866_10046005
1894	Ga0068861_100010826
1895	Ga0068851_10000028
1896	Ga0068863_100130245
1897	Ga0068858_100009868
1898	Ga0068858_100118037
1899	Ga0068858_100205480
1900	Ga0068858_100427408
1901	Ga0068860_100001710
1902	Ga0068862_100005719
1903	Ga0068862_100031831
1904	Ga0068862_100036098
1905	Ga0068862_100157422
1906	Ga0075364_10105605
1907	Ga0075432_10002375
1908	Ga0075432_10005427
1909	Ga0075432_10048795
1910	Ga0070716_100438116
1911	Ga0075362_10057084
1912	Ga0075362_10117077
1913	Ga0075370_10000524
1914	Ga0068871_100224738
1915	Ga0075430_100109826
1916	Ga0075431_100003695
1917	Ga0075434_100487026
1918	Ga0075429_100007951
1919	Ga0068865_100193502
1920	Ga0075436_100136468
1921	Ga0097620_100027400
1922	Ga0099823_1000024
1923	Ga0079104_1000543
1924	Ga0079104_1001214
1925	Ga0079104_1040972
1926	Ga0099826_10008026
1927	Ga0105251_10000060
1928	Ga0105251_10000221
1929	Ga0105251_10001570
1930	Ga0105251_10003052
1931	Ga0105251_10006170
1932	Ga0105251_10009446
1933	Ga0105251_10017278
1934	Ga0105251_10018136
1935	Ga0105251_10020075
1936	Ga0105251_10020386
1937	Ga0105251_10027627
1938	Ga0105251_10049315
1939	Ga0105251_10160853
1940	Ga0105251_10206034
1941	Ga0105244_10004756
1942	Ga0105244_10005482
1943	Ga0105244_10005859
1944	Ga0105244_10008923
1945	Ga0105244_10018991
1946	Ga0105244_10024650
1947	Ga0105244_10025625
1948	Ga0105244_10036162
1949	Ga0105244_10036811
1950	Ga0105244_10045914
1951	Ga0105244_10046553
1952	Ga0105244_10077645
1953	Ga0105244_10084332
1954	Ga0105244_10106675
1955	Ga0105244_10139521
1956	Ga0105244_10152739
1957	Ga0105250_10000215
1958	Ga0105250_10002063
1959	Ga0105250_10008731
1960	Ga0105250_10012494
1961	Ga0105250_10017250
1962	Ga0105250_10021202
1963	Ga0105250_10029354
1964	Ga0105250_10038991
1965	Ga0105250_10092963
1966	Ga0111539_10019233
1967	Ga0111539_10040342
1968	Ga0105247_10155629
1969	Ga0105243_10000158
1970	Ga0105243_10001567
1971	Ga0105243_10040342
1972	Ga0105243_10056668
1973	Ga0105243_10107737
1974	Ga0105243_10111102
1975	Ga0105243_10215079
1976	Ga0105243_10364349
1977	Ga0105243_10440538
1978	Ga0105241_10086637
1979	Ga0105242_10001027
1980	Ga0105242_10140834
1981	Ga0105248_10104051
1982	Ga0105237_10000944
1983	Ga0105249_10042407
1984	Ga0105249_10097062
1985	Ga0105239_10242600
1986	Ga0105246_10001106
1987	Ga0105246_10009697
1988	Ga0105246_10032515
1989	Ga0105246_10130349
1990	Ga0105246_10214448
1991	Ga0157345_1000337
1992	Ga0157373_10001402
1993	Ga0157373_10001490
1994	Ga0157373_10006835
1995	Ga0157373_10011111
1996	Ga0157373_10033327
1997	Ga0157373_10042291
1998	Ga0157373_10183690
1999	Ga0157373_10257054
2000	Ga0157371_10000203
2001	Ga0157371_10001725
2002	Ga0157371_10006553
2003	Ga0157371_10011640
2004	Ga0157371_10106710
2005	Ga0157371_10130218
2006	Ga0157371_10201688
2007	Ga0157370_10005599
2008	Ga0157370_10018541
2009	Ga0157370_10033549
2010	Ga0157370_10059116
2011	Ga0157370_10070971
2012	Ga0157370_10092212
2013	Ga0157370_10096674
2014	Ga0157370_10100556
2015	Ga0157369_10020226
2016	Ga0157369_10030498
2017	Ga0157369_10035558
2018	Ga0157369_10037127
2019	Ga0157369_10207212
2020	Ga0157369_10693635
2021	Ga0157369_10884198
2022	Ga0157374_10051401
2023	Ga0157378_10020973
2024	Ga0163162_10024300
2025	Ga0163162_10025717
2026	Ga0163162_10143382
2027	Ga0163162_10204447
2028	Ga0163162_10441608
2029	Ga0163162_10996033
2030	Ga0157372_10002134
2031	Ga0157372_10014583
2032	Ga0157372_10025911
2033	Ga0157372_10498152
2034	Ga0157372_10507343
2035	Ga0157375_10096089
2036	Ga0157375_10288007
2037	Ga0163163_10000162
2038	Ga0163163_10008768
2039	Ga0157380_10067995
2040	Ga0182008_10000040
2041	Ga0182008_10021673
2042	Ga0182008_10030495
2043	Ga0182008_10037326
2044	Ga0182008_10040588
2045	Ga0182008_10054247
2046	Ga0182008_10069304
2047	Ga0157379_10086468
2048	Ga0157379_10096959
2049	Ga0182006_1002164
2050	Ga0182006_1004779
2051	Ga0182006_1015511
2052	Ga0182006_1016346
2053	Ga0182006_1045947
2054	Ga0182006_1047799
2055	Ga0182006_1048133
2056	Ga0182007_10003128
2057	Ga0182007_10027337
2058	Ga0182007_10033666
2059	Ga0182005_1003063
2060	Ga0182005_1022297
2061	Ga0182005_1036184
2062	Ga0182005_1050825
2063	Ga0182005_1052122
2064	Ga0163161_10012274
2065	Ga0163161_10017846
2066	Ga0163161_10023635
2067	Ga0163161_10093843
2068	Ga0163161_10278306
2069	Ga0213872_10001215
2070	Ga0213872_10035315
2071	Ga0209435_100812
2072	Ga0209760_100022
2073	Ga0209760_100053
2074	Ga0209784_100017
2075	Ga0209566_100014
2076	Ga0209674_100028
2077	Ga0209147_100038
2078	Ga0209563_100032
2079	Ga0209563_100367
2080	Ga0207427_100001
2081	Ga0207427_100047
2082	Ga0209437_100003
2083	Ga0209437_100009
2084	Ga0209258_100409
2085	Ga0209646_1001371
2086	Ga0209677_100018
2087	Ga0209759_1002719
2088	Ga0209233_1000007
2089	Ga0209233_1000032
2090	Ga0209130_1025347
2091	Ga0209676_1000016
2092	Ga0209676_1000021
2093	Ga0209676_1000033
2094	Ga0209676_1000753
2095	Ga0209050_1000009
2096	Ga0209050_1000036
2097	Ga0209050_1000107
2098	Ga0209050_1020305
2099	Ga0209051_1000043
2100	Ga0209051_1000053
2101	Ga0209051_1000474
2102	Ga0209051_1004467
2103	Ga0209257_1000098
2104	Ga0209257_1009275
2105	Ga0207656_10000119
2106	Ga0207696_1000010
2107	Ga0207696_1000043
2108	Ga0207696_1000101
2109	Ga0207696_1000175
2110	Ga0207696_1003416
2111	Ga0207696_1005667
2112	Ga0207696_1007727
2113	Ga0207696_1015790
