F495693

General Info

Members Datasets Scaffolds Average Seq Length
1785 566 3570 141

Family's Representative Sequence

Representative Sequence 3300037418|Ga0395900_0000133|Ga0395900_0000133_36234_36698
Length 154
Sequence MNFRRHHPEEPEINLIPFIDVLLVVLIFLMLSTTYSKFTELQVTLPTADAQAMHDQPAEVVVAVSADGRYAVNHKAVEGRSVDVLTAELAAAAAGQKDPVVIISADAAATHQSVINVLDAARRAGLPHLTFASQSGGGANGSAPPADEPAPATP

Samples

Sample ID Description Type Environment
1 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
4 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
5 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
6 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
7 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
8 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
9 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
10 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
11 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
12 3300003347 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM Metagenome Rhizosphere
13 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
14 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
15 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
16 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
17 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
18 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
19 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
20 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
21 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
22 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
23 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
24 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
25 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
26 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
27 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
28 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
29 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
30 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
31 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
32 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
33 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
34 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
35 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
36 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
37 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
38 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
39 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
40 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
41 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
42 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
43 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
44 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
45 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
46 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
47 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
48 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
49 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
50 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
51 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
52 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
53 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
54 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
55 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
56 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
57 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
58 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
59 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
60 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
61 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
62 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
63 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
64 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
65 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
66 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
67 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
68 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
69 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
70 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
71 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
72 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
73 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
74 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
75 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
76 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
77 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
78 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
79 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
80 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
81 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
82 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
83 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
84 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
85 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
86 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
87 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
88 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
89 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
91 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
92 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
93 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
94 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
95 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
96 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
97 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
98 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
99 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
100 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
101 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
102 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
103 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
104 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
105 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
106 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
107 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
108 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
109 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
110 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
111 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
112 3300012506 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 Metagenome Rhizosphere
113 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
114 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
115 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
116 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
117 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
118 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
119 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
120 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
121 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
122 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
123 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
124 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
125 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
126 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
127 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
128 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
129 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
130 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
131 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
132 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
133 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
134 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
135 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
136 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
137 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
138 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
139 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
140 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
141 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
142 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
143 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
144 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
145 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
146 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
147 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
148 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
149 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
150 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
151 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
152 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
153 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
154 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
155 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
156 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
208 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
209 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
210 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
211 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
212 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
213 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
214 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
215 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
216 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
218 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
222 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
223 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
224 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
225 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
226 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
227 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
228 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
229 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
230 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
231 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
232 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
233 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
234 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
235 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
236 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
237 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
238 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
239 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
240 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
241 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
242 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
243 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
244 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
245 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
246 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
247 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
248 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
249 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
250 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
251 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
252 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
253 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
254 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
255 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
256 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
257 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
258 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
259 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
260 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
261 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
262 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
263 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
264 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
265 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
266 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
267 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
268 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
269 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
270 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
271 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
272 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
273 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
274 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
275 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
276 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
277 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
278 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
279 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
280 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
281 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
282 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
283 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
284 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
285 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
286 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
287 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
288 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
289 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
290 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
291 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
292 3300042117 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0415F_E14_082316_1937 Metagenome Rhizosphere
293 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
294 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