2114	Ga0207696_1030543
2115	Ga0207696_1044334
2116	Ga0207655_1000019
2117	Ga0207655_1000095
2118	Ga0207655_1000402
2119	Ga0207655_1000562
2120	Ga0207655_1000619
2121	Ga0207655_1000670
2122	Ga0207655_1000825
2123	Ga0207655_1005875
2124	Ga0207655_1007976
2125	Ga0207655_1008317
2126	Ga0207655_1010144
2127	Ga0207655_1011027
2128	Ga0207655_1015056
2129	Ga0207655_1022350
2130	Ga0207655_1022468
2131	Ga0207655_1024406
2132	Ga0207655_1025777
2133	Ga0207655_1037736
2134	Ga0207713_1000150
2135	Ga0207713_1000207
2136	Ga0207713_1002393
2137	Ga0207713_1002430
2138	Ga0207713_1003445
2139	Ga0207713_1003756
2140	Ga0207713_1004068
2141	Ga0207713_1004396
2142	Ga0207713_1006140
2143	Ga0207713_1008180
2144	Ga0207713_1008868
2145	Ga0207713_1009854
2146	Ga0207713_1011406
2147	Ga0207713_1015726
2148	Ga0207713_1017866
2149	Ga0207713_1028157
2150	Ga0207713_1035664
2151	Ga0207713_1039634
2152	Ga0207642_10002846
2153	Ga0207680_10082488
2154	Ga0207645_10132647
2155	Ga0207654_10082391
2156	Ga0207671_10000035
2157	Ga0207671_10010328
2158	Ga0207649_10000017
2159	Ga0207681_10001458
2160	Ga0207681_10304370
2161	Ga0207650_10000002
2162	Ga0207650_10000180
2163	Ga0207650_10000181
2164	Ga0207664_10076600
2165	Ga0207644_10000065
2166	Ga0207690_10429874
2167	Ga0207706_10003017
2168	Ga0207706_10014450
2169	Ga0207706_10030654
2170	Ga0207686_10001754
2171	Ga0207686_10308102
2172	Ga0207709_10000053
2173	Ga0207709_10003120
2174	Ga0207709_10027125
2175	Ga0207709_10041754
2176	Ga0207709_10081037
2177	Ga0207709_10094870
2178	Ga0207709_10170426
2179	Ga0207709_10217202
2180	Ga0207669_10268812
2181	Ga0207704_10026295
2182	Ga0207691_10012813
2183	Ga0207711_10001164
2184	Ga0207679_10000005
2185	Ga0207679_10073297
2186	Ga0207679_10168035
2187	Ga0207712_10057455
2188	Ga0207668_10061346
2189	Ga0207640_10071381
2190	Ga0207658_10000001
2191	Ga0207703_10023685
2192	Ga0207703_10228664
2193	Ga0207703_10698584
2194	Ga0207639_10001808
2195	Ga0207639_10005439
2196	Ga0207678_10073289
2197	Ga0207678_10270830
2198	Ga0207702_10277184
2199	Ga0207702_10673767
2200	Ga0207648_10000439
2201	Ga0207676_10000001
2202	Ga0207674_10238100
2203	Ga0207675_100013133
2204	Ga0207675_100337700
2205	Ga0207683_10096050
2206	Ga0209281_1000018
2207	Ga0209281_1000174
2208	Ga0209281_1015909
2209	Ga0209389_1000018
2210	Ga0209371_1001864
2211	Ga0209371_1003258
2212	Ga0209371_1014573
2213	Ga0209984_1000270
2214	Ga0209995_1002759
2215	Ga0209999_1005222
2216	Ga0209983_1003420
2217	Ga0209974_10003574
2218	Ga0207428_10028426
2219	Ga0207428_10124641
2220	Ga0207428_10223990
2221	Ga0207428_10259802
2222	Ga0268266_10048922
2223	Ga0268266_10264200
2224	Ga0268265_10000388
2225	Ga0268265_10030477
2226	Ga0268265_10122583
2227	Ga0268265_10141061
2228	Ga0268264_10000061
2229	Ga0268264_10013375
2230	Ga0268264_10176392
2231	Ga0265318_10055317
2232	Ga0265336_10001365
2233	Ga0307517_10026165
2234	Ga0265338_10044219
2235	Ga0265338_10288666
2236	Ga0265324_10000023
2237	Ga0265324_10000557
2238	Ga0268256_1001635
2239	Ga0268256_1001974
2240	Ga0268256_1006182
2241	Ga0307511_10059309
2242	Ga0314311_1190454
2243	Ga0316178_1017517
2244	Ga0316183_1151755
2245	Ga0265330_10021565
2246	Ga0265330_10122342
2247	Ga0265332_10023424
2248	Ga0265328_10011375
2249	Ga0265320_10015761
2250	Ga0265325_10000099
2251	Ga0265325_10018111
2252	Ga0265339_10172373
2253	Ga0265331_10003774
2254	Ga0265331_10005247
2255	Ga0265331_10012115
2256	Ga0265331_10018195
2257	Ga0265331_10019217
2258	Ga0265331_10033698
2259	Ga0265331_10115008
2260	Ga0265331_10151819
2261	Ga0265327_10000065
2262	Ga0265327_10000257
2263	Ga0265327_10000384
2264	Ga0265327_10010769
2265	Ga0265327_10011016
2266	Ga0265316_10035418
2267	Ga0265316_10132060
2268	Ga0307513_10020857
2269	Ga0307408_100000018
2270	Ga0307408_100015942
2271	Ga0307408_100025025
2272	Ga0307408_100080623
2273	Ga0307408_100081707
2274	Ga0307408_100139478
2275	Ga0307408_100283138
2276	Ga0307408_100514716
2277	Ga0316575_10015090
2278	Ga0316579_10006065
2279	Ga0316579_10025457
2280	Ga0265314_10000433
2281	Ga0265314_10001396
2282	Ga0265314_10020614
2283	Ga0265342_10018541
2284	Ga0316576_10002240
2285	Ga0316576_10005681
2286	Ga0316576_10332176
2287	Ga0316578_10025352
2288	Ga0316578_10054629
2289	Ga0307405_10005593
2290	Ga0307405_10020268
2291	Ga0307405_10057573
2292	Ga0307405_10201871
2293	Ga0316577_10115592
2294	Ga0307413_10007830
2295	Ga0307413_10170869
2296	Ga0307410_10093591
2297	Ga0307406_10030398
2298	Ga0307407_10231779
2299	Ga0307407_10440503
2300	Ga0307412_10026009
2301	Ga0307412_10069236
2302	Ga0307412_10169828
2303	Ga0307412_10204624
2304	Ga0307409_100027501
2305	Ga0307409_100169363
2306	Ga0307416_100151409
2307	Ga0307416_100315019
2308	Ga0307414_10074088
2309	Ga0307414_10234268
2310	Ga0307411_10013117
2311	Ga0307411_10022065
2312	Ga0307411_10070087
2313	Ga0307411_10124138
2314	Ga0307411_10447515
2315	Ga0316583_10006991
2316	Ga0316593_10002164
2317	Ga0307510_10017682
2318	Ga0307510_10091006
2319	Ga0373955_0045391
2320	Ga0316574_0008371
2321	Ga0373927_0299370
2322	Ga0373937_0042829
2323	Ga0316582_0011144
2324	Ga0316582_0095316
2325	Ga0316582_0101983
2326	Ga0316582_0210710
2327	Ga0316584_0035907
2328	Ga0316584_0068479
2329	Ga0316584_0078325
2330	Ga0316584_0205958
2331	Ga0373925_0034844
2332	Ga0373925_0642923
2333	Ga0395905_0002001
2334	Ga0316581_0005837
2335	Ga0316581_0067070
2336	Ga0395901_0555632
2337	Ga0237819_00758
2338	Ga0400484_02420
2339	Ga0400484_05024
2340	Ga0400484_09242
2341	Ga0400484_17083
2342	Ga0400484_27281
2343	Ga0400490_00409
2344	Ga0400490_00629
2345	Ga0400490_19114
2346	Ga0400490_34188
2347	Ga0400490_41636
2348	Ga0400490_42931
2349	Ga0400490_47827
2350	Ga0400490_56758
2351	Ga0400491_18134
2352	Ga0400491_24212
2353	Ga0400491_26290
2354	Ga0400485_01446
2355	Ga0400485_04007
2356	Ga0400485_07089
2357	Ga0400485_08390
2358	Ga0400485_12289
2359	Ga0400488_08357
2360	Ga0400488_15610
2361	Ga0400488_24090
2362	Ga0400488_35305
2363	Ga0400488_35681
2364	Ga0400488_37280
2365	Ga0400488_38081
2366	Ga0400488_42106
2367	Ga0400488_45799
2368	Ga0400488_46833
2369	Ga0400488_51714
2370	Ga0400488_59122
2371	Ga0400488_59901
2372	Ga0400486_00610
2373	Ga0400486_00736
2374	Ga0400486_11633
2375	Ga0400486_17202
2376	Ga0400486_21916
2377	Ga0400483_015059
2378	Ga0400483_036281
2379	Ga0400483_050487
2380	Ga0400483_061608
2381	Ga0400483_072960
2382	Ga0400483_078562
2383	Ga0400483_082194
2384	Ga0400483_088943
2385	Ga0400483_091971
2386	Ga0400483_117917
2387	Ga0400483_128929
2388	Ga0400483_132309
2389	Ga0400483_141043
2390	Ga0400483_145588
2391	Ga0400483_147621
2392	Ga0400483_153623
2393	Ga0400483_161094
2394	Ga0400483_163278
2395	Ga0400483_170536
2396	Ga0400483_172133
2397	Ga0400483_173670
2398	Ga0400483_176269
2399	Ga0400483_180135
2400	Ga0400483_210780
2401	Ga0400483_219056
2402	Ga0400483_228091
2403	Ga0400483_256324
2404	Ga0400483_266740
2405	Ga0400483_275518
2406	Ga0400483_283418
2407	Ga0400489_00591
2408	Ga0400489_40355
2409	Ga0400489_65224
2410	Ga0400487_02857
2411	Ga0400487_07641
2412	Ga0400487_22307
2413	Ga0400487_24442
2414	Ga0400487_26069
2415	Ga0400487_31982
2416	Ga0400487_36190
2417	Ga0400487_43518
2418	Ga0400487_65155
2419	Ga0436365_1279657
2420	Ga0436361_0880017
2421	Ga0439436_0009859
2422	Ga0439438_001091
2423	Ga0439438_003173
2424	Ga0439438_003183
2425	Ga0439438_004345
2426	Ga0439438_006363
2427	Ga0439438_006824
2428	Ga0439438_006855
2429	Ga0439438_008224
2430	Ga0439438_009560
2431	Ga0439438_014690
2432	Ga0439438_025999
2433	Ga0439447_004549
2434	Ga0439447_004599
2435	Ga0439447_006753
2436	Ga0439447_008342
2437	Ga0439447_029549
2438	Ga0439447_066602
2439	Ga0439466_0002465
2440	Ga0439466_0002955
2441	Ga0439466_0005271
2442	Ga0439466_0007281
2443	Ga0439466_0007700
2444	Ga0439466_0008897
2445	Ga0439466_0009853
2446	Ga0439466_0015396
2447	Ga0439466_0032588
2448	Ga0439466_0035546
2449	Ga0439465_0100680
2450	Ga0439431_0009622
2451	Ga0439431_0026517
2452	Ga0439431_0061687
2453	Ga0439437_005367
2454	Ga0439443_015839
2455	Ga0439445_0019725
2456	Ga0439432_001383
2457	Ga0439432_004872
2458	Ga0439432_005314
2459	Ga0439432_006716
2460	Ga0439432_008662
2461	Ga0439432_045194
2462	Ga0439432_059236
2463	Ga0439451_001033
2464	Ga0439451_002013
2465	Ga0439451_002283
2466	Ga0439451_006038
2467	Ga0439452_000753
2468	Ga0439452_000764
2469	Ga0439452_001071
2470	Ga0439452_004297
2471	Ga0439452_006545
2472	Ga0439452_008266
2473	Ga0439452_011131
2474	Ga0439452_026007
2475	Ga0439455_0031169
2476	Ga0439456_000166
2477	Ga0439456_001408
2478	Ga0439456_002609
2479	Ga0439456_008235
2480	Ga0439456_016830
2481	Ga0439456_020087
2482	Ga0439463_001311
2483	Ga0439463_002590
2484	Ga0439463_008995
2485	Ga0439463_016231
2486	Ga0450911_000001
2487	Ga0450911_000864
2488	Ga0450911_003967
2489	Ga0450919_004555
2490	Ga0450900_005266
2491	Ga0450900_010069
2492	Ga0450902_002765
2493	Ga0450902_030102
2494	Ga0450903_002630
2495	Ga0450903_003594
2496	Ga0450903_007456
2497	Ga0450904_000136
2498	Ga0450905_001380
2499	Ga0450905_003212
2500	Ga0450905_012685
2501	Ga0450906_001310
2502	Ga0450907_000921
2503	Ga0450907_002184
2504	Ga0450907_002615
2505	Ga0450907_020453
2506	Ga0450910_002467
2507	Ga0450910_005672
2508	Ga0439446_0011393
2509	Ga0439446_0037950
2510	Ga0450908_012579
2511	Ga0450909_001993
2512	Ga0450909_002887
2513	Ga0439434_0005074
2514	Ga0439434_0007032
2515	Ga0439459_0002611
2516	Ga0439464_0000157
2517	Ga0439460_0000703
2518	Ga0439460_0001560
2519	Ga0439460_0006439
2520	Ga0450916_002557
2521	Ga0450918_008548
2522	Ga0450918_027855
2523	Ga0450893_0005568
2524	Ga0450893_0014720
2525	Ga0450901_001308
2526	Ga0451577_0000013
2527	Ga0451577_0055837
2528	Ga0451577_0094281
2529	Ga0451577_0190883
2530	Ga0451577_0213673
2531	Ga0451577_0219365
2532	Ga0466972_0046599
2533	Ga0466977_0000151
2534	Ga0453683_0000033
2535	Ga0466961_0043879
2536	Ga0453684_0000029
2537	Ga0453684_0000085
2538	Ga0453684_0006406
2539	Ga0453684_0014629
2540	Ga0453684_0131943
2541	Ga0453684_0332819
2542	Ga0466970_0074937
2543	Ga0451576_0000018
2544	Ga0451576_0000320
2545	Ga0451576_0001448
2546	Ga0451576_0016908
2547	Ga0451576_0025846
2548	Ga0466967_0770704
2549	Ga0495617_002271
2550	Ga0495617_005844
2551	Ga0495617_013432
2552	Ga0495617_019513
2553	Ga0495617_035856
2554	Ga0495617_041863
2555	Ga0495627_000013
2556	Ga0495627_001540
2557	Ga0495627_001543
2558	Ga0495627_002603
2559	Ga0495627_005677
2560	Ga0495627_006905
2561	Ga0495627_008854
2562	Ga0495627_028737
2563	Ga0495627_033024
2564	Ga0495627_045155
2565	Ga0495592_0203159
2566	Ga0495603_0044895
2567	Ga0495603_0087342
2568	Ga0495603_0147459
2569	Ga0495590_0003161
2570	Ga0495590_0006189