295 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
296 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
297 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
298 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
299 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
300 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
301 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
302 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
303 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
304 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
305 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
306 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
307 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
308 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
309 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
310 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
311 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
312 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
313 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
314 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
315 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
316 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
317 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
318 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
319 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
320 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
321 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
322 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
323 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
324 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
325 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
326 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
327 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
328 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
329 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
330 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
331 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
332 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
333 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
334 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
335 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
336 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
337 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
338 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
339 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
340 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
341 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
342 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
343 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
344 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
345 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
346 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
347 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
348 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
349 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
350 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
351 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
352 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
353 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
354 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
355 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
356 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
357 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
358 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
359 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
360 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
361 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
362 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
363 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
364 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
365 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
366 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
367 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
368 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
369 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
370 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
371 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
372 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
373 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
374 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
375 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
376 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
377 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
378 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
379 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
380 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
381 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
382 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
383 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
384 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
385 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
386 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
387 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
388 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
389 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
390 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
391 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
392 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
393 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
394 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
395 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
396 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
397 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
398 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
399 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
400 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
401 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
402 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
403 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
404 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
405 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
406 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
407 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
408 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
409 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
410 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
411 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
412 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
413 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
414 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
415 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
416 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
417 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
418 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
419 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
420 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
421 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
422 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
423 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
424 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
425 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
426 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
427 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
428 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
429 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
430 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
431 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
432 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
433 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
434 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
435 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
436 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
437 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
438 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
439 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
440 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
441 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
442 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
443 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
444 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
445 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
446 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
447 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
448 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
449 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
450 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
451 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
452 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
453 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
454 3300049524 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H21_B_7_control Metagenome Rhizosphere
455 3300049526 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control Metagenome Rhizosphere
456 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
457 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
458 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
459 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
460 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
461 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
462 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
463 3300049657 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought Metagenome Rhizosphere
464 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
465 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
466 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
467 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
468 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
469 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
470 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
471 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
472 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
473 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
474 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
475 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
476 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
477 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
478 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
479 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
480 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
481 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
482 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
483 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
484 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
485 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
486 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
487 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
488 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
489 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
490 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
491 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
492 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
493 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
494 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
495 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
496 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
497 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
498 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
499 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
500 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
501 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
502 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
503 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
504 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
505 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
506 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
507 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
508 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
509 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
510 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
511 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
512 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
513 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
514 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
515 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
516 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
517 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
518 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
519 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
520 3300053726 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 endosphere Metagenome Endosphere
521 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
522 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
523 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
524 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
525 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
526 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
527 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
528 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
529 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
530 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
531 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
532 2643221544 Pelomonas sp. Root1444 Isolate Unclassified
533 2643221556 Massilia sp. Root1485 Isolate Unclassified
534 2643221585 Pelomonas sp. Root662 Isolate Unclassified