2571	Ga0495590_0031095
2572	Ga0495590_0038108
2573	Ga0495590_0065604
2574	Ga0495590_0101052
2575	Ga0495591_000020
2576	Ga0495591_000376
2577	Ga0495591_000959
2578	Ga0495591_003817
2579	Ga0495591_003863
2580	Ga0495591_003878
2581	Ga0495591_004517
2582	Ga0495591_008934
2583	Ga0495591_009968
2584	Ga0495591_010153
2585	Ga0495591_012752
2586	Ga0495591_013718
2587	Ga0495591_015190
2588	Ga0495591_016860
2589	Ga0495638_0010589
2590	Ga0495638_0013958
2591	Ga0495638_0016718
2592	Ga0495638_0017681
2593	Ga0495638_0020383
2594	Ga0495638_0022970
2595	Ga0495638_0026186
2596	Ga0495638_0056369
2597	Ga0495638_0056709
2598	Ga0495638_0063189
2599	Ga0495638_0091879
2600	Ga0495653_0002537
2601	Ga0495653_0031492
2602	Ga0495653_0043635
2603	Ga0495650_0000221
2604	Ga0495650_0010761
2605	Ga0495650_0015410
2606	Ga0495650_0015935
2607	Ga0495650_0016280
2608	Ga0495650_0017300
2609	Ga0495650_0017951
2610	Ga0495650_0022429
2611	Ga0495650_0026218
2612	Ga0495650_0044939
2613	Ga0495650_0053516
2614	Ga0495650_0069701
2615	Ga0495605_0000032
2616	Ga0495605_0000047
2617	Ga0495605_0001592
2618	Ga0495605_0007134
2619	Ga0495605_0016876
2620	Ga0495605_0017142
2621	Ga0495605_0020200
2622	Ga0495605_0025388
2623	Ga0495605_0029459
2624	Ga0495605_0034743
2625	Ga0495605_0035412
2626	Ga0495605_0050199
2627	Ga0495605_0050995
2628	Ga0495605_0051001
2629	Ga0495605_0067482
2630	Ga0495639_0001688
2631	Ga0495639_0021967
2632	Ga0495639_0117623
2633	Ga0495584_0005692
2634	Ga0495584_0007770
2635	Ga0495584_0011026
2636	Ga0495584_0014019
2637	Ga0495584_0021856
2638	Ga0495584_0023054
2639	Ga0495584_0027603
2640	Ga0495584_0031122
2641	Ga0495584_0075348
2642	Ga0495584_0088276
2643	Ga0495584_0121597
2644	Ga0495585_0000483
2645	Ga0495585_0008886
2646	Ga0495585_0011164
2647	Ga0495585_0011393
2648	Ga0495585_0013809
2649	Ga0495585_0022993
2650	Ga0495585_0025024
2651	Ga0495585_0102150
2652	Ga0495585_0129285
2653	Ga0495594_0000489
2654	Ga0495594_0012490
2655	Ga0495594_0022396
2656	Ga0495594_0259413
2657	Ga0495596_0000231
2658	Ga0495596_0015010
2659	Ga0495607_0000129
2660	Ga0495607_0000281
2661	Ga0495607_0002338
2662	Ga0495607_0003653
2663	Ga0495607_0003762
2664	Ga0495607_0006147
2665	Ga0495607_0007868
2666	Ga0495607_0009865
2667	Ga0495607_0009959
2668	Ga0495607_0012067
2669	Ga0495607_0018409
2670	Ga0495607_0020217
2671	Ga0495607_0022260
2672	Ga0495607_0057665
2673	Ga0495607_0059064
2674	Ga0495607_0072070
2675	Ga0495607_0095090
2676	Ga0495607_0100857
2677	Ga0495607_0150582
2678	Ga0495607_0152553
2679	Ga0495607_0159233
2680	Ga0495607_0172156
2681	Ga0495607_0202809
2682	Ga0495583_0000052
2683	Ga0495583_0001185
2684	Ga0495583_0005780
2685	Ga0495583_0008659
2686	Ga0495583_0009370
2687	Ga0495583_0011883
2688	Ga0495583_0023592
2689	Ga0495583_0023648
2690	Ga0495583_0085198
2691	Ga0495583_0108403
2692	Ga0495606_0000669
2693	Ga0495606_0002501
2694	Ga0495606_0003264
2695	Ga0495606_0005069
2696	Ga0495606_0014464
2697	Ga0495606_0021674
2698	Ga0495606_0025275
2699	Ga0495606_0028239
2700	Ga0495606_0042575
2701	Ga0495606_0045629
2702	Ga0495606_0045634
2703	Ga0495606_0061965
2704	Ga0495606_0078029
2705	Ga0495606_0170421
2706	Ga0495610_0008711
2707	Ga0495610_0009928
2708	Ga0495610_0011456
2709	Ga0495610_0014936
2710	Ga0495610_0021977
2711	Ga0495610_0023134
2712	Ga0495610_0026436
2713	Ga0495610_0033337
2714	Ga0495610_0040827
2715	Ga0495610_0044649
2716	Ga0495610_0127116
2717	Ga0495610_0132532
2718	Ga0495616_0004932
2719	Ga0495616_0006463
2720	Ga0495616_0010373
2721	Ga0495616_0015102
2722	Ga0495616_0018806
2723	Ga0495616_0032842
2724	Ga0495620_0000002
2725	Ga0495620_0000019
2726	Ga0495620_0001475
2727	Ga0495620_0002415
2728	Ga0495620_0008232
2729	Ga0495620_0013369
2730	Ga0495620_0017199
2731	Ga0495620_0025420
2732	Ga0495620_0037121
2733	Ga0495620_0097952
2734	Ga0495620_0126572
2735	Ga0495628_0014937
2736	Ga0495628_0124008
2737	Ga0495630_0060721
2738	Ga0495630_0064876
2739	Ga0495631_0003575
2740	Ga0495631_0004375
2741	Ga0495631_0019406
2742	Ga0495631_0021543
2743	Ga0495631_0035235
2744	Ga0495631_0063462
2745	Ga0495631_0084006
2746	Ga0495632_0001503
2747	Ga0495632_0005232
2748	Ga0495632_0006113
2749	Ga0495632_0006454
2750	Ga0495632_0006699
2751	Ga0495632_0006844
2752	Ga0495632_0009876
2753	Ga0495632_0012140
2754	Ga0495632_0013249
2755	Ga0495632_0019096
2756	Ga0495632_0022612
2757	Ga0495632_0022985
2758	Ga0495632_0031695
2759	Ga0495632_0047460
2760	Ga0495632_0063457
2761	Ga0495632_0075076
2762	Ga0495632_0077643
2763	Ga0495632_0143206
2764	Ga0495637_0000594
2765	Ga0495637_0001738
2766	Ga0495637_0004300
2767	Ga0495637_0004996
2768	Ga0495637_0006530
2769	Ga0495637_0015582
2770	Ga0495637_0018438
2771	Ga0495637_0018494
2772	Ga0495637_0018614
2773	Ga0495637_0023034
2774	Ga0495637_0027077
2775	Ga0495637_0027372
2776	Ga0495637_0034309
2777	Ga0495637_0040098
2778	Ga0495637_0041085
2779	Ga0495637_0058651
2780	Ga0495637_0076474
2781	Ga0495643_0000272
2782	Ga0495643_0000640
2783	Ga0495643_0003942
2784	Ga0495643_0004751
2785	Ga0495643_0012511
2786	Ga0495643_0019888
2787	Ga0495643_0022853
2788	Ga0495643_0028918
2789	Ga0495643_0032593
2790	Ga0495643_0035123
2791	Ga0495643_0048043
2792	Ga0495643_0071049
2793	Ga0495643_0110464
2794	Ga0495644_0003180
2795	Ga0495644_0008888
2796	Ga0495644_0022160
2797	Ga0495644_0076496
2798	Ga0495644_0144380
2799	Ga0495648_0001346
2800	Ga0495648_0002370
2801	Ga0495648_0004086
2802	Ga0495648_0008572
2803	Ga0495648_0009557
2804	Ga0495648_0011579
2805	Ga0495648_0019025
2806	Ga0495648_0019797
2807	Ga0495648_0032635
2808	Ga0495648_0038460
2809	Ga0495648_0043477
2810	Ga0495648_0047808
2811	Ga0495648_0064471
2812	Ga0495648_0067937
2813	Ga0495648_0074826
2814	Ga0495648_0090667
2815	Ga0495648_0117279
2816	Ga0495648_0196486
2817	Ga0495666_0013202
2818	Ga0495666_0028873
2819	Ga0495666_0072634
2820	Ga0495642_0001439
2821	Ga0495642_0001517
2822	Ga0495642_0007727
2823	Ga0495642_0008591
2824	Ga0495652_0143017
2825	Ga0495654_0000925
2826	Ga0495654_0001885
2827	Ga0495654_0007272
2828	Ga0495654_0007276
2829	Ga0495654_0010122
2830	Ga0495654_0010429
2831	Ga0495654_0015766
2832	Ga0495654_0016015
2833	Ga0495654_0038557
2834	Ga0495654_0043519
2835	Ga0495654_0045201
2836	Ga0495654_0047960
2837	Ga0495654_0061945
2838	Ga0495654_0102643
2839	Ga0495654_0104369
2840	Ga0495654_0106785
2841	Ga0495654_0251481
2842	Ga0495640_0049330
2843	Ga0495586_0002705
2844	Ga0495586_0020317
2845	Ga0495587_0009417
2846	Ga0495587_0064163
2847	Ga0495609_0000032
2848	Ga0495609_0000187
2849	Ga0495609_0000563
2850	Ga0495609_0003267
2851	Ga0495609_0005350
2852	Ga0495609_0022356
2853	Ga0495609_0029563
2854	Ga0495609_0048994
2855	Ga0495609_0052289
2856	Ga0495597_0000004
2857	Ga0495597_0005721
2858	Ga0495597_0006383
2859	Ga0495597_0010493
2860	Ga0495597_0012939
2861	Ga0495597_0019019
2862	Ga0495597_0027400
2863	Ga0495597_0061997
2864	Ga0495597_0068452
2865	Ga0495597_0123804
2866	Ga0495645_0131802
2867	Ga0495622_0001828
2868	Ga0495622_0002145
2869	Ga0495622_0002533
2870	Ga0495622_0020085
2871	Ga0495622_0031561
2872	Ga0495622_0161187
2873	Ga0495633_0000040
2874	Ga0495633_0010871
2875	Ga0495633_0019399
2876	Ga0495633_0079139
2877	Ga0495656_0059682
2878	Ga0495668_0017610
2879	Ga0495668_0019466
2880	Ga0495668_0019934
2881	Ga0495668_0036480
2882	Ga0495668_0082868
2883	Ga0495668_0102069
2884	Ga0495634_0048385
2885	Ga0495634_0153915
2886	Ga0495611_0000814
2887	Ga0495611_0001050
2888	Ga0495611_0004555
2889	Ga0495611_0021523
2890	Ga0495611_0038974
2891	Ga0495611_0081260
2892	Ga0495625_0000010
2893	Ga0495625_0028113
2894	Ga0495625_0028954
2895	Ga0495625_0032031
2896	Ga0495625_0034383
2897	Ga0495625_0048330
2898	Ga0495625_0103159
2899	Ga0495625_0304113
2900	Ga0495625_0339840
2901	Ga0495635_0007004
2902	Ga0495635_0051084
2903	Ga0495659_0001077
2904	Ga0495659_0007439
2905	Ga0495661_0000037
2906	Ga0495661_0000095
2907	Ga0495661_0000208
2908	Ga0495661_0001285
2909	Ga0495661_0005778
2910	Ga0495661_0020607
2911	Ga0495661_0037263
2912	Ga0495661_0042258
2913	Ga0495661_0052498
2914	Ga0495661_0108991
2915	Ga0495661_0113929
2916	Ga0495661_0227440
2917	Ga0495661_0261593
2918	Ga0495588_0021148
2919	Ga0495588_0077324
2920	Ga0495623_0024631
2921	Ga0495658_0074888
2922	Ga0495669_0008510
2923	Ga0495613_0099630
2924	Ga0495613_0407986
2925	Ga0495624_0011291
2926	Ga0495670_0001570
2927	Ga0495670_0004104
2928	Ga0495670_0025568
2929	Ga0495670_0027884
2930	Ga0495670_0065527
2931	Ga0495670_0117768
2932	Ga0495671_0001786
2933	Ga0495671_0002715
2934	Ga0495671_0008100
2935	Ga0495671_0012661
2936	Ga0495671_0014408
2937	Ga0495671_0016365
2938	Ga0495671_0020690
2939	Ga0495671_0024151
2940	Ga0495671_0025353
2941	Ga0495671_0028131
2942	Ga0495671_0028202
2943	Ga0495671_0029075
2944	Ga0495671_0032166
2945	Ga0495671_0053335
2946	Ga0495671_0157130
2947	Ga0495649_0000947
2948	Ga0495649_0009366
2949	Ga0495649_0010080
2950	Ga0495649_0012004
2951	Ga0495649_0019023
2952	Ga0495649_0020998
2953	Ga0495649_0021252
2954	Ga0495649_0027552
2955	Ga0495649_0040077
2956	Ga0495649_0056458
2957	Ga0495649_0060394
2958	Ga0495649_0127404
2959	Ga0495589_0002228
2960	Ga0495589_0002536
2961	Ga0495589_0003006
2962	Ga0495589_0012264
2963	Ga0495589_0026864
2964	Ga0495589_0040630
2965	Ga0495589_0051265
2966	Ga0495589_0081462
2967	Ga0495589_0083315
2968	Ga0495600_0060791
2969	Ga0495600_0175113
2970	Ga0495660_0001556
2971	Ga0495660_0010294
2972	Ga0495660_0010989
2973	Ga0495660_0011476
2974	Ga0495660_0014523
2975	Ga0495660_0014720
2976	Ga0495660_0014764
2977	Ga0495660_0022502
2978	Ga0495660_0022655
2979	Ga0495660_0038528
2980	Ga0495660_0041184
2981	Ga0495660_0060826
2982	Ga0495660_0142667
2983	Ga0495660_0189361
2984	Ga0495660_0209456
2985	Ga0495604_0026431
2986	Ga0495604_0036787
2987	Ga0495604_0074966
2988	Ga0495604_0300872
2989	Ga0495636_0008220
2990	Ga0495674_0095378
2991	Ga0495672_0002942
2992	Ga0495672_0010001
2993	Ga0495672_0011385
2994	Ga0495672_0012759
2995	Ga0495672_0014999
2996	Ga0495672_0016828
2997	Ga0495672_0017581
2998	Ga0495672_0023302
2999	Ga0495672_0029537
3000	Ga0495672_0031749
3001	Ga0495672_0045762
3002	Ga0495672_0051231
3003	Ga0495672_0082673
3004	Ga0495672_0122856
3005	Ga0495672_0160839
3006	Ga0495676_0000002
3007	Ga0495676_0013290
3008	Ga0495676_0126713
3009	Ga0495680_0024428
3010	Ga0495680_0039482
3011	Ga0495680_0051783
3012	Ga0495680_0062937
3013	Ga0495680_0085465
3014	Ga0495683_0000011
3015	Ga0495683_0000089
3016	Ga0495683_0003963
3017	Ga0495683_0007287
3018	Ga0495683_0014227
3019	Ga0495683_0021191
3020	Ga0495683_0050460
3021	Ga0495683_0069872
3022	Ga0495683_0166114
3023	Ga0495687_010990
3024	Ga0495687_013802
3025	Ga0495687_032472