535 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
536 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
537 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
538 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
539 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
540 2643221645 Massilia sp. Root351 Isolate Unclassified
541 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
542 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
543 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
544 2643221656 Pelomonas sp. Root405 Isolate Unclassified
545 2643221660 Methylibium sp. Root1272 Isolate Unclassified
546 2643221684 Massilia sp. Root133 Isolate Unclassified
547 2738541297 Duganella sp. GV083 Isolate Unclassified
548 2738541337 Pelomonas sp. BT06 Isolate Unclassified
549 2738541357 Duganella sp. GV053 Isolate Unclassified
550 2738543003 Duganella sp. GV066 Isolate Unclassified
551 2738543026 Duganella sp. GV089 Isolate Unclassified
552 2738543029 Duganella sp. GV039 Isolate Unclassified
553 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
554 2821131069 Duganella sp. 1224 Isolate Unclassified
555 2842711865 Duganella sp. R-73148 Isolate Unclassified
556 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
557 2857553236 Duganella sp. R-74557 Isolate Unclassified
558 2857558681 Duganella sp. R-74565 Isolate Unclassified
559 2857564685 Duganella sp. R-74599 Isolate Unclassified
560 2885080285 Janthinobacterium sp. AD80 Isolate Rhizosphere
561 2904424332 Duganella sp. 1411 Isolate Rhizosphere
562 2919476304 Duganella sp. 3397 Isolate Unclassified
563 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
564 2932410948 Janthinobacterium lividum 2829 Isolate Rhizosphere
565 2932416698 Janthinobacterium lividum 2830 Isolate Rhizosphere
566 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.25
Metatranscriptomes 0.56
Isolates 2.18

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.52
Nodule 0.39
Rhizoplane 4.09
Rhizosphere 79.55
Stem 0
Stem Tuber 0
Unclassified 0.06

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395900_0000133 3300037418 Bacteria 124692
2 JGI24740J21852_10016707 3300001979 Bacteria 2643
3 JGI25156J39149_1000114 3300002705 Bacteria 57756
4 JGI25154J39366_1002215 3300002738 Bacteria 5358
5 JGI25154J39366_1003246 3300002738 Bacteria 3542
6 JGI25157J39369_1000015 3300002741 Bacteria 194042
7 JGI25150J39212_1014060 3300002774 Bacteria 1369
8 JGI25159J45721_1006583 3300002987 Bacteria 3459
9 JGI25153J46596_10017655 3300003215 Bacteria 2803
10 rootH2_10058683 3300003320 Bacteria 2490
11 rootL2_10031669 3300003322 Bacteria 3117
12 rootH1_10010269 3300003323 Bacteria 2239
13 JGI26128J50194_1000617 3300003347 Bacteria 2036
14 Ga0055539_1000967 3300003752 Bacteria 6333
15 Ga0055533_1000010 3300003756 Bacteria 491196
16 Ga0055525_1000013 3300003759 Bacteria 440870
17 Ga0055525_1000074 3300003759 Bacteria 178058
18 Ga0055525_1001452 3300003759 Bacteria 4263
19 Ga0055535_1006711 3300003761 Bacteria 2292
20 Ga0055542_1019745 3300003762 Bacteria 1000
21 Ga0055529_1000100 3300003763 Bacteria 131049
22 Ga0055529_1000303 3300003763 Bacteria 56663
23 Ga0055526_1000010 3300003771 Bacteria 241512
24 Ga0055526_1000104 3300003771 Bacteria 73451
25 Ga0055526_1000410 3300003771 Bacteria 34678
26 Ga0055537_1000200 3300003773 Bacteria 44838
27 Ga0055524_1000025 3300003775 Bacteria 216427
28 Ga0055524_1005355 3300003775 Bacteria 5748
29 Ga0055524_1008185 3300003775 Bacteria 4365
30 Ga0055534_1000083 3300003784 Bacteria 74541
31 Ga0055528_1000372 3300003790 Bacteria 36454
32 Ga0055540_1103473 3300003792 Bacteria 529
33 Ga0055531_10000064 3300003794 Bacteria 117923
34 Ga0055543_1004761 3300004625 Bacteria 3615
35 Ga0055543_1049002 3300004625 Bacteria 696
36 Ga0065165_1000074 3300005262 Bacteria 164454
37 Ga0065165_1000120 3300005262 Bacteria 134211
38 Ga0065165_1000889 3300005262 Bacteria 38581
39 Ga0065165_1005640 3300005262 Bacteria 6921
40 Ga0065165_1028015 3300005262 Bacteria 1827
41 Ga0065165_1032237 3300005262 Bacteria 1645
42 Ga0065707_10107803 3300005295 Bacteria 2538
43 Ga0070658_10026499 3300005327 Bacteria 4651
44 Ga0070658_10037732 3300005327 Bacteria 3895
45 Ga0070658_10141993 3300005327 Bacteria 2006
46 Ga0070658_10170300 3300005327 Bacteria 1829
47 Ga0070658_11384646 3300005327 Bacteria 610
48 Ga0070676_10095269 3300005328 Bacteria 1830
49 Ga0070676_10155113 3300005328 Bacteria 1469
50 Ga0070676_10222677 3300005328 Bacteria 1247
51 Ga0070676_10366082 3300005328 Bacteria 995
52 Ga0070676_10726973 3300005328 Bacteria 727
53 Ga0070683_100005699 3300005329 Bacteria 10405
54 Ga0070683_100109501 3300005329 Bacteria 2605
55 Ga0070690_100001536 3300005330 Bacteria 12104
56 Ga0070670_100044272 3300005331 Bacteria 3827
57 Ga0070670_100045928 3300005331 Bacteria 3755
58 Ga0070670_100050278 3300005331 Bacteria 3582
59 Ga0070670_100156245 3300005331 Bacteria 1975
60 Ga0070670_100393495 3300005331 Bacteria 1222
61 Ga0070670_100811054 3300005331 Bacteria 845
62 Ga0070670_101519250 3300005331 Bacteria 615
63 Ga0070677_10007539 3300005333 Bacteria 3635
64 Ga0070677_10017613 3300005333 Bacteria 2560
65 Ga0070677_10226157 3300005333 Bacteria 917
66 Ga0070677_10269223 3300005333 Bacteria 853
67 Ga0068869_100036690 3300005334 Bacteria 3481
68 Ga0068869_100772992 3300005334 Bacteria 824
69 Ga0068869_101050214 3300005334 Bacteria 711
70 Ga0070666_10680537 3300005335 Bacteria 754
71 Ga0070680_100016692 3300005336 Bacteria 5780
72 Ga0070680_100593369 3300005336 Bacteria 951
73 Ga0070680_100815715 3300005336 Bacteria 804
74 Ga0070680_100835370 3300005336 Bacteria 794
75 Ga0070682_100050509 3300005337 Bacteria 2597
76 Ga0070682_100303495 3300005337 Bacteria 1173
77 Ga0068868_100078234 3300005338 Bacteria 2647
78 Ga0070660_100025792 3300005339 Bacteria 4371
79 Ga0070660_100061600 3300005339 Bacteria 2913
80 Ga0070660_100478924 3300005339 Bacteria 1034
81 Ga0070660_100806976 3300005339 Bacteria 789
82 Ga0070660_101071812 3300005339 Bacteria 682
83 Ga0070689_100674438 3300005340 Bacteria 901
84 Ga0070661_100004078 3300005344 Bacteria 10061
85 Ga0070661_100038941 3300005344 Bacteria 3462
86 Ga0070661_100211037 3300005344 Bacteria 1486
87 Ga0070661_100542839 3300005344 Bacteria 934
88 Ga0070668_100634446 3300005347 Bacteria 937
89 Ga0070669_100014248 3300005353 Bacteria 5657
90 Ga0070669_100037978 3300005353 Bacteria 3495
91 Ga0070669_100106693 3300005353 Bacteria 2121
92 Ga0070669_100188610 3300005353 Bacteria 1616
93 Ga0070669_100264513 3300005353 Bacteria 1373
94 Ga0070669_100281790 3300005353 Bacteria 1332
95 Ga0070675_100002690 3300005354 Bacteria 13361
96 Ga0070675_100011188 3300005354 Bacteria 7020
97 Ga0070675_100048103 3300005354 Bacteria 3496
98 Ga0070675_100053943 3300005354 Bacteria 3306
99 Ga0070675_100104159 3300005354 Bacteria 2393
100 Ga0070675_100232111 3300005354 Bacteria 1610
101 Ga0070675_100256119 3300005354 Bacteria 1533
102 Ga0070675_100301189 3300005354 Bacteria 1412
103 Ga0070675_100617491 3300005354 Bacteria 984
104 Ga0070671_100036807 3300005355 Bacteria 4057
105 Ga0070671_100038300 3300005355 Bacteria 3979
106 Ga0070671_100219491 3300005355 Bacteria 1613
107 Ga0070671_100358210 3300005355 Bacteria 1245
108 Ga0070671_100529714 3300005355 Bacteria 1015
109 Ga0070671_100634338 3300005355 Bacteria 924
110 Ga0070674_100005898 3300005356 Bacteria 7122
111 Ga0070674_100186772 3300005356 Bacteria 1591
112 Ga0070674_100299279 3300005356 Bacteria 1282
113 Ga0070674_100999724 3300005356 Bacteria 734
114 Ga0070674_101106421 3300005356 Bacteria 700
115 Ga0070673_100030293 3300005364 Bacteria 4046
116 Ga0070673_100048345 3300005364 Bacteria 3315
117 Ga0070673_100171447 3300005364 Bacteria 1852
118 Ga0070673_100612918 3300005364 Bacteria 994
119 Ga0070673_100753633 3300005364 Bacteria 897
120 Ga0070673_101552796 3300005364 Bacteria 625
121 Ga0070688_100387313 3300005365 Bacteria 1032
122 Ga0070688_100723293 3300005365 Bacteria 773
123 Ga0070659_100000666 3300005366 Bacteria 24947
124 Ga0070659_100038040 3300005366 Bacteria 3751
125 Ga0070659_100084714 3300005366 Bacteria 2534
126 Ga0070659_100203977 3300005366 Bacteria 1628
127 Ga0070667_100000677 3300005367 Bacteria 33094
128 Ga0070667_100041820 3300005367 Bacteria 3844
129 Ga0070667_100208611 3300005367 Bacteria 1736
130 Ga0070667_100591749 3300005367 Bacteria 1022
131 Ga0070667_101309330 3300005367 Bacteria 679
132 Ga0070714_100406359 3300005435 Bacteria 1288
133 Ga0070708_100199245 3300005445 Bacteria 1874
134 Ga0070663_100006532 3300005455 Bacteria 7022
135 Ga0070663_100280802 3300005455 Bacteria 1327
136 Ga0070663_100292332 3300005455 Bacteria 1302
137 Ga0070663_100351977 3300005455 Bacteria 1193
138 Ga0070663_100524025 3300005455 Bacteria 987
139 Ga0070663_101026899 3300005455 Bacteria 718
140 Ga0070678_100009538 3300005456 Bacteria 5886
141 Ga0070678_100009859 3300005456 Bacteria 5806
142 Ga0070678_100017043 3300005456 Bacteria 4665
143 Ga0070678_100557878 3300005456 Bacteria 1018
144 Ga0070678_101128244 3300005456 Bacteria 725
145 Ga0070678_101445105 3300005456 Bacteria 643
146 Ga0070662_100116572 3300005457 Bacteria 2041
147 Ga0070662_100181759 3300005457 Bacteria 1658
148 Ga0070662_100840551 3300005457 Bacteria 781
149 Ga0070662_101258287 3300005457 Bacteria 636
150 Ga0070681_10026267 3300005458 Bacteria 5853
151 Ga0070681_10358612 3300005458 Bacteria 1368
152 Ga0068867_100003972 3300005459 Bacteria 10404
153 Ga0068867_100004620 3300005459 Bacteria 9689
154 Ga0068867_100006451 3300005459 Bacteria 8284
155 Ga0068867_100012180 3300005459 Bacteria 6077
156 Ga0068867_100148304 3300005459 Bacteria 1840
157 Ga0068867_100221025 3300005459 Bacteria 1526
158 Ga0068867_100284181 3300005459 Bacteria 1358
159 Ga0068867_100847655 3300005459 Bacteria 818
160 Ga0070685_10991557 3300005466 Bacteria 630
161 Ga0070706_100013624 3300005467 Bacteria 7517
162 Ga0070706_100061300 3300005467 Bacteria 3474
163 Ga0070679_100028221 3300005530 Bacteria 5532
164 Ga0070684_100032261 3300005535 Bacteria 4463
165 Ga0070684_100110528 3300005535 Bacteria 2464
166 Ga0068853_100066374 3300005539 Bacteria 3133
167 Ga0068853_100137713 3300005539 Bacteria 2189
168 Ga0068853_100525537 3300005539 Bacteria 1119
169 Ga0068853_100542851 3300005539 Bacteria 1101
170 Ga0070672_100014390 3300005543 Bacteria 5606
171 Ga0070672_100014964 3300005543 Bacteria 5511
172 Ga0070672_100128138 3300005543 Bacteria 2084
173 Ga0070672_100219223 3300005543 Bacteria 1595
174 Ga0070686_100289447 3300005544 Bacteria 1211
175 Ga0070686_100630358 3300005544 Bacteria 848
176 Ga0070693_100064607 3300005547 Bacteria 2137
177 Ga0070693_100155581 3300005547 Bacteria 1451
178 Ga0070693_100418017 3300005547 Bacteria 934
179 Ga0070665_100056462 3300005548 Bacteria 3936
180 Ga0070665_100195862 3300005548 Bacteria 2021
181 Ga0070665_100257967 3300005548 Bacteria 1744
182 Ga0070665_100348547 3300005548 Bacteria 1486
183 Ga0070665_102019592 3300005548 Bacteria 582
184 Ga0068855_100019587 3300005563 Bacteria 8127
185 Ga0068855_100064421 3300005563 Bacteria 4275
186 Ga0068855_100139662 3300005563 Bacteria 2763
187 Ga0068855_100194335 3300005563 Bacteria 2287
188 Ga0068855_100621090 3300005563 Bacteria 1163
189 Ga0068855_100714985 3300005563 Bacteria 1071
190 Ga0070664_100027119 3300005564 Bacteria 4759
191 Ga0070664_100037626 3300005564 Bacteria 4069
192 Ga0070664_100043037 3300005564 Bacteria 3810
193 Ga0070664_100360173 3300005564 Bacteria 1324
194 Ga0070664_100403408 3300005564 Bacteria 1250
195 Ga0070664_100551765 3300005564 Bacteria 1065
196 Ga0070664_100618262 3300005564 Bacteria 1005
197 Ga0070664_100796299 3300005564 Bacteria 884
198 Ga0068857_100729936 3300005577 Bacteria 942
199 Ga0068857_101028775 3300005577 Bacteria 793
200 Ga0068854_100000903 3300005578 Bacteria 17876
201 Ga0068854_100040558 3300005578 Bacteria 3285
202 Ga0068854_100334516 3300005578 Bacteria 1235
203 Ga0068856_100016907 3300005614 Bacteria 7070
204 Ga0068856_100063174 3300005614 Bacteria 3658
205 Ga0068856_100945156 3300005614 Bacteria 881
206 Ga0068856_101153496 3300005614 Bacteria 792
207 Ga0068852_100024399 3300005616 Bacteria 4886
208 Ga0068852_100033409 3300005616 Bacteria 4270
209 Ga0068852_100063334 3300005616 Bacteria 3220
210 Ga0068852_100275484 3300005616 Bacteria 1620
211 Ga0068852_100294866 3300005616 Bacteria 1568
212 Ga0068852_100349956 3300005616 Bacteria 1442
213 Ga0068852_100455717 3300005616 Bacteria 1267
214 Ga0068852_100976152 3300005616 Bacteria 865
215 Ga0068852_101430659 3300005616 Bacteria 713
216 Ga0068859_100027031 3300005617 Bacteria 5755
217 Ga0068859_100035700 3300005617 Bacteria 4988
218 Ga0068859_100083488 3300005617 Bacteria 3238
219 Ga0068859_100272232 3300005617 Bacteria 1786
220 Ga0068859_101077292 3300005617 Bacteria 884
221 Ga0068864_100009238 3300005618 Bacteria 8129
222 Ga0068864_100069099 3300005618 Bacteria 3071
223 Ga0068866_10010005 3300005718 Bacteria 4051
224 Ga0068866_10033904 3300005718 Bacteria 2482
225 Ga0068866_10291282 3300005718 Bacteria 1015
226 Ga0068861_100001416 3300005719 Bacteria 15100
227 Ga0068861_100005119 3300005719 Bacteria 8841
228 Ga0068861_100013239 3300005719 Bacteria 5771
229 Ga0068851_10021738 3300005834 Bacteria 3116
230 Ga0068851_10036008 3300005834 Bacteria 2477
231 Ga0068851_10065777 3300005834 Bacteria 1866
232 Ga0068851_10594962 3300005834 Bacteria 673
233 Ga0068863_100087934 3300005841 Bacteria 2944
234 Ga0068863_100970866 3300005841 Bacteria 852
235 Ga0068863_102153713 3300005841 Bacteria 568
236 Ga0068858_100006788 3300005842 Bacteria 11135
237 Ga0068858_100073500 3300005842 Bacteria 3173
238 Ga0068858_101523109 3300005842 Bacteria 660
239 Ga0068860_100000903 3300005843 Bacteria 32899
240 Ga0068860_100008648 3300005843 Bacteria 10144
241 Ga0068860_100372371 3300005843 Bacteria 1409
242 Ga0068862_100007315 3300005844 Bacteria 9166
243 Ga0068862_100033939 3300005844 Bacteria 4316
244 Ga0068862_100100036 3300005844 Bacteria 2535
245 Ga0068862_100603560 3300005844 Bacteria 1054
246 Ga0068862_101903787 3300005844 Bacteria 605
247 Ga0081455_10154969 3300005937 Bacteria 1762
248 Ga0075363_100191580 3300006048 Bacteria 1166
249 Ga0075364_10686904 3300006051 Bacteria 699