3026	Ga0495687_033653
3027	Ga0495677_0008561
3028	Ga0495679_002295
3029	Ga0495679_002642
3030	Ga0495679_003615
3031	Ga0495679_011865
3032	Ga0495679_013862
3033	Ga0495679_014617
3034	Ga0495679_021746
3035	Ga0495679_051669
3036	Ga0495679_056153
3037	Ga0495673_0000573
3038	Ga0495673_0003056
3039	Ga0495673_0004805
3040	Ga0495673_0005998
3041	Ga0495673_0007572
3042	Ga0495673_0007854
3043	Ga0495673_0009619
3044	Ga0495673_0012468
3045	Ga0495673_0013191
3046	Ga0495673_0015791
3047	Ga0495673_0025079
3048	Ga0495673_0030569
3049	Ga0495673_0032618
3050	Ga0495673_0040500
3051	Ga0495673_0042538
3052	Ga0495673_0086144
3053	Ga0495673_0123847
3054	Ga0495673_0148604
3055	Ga0495681_0002515
3056	Ga0495681_0004285
3057	Ga0495681_0006105
3058	Ga0495681_0006355
3059	Ga0495681_0007065
3060	Ga0495681_0007894
3061	Ga0495681_0009655
3062	Ga0495681_0011886
3063	Ga0495681_0014289
3064	Ga0495681_0019776
3065	Ga0495681_0027875
3066	Ga0495681_0041553
3067	Ga0495681_0050320
3068	Ga0495681_0083805
3069	Ga0495686_0003332
3070	Ga0495686_0017065
3071	Ga0495686_0021370
3072	Ga0495686_0047518
3073	Ga0495686_0110888
3074	Ga0495686_0155524
3075	Ga0495686_0203436
3076	Ga0495593_0022979
3077	Ga0495593_0032827
3078	Ga0495593_0243870
3079	Ga0495593_0245923
3080	Ga0495602_0087907
3081	Ga0495626_0000007
3082	Ga0495626_0000246
3083	Ga0495626_0003502
3084	Ga0495626_0009950
3085	Ga0495626_0010191
3086	Ga0495626_0010869
3087	Ga0495626_0014076
3088	Ga0495626_0019958
3089	Ga0495626_0058363
3090	Ga0495626_0064015
3091	Ga0495626_0072012
3092	Ga0496100_0462024
3093	Ga0496101_0216052
3094	Ga0496101_0336456
3095	Ga0496102_0018098
3096	Ga0496102_0335475
3097	Ga0496102_0572291
3098	Ga0496104_0234067
3099	Ga0496104_0410133
3100	Ga0496105_0260500
3101	Ga0496108_0466655
3102	Ga0496109_0240926
3103	Ga0496109_0454706
3104	Ga0496110_0328304
3105	Ga0496111_0098269
3106	Ga0496111_0113818
3107	Ga0496114_0000303
3108	Ga0496114_0006503
3109	Ga0496114_0014654
3110	Ga0496114_0086640
3111	Ga0496114_0124852
3112	Ga0496115_0174592
3113	Ga0496116_0000085
3114	Ga0496116_0001765
3115	Ga0496116_0006943
3116	Ga0496116_0009249
3117	Ga0496116_0026314
3118	Ga0496116_0034158
3119	Ga0496116_0131054
3120	Ga0496117_0002373
3121	Ga0496117_0007298
3122	Ga0496117_0018516
3123	Ga0496117_0018978
3124	Ga0496117_0023927
3125	Ga0496117_0036246
3126	Ga0496117_0047138
3127	Ga0496117_0118652
3128	Ga0496117_0144823
3129	Ga0496117_0236909
3130	Ga0496118_0004346
3131	Ga0496118_0019359
3132	Ga0496118_0031366
3133	Ga0496118_0034014
3134	Ga0496118_0041389
3135	Ga0496118_0064444
3136	Ga0496118_0085212
3137	Ga0496118_0147697
3138	Ga0496118_0150084
3139	Ga0496119_0000536
3140	Ga0496119_0183550
3141	Ga0496120_0002323
3142	Ga0496120_0076845
3143	Ga0496120_0204234
3144	Ga0496121_0000505
3145	Ga0496121_0015365
3146	Ga0496121_0020861
3147	Ga0496121_0052342
3148	Ga0496121_0066940
3149	Ga0496121_0117410
3150	Ga0496121_0166028
3151	Ga0496121_0176115
3152	Ga0496122_0000945
3153	Ga0496122_0005538
3154	Ga0496122_0006020
3155	Ga0496122_0007437
3156	Ga0496122_0060147
3157	Ga0496122_0123740
3158	Ga0496122_0126741
3159	Ga0496123_0000437
3160	Ga0496123_0000888
3161	Ga0496123_0003233
3162	Ga0496123_0025952
3163	Ga0496123_0060800
3164	Ga0496123_0100683
3165	Ga0496123_0137759
3166	Ga0496124_0000807
3167	Ga0496124_0004554
3168	Ga0496124_0008283
3169	Ga0496124_0010386
3170	Ga0496124_0010673
3171	Ga0496124_0018964
3172	Ga0496124_0078335
3173	Ga0496124_0095099
3174	Ga0496124_0095644
3175	Ga0496124_0156018
3176	Ga0496124_0160210
3177	Ga0496124_0173286
3178	Ga0496124_0182327
3179	Ga0496124_0321103
3180	Ga0496125_0000861
3181	Ga0496125_0016758
3182	Ga0496125_0041313
3183	Ga0496125_0049834
3184	Ga0496125_0082868
3185	Ga0496125_0097371
3186	Ga0496125_0137948
3187	Ga0496125_0172347
3188	Ga0496125_0179356
3189	Ga0496125_0309013
3190	Ga0496126_0031973
3191	Ga0496126_0256089
3192	Ga0496126_0283466
3193	Ga0495678_000033
3194	Ga0495678_002996
3195	Ga0495678_007050
3196	Ga0495678_007571
3197	Ga0495678_008995
3198	Ga0495678_012399
3199	Ga0495678_015114
3200	Ga0495678_015250
3201	Ga0495678_016562
3202	Ga0495678_040305
3203	Ga0495678_044785
3204	Ga0495678_045075
3205	Ga0495678_048426
3206	Ga0495678_067619
3207	Ga0495678_089914
3208	Ga0495682_0000072
3209	Ga0495682_0000213
3210	Ga0495682_0001612
3211	Ga0495682_0022268
3212	Ga0495682_0024940
3213	Ga0495682_0026801
3214	Ga0495682_0032643
3215	Ga0501032_0000544
3216	Ga0501032_0015477
3217	Ga0501032_0074656
3218	Ga0501032_0103378
3219	Ga0501033_0010735
3220	Ga0501033_0113376
3221	Ga0501033_0300594
3222	Ga0501034_0000041
3223	Ga0501034_0022786
3224	Ga0501036_0027523
3225	Ga0501036_0034801
3226	Ga0501036_0181536
3227	Ga0501037_0002860
3228	Ga0501037_0020086
3229	Ga0501037_0049458
3230	Ga0501037_0116790
3231	Ga0501037_0145203
3232	Ga0501038_0003152
3233	Ga0501038_0023378
3234	Ga0501038_0036619
3235	Ga0501038_0069163
3236	Ga0501038_0231891
3237	Ga0501038_0344047
3238	Ga0501039_0012138
3239	Ga0501039_0204654
3240	Ga0501039_0262791
3241	Ga0501040_0000770
3242	Ga0501042_0069563
3243	Ga0501043_0040439
3244	Ga0501043_0072241
3245	Ga0501046_0032971
3246	Ga0501046_0058657
3247	Ga0501047_0028905
3248	Ga0501047_0159945
3249	Ga0501047_0411821
3250	Ga0501068_0178444
3251	Ga0501073_0004960
3252	Ga0501079_0105110
3253	Ga0501080_0002132
3254	Ga0501083_0011559