250 Ga0075362_10105057 3300006177 Bacteria 1324
251 Ga0075362_10162763 3300006177 Bacteria 1075
252 Ga0075362_10169259 3300006177 Bacteria 1055
253 Ga0075362_10232140 3300006177 Bacteria 904
254 Ga0075367_10087101 3300006178 Bacteria 1896
255 Ga0075367_10485311 3300006178 Bacteria 784
256 Ga0075366_10023840 3300006195 Bacteria 3566
257 Ga0075366_10069763 3300006195 Bacteria 2092
258 Ga0075366_10161165 3300006195 Bacteria 1359
259 Ga0075366_10245148 3300006195 Bacteria 1092
260 Ga0075366_10506264 3300006195 Bacteria 747
261 Ga0075366_10820974 3300006195 Bacteria 578
262 Ga0075366_10975405 3300006195 Bacteria 528
263 Ga0097621_100098460 3300006237 Bacteria 2457
264 Ga0097621_100293346 3300006237 Bacteria 1434
265 Ga0097621_100806884 3300006237 Bacteria 870
266 Ga0097621_101655116 3300006237 Bacteria 609
267 Ga0075370_10011463 3300006353 Bacteria 4659
268 Ga0075370_10020006 3300006353 Bacteria 3651
269 Ga0075370_10051619 3300006353 Bacteria 2333
270 Ga0075370_10181382 3300006353 Bacteria 1239
271 Ga0075370_10498900 3300006353 Bacteria 734
272 Ga0075370_10647199 3300006353 Bacteria 641
273 Ga0068871_100014710 3300006358 Bacteria 5839
274 Ga0068871_100014932 3300006358 Bacteria 5806
275 Ga0068871_100049440 3300006358 Bacteria 3399
276 Ga0068871_100051168 3300006358 Bacteria 3344
277 Ga0068871_100330659 3300006358 Bacteria 1344
278 Ga0075430_100082328 3300006846 Bacteria 2697
279 Ga0075429_100008833 3300006880 Bacteria 8761
280 Ga0068865_100003663 3300006881 Bacteria 9226
281 Ga0068865_100233935 3300006881 Bacteria 1443
282 Ga0068865_100289236 3300006881 Bacteria 1307
283 Ga0068865_100437424 3300006881 Bacteria 1079
284 Ga0068865_100707074 3300006881 Bacteria 862
285 Ga0068865_100859153 3300006881 Bacteria 786
286 Ga0097620_100027032 3300006931 Bacteria 5755
287 Ga0097620_100035700 3300006931 Bacteria 4988
288 Ga0097620_100083487 3300006931 Bacteria 3238
289 Ga0097620_100272234 3300006931 Bacteria 1786
290 Ga0097620_101077262 3300006931 Bacteria 884
291 Ga0079104_1000273 3300006946 Bacteria 67267
292 Ga0079104_1003849 3300006946 Bacteria 6724
293 Ga0079104_1059468 3300006946 Bacteria 827
294 Ga0099826_10000005 3300006948 Bacteria 465206
295 Ga0075435_101387957 3300007076 Bacteria 616
296 Ga0105244_10002947 3300009036 Bacteria 12550
297 Ga0105244_10004312 3300009036 Bacteria 9842
298 Ga0105244_10162888 3300009036 Bacteria 1064
299 Ga0105244_10280324 3300009036 Bacteria 773
300 Ga0111539_10941517 3300009094 Bacteria 1004
301 Ga0105245_10036044 3300009098 Bacteria 4392
302 Ga0105245_10222432 3300009098 Bacteria 1822
303 Ga0105245_11116907 3300009098 Bacteria 835
304 Ga0114129_10137155 3300009147 Bacteria 3356
305 Ga0105243_10023700 3300009148 Bacteria 4677
306 Ga0105243_10063627 3300009148 Bacteria 2956
307 Ga0105243_10138979 3300009148 Bacteria 2070
308 Ga0105243_10435328 3300009148 Bacteria 1227
309 Ga0105243_10950944 3300009148 Bacteria 858
310 Ga0105241_10023999 3300009174 Bacteria 4527
311 Ga0105241_10242877 3300009174 Bacteria 1523
312 Ga0105241_11022846 3300009174 Bacteria 774
313 Ga0105242_10269981 3300009176 Bacteria 1540
314 Ga0105242_10365056 3300009176 Bacteria 1337
315 Ga0105242_11024226 3300009176 Bacteria 835
316 Ga0105242_11774809 3300009176 Bacteria 655
317 Ga0105248_10000595 3300009177 Bacteria 41224
318 Ga0105248_10027182 3300009177 Bacteria 6364
319 Ga0105248_10112431 3300009177 Bacteria 3071
320 Ga0105248_10204255 3300009177 Bacteria 2226
321 Ga0105248_10498071 3300009177 Bacteria 1373
322 Ga0105248_11331677 3300009177 Bacteria 812
323 Ga0105237_10172915 3300009545 Bacteria 2160
324 Ga0105237_10212870 3300009545 Bacteria 1932
325 Ga0105237_10399046 3300009545 Bacteria 1380
326 Ga0105237_11143531 3300009545 Bacteria 785
327 Ga0105238_10003253 3300009551 Bacteria 16214
328 Ga0105238_10052730 3300009551 Bacteria 4088
329 Ga0105238_10108100 3300009551 Bacteria 2762
330 Ga0105238_10275226 3300009551 Bacteria 1664
331 Ga0105249_10572519 3300009553 Bacteria 1182
332 Ga0105249_12040167 3300009553 Bacteria 646
333 Ga0105239_10080637 3300010375 Bacteria 3581
334 Ga0105239_10785653 3300010375 Bacteria 1090
335 Ga0105246_10400389 3300011119 Bacteria 1140
336 Ga0157324_1035756 3300012506 Bacteria 585
337 Ga0157326_1013205 3300012513 Bacteria 950
338 Ga0157373_10017629 3300013100 Bacteria 5200
339 Ga0157373_10877224 3300013100 Bacteria 665
340 Ga0157371_10171540 3300013102 Bacteria 1550
341 Ga0157371_10430578 3300013102 Bacteria 968
342 Ga0157370_10561401 3300013104 Bacteria 1046
343 Ga0157369_10018014 3300013105 Bacteria 7924
344 Ga0157369_10049207 3300013105 Bacteria 4570
345 Ga0157369_11075203 3300013105 Bacteria 823
346 Ga0157369_11119535 3300013105 Bacteria 804
347 Ga0157369_11530978 3300013105 Bacteria 678
348 Ga0157374_10075363 3300013296 Bacteria 3188
349 Ga0157374_10091458 3300013296 Bacteria 2902
350 Ga0157374_10136709 3300013296 Bacteria 2376
351 Ga0157374_10954611 3300013296 Bacteria 876
352 Ga0157374_11124861 3300013296 Bacteria 806
353 Ga0157374_12440091 3300013296 Bacteria 550
354 Ga0157378_10345680 3300013297 Bacteria 1452
355 Ga0157378_10648722 3300013297 Bacteria 1071
356 Ga0157378_11279228 3300013297 Bacteria 774
357 Ga0157378_11435357 3300013297 Bacteria 734
358 Ga0163162_10040290 3300013306 Bacteria 4671
359 Ga0163162_10154852 3300013306 Bacteria 2411
360 Ga0163162_11211092 3300013306 Bacteria 857
361 Ga0163162_11716639 3300013306 Bacteria 717
362 Ga0157372_10042427 3300013307 Bacteria 5032
363 Ga0157372_10334629 3300013307 Bacteria 1763
364 Ga0157372_10601169 3300013307 Bacteria 1282
365 Ga0157372_10986112 3300013307 Bacteria 976
366 Ga0157372_11281337 3300013307 Bacteria 846
367 Ga0157372_12697135 3300013307 Bacteria 570
368 Ga0157375_10045304 3300013308 Bacteria 4280
369 Ga0157375_10065030 3300013308 Bacteria 3634
370 Ga0157375_10112570 3300013308 Bacteria 2822
371 Ga0157375_10616094 3300013308 Bacteria 1244
372 Ga0163163_10190597 3300014325 Bacteria 2099
373 Ga0163163_11056694 3300014325 Bacteria 875
374 Ga0163163_11516962 3300014325 Bacteria 731
375 Ga0157380_10007364 3300014326 Bacteria 7813
376 Ga0157380_10013785 3300014326 Bacteria 5903
377 Ga0157380_10038853 3300014326 Bacteria 3698
378 Ga0157380_10256033 3300014326 Bacteria 1587
379 Ga0157380_10833381 3300014326 Bacteria 942
380 Ga0182008_10001405 3300014497 Bacteria 16197
381 Ga0182008_10388828 3300014497 Bacteria 747
382 Ga0157377_10000294 3300014745 Bacteria 23613
383 Ga0157377_10586265 3300014745 Bacteria 793
384 Ga0157379_10023168 3300014968 Bacteria 5507
385 Ga0157379_10025892 3300014968 Bacteria 5215
386 Ga0157379_10089602 3300014968 Bacteria 2760
387 Ga0157379_10107716 3300014968 Bacteria 2502
388 Ga0157376_10004653 3300014969 Bacteria 9562
389 Ga0157376_10079761 3300014969 Bacteria 2807
390 Ga0157376_10115009 3300014969 Bacteria 2375
391 Ga0157376_10202284 3300014969 Bacteria 1828
392 Ga0157376_10305066 3300014969 Bacteria 1508
393 Ga0157376_10663038 3300014969 Bacteria 1045
394 Ga0157376_12097438 3300014969 Bacteria 604
395 Ga0182006_1000004 3300015261 Bacteria 622190
396 Ga0182006_1000176 3300015261 Bacteria 67387
397 Ga0182007_10000017 3300015262 Bacteria 199097
398 Ga0182007_10127552 3300015262 Bacteria 854
399 Ga0182007_10189429 3300015262 Bacteria 715
400 Ga0182005_1000005 3300015265 Bacteria 537378
401 Ga0182005_1000030 3300015265 Bacteria 213092
402 Ga0182005_1099447 3300015265 Bacteria 814
403 Ga0163161_10020753 3300017792 Bacteria 4612
404 Ga0163161_10021914 3300017792 Bacteria 4492
405 Ga0163161_10048829 3300017792 Bacteria 3057
406 Ga0163161_10104696 3300017792 Bacteria 2109
407 Ga0163161_10180987 3300017792 Bacteria 1616
408 Ga0163161_10232114 3300017792 Bacteria 1432
409 Ga0163161_10694080 3300017792 Bacteria 847
410 Ga0163161_10722683 3300017792 Bacteria 831
411 Ga0163161_10889649 3300017792 Bacteria 754
412 Ga0213872_10000035 3300021361 Bacteria 133053
413 Ga0213872_10000127 3300021361 Bacteria 69204
414 Ga0213872_10000139 3300021361 Bacteria 65459
415 Ga0213872_10000160 3300021361 Bacteria 61551
416 Ga0213872_10000683 3300021361 Bacteria 25720
417 Ga0213872_10018814 3300021361 Bacteria 3183
418 Ga0213872_10028189 3300021361 Bacteria 2576
419 Ga0213872_10158072 3300021361 Bacteria 987
420 Ga0209674_100003 3300025226 Bacteria 2196646
421 Ga0209672_113998 3300025228 Bacteria 942
422 Ga0209563_100003 3300025230 Bacteria 1932942
423 Ga0209563_100010 3300025230 Bacteria 1337457
424 Ga0209563_100025 3300025230 Bacteria 596456
425 Ga0207427_104232 3300025231 Bacteria 2518
426 Ga0209258_100163 3300025242 Bacteria 149677
427 Ga0209258_100627 3300025242 Bacteria 27977
428 Ga0207425_1000376 3300025245 Bacteria 30569
429 Ga0209646_1000036 3300025246 Bacteria 358864
430 Ga0209646_1000138 3300025246 Bacteria 114892
431 Ga0209026_1000021 3300025250 Bacteria 375165
432 Ga0209677_100093 3300025253 Bacteria 101695
433 Ga0209677_100817 3300025253 Bacteria 15553
434 Ga0209677_102569 3300025253 Bacteria 6689
435 Ga0209677_102895 3300025253 Bacteria 6026
436 Ga0209148_1000203 3300025254 Bacteria 105950
437 Ga0209759_1000025 3300025256 Bacteria 317082
438 Ga0209759_1001158 3300025256 Bacteria 16724
439 Ga0209759_1013130 3300025256 Bacteria 2256
440 Ga0209565_1000068 3300025263 Bacteria 171201
441 Ga0209565_1011943 3300025263 Bacteria 2093
442 Ga0209455_1000047 3300025272 Bacteria 379709
443 Ga0209455_1000059 3300025272 Bacteria 339995
444 Ga0209673_1000119 3300025273 Bacteria 171203
445 Ga0209673_1006475 3300025273 Bacteria 5650
446 Ga0209130_1000057 3300025284 Bacteria 210593
447 Ga0209675_1000068 3300025291 Bacteria 171202
448 Ga0209675_1012938 3300025291 Bacteria 2649
449 Ga0209025_1004584 3300025294 Bacteria 11853
450 Ga0209564_1000060 3300025295 Bacteria 325890
451 Ga0209564_1000141 3300025295 Bacteria 179852
452 Ga0209564_1000149 3300025295 Bacteria 170958
453 Ga0209758_1000941 3300025297 Bacteria 39283
454 Ga0209256_1000024 3300025299 Bacteria 448909
455 Ga0209256_1000040 3300025299 Bacteria 366839
456 Ga0209256_1000173 3300025299 Bacteria 129001
457 Ga0209051_1003858 3300025303 Bacteria 9585
458 Ga0209051_1004022 3300025303 Bacteria 9305
459 Ga0209051_1011624 3300025303 Bacteria 4328
460 Ga0209257_1000032 3300025304 Bacteria 680354
461 Ga0207656_10083296 3300025321 Bacteria 1441
462 Ga0207655_1022557 3300025728 Bacteria 3150
463 Ga0207655_1024930 3300025728 Bacteria 2918
464 Ga0207682_10001255 3300025893 Bacteria 11730
465 Ga0207682_10114555 3300025893 Bacteria 1190
466 Ga0207682_10229071 3300025893 Bacteria 861
467 Ga0207682_10297195 3300025893 Bacteria 757
468 Ga0207642_10025093 3300025899 Bacteria 2406
469 Ga0207642_10075539 3300025899 Bacteria 1619
470 Ga0207710_10372598 3300025900 Bacteria 730
471 Ga0207688_10005290 3300025901 Bacteria 7013
472 Ga0207645_10031533 3300025907 Bacteria 3410
473 Ga0207645_10128376 3300025907 Bacteria 1649
474 Ga0207645_10219054 3300025907 Bacteria 1254
475 Ga0207645_10293283 3300025907 Bacteria 1082
476 Ga0207705_10011989 3300025909 Bacteria 6265
477 Ga0207705_11042357 3300025909 Bacteria 631
478 Ga0207654_10021482 3300025911 Bacteria 3432
479 Ga0207707_10108844 3300025912 Bacteria 2423
480 Ga0207695_10080700 3300025913 Bacteria 3294
481 Ga0207695_10084675 3300025913 Bacteria 3201
482 Ga0207671_10164373 3300025914 Bacteria 1720
483 Ga0207660_10004601 3300025917 Bacteria 8988
484 Ga0207660_10590952 3300025917 Bacteria 904
485 Ga0207657_10020777 3300025919 Bacteria 6197
486 Ga0207657_10084454 3300025919 Bacteria 2661
487 Ga0207657_10457320 3300025919 Bacteria 1001
488 Ga0207657_10982071 3300025919 Bacteria 648
489 Ga0207649_10010449 3300025920 Bacteria 5101
490 Ga0207649_10028943 3300025920 Bacteria 3267
491 Ga0207649_10154052 3300025920 Bacteria 1586
492 Ga0207649_10737776 3300025920 Bacteria 766
493 Ga0207652_10080840 3300025921 Bacteria 2842
494 Ga0207652_10452857 3300025921 Bacteria 1157
495 Ga0207681_10032182 3300025923 Bacteria 3432
496 Ga0207681_10037994 3300025923 Bacteria 3186
497 Ga0207681_10043789 3300025923 Bacteria 2997
498 Ga0207681_10061997 3300025923 Bacteria 2573
499 Ga0207681_10499004 3300025923 Bacteria 996
500 Ga0207681_10868202 3300025923 Bacteria 755
501 Ga0207650_10010814 3300025925 Bacteria 6268
502 Ga0207650_10019962 3300025925 Bacteria 4718
503 Ga0207659_10030843 3300025926 Bacteria 3666
504 Ga0207659_10211488 3300025926 Bacteria 1555
505 Ga0207659_10217458 3300025926 Bacteria 1534
506 Ga0207659_10302321 3300025926 Bacteria 1314
507 Ga0207659_10659996 3300025926 Bacteria 894
508 Ga0207687_10008809 3300025927 Bacteria 6594
509 Ga0207687_10406772 3300025927 Bacteria 1120
510 Ga0207687_10430098 3300025927 Bacteria 1091
511 Ga0207687_11132129 3300025927 Bacteria 672
512 Ga0207644_10033398 3300025931 Bacteria 3595
513 Ga0207644_10053041 3300025931 Bacteria 2917
514 Ga0207644_10062491 3300025931 Bacteria 2701
515 Ga0207644_10196003 3300025931 Bacteria 1591
516 Ga0207690_10004038 3300025932 Bacteria 8665
517 Ga0207690_10170685 3300025932 Bacteria 1629
518 Ga0207690_10268912 3300025932 Bacteria 1323
519 Ga0207706_10004089 3300025933 Bacteria 13782
520 Ga0207706_10058771 3300025933 Bacteria 3386
521 Ga0207706_10284462 3300025933 Bacteria 1442
522 Ga0207706_10438292 3300025933 Bacteria 1131
523 Ga0207706_10440688 3300025933 Bacteria 1128
524 Ga0207686_10032006 3300025934 Bacteria 3127
525 Ga0207686_10063522 3300025934 Bacteria 2348
526 Ga0207709_10025634 3300025935 Bacteria 3377
527 Ga0207709_10041325 3300025935 Bacteria 2766
528 Ga0207709_10064766 3300025935 Bacteria 2296
529 Ga0207709_11175023 3300025935 Bacteria 632
530 Ga0207670_10737083 3300025936 Bacteria 818
531 Ga0207669_10112485 3300025937 Bacteria 1828
532 Ga0207669_10611394 3300025937 Bacteria 887
533 Ga0207669_11947629 3300025937 Bacteria 502
534 Ga0207704_10005537 3300025938 Bacteria 5819
535 Ga0207704_10083314 3300025938 Bacteria 2075
536 Ga0207704_10517258 3300025938 Bacteria 965
537 Ga0207691_10011878 3300025940 Bacteria 8357
538 Ga0207691_10057109 3300025940 Bacteria 3554
539 Ga0207691_10272294 3300025940 Bacteria 1458
540 Ga0207691_10315262 3300025940 Bacteria 1341
541 Ga0207711_10001919 3300025941 Bacteria 18885
542 Ga0207711_10006066 3300025941 Bacteria 10211
543 Ga0207711_10749057 3300025941 Bacteria 911
544 Ga0207711_11612572 3300025941 Bacteria 592
545 Ga0207689_10008328 3300025942 Bacteria 9033
546 Ga0207689_10442637 3300025942 Bacteria 1086
547 Ga0207661_10840130 3300025944 Bacteria 845
548 Ga0207679_10016886 3300025945 Bacteria 4853
549 Ga0207679_10024101 3300025945 Bacteria 4169
550 Ga0207679_10060411 3300025945 Bacteria 2816
551 Ga0207679_10162791 3300025945 Bacteria 1828
552 Ga0207679_10376143 3300025945 Bacteria 1244
553 Ga0207679_10593518 3300025945 Bacteria 997
554 Ga0207667_10078788 3300025949 Bacteria 3414
555 Ga0207667_10115407 3300025949 Bacteria 2768
556 Ga0207667_10874050 3300025949 Bacteria 892
557 Ga0207667_11091962 3300025949 Bacteria 781
558 Ga0207651_10013982 3300025960 Bacteria 4619
559 Ga0207651_10134791 3300025960 Bacteria 1897
560 Ga0207651_10172606 3300025960 Bacteria 1707
561 Ga0207651_10198999 3300025960 Bacteria 1604
562 Ga0207651_10217888 3300025960 Bacteria 1541
563 Ga0207651_12023631 3300025960 Bacteria 517
564 Ga0207712_10219856 3300025961 Bacteria 1518
565 Ga0207668_10275466 3300025972 Bacteria 1377
566 Ga0207640_10216373 3300025981 Bacteria 1463
567 Ga0207658_10002360 3300025986 Bacteria 13877
568 Ga0207658_10515090 3300025986 Bacteria 1067
569 Ga0207658_10747993 3300025986 Bacteria 885
570 Ga0207658_10962500 3300025986 Bacteria 778
571 Ga0207658_11037347 3300025986 Bacteria 748
572 Ga0207677_10004412 3300026023 Bacteria 7546
573 Ga0207677_10211222 3300026023 Bacteria 1550
574 Ga0207677_10892895 3300026023 Bacteria 801
575 Ga0207677_11054321 3300026023 Bacteria 739
576 Ga0207677_11257016 3300026023 Bacteria 679
577 Ga0207703_10053412 3300026035 Bacteria 3284
578 Ga0207703_10141302 3300026035 Bacteria 2090
579 Ga0207703_10476025 3300026035 Bacteria 1170
580 Ga0207703_10565636 3300026035 Bacteria 1073
581 Ga0207639_10085207 3300026041 Bacteria 2512
582 Ga0207639_10744272 3300026041 Bacteria 911
583 Ga0207678_10003169 3300026067 Bacteria 14868
584 Ga0207678_10027797 3300026067 Bacteria 4939
585 Ga0207678_10082037 3300026067 Bacteria 2759
586 Ga0207678_10109071 3300026067 Bacteria 2361
587 Ga0207678_10174309 3300026067 Bacteria 1836
588 Ga0207678_10259657 3300026067 Bacteria 1489
589 Ga0207678_10407539 3300026067 Bacteria 1178
590 Ga0207702_10000227 3300026078 Bacteria 65464
591 Ga0207702_10250517 3300026078 Bacteria 1663
592 Ga0207702_10758403 3300026078 Bacteria 958
593 Ga0207702_11178159 3300026078 Bacteria 760
594 Ga0207702_11365627 3300026078 Bacteria 702
595 Ga0207641_10100139 3300026088 Bacteria 2552
596 Ga0207641_10119259 3300026088 Bacteria 2351
597 Ga0207641_10789438 3300026088 Bacteria 939
598 Ga0207648_10004504 3300026089 Bacteria 14286
599 Ga0207648_10010128 3300026089 Bacteria 8962
600 Ga0207648_10024243 3300026089 Bacteria 5418
601 Ga0207648_10074300 3300026089 Bacteria 2963
602 Ga0207648_10117298 3300026089 Bacteria 2340
603 Ga0207648_10363776 3300026089 Bacteria 1306
604 Ga0207676_10009240 3300026095 Bacteria 7014
605 Ga0207676_10080135 3300026095 Bacteria 2650
606 Ga0207674_10091585 3300026116 Bacteria 3030
607 Ga0207675_100001125 3300026118 Bacteria 26534
608 Ga0207675_100005766 3300026118 Bacteria 11845
609 Ga0207675_100105822 3300026118 Bacteria 2652
610 Ga0207675_100408557 3300026118 Bacteria 1339
611 Ga0207683_10007938 3300026121 Bacteria 9084
612 Ga0207683_10012078 3300026121 Bacteria 7373
613 Ga0207683_10215090 3300026121 Bacteria 1750
614 Ga0207683_10295538 3300026121 Bacteria 1482
615 Ga0207683_11291420 3300026121 Bacteria 676
616 Ga0207698_10042094 3300026142 Bacteria 3410
617 Ga0209281_1000416 3300027111 Bacteria 64290
618 Ga0209281_1050051 3300027111 Bacteria 670
619 Ga0209967_1001211 3300027364 Bacteria 3303
620 Ga0210000_1002227 3300027462 Bacteria 2749
621 Ga0209995_1014917 3300027471 Bacteria 1274
622 Ga0209968_1002465 3300027526 Bacteria 2796
623 Ga0209999_1023219 3300027543 Bacteria 1142
624 Ga0209970_1000174 3300027614 Bacteria 10132
625 Ga0209983_1032993 3300027665 Bacteria 1107
626 Ga0209282_1000003 3300027666 Bacteria 856377
627 Ga0209588_1051553 3300027671 Bacteria 1331
628 Ga0209966_1000303 3300027695 Bacteria 16183
629 Ga0268266_10297392 3300028379 Bacteria 1505
630 Ga0268266_10740279 3300028379 Bacteria 948
631 Ga0268265_10175003 3300028380 Bacteria 1838
632 Ga0268265_10180418 3300028380 Bacteria 1813
633 Ga0268265_10207139 3300028380 Bacteria 1706
634 Ga0268265_10558854 3300028380 Bacteria 1087
635 Ga0268265_11675532 3300028380 Bacteria 641
636 Ga0268264_10008380 3300028381 Bacteria 8594
637 Ga0268264_10521151 3300028381 Bacteria 1162
638 Ga0265336_10000051 3300028666 Bacteria 114796
639 Ga0307517_10000052 3300028786 Bacteria 155904
640 Ga0307517_10147490 3300028786 Bacteria 1627
641 Ga0307517_10396630 3300028786 Bacteria 732
642 Ga0307515_10000416 3300028794 Bacteria 102535
643 Ga0307515_10000645 3300028794 Bacteria 80548
644 Ga0307515_10001163 3300028794 Bacteria 60305
645 Ga0307515_10004048 3300028794 Bacteria 30591
646 Ga0307515_10004318 3300028794 Bacteria 29495
647 Ga0307515_10014143 3300028794 Bacteria 14834
648 Ga0307515_10026385 3300028794 Bacteria 10003
649 Ga0307515_10047081 3300028794 Bacteria 6569
650 Ga0307515_10102840 3300028794 Bacteria 3431
651 Ga0307515_10181532 3300028794 Bacteria 2052
652 Ga0307515_10335364 3300028794 Bacteria 1168
653 Ga0307515_10361979 3300028794 Bacteria 1091
654 Ga0265324_10000292 3300029957 Bacteria 37241
655 Ga0265324_10043351 3300029957 Bacteria 1553
656 Ga0307512_10072314 3300030522 Bacteria 2552
657 Ga0307512_10104738 3300030522 Bacteria 1896
658 Ga0316181_1032650 3300030744 Bacteria 4582
659 Ga0265328_10038853 3300031239 Bacteria 1756
660 Ga0265331_10002254 3300031250 Bacteria 13195
661 Ga0265327_10000309 3300031251 Bacteria 94387
662 Ga0265316_10000299 3300031344 Bacteria 55433
663 Ga0307513_10024348 3300031456 Bacteria 7043
664 Ga0307513_10127823 3300031456 Bacteria 2492
665 Ga0307513_10218597 3300031456 Bacteria 1729
666 Ga0307509_10012817 3300031507 Bacteria 9981
667 Ga0307509_10049892 3300031507 Bacteria 4484
668 Ga0307509_10108307 3300031507 Bacteria 2792
669 Ga0307509_10128511 3300031507 Bacteria 2495
670 Ga0307509_10131278 3300031507 Bacteria 2460
671 Ga0307509_10218808 3300031507 Bacteria 1720
672 Ga0307509_10351648 3300031507 Bacteria 1197
673 Ga0307408_100000010 3300031548 Bacteria 420048
674 Ga0307408_100002273 3300031548 Bacteria 13680
675 Ga0307408_100065404 3300031548 Bacteria 2667
676 Ga0307408_100272435 3300031548 Bacteria 1406
677 Ga0307408_100461417 3300031548 Bacteria 1104
678 Ga0307408_100647165 3300031548 Bacteria 945
679 Ga0307508_10000047 3300031616 Bacteria 137805
680 Ga0307508_10001110 3300031616 Bacteria 31159
681 Ga0307508_10012672 3300031616 Bacteria 7709
682 Ga0307508_10400903 3300031616 Bacteria 963
683 Ga0307514_10002133 3300031649 Bacteria 21325
684 Ga0307514_10017955 3300031649 Bacteria 5812
685 Ga0307514_10045424 3300031649 Bacteria 3438
686 Ga0265314_10062809 3300031711 Bacteria 2523
687 Ga0307516_10000038 3300031730 Bacteria 147103
688 Ga0307516_10001369 3300031730 Bacteria 33766
689 Ga0307516_10005900 3300031730 Bacteria 14498
690 Ga0307516_10254243 3300031730 Bacteria 1450
691 Ga0307516_10312345 3300031730 Bacteria 1245
692 Ga0307405_10018925 3300031731 Bacteria 3812
693 Ga0307405_10191108 3300031731 Bacteria 1479
694 Ga0307405_10348696 3300031731 Bacteria 1141
695 Ga0307413_10001478 3300031824 Bacteria 8945
696 Ga0307413_10034527 3300031824 Bacteria 2892
697 Ga0307413_11202310 3300031824 Bacteria 659
698 Ga0307518_10019478 3300031838 Bacteria 4874
699 Ga0307410_10130880 3300031852 Bacteria 1843
700 Ga0307410_10341775 3300031852 Bacteria 1193
701 Ga0307410_10414646 3300031852 Bacteria 1091
702 Ga0307410_10480113 3300031852 Bacteria 1019
703 Ga0307410_10559137 3300031852 Bacteria 949
704 Ga0307406_10007697 3300031901 Bacteria 5983
705 Ga0307406_10606605 3300031901 Bacteria 903
706 Ga0307412_10003056 3300031911 Bacteria 9276
707 Ga0307412_10134632 3300031911 Bacteria 1801
708 Ga0307409_100012773 3300031995 Bacteria 5367
709 Ga0307409_100244130 3300031995 Bacteria 1637
710 Ga0307409_100316229 3300031995 Bacteria 1459
711 Ga0307409_100754418 3300031995 Bacteria 977
712 Ga0307416_100376041 3300032002 Bacteria 1449
713 Ga0307416_100426917 3300032002 Bacteria 1371
714 Ga0307416_101093401 3300032002 Bacteria 902
715 Ga0307416_101355712 3300032002 Bacteria 817
716 Ga0307414_10099483 3300032004 Bacteria 2185
717 Ga0307414_10158522 3300032004 Bacteria 1794
718 Ga0307411_10002067 3300032005 Bacteria 8629
719 Ga0307411_10019462 3300032005 Bacteria 3922
720 Ga0307411_10156038 3300032005 Bacteria 1703
721 Ga0307411_10186301 3300032005 Bacteria 1580
722 Ga0307411_10268406 3300032005 Bacteria 1352
723 Ga0307411_10296460 3300032005 Bacteria 1295
724 Ga0307411_11675038 3300032005 Bacteria 588
725 Ga0307415_100043660 3300032126 Bacteria 2992
726 Ga0307415_100581294 3300032126 Bacteria 994
727 Ga0307415_102208059 3300032126 Bacteria 539
728 Ga0307510_10005294 3300033180 Bacteria 15345
729 Ga0307510_10037378 3300033180 Bacteria 5387
730 Ga0307510_10253556 3300033180 Bacteria 1245
731 Ga0307510_10468508 3300033180 Bacteria 701
732 Ga0373959_0049269 3300034820 Bacteria 905
733 Ga0373929_0090021 3300035085 Bacteria 760
734 Ga0373934_0097225 3300035086 Bacteria 1189
735 Ga0373944_0061421 3300035089 Bacteria 1206
736 Ga0373944_0112318 3300035089 Bacteria 932
737 Ga0373951_0018674 3300035091 Bacteria 1576
738 Ga0373939_0000579 3300035114 Bacteria 9136
739 Ga0373941_0061235 3300035115 Bacteria 1225
740 Ga0373941_0462326 3300035115 Bacteria 534
741 Ga0373943_0969621 3300035170 Bacteria 509
742 Ga0373962_0060087 3300035242 Bacteria 1114
743 Ga0373931_0000228 3300035691 Bacteria 23922
744 Ga0373931_0006809 3300035691 Bacteria 5370
745 Ga0373931_0011745 3300035691 Bacteria 4233
746 Ga0373931_0904443 3300035691 Bacteria 593
747 Ga0373927_0009397 3300035695 Bacteria 6558
748 Ga0373933_0043177 3300035724 Bacteria 2667
749 Ga0373925_0001850 3300037068 Bacteria 17621
750 Ga0373925_0497099 3300037068 Bacteria 1001
751 Ga0395899_0000370 3300037312 Bacteria 54053
752 Ga0395899_0038495 3300037312 Bacteria 3582
753 Ga0395899_0043349 3300037312 Bacteria 3356
754 Ga0395899_0113735 3300037312 Bacteria 1943
755 Ga0395899_0243257 3300037312 Bacteria 1237
756 Ga0395899_0362820 3300037312 Bacteria 966
757 Ga0395899_0494725 3300037312 Bacteria 794
758 Ga0395900_0000640 3300037418 Bacteria 47118
759 Ga0395900_0033983 3300037418 Bacteria 5248
760 Ga0395900_0120467 3300037418 Bacteria 2692
761 Ga0395900_0123750 3300037418 Bacteria 2652
762 Ga0395900_0220142 3300037418 Bacteria 1913
763 Ga0395900_0617867 3300037418 Bacteria 1023
764 Ga0395898_0007053 3300037466 Bacteria 11937
765 Ga0395898_0070112 3300037466 Bacteria 3390
766 Ga0395898_1319919 3300037466 Bacteria 650
767 Ga0395905_0000676 3300037471 Bacteria 45246
768 Ga0395905_0008541 3300037471 Bacteria 10098
769 Ga0395905_0013220 3300037471 Bacteria 7921
770 Ga0395905_0018255 3300037471 Bacteria 6659
771 Ga0395905_0133785 3300037471 Bacteria 2332
772 Ga0395905_0140362 3300037471 Bacteria 2273
773 Ga0395905_0227962 3300037471 Bacteria 1742
774 Ga0395905_0284022 3300037471 Bacteria 1541
775 Ga0395905_0516473 3300037471 Bacteria 1095
776 Ga0395905_0747246 3300037471 Bacteria 880
777 Ga0395905_0873193 3300037471 Bacteria 802
778 Ga0395901_0000074 3300038443 Bacteria 138735
779 Ga0395901_0001733 3300038443 Bacteria 22534
780 Ga0395901_0244277 3300038443 Bacteria 1871
781 Ga0395901_0279774 3300038443 Bacteria 1733
782 Ga0395901_0323079 3300038443 Bacteria 1596
783 Ga0395901_0429941 3300038443 Bacteria 1353
784 Ga0395901_0961672 3300038443 Bacteria 832
785 Ga0436361_0048643 3300039447 Bacteria 3615
786 Ga0436361_0053671 3300039447 Bacteria 10745
787 Ga0436361_0062004 3300039447 Bacteria 42438
788 Ga0436361_0071334 3300039447 Bacteria 40702
789 Ga0436361_0144792 3300039447 Bacteria 34252
790 Ga0436361_0239153 3300039447 Bacteria 3627
791 Ga0436361_0362312 3300039447 Bacteria 55943
792 Ga0436361_0588758 3300039447 Bacteria 2463
793 Ga0436361_0615018 3300039447 Bacteria 2619
794 Ga0436361_0692200 3300039447 Bacteria 6235
795 Ga0436361_0749269 3300039447 Bacteria 121408
796 Ga0436361_1191441 3300039447 Bacteria 1913
797 Ga0436363_1606815 3300039450 Bacteria 546
798 Ga0439453_0015160 3300041408 Bacteria 1330
799 Ga0439465_0221247 3300041413 Bacteria 694
800 Ga0451791_1212493 3300041451 Bacteria 586
801 Ga0451791_1752511 3300041451 Bacteria 1317
802 Ga0451795_1328699 3300041456 Bacteria 937
803 Ga0451798_0266409 3300041458 Bacteria 709
804 Ga0451802_0610707 3300041460 Bacteria 559
805 Ga0451807_1373320 3300041486 Bacteria 1108
806 Ga0451835_1125194 3300041492 Bacteria 567
807 Ga0451837_1627762 3300041494 Bacteria 534
808 Ga0451845_0632488 3300041501 Bacteria 700
809 Ga0451847_0912814 3300041503 Bacteria 558
810 Ga0451849_1092259 3300041505 Bacteria 1980
811 Ga0451851_0023497 3300041507 Bacteria 1848
812 Ga0451851_0889618 3300041507 Bacteria 546
813 Ga0451843_0699320 3300041509 Bacteria 1896
814 Ga0451853_0907922 3300041512 Bacteria 896
815 Ga0439431_0006166 3300041997 Bacteria 2648
816 Ga0439433_0021226 3300041999 Bacteria 1452
817 Ga0439437_000360 3300042000 Bacteria 4343
818 Ga0439448_0003089 3300042005 Bacteria 4583
819 Ga0439448_0081905 3300042005 Bacteria 1084
820 Ga0439448_0127064 3300042005 Bacteria 877
821 Ga0439448_0172457 3300042005 Bacteria 755
822 Ga0439449_0016561 3300042007 Bacteria 2770
823 Ga0439449_0070323 3300042007 Bacteria 1290
824 Ga0439455_0012754 3300042012 Bacteria 1892
825 Ga0439455_0174098 3300042012 Bacteria 618
826 Ga0439462_0151164 3300042015 Bacteria 653
827 Ga0450911_014457 3300042115 Bacteria 1049
828 Ga0450913_016161 3300042117 Bacteria 650
829 Ga0450917_000369 3300042120 Bacteria 3371
830 Ga0450919_004025 3300042121 Bacteria 1807
831 Ga0450920_014429 3300042122 Bacteria 1495
832 Ga0450888_000895 3300042126 Bacteria 2838
833 Ga0450888_013430 3300042126 Unclassified 981
834 Ga0450890_037914 3300042127 Bacteria 705
835 Ga0450890_078507 3300042127 Bacteria 536
836 Ga0450891_000017 3300042129 Bacteria 12411
837 Ga0450895_006529 3300042132 Bacteria 956
838 Ga0450898_015726 3300042134 Bacteria 1285
839 Ga0450898_026984 3300042134 Bacteria 1037
840 Ga0450898_062501 3300042134 Bacteria 734
841 Ga0450898_084618 3300042134 Bacteria 648