3255	Ga0501241_000578
3256	Ga0501035_0007405
3257	Ga0501035_0025130
3258	Ga0501035_0230568
3259	Ga0501044_0001523
3260	Ga0501044_0004461
3261	Ga0501044_0015312
3262	Ga0501045_0110258
3263	Ga0501226_000014
3264	nmdc:mga03683_43263_c1
3265	nmdc:mga09592_35615_c1
3266	nmdc:mga0qj67_42002_c1
3267	nmdc:mga06r32_4263_c1
3268	nmdc:mga08y16_8514_c1
3269	nmdc:mga08y16_95174_c1
3270	nmdc:mga0n895_670605_c1
3271	nmdc:mga08x19_277914_c1
3272	Ga0495612_0126842
3273	Ga0500572_026825
3274	Ga0500618_003225
3275	Ga0500618_022347
3276	Ga0500659_0013561
3277	Ga0500564_032295
3278	Ga0500586_171215
3279	Ga0501084_0057454
3280	Ga0590071_005784
3281	Ga0590074_013959
3282	Ga0501082_0074396
3283	2510281295
3284	2510294419
3285	2510309443
3286	2511252459
3287	2511263917
3288	2511272065
3289	2511280524
3290	2511288565
3291	2511296783
3292	2511302176
3293	2511312199
3294	2511321983
3295	2511324521
3296	2511334399
3297	2511336029
3298	2511344255
3299	2511352325
3300	2511356212
3301	2511363648
3302	2511366860
3303	2511374725
3304	2511416326
3305	2511823566
3306	2512324920
3307	2554816288
3308	2555247903
3309	2555668634
3310	2566035718
3311	2583791045
3312	2597856810
3313	2597865114
3314	2597870973
3315	2599330433
3316	2599357004
3317	2599362209
3318	2599368529
3319	2599375318
3320	2599382109
3321	2599388556
3322	2599394176
3323	2599400244
3324	2599405941
3325	2599451425
3326	2599464491
3327	2599468815
3328	2599483833
3329	2599493514
3330	2599504057
3331	2599508738
3332	2599512598
3333	2599519948
3334	2599615680
3335	2599770157
3336	2599801479
3337	2599878456
3338	2599887643
3339	2599891274
3340	2599899878
3341	2599932018
3342	2599941916
3343	2599947659
3344	2599952564
3345	2599960455
3346	2599965361
3347	2599971570
3348	2599978500
3349	2599982080
3350	2599987990
3351	2599995692
3352	2599998120
3353	2600008597
3354	2600010593
3355	2600017505
3356	2600025488
3357	2600030372
3358	2600034527
3359	2600041634
3360	2600046318
3361	2600052329
3362	2600057695
3363	2600065098
3364	2600073725
3365	2600078806
3366	2600216768
3367	2600360804
3368	2600365780
3369	2600446778
3370	2601625188
3371	2601689629
3372	2601776635
3373	2601795462
3374	2602010684
3375	2606075531
3376	2606128557
3377	2608380312
3378	2621298329
3379	2624479397
3380	2624493608
3381	2643841796
3382	2643874287
3383	2643952537
3384	2644022299
3385	2644187191
3386	2644281748
3387	2644621947
3388	2649122610
3389	2652544712
3390	2652974066
3391	2671090304
3392	2671098848
3393	2671125889
3394	2671768428
3395	2677899898
3396	2678262487
3397	2691331740
3398	2715751917
3399	2715754964
3400	2718633243
3401	2723249868
3402	2723879815
3403	2729148349
3404	2738671286
3405	2738691771
3406	2738749680
3407	2738808459
3408	2738858720
3409	2738895819
3410	2739200822
3411	2739261072
3412	2739267545
3413	2739287783
3414	2739293095
3415	2739316065
3416	2743736238
3417	2745008830
3418	2765582795
3419	2774122840
3420	2774131676
3421	2774137555
3422	2784265697
3423	2784315198
3424	2794596295
3425	2807409461
3426	2807457762
3427	2808856107
3428	2808904073
3429	2808923575
3430	2808927329
3431	2808936142
3432	2808939219
3433	2808945662
3434	2808950132
3435	2808957653
3436	2808964612
3437	2808971279
3438	2808977823
3439	2808993303
3440	2808999500
3441	2809006337
3442	2809013246
3443	2809216335
3444	2812365888
3445	2817492526
3446	2819654047
3447	2819703969
3448	2823423247
3449	2825653154
3450	2826583340
3451	2834031881
3452	2842809578
3453	2842817336
3454	2842827660
3455	2842832732
3456	2842841230
3457	2842848180
3458	2842850414
3459	2842854541
3460	2844669142
3461	2852613106
3462	2852658878
3463	2852669159
3464	2860340056
3465	2860871618
3466	2878031402
3467	2880232267
3468	2887632366
3469	2904521837
3470	2904553235
3471	2908451023
3472	2912965338
3473	2913038459
3474	2916181165
3475	2917072405
3476	2917833536
3477	2919064126
3478	2919129438
3479	2919157730
3480	2919386363
3481	2919457145
3482	2919481743
3483	2919491360
3484	2919494181
3485	2919498514
3486	2919505399
3487	2919536999
3488	2919543813
3489	2919688611
3490	2919702908
3491	2923155252
3492	2923519909
3493	2923527663
3494	2923587421
3495	2926067076
3496	2929145917
3497	2929193655
3498	2931370742
3499	2931394979
3500	2931400052
3501	2935354569
3502	2939639775
3503	2939655162
3504	2945932328
3505	2945965212
3506	2946008518
3507	2946032120
3508	2947238954
3509	2952252975
3510	2969306185
3511	2974292167
3512	2974300796
3513	2984290786
3514	2984503266
3515	2984508260
3516	2988733455
3517	2990198870
3518	2998141575
3519	3007256784
3520	3007318976
3521	3007400793
3522	3007421250
3523	3007512968
3524	3007617093
3525	3007622380
3526	3007722831
3527	3007805274
3528	3007856173
3529	3007863185
3530	3007870445
3531	3007875615
3532	637318992
3533	640488519
3534	651176556
3535	8001523369
3536	8002746424
3537	8011354418
3538	8015689473
3539	8016729533
3540	8019774124
3541	8019780211
3542	8029999173
3543	8034963836
3544	8052498477
3545	8054289118
3546	8054350761
3547	8054358469
3548	8054507487
3549	8054930120
3550	8055772607
3551	8055822427
3552	8055879022
3553	8056119782
3554	8056122383
3555	8056130224
3556	8056135884
3557	8056141409
3558	8056147373
3559	8056153208
3560	8056156268
3561	8056162093
3562	8056169412
3563	8056175590
3564	8056181096
3565	8056573263
3566	8057799034