842 Ga0450903_016707 3300042138 Bacteria 1150
843 Ga0450904_000117 3300042139 Bacteria 17632
844 Ga0450906_026774 3300042145 Bacteria 1024
845 Ga0439446_0237398 3300042156 Bacteria 625
846 Ga0439446_0282478 3300042156 Bacteria 579
847 Ga0450918_000764 3300042531 Bacteria 6808
848 Ga0450893_0002946 3300042532 Bacteria 2678
849 Ga0450893_0128648 3300042532 Bacteria 533
850 Ga0450901_017537 3300042533 Bacteria 758
851 Ga0451577_0043475 3300042876 Bacteria 4024
852 Ga0466969_0000037 3300044656 Bacteria 75663
853 Ga0466969_0034564 3300044656 Bacteria 2560
854 Ga0466969_0043321 3300044656 Bacteria 2243
855 Ga0466969_0464173 3300044656 Bacteria 576
856 Ga0466972_0002974 3300044658 Bacteria 8390
857 Ga0466972_0009008 3300044658 Bacteria 5009
858 Ga0466972_0059269 3300044658 Bacteria 1838
859 Ga0466972_0316178 3300044658 Bacteria 729
860 Ga0466982_0034801 3300044672 Bacteria 3016
861 Ga0466965_0004104 3300044683 Bacteria 6467
862 Ga0466965_0017071 3300044683 Bacteria 3465
863 Ga0466965_0030031 3300044683 Bacteria 2646
864 Ga0466965_0043171 3300044683 Bacteria 2225
865 Ga0466965_0077681 3300044683 Bacteria 1676
866 Ga0466965_0081903 3300044683 Bacteria 1632
867 Ga0466965_0125565 3300044683 Bacteria 1327
868 Ga0466965_0263412 3300044683 Bacteria 927
869 Ga0466966_0014648 3300044684 Bacteria 5190
870 Ga0466966_0032499 3300044684 Bacteria 3381
871 Ga0466966_0048223 3300044684 Bacteria 2713
872 Ga0466966_0114801 3300044684 Bacteria 1658
873 Ga0466966_0191066 3300044684 Bacteria 1240
874 Ga0466966_0286152 3300044684 Bacteria 991
875 Ga0466966_0417301 3300044684 Bacteria 806
876 Ga0466966_0444248 3300044684 Bacteria 779
877 Ga0466961_0015995 3300044693 Bacteria 4816
878 Ga0466961_0020395 3300044693 Bacteria 4263
879 Ga0466961_0022942 3300044693 Bacteria 4014
880 Ga0466961_0048858 3300044693 Bacteria 2704
881 Ga0466963_0024612 3300044694 Bacteria 3832
882 Ga0466963_0321315 3300044694 Bacteria 1089
883 Ga0466964_0005515 3300044706 Bacteria 4697
884 Ga0466964_0008450 3300044706 Bacteria 3868
885 Ga0466964_0022795 3300044706 Bacteria 2431
886 Ga0466964_0189517 3300044706 Bacteria 980
887 Ga0466964_0273959 3300044706 Bacteria 841
888 Ga0466964_0493591 3300044706 Bacteria 656
889 Ga0453684_0047302 3300044712 Bacteria 5707
890 Ga0453684_0103481 3300044712 Bacteria 3479
891 Ga0453684_0147265 3300044712 Bacteria 2803
892 Ga0453684_0158290 3300044712 Bacteria 2682
893 Ga0453684_0228640 3300044712 Bacteria 2149
894 Ga0453684_0428150 3300044712 Bacteria 1477
895 Ga0453684_0546938 3300044712 Bacteria 1276
896 Ga0453684_1324140 3300044712 Bacteria 750
897 Ga0466971_0008028 3300044719 Bacteria 4602
898 Ga0466971_0025492 3300044719 Bacteria 2640
899 Ga0466971_0031185 3300044719 Bacteria 2386
900 Ga0466968_0000503 3300044735 Bacteria 13277
901 Ga0466968_0026789 3300044735 Bacteria 2368
902 Ga0466968_0032257 3300044735 Bacteria 2178
903 Ga0466970_0028959 3300044765 Bacteria 2913
904 Ga0466970_0073793 3300044765 Bacteria 1836
905 Ga0466970_0085799 3300044765 Bacteria 1706
906 Ga0466970_0206437 3300044765 Bacteria 1094
907 Ga0466957_0006839 3300044842 Bacteria 6445
908 Ga0466957_0009983 3300044842 Bacteria 5432
909 Ga0466957_0020390 3300044842 Bacteria 3900
910 Ga0466957_0035356 3300044842 Bacteria 2998
911 Ga0466957_0082980 3300044842 Bacteria 1998
912 Ga0466957_0102870 3300044842 Bacteria 1802
913 Ga0466957_0701491 3300044842 Bacteria 714
914 Ga0466957_1018496 3300044842 Bacteria 595
915 Ga0466960_0146279 3300044901 Bacteria 1259
916 Ga0466960_0160039 3300044901 Bacteria 1208
917 Ga0466960_0168693 3300044901 Bacteria 1180
918 Ga0466960_0661791 3300044901 Bacteria 624
919 Ga0466960_0716203 3300044901 Bacteria 601
920 Ga0466959_0006252 3300045049 Bacteria 8227
921 Ga0466959_0110779 3300045049 Bacteria 1959
922 Ga0466959_0112723 3300045049 Bacteria 1939
923 Ga0466959_0117917 3300045049 Bacteria 1889
924 Ga0466959_0125799 3300045049 Bacteria 1819
925 Ga0466959_0528259 3300045049 Bacteria 796
926 Ga0466959_0735569 3300045049 Bacteria 660
927 Ga0451576_0002339 3300045051 Bacteria 28645
928 Ga0451576_0454819 3300045051 Bacteria 1344
929 Ga0451576_0819428 3300045051 Bacteria 977
930 Ga0451576_1458115 3300045051 Bacteria 711
931 Ga0451576_1686886 3300045051 Bacteria 656
932 Ga0466958_0077892 3300045836 Bacteria 2036
933 Ga0466958_0109142 3300045836 Bacteria 1727
934 Ga0466958_0113256 3300045836 Bacteria 1694
935 Ga0466958_0115744 3300045836 Bacteria 1675
936 Ga0466958_0156942 3300045836 Bacteria 1436
937 Ga0466958_0213387 3300045836 Bacteria 1230
938 Ga0466958_0233977 3300045836 Bacteria 1173
939 Ga0466967_0011205 3300045976 Bacteria 6777
940 Ga0466967_0020086 3300045976 Bacteria 5389
941 Ga0466967_0313540 3300045976 Bacteria 1511
942 Ga0466967_0376686 3300045976 Bacteria 1377
943 Ga0466967_0505951 3300045976 Bacteria 1186
944 Ga0495617_000005 3300046452 Bacteria 404687
945 Ga0495617_000026 3300046452 Bacteria 157675
946 Ga0495617_000362 3300046452 Bacteria 25053
947 Ga0495617_004468 3300046452 Bacteria 5088
948 Ga0495617_013150 3300046452 Bacteria 2818
949 Ga0495617_085770 3300046452 Bacteria 1030
950 Ga0495627_000038 3300046453 Bacteria 198316
951 Ga0495627_000043 3300046453 Bacteria 185855
952 Ga0495627_023622 3300046453 Bacteria 2011
953 Ga0495592_0000346 3300046454 Bacteria 37799
954 Ga0495603_0120676 3300046455 Bacteria 1527
955 Ga0495603_0157418 3300046455 Bacteria 1318
956 Ga0495603_0183569 3300046455 Bacteria 1210
957 Ga0495590_0000031 3300046457 Bacteria 143779
958 Ga0495590_0000041 3300046457 Bacteria 121084
959 Ga0495590_0006069 3300046457 Bacteria 4740
960 Ga0495590_0006704 3300046457 Bacteria 4483
961 Ga0495590_0123181 3300046457 Bacteria 929
962 Ga0495590_0195367 3300046457 Bacteria 742
963 Ga0495590_0227942 3300046457 Bacteria 689
964 Ga0495591_000213 3300046458 Bacteria 58510
965 Ga0495629_0001336 3300046459 Bacteria 19404
966 Ga0495629_0094490 3300046459 Bacteria 2086
967 Ga0495629_0182113 3300046459 Bacteria 1456
968 Ga0495629_0655730 3300046459 Bacteria 699
969 Ga0495629_0980435 3300046459 Bacteria 551
970 Ga0495638_0000101 3300046460 Bacteria 137331
971 Ga0495638_0018344 3300046460 Bacteria 4647
972 Ga0495638_0068193 3300046460 Bacteria 2182
973 Ga0495638_0078354 3300046460 Bacteria 2011
974 Ga0495638_0199792 3300046460 Bacteria 1129
975 Ga0495638_0228610 3300046460 Bacteria 1036
976 Ga0495638_0296130 3300046460 Bacteria 873
977 Ga0495638_0296595 3300046460 Bacteria 872
978 Ga0495638_0438618 3300046460 Bacteria 669
979 Ga0495638_0442370 3300046460 Bacteria 665
980 Ga0495638_0484298 3300046460 Bacteria 626
981 Ga0495653_0000031 3300046463 Bacteria 137159
982 Ga0495653_0012591 3300046463 Bacteria 6908
983 Ga0495653_0025416 3300046463 Bacteria 4760
984 Ga0495653_0072599 3300046463 Bacteria 2569
985 Ga0495653_0087730 3300046463 Bacteria 2284
986 Ga0495650_0000230 3300046471 Bacteria 114025
987 Ga0495650_0000274 3300046471 Bacteria 98605
988 Ga0495650_0000288 3300046471 Bacteria 93448
989 Ga0495650_0000504 3300046471 Bacteria 58448
990 Ga0495650_0001351 3300046471 Bacteria 24390
991 Ga0495650_0098457 3300046471 Bacteria 1101
992 Ga0495580_0006752 3300046472 Bacteria 9309
993 Ga0495580_0086525 3300046472 Bacteria 2183
994 Ga0495582_0017018 3300046473 Bacteria 3980
995 Ga0495605_0000071 3300046474 Bacteria 135203
996 Ga0495605_0000113 3300046474 Bacteria 103900
997 Ga0495605_0000186 3300046474 Bacteria 77457
998 Ga0495605_0001197 3300046474 Bacteria 17283
999 Ga0495605_0009878 3300046474 Bacteria 5352
1000 Ga0495605_0050343 3300046474 Bacteria 2032
1001 Ga0495605_0085279 3300046474 Bacteria 1471
1002 Ga0495605_0227370 3300046474 Bacteria 804
1003 Ga0495605_0281587 3300046474 Bacteria 706
1004 Ga0495605_0452653 3300046474 Bacteria 528
1005 Ga0495639_0047800 3300046475 Bacteria 1940
1006 Ga0495664_0225997 3300046477 Bacteria 1133
1007 Ga0495664_0490464 3300046477 Bacteria 734
1008 Ga0495584_0000007 3300046491 Bacteria 294820
1009 Ga0495584_0000252 3300046491 Bacteria 38603
1010 Ga0495584_0004963 3300046491 Bacteria 7093
1011 Ga0495584_0008099 3300046491 Bacteria 5461
1012 Ga0495584_0015762 3300046491 Bacteria 3853
1013 Ga0495584_0021355 3300046491 Bacteria 3289
1014 Ga0495584_0032557 3300046491 Bacteria 2638
1015 Ga0495584_0043442 3300046491 Bacteria 2268
1016 Ga0495584_0144931 3300046491 Bacteria 1206
1017 Ga0495584_0162952 3300046491 Bacteria 1133
1018 Ga0495584_0222395 3300046491 Bacteria 959
1019 Ga0495584_0355275 3300046491 Bacteria 744
1020 Ga0495584_0457278 3300046491 Bacteria 649
1021 Ga0495585_0000090 3300046492 Bacteria 95790
1022 Ga0495585_0000147 3300046492 Bacteria 76686
1023 Ga0495585_0000919 3300046492 Bacteria 24945
1024 Ga0495585_0006598 3300046492 Bacteria 7174
1025 Ga0495585_0012830 3300046492 Bacteria 4927
1026 Ga0495585_0016190 3300046492 Bacteria 4320
1027 Ga0495585_0024549 3300046492 Bacteria 3455
1028 Ga0495585_0025178 3300046492 Bacteria 3411
1029 Ga0495585_0029280 3300046492 Bacteria 3135
1030 Ga0495585_0041940 3300046492 Bacteria 2565
1031 Ga0495585_0058592 3300046492 Bacteria 2124
1032 Ga0495585_0092763 3300046492 Bacteria 1625
1033 Ga0495585_0113717 3300046492 Bacteria 1437
1034 Ga0495585_0189373 3300046492 Bacteria 1053
1035 Ga0495585_0217815 3300046492 Bacteria 964
1036 Ga0495585_0377688 3300046492 Bacteria 685
1037 Ga0495585_0554786 3300046492 Bacteria 542
1038 Ga0495594_0025128 3300046499 Bacteria 3201
1039 Ga0495594_0051651 3300046499 Bacteria 2262
1040 Ga0495594_0107383 3300046499 Bacteria 1572
1041 Ga0495594_0306657 3300046499 Bacteria 904
1042 Ga0495596_0000270 3300046500 Bacteria 34366
1043 Ga0495596_0001876 3300046500 Bacteria 11668
1044 Ga0495596_0001991 3300046500 Bacteria 11245
1045 Ga0495596_0006043 3300046500 Bacteria 5646
1046 Ga0495596_0013973 3300046500 Bacteria 3390
1047 Ga0495596_0015363 3300046500 Bacteria 3208
1048 Ga0495596_0019543 3300046500 Bacteria 2781
1049 Ga0495596_0063271 3300046500 Bacteria 1439
1050 Ga0495596_0079667 3300046500 Bacteria 1271
1051 Ga0495607_0000842 3300046501 Bacteria 29026
1052 Ga0495607_0001791 3300046501 Bacteria 18333
1053 Ga0495607_0002436 3300046501 Bacteria 15157
1054 Ga0495607_0006283 3300046501 Bacteria 8376
1055 Ga0495607_0008025 3300046501 Bacteria 7249
1056 Ga0495607_0010917 3300046501 Bacteria 6077
1057 Ga0495607_0018599 3300046501 Bacteria 4427
1058 Ga0495607_0023678 3300046501 Bacteria 3840
1059 Ga0495607_0083828 3300046501 Bacteria 1745
1060 Ga0495607_0093779 3300046501 Bacteria 1620
1061 Ga0495607_0093985 3300046501 Bacteria 1618
1062 Ga0495607_0096950 3300046501 Bacteria 1586
1063 Ga0495607_0111651 3300046501 Bacteria 1448
1064 Ga0495607_0141005 3300046501 Bacteria 1243
1065 Ga0495607_0215458 3300046501 Bacteria 942
1066 Ga0495607_0455918 3300046501 Bacteria 573
1067 Ga0495583_0000016 3300046506 Bacteria 312691
1068 Ga0495583_0000075 3300046506 Bacteria 177074
1069 Ga0495583_0000194 3300046506 Bacteria 101824
1070 Ga0495583_0000284 3300046506 Bacteria 81053
1071 Ga0495583_0000783 3300046506 Bacteria 39666
1072 Ga0495583_0001150 3300046506 Bacteria 28793
1073 Ga0495583_0005291 3300046506 Bacteria 8824
1074 Ga0495583_0005830 3300046506 Bacteria 8223
1075 Ga0495583_0005871 3300046506 Bacteria 8181
1076 Ga0495583_0012206 3300046506 Bacteria 4878
1077 Ga0495583_0019843 3300046506 Bacteria 3498
1078 Ga0495583_0023530 3300046506 Bacteria 3114
1079 Ga0495606_0000077 3300046507 Bacteria 166824
1080 Ga0495606_0000133 3300046507 Bacteria 126345
1081 Ga0495606_0000474 3300046507 Bacteria 65914
1082 Ga0495606_0001180 3300046507 Bacteria 36859
1083 Ga0495606_0001442 3300046507 Bacteria 31886
1084 Ga0495606_0006254 3300046507 Bacteria 11053
1085 Ga0495606_0006540 3300046507 Bacteria 10719
1086 Ga0495606_0010878 3300046507 Bacteria 7492
1087 Ga0495606_0016609 3300046507 Bacteria 5603
1088 Ga0495606_0022834 3300046507 Bacteria 4546
1089 Ga0495606_0027155 3300046507 Bacteria 4065
1090 Ga0495606_0062093 3300046507 Bacteria 2386
1091 Ga0495606_0287324 3300046507 Bacteria 896
1092 Ga0495606_0355959 3300046507 Bacteria 775
1093 Ga0495606_0442077 3300046507 Bacteria 668
1094 Ga0495608_0747823 3300046511 Bacteria 579
1095 Ga0495610_0000038 3300046512 Bacteria 181669
1096 Ga0495610_0001086 3300046512 Bacteria 24866
1097 Ga0495610_0009405 3300046512 Bacteria 6187
1098 Ga0495610_0016768 3300046512 Bacteria 4204
1099 Ga0495610_0033904 3300046512 Bacteria 2634
1100 Ga0495610_0043657 3300046512 Bacteria 2231
1101 Ga0495610_0078844 3300046512 Bacteria 1517
1102 Ga0495610_0095798 3300046512 Bacteria 1337
1103 Ga0495616_0000048 3300046513 Bacteria 108577
1104 Ga0495616_0002015 3300046513 Bacteria 13670
1105 Ga0495616_0004259 3300046513 Bacteria 9046
1106 Ga0495616_0006556 3300046513 Bacteria 7028
1107 Ga0495616_0010268 3300046513 Bacteria 5427
1108 Ga0495616_0011262 3300046513 Bacteria 5133
1109 Ga0495616_0016471 3300046513 Bacteria 4091
1110 Ga0495616_0030381 3300046513 Bacteria 2840
1111 Ga0495616_0031023 3300046513 Bacteria 2803
1112 Ga0495616_0036660 3300046513 Bacteria 2529
1113 Ga0495616_0067735 3300046513 Bacteria 1734
1114 Ga0495616_0074501 3300046513 Bacteria 1635
1115 Ga0495616_0259799 3300046513 Bacteria 743
1116 Ga0495616_0292678 3300046513 Bacteria 689
1117 Ga0495616_0334098 3300046513 Bacteria 634
1118 Ga0495620_0009384 3300046515 Bacteria 5208
1119 Ga0495620_0294975 3300046515 Bacteria 616
1120 Ga0495628_0212869 3300046516 Bacteria 1453
1121 Ga0495630_0144757 3300046517 Bacteria 1807
1122 Ga0495630_0654721 3300046517 Bacteria 804
1123 Ga0495630_0891788 3300046517 Bacteria 678
1124 Ga0495631_0000684 3300046518 Bacteria 21916
1125 Ga0495631_0002923 3300046518 Bacteria 9464
1126 Ga0495631_0003899 3300046518 Bacteria 8065
1127 Ga0495631_0006452 3300046518 Bacteria 6054
1128 Ga0495631_0014808 3300046518 Bacteria 3755
1129 Ga0495631_0035930 3300046518 Bacteria 2214
1130 Ga0495631_0066285 3300046518 Bacteria 1562
1131 Ga0495631_0181683 3300046518 Bacteria 901
1132 Ga0495632_0000098 3300046519 Bacteria 88691
1133 Ga0495632_0000152 3300046519 Bacteria 71699
1134 Ga0495632_0002349 3300046519 Bacteria 14506
1135 Ga0495632_0003810 3300046519 Bacteria 10511
1136 Ga0495632_0005546 3300046519 Bacteria 8318
1137 Ga0495632_0011269 3300046519 Bacteria 5229
1138 Ga0495632_0014466 3300046519 Bacteria 4462
1139 Ga0495632_0024146 3300046519 Bacteria 3236
1140 Ga0495632_0086630 3300046519 Bacteria 1489
1141 Ga0495632_0130761 3300046519 Bacteria 1168
1142 Ga0495637_0000013 3300046520 Bacteria 244837
1143 Ga0495637_0003644 3300046520 Bacteria 8158
1144 Ga0495637_0012166 3300046520 Bacteria 4120
1145 Ga0495637_0015193 3300046520 Bacteria 3615
1146 Ga0495637_0022638 3300046520 Bacteria 2864
1147 Ga0495637_0035358 3300046520 Bacteria 2182
1148 Ga0495643_0000115 3300046522 Bacteria 130423
1149 Ga0495643_0000204 3300046522 Bacteria 92222
1150 Ga0495643_0000206 3300046522 Bacteria 91463
1151 Ga0495643_0005635 3300046522 Bacteria 8400
1152 Ga0495643_0008875 3300046522 Bacteria 6322
1153 Ga0495643_0010126 3300046522 Bacteria 5815
1154 Ga0495643_0020187 3300046522 Bacteria 3847
1155 Ga0495643_0032309 3300046522 Bacteria 2906
1156 Ga0495643_0032526 3300046522 Bacteria 2895
1157 Ga0495643_0052450 3300046522 Bacteria 2190
1158 Ga0495643_0062241 3300046522 Bacteria 1976
1159 Ga0495643_0121146 3300046522 Bacteria 1321
1160 Ga0495643_0293703 3300046522 Bacteria 743
1161 Ga0495644_0006682 3300046523 Bacteria 4467
1162 Ga0495644_0010702 3300046523 Bacteria 3533
1163 Ga0495644_0012933 3300046523 Bacteria 3208
1164 Ga0495644_0025704 3300046523 Bacteria 2234
1165 Ga0495644_0043410 3300046523 Bacteria 1692
1166 Ga0495644_0051930 3300046523 Bacteria 1539
1167 Ga0495644_0062795 3300046523 Bacteria 1396
1168 Ga0495648_0000089 3300046524 Bacteria 115026
1169 Ga0495648_0000091 3300046524 Bacteria 113822
1170 Ga0495648_0000353 3300046524 Bacteria 50659
1171 Ga0495648_0001746 3300046524 Bacteria 21012
1172 Ga0495648_0010945 3300046524 Bacteria 6879
1173 Ga0495648_0019012 3300046524 Bacteria 4845
1174 Ga0495648_0023916 3300046524 Bacteria 4172
1175 Ga0495648_0032254 3300046524 Bacteria 3440
1176 Ga0495648_0034766 3300046524 Bacteria 3275
1177 Ga0495648_0041778 3300046524 Bacteria 2892
1178 Ga0495648_0076691 3300046524 Bacteria 1918
1179 Ga0495648_0117986 3300046524 Bacteria 1431
1180 Ga0495648_0158085 3300046524 Bacteria 1175
1181 Ga0495648_0177032 3300046524 Bacteria 1088
1182 Ga0495648_0295370 3300046524 Bacteria 761
1183 Ga0495648_0354105 3300046524 Bacteria 669
1184 Ga0495663_0178770 3300046525 Bacteria 734
1185 Ga0495663_0348303 3300046525 Bacteria 539
1186 Ga0495666_0000042 3300046526 Bacteria 47032
1187 Ga0495666_0000406 3300046526 Bacteria 18977
1188 Ga0495666_0066514 3300046526 Bacteria 1718
1189 Ga0495666_0218832 3300046526 Bacteria 872
1190 Ga0495642_0004297 3300046528 Bacteria 5538
1191 Ga0495642_0004327 3300046528 Bacteria 5515
1192 Ga0495642_0005729 3300046528 Bacteria 4766
1193 Ga0495642_0005832 3300046528 Bacteria 4725
1194 Ga0495642_0032927 3300046528 Bacteria 2082
1195 Ga0495642_0141799 3300046528 Bacteria 1037
1196 Ga0495642_0191297 3300046528 Bacteria 891
1197 Ga0495642_0220331 3300046528 Bacteria 828
1198 Ga0495642_0384232 3300046528 Bacteria 618
1199 Ga0495652_0008927 3300046529 Bacteria 9122
1200 Ga0495652_0644009 3300046529 Bacteria 718
1201 Ga0495652_0692160 3300046529 Bacteria 687
1202 Ga0495654_0000047 3300046530 Bacteria 147597
1203 Ga0495654_0010498 3300046530 Bacteria 5037
1204 Ga0495654_0047709 3300046530 Bacteria 2104
1205 Ga0495654_0054606 3300046530 Bacteria 1937
1206 Ga0495654_0108211 3300046530 Bacteria 1271
1207 Ga0495654_0164605 3300046530 Bacteria 971
1208 Ga0495665_0011224 3300046531 Bacteria 4851
1209 Ga0495665_0020612 3300046531 Bacteria 3539
1210 Ga0495665_0351615 3300046531 Bacteria 750
1211 Ga0495665_0430889 3300046531 Bacteria 667
1212 Ga0495640_0563530 3300046533 Bacteria 690
1213 Ga0495586_0003306 3300046535 Bacteria 8645
1214 Ga0495586_0029130 3300046535 Bacteria 2955
1215 Ga0495586_0041477 3300046535 Bacteria 2478
1216 Ga0495586_0068372 3300046535 Bacteria 1937
1217 Ga0495587_0025272 3300046536 Bacteria 3629
1218 Ga0495587_0222801 3300046536 Bacteria 1063
1219 Ga0495609_0000022 3300046538 Bacteria 279488
1220 Ga0495609_0000482 3300046538 Bacteria 31993
1221 Ga0495609_0000525 3300046538 Bacteria 30623
1222 Ga0495609_0000817 3300046538 Bacteria 23240
1223 Ga0495609_0004242 3300046538 Bacteria 7918
1224 Ga0495609_0011455 3300046538 Bacteria 4222
1225 Ga0495609_0015753 3300046538 Bacteria 3534
1226 Ga0495609_0027835 3300046538 Bacteria 2581
1227 Ga0495609_0040439 3300046538 Bacteria 2098
1228 Ga0495609_0045080 3300046538 Bacteria 1976
1229 Ga0495609_0064246 3300046538 Bacteria 1619
1230 Ga0495609_0092309 3300046538 Bacteria 1316
1231 Ga0495609_0129507 3300046538 Bacteria 1081
1232 Ga0495609_0212564 3300046538 Bacteria 805
1233 Ga0495621_0003510 3300046539 Bacteria 4327
1234 Ga0495597_0000104 3300046542 Bacteria 75532
1235 Ga0495597_0000246 3300046542 Bacteria 49396
1236 Ga0495597_0000771 3300046542 Bacteria 25342
1237 Ga0495597_0000806 3300046542 Bacteria 24735
1238 Ga0495597_0004134 3300046542 Bacteria 8071
1239 Ga0495597_0004503 3300046542 Bacteria 7633
1240 Ga0495597_0051448 3300046542 Bacteria 1816
1241 Ga0495597_0218038 3300046542 Bacteria 758
1242 Ga0495645_0519153 3300046543 Bacteria 742
1243 Ga0495622_0000015 3300046557 Bacteria 179054
1244 Ga0495622_0000598 3300046557 Bacteria 21004
1245 Ga0495622_0003085 3300046557 Bacteria 7901
1246 Ga0495622_0027127 3300046557 Bacteria 2673
1247 Ga0495622_0178754 3300046557 Bacteria 952
1248 Ga0495633_0000110 3300046558 Bacteria 110302
1249 Ga0495633_0000189 3300046558 Bacteria 80465
1250 Ga0495633_0000253 3300046558 Bacteria 63420
1251 Ga0495633_0003539 3300046558 Bacteria 10342
1252 Ga0495633_0004049 3300046558 Bacteria 9473
1253 Ga0495633_0005097 3300046558 Bacteria 8158
1254 Ga0495633_0006064 3300046558 Bacteria 7247
1255 Ga0495633_0019372 3300046558 Bacteria 3443
1256 Ga0495633_0024369 3300046558 Bacteria 2991
1257 Ga0495633_0027835 3300046558 Bacteria 2759
1258 Ga0495633_0045331 3300046558 Bacteria 2082
1259 Ga0495633_0053117 3300046558 Bacteria 1907
1260 Ga0495633_0058702 3300046558 Bacteria 1805
1261 Ga0495633_0077901 3300046558 Bacteria 1543
1262 Ga0495633_0186950 3300046558 Bacteria 953
1263 Ga0495667_0409249 3300046559 Bacteria 854
1264 Ga0495656_0046421 3300046615 Bacteria 1838
1265 Ga0495656_0295828 3300046615 Bacteria 828
1266 Ga0495656_0413918 3300046615 Bacteria 706
1267 Ga0495656_0542329 3300046615 Bacteria 619
1268 Ga0495656_0543884 3300046615 Bacteria 618
1269 Ga0495668_0000064 3300046616 Bacteria 180583
1270 Ga0495668_0000131 3300046616 Bacteria 112755
1271 Ga0495668_0000245 3300046616 Bacteria 77566
1272 Ga0495668_0000434 3300046616 Bacteria 53950
1273 Ga0495668_0001415 3300046616 Bacteria 23352
1274 Ga0495668_0001765 3300046616 Bacteria 19790
1275 Ga0495668_0005921 3300046616 Bacteria 8133
1276 Ga0495668_0006701 3300046616 Bacteria 7502
1277 Ga0495668_0037092 3300046616 Bacteria 2729
1278 Ga0495668_0112999 3300046616 Bacteria 1485
1279 Ga0495668_0181098 3300046616 Bacteria 1154
1280 Ga0495668_0574453 3300046616 Bacteria 622
1281 Ga0495668_0642286 3300046616 Bacteria 586
1282 Ga0495634_0006153 3300046642 Bacteria 9139
1283 Ga0495634_0420950 3300046642 Bacteria 791
1284 Ga0495611_0003458 3300046648 Bacteria 6962
1285 Ga0495611_0008445 3300046648 Bacteria 4360
1286 Ga0495611_0016209 3300046648 Bacteria 3185
1287 Ga0495611_0024536 3300046648 Bacteria 2623
1288 Ga0495625_0000188 3300046660 Bacteria 97649
1289 Ga0495625_0001292 3300046660 Bacteria 31449
1290 Ga0495625_0001624 3300046660 Bacteria 26504
1291 Ga0495625_0011006 3300046660 Bacteria 7423
1292 Ga0495625_0011060 3300046660 Bacteria 7395
1293 Ga0495625_0023122 3300046660 Bacteria 4751
1294 Ga0495625_0051373 3300046660 Bacteria 2955
1295 Ga0495625_0093430 3300046660 Bacteria 2077
1296 Ga0495625_0138509 3300046660 Bacteria 1643
1297 Ga0495625_0140960 3300046660 Bacteria 1626
1298 Ga0495625_0175871 3300046660 Bacteria 1426
1299 Ga0495625_0179402 3300046660 Bacteria 1409
1300 Ga0495625_0454015 3300046660 Bacteria 791
1301 Ga0495625_0463659 3300046660 Bacteria 780
1302 Ga0495635_0005244 3300046663 Bacteria 9016
1303 Ga0495659_0000679 3300046664 Bacteria 12343
1304 Ga0495659_0001640 3300046664 Bacteria 7513
1305 Ga0495661_0000502 3300046665 Bacteria 40792
1306 Ga0495661_0001265 3300046665 Bacteria 21757
1307 Ga0495661_0005726 3300046665 Bacteria 8799
1308 Ga0495661_0009038 3300046665 Bacteria 6857
1309 Ga0495661_0015856 3300046665 Bacteria 5016
1310 Ga0495661_0027532 3300046665 Bacteria 3647
1311 Ga0495661_0031420 3300046665 Bacteria 3370
1312 Ga0495661_0035252 3300046665 Bacteria 3141
1313 Ga0495661_0043898 3300046665 Bacteria 2744
1314 Ga0495661_0049104 3300046665 Bacteria 2560
1315 Ga0495661_0083814 3300046665 Bacteria 1831
1316 Ga0495661_0087827 3300046665 Bacteria 1776
1317 Ga0495661_0089152 3300046665 Bacteria 1759
1318 Ga0495661_0104665 3300046665 Bacteria 1586
1319 Ga0495661_0105438 3300046665 Bacteria 1578
1320 Ga0495661_0112456 3300046665 Bacteria 1515
1321 Ga0495661_0123683 3300046665 Bacteria 1425
1322 Ga0495661_0210079 3300046665 Bacteria 1014
1323 Ga0495661_0401328 3300046665 Bacteria 666
1324 Ga0495661_0437020 3300046665 Bacteria 631
1325 Ga0495588_0000148 3300046674 Bacteria 100600
1326 Ga0495588_0017071 3300046674 Bacteria 3518
1327 Ga0495588_0074754 3300046674 Bacteria 1764
1328 Ga0495588_0081574 3300046674 Bacteria 1688
1329 Ga0495588_0151054 3300046674 Bacteria 1227
1330 Ga0495599_0420424 3300046678 Bacteria 794
1331 Ga0495623_0023548 3300046679 Bacteria 3974
1332 Ga0495623_0030990 3300046679 Bacteria 3440
1333 Ga0495623_0033544 3300046679 Bacteria 3294
1334 Ga0495647_0082352 3300046681 Bacteria 1307
1335 Ga0495658_0678181 3300046683 Bacteria 660
1336 Ga0495669_0000355 3300046684 Bacteria 23402
1337 Ga0495669_0001964 3300046684 Bacteria 8448
1338 Ga0495669_0007315 3300046684 Bacteria 4625
1339 Ga0495669_0016714 3300046684 Bacteria 3145
1340 Ga0495669_0027926 3300046684 Bacteria 2469
1341 Ga0495613_0009841 3300046689 Bacteria 7111
1342 Ga0495613_0232461 3300046689 Bacteria 1291
1343 Ga0495613_0890572 3300046689 Bacteria 576
1344 Ga0495624_0018263 3300046690 Bacteria 4691
1345 Ga0495670_0003213 3300046691 Bacteria 8042
1346 Ga0495670_0011444 3300046691 Bacteria 4364
1347 Ga0495670_0030214 3300046691 Bacteria 2691
1348 Ga0495670_0086312 3300046691 Bacteria 1602
1349 Ga0495670_0108500 3300046691 Bacteria 1435
1350 Ga0495670_0156969 3300046691 Bacteria 1194
1351 Ga0495670_0374453 3300046691 Bacteria 768
1352 Ga0495670_0421203 3300046691 Bacteria 722
1353 Ga0495670_0440460 3300046691 Bacteria 706
1354 Ga0495670_0562660 3300046691 Bacteria 620
1355 Ga0495671_0000044 3300046692 Bacteria 160337
1356 Ga0495671_0000426 3300046692 Bacteria 33503
1357 Ga0495671_0019650 3300046692 Bacteria 3566
1358 Ga0495671_0028581 3300046692 Bacteria 2871
1359 Ga0495671_0038152 3300046692 Bacteria 2428
1360 Ga0495671_0073066 3300046692 Bacteria 1683
1361 Ga0495671_0290865 3300046692 Bacteria 786
1362 Ga0495671_0312540 3300046692 Bacteria 755
1363 Ga0495649_0000806 3300046694 Bacteria 25272
1364 Ga0495649_0005148 3300046694 Bacteria 8387
1365 Ga0495649_0019253 3300046694 Bacteria 3835
1366 Ga0495649_0040661 3300046694 Bacteria 2544
1367 Ga0495649_0102632 3300046694 Bacteria 1519
1368 Ga0495649_0110028 3300046694 Bacteria 1461
1369 Ga0495649_0218377 3300046694 Bacteria 986
1370 Ga0495649_0337019 3300046694 Bacteria 763
1371 Ga0495649_0480981 3300046694 Bacteria 618
1372 Ga0495589_0000017 3300046794 Bacteria 206113
1373 Ga0495589_0000508 3300046794 Bacteria 27530
1374 Ga0495589_0006901 3300046794 Bacteria 5969
1375 Ga0495589_0009727 3300046794 Bacteria 4995
1376 Ga0495589_0015977 3300046794 Bacteria 3859
1377 Ga0495589_0049188 3300046794 Bacteria 2086
1378 Ga0495589_0052782 3300046794 Bacteria 2007
1379 Ga0495589_0091798 3300046794 Bacteria 1474
1380 Ga0495600_0123284 3300046809 Bacteria 1685
1381 Ga0495660_0000162 3300046810 Bacteria 71874
1382 Ga0495660_0000403 3300046810 Bacteria 37269
1383 Ga0495660_0005437 3300046810 Bacteria 7627
1384 Ga0495660_0007545 3300046810 Bacteria 6385
1385 Ga0495660_0015676 3300046810 Bacteria 4376
1386 Ga0495660_0021946 3300046810 Bacteria 3650
1387 Ga0495660_0023195 3300046810 Bacteria 3541
1388 Ga0495660_0035577 3300046810 Bacteria 2781
1389 Ga0495660_0086023 3300046810 Bacteria 1641
1390 Ga0495660_0139169 3300046810 Bacteria 1209
1391 Ga0495660_0261881 3300046810 Bacteria 798
1392 Ga0495660_0314563 3300046810 Bacteria 705
1393 Ga0495660_0429093 3300046810 Bacteria 574
1394 Ga0495581_0027074 3300047315 Bacteria 3325
1395 Ga0495581_0068577 3300047315 Bacteria 2050
1396 Ga0495581_0138604 3300047315 Bacteria 1418
1397 Ga0495581_0351395 3300047315 Bacteria 860
1398 Ga0495604_0006708 3300047317 Bacteria 9127
1399 Ga0495604_0044087 3300047317 Bacteria 3488
1400 Ga0495604_0150900 3300047317 Bacteria 1651
1401 Ga0495604_0349592 3300047317 Bacteria 982
1402 Ga0495636_0005184 3300047318 Bacteria 5111
1403 Ga0495636_0050921 3300047318 Bacteria 1734
1404 Ga0495636_0163907 3300047318 Bacteria 1002
1405 Ga0495636_0339180 3300047318 Bacteria 708
1406 Ga0495674_0006559 3300047319 Bacteria 11166
1407 Ga0495672_0000111 3300047320 Bacteria 130829
1408 Ga0495672_0000142 3300047320 Bacteria 105843
1409 Ga0495672_0000152 3300047320 Bacteria 100381
1410 Ga0495672_0000167 3300047320 Bacteria 95937
1411 Ga0495672_0000559 3300047320 Bacteria 42288
1412 Ga0495672_0000581 3300047320 Bacteria 41296
1413 Ga0495672_0038378 3300047320 Bacteria 2922
1414 Ga0495672_0070711 3300047320 Bacteria 1976
1415 Ga0495672_0075445 3300047320 Bacteria 1896
1416 Ga0495672_0097259 3300047320 Bacteria 1603
1417 Ga0495676_0000123 3300047321 Bacteria 59710
1418 Ga0495676_0069412 3300047321 Bacteria 2719
1419 Ga0495676_0588180 3300047321 Bacteria 725
1420 Ga0495680_0007799 3300047322 Bacteria 9775
1421 Ga0495680_0060600 3300047322 Bacteria 2916
1422 Ga0495683_0000069 3300047323 Bacteria 110339
1423 Ga0495683_0000098 3300047323 Bacteria 88510
1424 Ga0495683_0002101 3300047323 Bacteria 12334
1425 Ga0495683_0014744 3300047323 Bacteria 4072
1426 Ga0495683_0019856 3300047323 Bacteria 3466
1427 Ga0495683_0026681 3300047323 Bacteria 2955
1428 Ga0495683_0044801 3300047323 Bacteria 2225
1429 Ga0495683_0046896 3300047323 Bacteria 2169
1430 Ga0495683_0068070 3300047323 Bacteria 1752
1431 Ga0495683_0116851 3300047323 Bacteria 1269
1432 Ga0495687_000113 3300047443 Bacteria 123712