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01311

Bac_export_1

Bacterial export proteins, family 1

13

248

0.94 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
6s3l-assembly1.cif.gz_F	structure of the core of the flagellar export apparatus from vibrio mimicus, the flipqr-flhb complex.	0.855	14	257
6s3l-assembly1.cif.gz_F	structure of the core of the flagellar export apparatus from vibrio mimicus, the flipqr-flhb complex.	0.8298	14	257
6s3r-assembly1.cif.gz_F	structure of the flipqr complex from the flagellar type 3 secretion system of pseudomonas savastanoi.	0.8283	10	259
6s3r-assembly1.cif.gz_F	structure of the flipqr complex from the flagellar type 3 secretion system of pseudomonas savastanoi.	0.8196	10	259
7bin-assembly1.cif.gz_F	salmonella export gate and rod refined in focussed c1 map	0.8152	7	257

ID	Description	Score	Start	End	Superfamily
af_P35462_32_400_1.20.1070.10	Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins	0.3729	14	213	1.20.1070.10
af_Q6NP72_1_153_1.10.10.1740	Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Transmembrane protein 14-like	0.3281	89	246	1.10.10.1740
af_A0A1D6K380_240_374_1.20.140.10	Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Butyryl-CoA Dehydrogenase, subunit A, domain 3	0.31	82	259	1.20.140.10
af_K7KEP5_99_290_1.20.120.340	Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Flagellar protein FliS	0.3083	154	255	1.20.120.340
af_O94756_40_250_1.20.1270.60	Mainly Alpha;Up-down Bundle;Substrate Binding Domain Of Dnak; Chain:A; Domain 2;Arfaptin homology (AH) domain/BAR domain	0.3039	82	257	1.20.1270.60

ID	Description	Score	Start	End	GO Terms
AF-A0A3S4J2Q0-F1-model_v4	Flagellar biosynthesis protein FliR	0.9286	10	219	GO:0005886 GO:0006605
AF-A0A2D6PVB3-F1-model_v4	Flagellar biosynthetic protein FliR	0.9033	11	256	GO:0005886 GO:0006605
AF-A0A7C7CJY5-F1-model_v4	Flagellar biosynthetic protein FliR	0.9007	4	256	GO:0005886 GO:0006605 GO:0009425 GO:0044780
AF-A0A2E2G5R2-F1-model_v4	deleted	0.8977	3	256
AF-A0A5A8EZL6-F1-model_v4	Flagellar biosynthetic protein FliR	0.8974	13	256	GO:0005886 GO:0006605 GO:0009425 GO:0044780

F495686

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF01311

Bac_export_1

Bacterial export proteins, family 1

13

248

0.94

Structural Annotation

Top 5 Hits

Map