1433 Ga0495687_000140 3300047443 Bacteria 109311
1434 Ga0495687_000175 3300047443 Bacteria 94911
1435 Ga0495687_000236 3300047443 Bacteria 76970
1436 Ga0495687_002221 3300047443 Bacteria 16034
1437 Ga0495687_007947 3300047443 Bacteria 6160
1438 Ga0495687_010281 3300047443 Bacteria 5141
1439 Ga0495687_044949 3300047443 Bacteria 1915
1440 Ga0495675_0012446 3300047444 Bacteria 5355
1441 Ga0495675_0109769 3300047444 Bacteria 1722
1442 Ga0495675_0113683 3300047444 Bacteria 1688
1443 Ga0495675_0200665 3300047444 Bacteria 1214
1444 Ga0495677_0000002 3300047445 Bacteria 346767
1445 Ga0495677_0000079 3300047445 Bacteria 49339
1446 Ga0495677_0000140 3300047445 Bacteria 34650
1447 Ga0495677_0000530 3300047445 Bacteria 15886
1448 Ga0495677_0002486 3300047445 Bacteria 7231
1449 Ga0495677_0004215 3300047445 Bacteria 5543
1450 Ga0495677_0005141 3300047445 Bacteria 4980
1451 Ga0495677_0006745 3300047445 Bacteria 4319
1452 Ga0495677_0056288 3300047445 Bacteria 1452
1453 Ga0495677_0100590 3300047445 Bacteria 1094
1454 Ga0495679_009955 3300047446 Bacteria 3766
1455 Ga0495679_011673 3300047446 Bacteria 3375
1456 Ga0495679_021210 3300047446 Bacteria 2248
1457 Ga0495679_034304 3300047446 Bacteria 1616
1458 Ga0495679_041740 3300047446 Bacteria 1418
1459 Ga0495679_048811 3300047446 Bacteria 1278
1460 Ga0495679_058770 3300047446 Bacteria 1133
1461 Ga0495679_173340 3300047446 Bacteria 573
1462 Ga0495685_000035 3300047447 Bacteria 55942
1463 Ga0495685_007306 3300047447 Bacteria 3644
1464 Ga0495685_017962 3300047447 Bacteria 2423
1465 Ga0495685_040764 3300047447 Bacteria 1587
1466 Ga0495685_068902 3300047447 Bacteria 1187
1467 Ga0495673_0000060 3300047469 Bacteria 231642
1468 Ga0495673_0000085 3300047469 Bacteria 193245
1469 Ga0495673_0000149 3300047469 Bacteria 122863
1470 Ga0495673_0002074 3300047469 Bacteria 14639
1471 Ga0495673_0011481 3300047469 Bacteria 4760
1472 Ga0495673_0138910 3300047469 Bacteria 949
1473 Ga0495681_0000824 3300047470 Bacteria 23910
1474 Ga0495681_0008558 3300047470 Bacteria 6401
1475 Ga0495681_0012074 3300047470 Bacteria 5094
1476 Ga0495681_0022943 3300047470 Bacteria 3327
1477 Ga0495681_0037046 3300047470 Bacteria 2406
1478 Ga0495681_0069635 3300047470 Bacteria 1597
1479 Ga0495681_0071377 3300047470 Bacteria 1572
1480 Ga0495681_0132533 3300047470 Bacteria 1059
1481 Ga0495686_0000169 3300047472 Bacteria 123511
1482 Ga0495686_0001301 3300047472 Bacteria 28115
1483 Ga0495686_0001456 3300047472 Bacteria 25789
1484 Ga0495686_0022113 3300047472 Bacteria 4210
1485 Ga0495686_0045233 3300047472 Bacteria 2785
1486 Ga0495686_0051556 3300047472 Bacteria 2581
1487 Ga0495686_0063418 3300047472 Bacteria 2290
1488 Ga0495686_0176616 3300047472 Bacteria 1239
1489 Ga0495686_0193354 3300047472 Bacteria 1171
1490 Ga0495686_0640205 3300047472 Bacteria 547
1491 Ga0495593_0007070 3300047673 Bacteria 6583
1492 Ga0495593_0027236 3300047673 Bacteria 3148
1493 Ga0495593_0334876 3300047673 Bacteria 756
1494 Ga0495602_0013704 3300048088 Bacteria 8268
1495 Ga0495602_0038029 3300048088 Bacteria 4456
1496 Ga0495602_1165652 3300048088 Bacteria 503
1497 Ga0495614_0005675 3300048089 Bacteria 5625
1498 Ga0495614_0259825 3300048089 Bacteria 796
1499 Ga0495614_0275022 3300048089 Bacteria 774
1500 Ga0495615_0251393 3300048090 Bacteria 560
1501 Ga0495626_0000076 3300048091 Bacteria 131125
1502 Ga0495626_0000170 3300048091 Bacteria 80445
1503 Ga0495626_0000882 3300048091 Bacteria 26543
1504 Ga0495626_0002487 3300048091 Bacteria 12748
1505 Ga0495626_0014577 3300048091 Bacteria 4049
1506 Ga0495626_0016369 3300048091 Bacteria 3768
1507 Ga0495626_0018299 3300048091 Bacteria 3521
1508 Ga0495626_0020538 3300048091 Bacteria 3288
1509 Ga0495626_0055268 3300048091 Bacteria 1820
1510 Ga0495626_0063415 3300048091 Bacteria 1676
1511 Ga0495626_0077862 3300048091 Bacteria 1477
1512 Ga0495626_0086070 3300048091 Bacteria 1389
1513 Ga0495626_0102698 3300048091 Bacteria 1245
1514 Ga0495626_0240270 3300048091 Bacteria 729
1515 Ga0495626_0294420 3300048091 Bacteria 642
1516 Ga0496100_0008425 3300048903 Bacteria 5749
1517 Ga0496100_0091449 3300048903 Bacteria 2077
1518 Ga0496100_0425875 3300048903 Bacteria 1014
1519 Ga0496101_0119689 3300048904 Bacteria 1989
1520 Ga0496101_0407770 3300048904 Bacteria 1071
1521 Ga0496101_0818837 3300048904 Bacteria 734
1522 Ga0496102_0000156 3300048905 Bacteria 92538
1523 Ga0496102_0026637 3300048905 Bacteria 5160
1524 Ga0496102_0035916 3300048905 Bacteria 4463
1525 Ga0496102_0040492 3300048905 Bacteria 4215
1526 Ga0496102_0241353 3300048905 Bacteria 1704
1527 Ga0496102_1601529 3300048905 Bacteria 569
1528 Ga0496103_0001871 3300048906 Bacteria 13677
1529 Ga0496103_0050964 3300048906 Bacteria 2561
1530 Ga0496103_0314841 3300048906 Bacteria 1007
1531 Ga0496103_0481771 3300048906 Bacteria 795
1532 Ga0496103_0685025 3300048906 Bacteria 650
1533 Ga0496104_0031258 3300048907 Bacteria 4951
1534 Ga0496104_0145130 3300048907 Bacteria 2279
1535 Ga0496104_0308104 3300048907 Bacteria 1496
1536 Ga0496104_0772260 3300048907 Bacteria 867
1537 Ga0496105_0086137 3300048908 Bacteria 2596
1538 Ga0496105_0115503 3300048908 Bacteria 2214
1539 Ga0496105_0277813 3300048908 Bacteria 1351
1540 Ga0496105_0336785 3300048908 Bacteria 1207
1541 Ga0496105_1046679 3300048908 Bacteria 608
1542 Ga0496106_0092083 3300048909 Bacteria 2341
1543 Ga0496106_0163178 3300048909 Bacteria 1763
1544 Ga0496106_0206902 3300048909 Bacteria 1562
1545 Ga0496106_0758867 3300048909 Bacteria 771
1546 Ga0496106_1265917 3300048909 Bacteria 573
1547 Ga0496107_0145371 3300048910 Bacteria 1753
1548 Ga0496107_0186240 3300048910 Bacteria 1542
1549 Ga0496107_0496247 3300048910 Bacteria 906
1550 Ga0496107_0705493 3300048910 Bacteria 742
1551 Ga0496108_0148228 3300048911 Bacteria 2024
1552 Ga0496108_0489275 3300048911 Bacteria 1075
1553 Ga0496108_1235550 3300048911 Bacteria 631
1554 Ga0496108_1759002 3300048911 Bacteria 509
1555 Ga0496109_0061400 3300048912 Bacteria 3436
1556 Ga0496109_0103067 3300048912 Bacteria 2648
1557 Ga0496109_0161761 3300048912 Bacteria 2097
1558 Ga0496109_0202296 3300048912 Bacteria 1867
1559 Ga0496109_0713198 3300048912 Bacteria 941
1560 Ga0496110_0015273 3300048913 Bacteria 6387
1561 Ga0496110_0317709 3300048913 Bacteria 1418
1562 Ga0496110_0759304 3300048913 Bacteria 873
1563 Ga0496110_1197560 3300048913 Bacteria 668
1564 Ga0496111_0133500 3300048914 Bacteria 1838
1565 Ga0496111_0403271 3300048914 Bacteria 1010
1566 Ga0496112_0059576 3300048915 Bacteria 3762
1567 Ga0496113_0040930 3300048916 Bacteria 3417
1568 Ga0496113_0050671 3300048916 Bacteria 3096
1569 Ga0496113_0065917 3300048916 Bacteria 2741
1570 Ga0496113_0358311 3300048916 Bacteria 1170
1571 Ga0496113_0375616 3300048916 Bacteria 1141
1572 Ga0496114_0005419 3300048917 Bacteria 9979
1573 Ga0496114_0017437 3300048917 Bacteria 5796
1574 Ga0496114_0065449 3300048917 Bacteria 3046
1575 Ga0496114_0517560 3300048917 Bacteria 1055
1576 Ga0496115_0031336 3300048918 Bacteria 4190
1577 Ga0496115_0118488 3300048918 Bacteria 2177
1578 Ga0496115_0169903 3300048918 Bacteria 1803
1579 Ga0496115_0189893 3300048918 Bacteria 1697
1580 Ga0496115_0502819 3300048918 Bacteria 974
1581 Ga0496115_0712322 3300048918 Bacteria 788
1582 Ga0496116_0026975 3300048919 Bacteria 4188
1583 Ga0496116_0075945 3300048919 Bacteria 2107
1584 Ga0496116_0207566 3300048919 Bacteria 1018
1585 Ga0496117_0000011 3300048920 Bacteria 610930
1586 Ga0496117_0389840 3300048920 Bacteria 706
1587 Ga0496118_0000010 3300048921 Bacteria 610930
1588 Ga0496118_0402302 3300048921 Bacteria 711
1589 Ga0496120_0055568 3300048923 Bacteria 2238
1590 Ga0496121_0014685 3300048924 Bacteria 8279
1591 Ga0496121_0020684 3300048924 Bacteria 6493
1592 Ga0496121_0072058 3300048924 Bacteria 2775
1593 Ga0496121_0089685 3300048924 Bacteria 2406
1594 Ga0496121_0091909 3300048924 Bacteria 2367
1595 Ga0496121_0537109 3300048924 Bacteria 734
1596 Ga0496122_0000653 3300048925 Bacteria 70150
1597 Ga0496122_0000691 3300048925 Bacteria 67209
1598 Ga0496122_0055165 3300048925 Bacteria 2976
1599 Ga0496122_0059591 3300048925 Bacteria 2817
1600 Ga0496123_0000196 3300048926 Bacteria 122955
1601 Ga0496123_0003602 3300048926 Bacteria 17162
1602 Ga0496123_0008397 3300048926 Bacteria 9492
1603 Ga0496123_0023456 3300048926 Bacteria 4721
1604 Ga0496123_0362392 3300048926 Bacteria 671
1605 Ga0496124_0001079 3300048927 Bacteria 43104
1606 Ga0496124_0007424 3300048927 Bacteria 11656
1607 Ga0496124_0047741 3300048927 Bacteria 3661
1608 Ga0496124_0280248 3300048927 Bacteria 1216
1609 Ga0496124_0295836 3300048927 Bacteria 1172
1610 Ga0496124_0342286 3300048927 Bacteria 1061
1611 Ga0496125_0003108 3300048928 Bacteria 20666
1612 Ga0496125_0052257 3300048928 Bacteria 3361
1613 Ga0496125_0052557 3300048928 Bacteria 3349
1614 Ga0496125_0200621 3300048928 Bacteria 1306
1615 Ga0496126_0011408 3300048929 Bacteria 9204
1616 Ga0496126_0324301 3300048929 Bacteria 1265
1617 Ga0496126_0565907 3300048929 Bacteria 900
1618 Ga0501306_031055 3300049127 Bacteria 794
1619 Ga0501308_012646 3300049128 Bacteria 967
1620 Ga0501304_014766 3300049160 Bacteria 726
1621 Ga0501304_017110 3300049160 Bacteria 691
1622 Ga0495678_000001 3300049459 Bacteria 1060340
1623 Ga0495678_000458 3300049459 Bacteria 40497
1624 Ga0495678_000745 3300049459 Bacteria 29532
1625 Ga0495678_001248 3300049459 Bacteria 20698
1626 Ga0495678_013374 3300049459 Bacteria 3856
1627 Ga0495678_016943 3300049459 Bacteria 3314
1628 Ga0495678_018139 3300049459 Bacteria 3171
1629 Ga0495678_055256 3300049459 Bacteria 1516
1630 Ga0495682_0002062 3300049460 Bacteria 9827
1631 Ga0495682_0002194 3300049460 Bacteria 9446
1632 Ga0495682_0003012 3300049460 Bacteria 7672
1633 Ga0495682_0036004 3300049460 Bacteria 1822
1634 Ga0501291_003206 3300049514 Bacteria 2022
1635 Ga0501297_008226 3300049520 Bacteria 1146
1636 Ga0501300_011751 3300049523 Bacteria 1275
1637 Ga0501301_018626 3300049524 Bacteria 649
1638 Ga0501303_017177 3300049526 Bacteria 739
1639 Ga0501314_002322 3300049530 Bacteria 1459
1640 Ga0501315_060558 3300049531 Bacteria 612
1641 Ga0501324_026192 3300049540 Bacteria 618
1642 Ga0501036_0833410 3300049572 Bacteria 759
1643 Ga0501041_0447632 3300049577 Bacteria 820
1644 Ga0501041_0955430 3300049577 Bacteria 551
1645 Ga0501198_000020 3300049649 Bacteria 75919
1646 Ga0501202_077752 3300049652 Bacteria 775
1647 Ga0501210_006741 3300049657 Bacteria 849
1648 Ga0501211_000342 3300049658 Bacteria 4336
1649 Ga0501222_000025 3300049662 Bacteria 64191
1650 Ga0501222_001535 3300049662 Bacteria 3221
1651 Ga0501222_008087 3300049662 Bacteria 1398
1652 Ga0501223_007317 3300049663 Bacteria 2262
1653 Ga0501227_060815 3300049665 Bacteria 968
1654 Ga0501233_013732 3300049668 Bacteria 1647
1655 Ga0501235_006749 3300049669 Bacteria 2499
1656 Ga0501238_026390 3300049671 Bacteria 833
1657 Ga0501257_089156 3300049686 Bacteria 801
1658 Ga0501258_003044 3300049687 Bacteria 1514
1659 Ga0501221_019756 3300049704 Bacteria 1311
1660 Ga0501229_002483 3300049706 Bacteria 2178
1661 Ga0501079_0175184 3300049741 Bacteria 1673
1662 Ga0501262_033377 3300049759 Bacteria 748
1663 Ga0501264_014637 3300049761 Bacteria 786
1664 Ga0501266_094602 3300049763 Bacteria 523
1665 Ga0501269_001764 3300049766 Bacteria 2754
1666 Ga0501272_010980 3300049769 Bacteria 1015
1667 Ga0501283_028357 3300049779 Bacteria 929
1668 Ga0501283_059939 3300049779 Bacteria 686
1669 Ga0501035_0018470 3300049822 Bacteria 6424
1670 Ga0501044_0164982 3300049823 Bacteria 2190
1671 nmdc:mga03683_106114_c1 3300050489 Bacteria 1238
1672 nmdc:mga03683_218867_c1 3300050489 Bacteria 878
1673 nmdc:mga03n38_95341_c1 3300050490 Bacteria 1425
1674 nmdc:mga00v17_823376_c1 3300050491 Bacteria 591
1675 nmdc:mga0k408_140886_c1 3300050493 Bacteria 1435
1676 nmdc:mga0k408_167711_c1 3300050493 Bacteria 1309
1677 nmdc:mga0k408_17968_c1 3300050493 Bacteria 3942
1678 nmdc:mga0k408_215628_c1 3300050493 Bacteria 1146
1679 nmdc:mga0k408_303971_c1 3300050493 Bacteria 952
1680 nmdc:mga0k408_432820_c1 3300050493 Bacteria 782
1681 nmdc:mga0k408_471718_c1 3300050493 Bacteria 745
1682 nmdc:mga0k408_48281_c1 3300050493 Bacteria 2462
1683 nmdc:mga06z11_388436_c1 3300050494 Bacteria 839
1684 nmdc:mga07m45_216290_c1 3300050496 Bacteria 1115
1685 nmdc:mga07m45_418293_c1 3300050496 Bacteria 778
1686 nmdc:mga07m45_602165_c1 3300050496 Bacteria 635
1687 nmdc:mga07m45_70331_c1 3300050496 Bacteria 1991
1688 nmdc:mga07m45_89189_c1 3300050496 Bacteria 1766
1689 nmdc:mga07m45_9660_c1 3300050496 Bacteria 5013
1690 nmdc:mga07m45_9841_c1 3300050496 Bacteria 4973
1691 nmdc:mga09592_1296_c1 3300050508 Bacteria 20095
1692 nmdc:mga0qj67_11367_c1 3300050509 Bacteria 6669
1693 nmdc:mga0qj67_142534_c1 3300050509 Bacteria 1943
1694 nmdc:mga0rr50_1435808_c1 3300050513 Bacteria 584
1695 Ga0500635_0000077 3300053080 Bacteria 63561
1696 Ga0500635_0191967 3300053080 Bacteria 792
1697 Ga0500578_0000013 3300053086 Bacteria 185921
1698 Ga0500644_0299089 3300053088 Bacteria 688
1699 Ga0500646_0058230 3300053090 Bacteria 1130
1700 Ga0500583_0302745 3300053092 Bacteria 782
1701 Ga0500651_0021759 3300053093 Bacteria 4001
1702 Ga0500650_0276913 3300053098 Bacteria 747
1703 Ga0500557_211979 3300053105 Bacteria 619
1704 Ga0500562_031435 3300053108 Bacteria 1401
1705 Ga0500569_016845 3300053109 Bacteria 1858
1706 Ga0500594_0001239 3300053118 Bacteria 5521
1707 Ga0500594_0003144 3300053118 Bacteria 3610
1708 Ga0500607_109745 3300053121 Bacteria 1355
1709 Ga0500618_004758 3300053125 Bacteria 4249
1710 Ga0500618_006553 3300053125 Bacteria 3405
1711 Ga0500621_258815 3300053126 Bacteria 580
1712 Ga0500642_0022296 3300053130 Bacteria 2524
1713 Ga0500642_0070947 3300053130 Bacteria 1585
1714 Ga0500652_001857 3300053131 Bacteria 6377
1715 Ga0500652_193579 3300053131 Bacteria 828
1716 Ga0500658_0025758 3300053134 Bacteria 2262
1717 Ga0500559_0003197 3300053136 Bacteria 8144
1718 Ga0500559_0043745 3300053136 Bacteria 1957
1719 Ga0500559_0490266 3300053136 Bacteria 565
1720 Ga0500564_124046 3300053138 Bacteria 1123
1721 Ga0500568_0001164 3300053139 Bacteria 17590
1722 Ga0500568_0013489 3300053139 Bacteria 3723
1723 Ga0500577_0003430 3300053142 Bacteria 4117
1724 Ga0500586_007537 3300053145 Bacteria 2909
1725 Ga0500589_202111 3300053147 Bacteria 762
1726 Ga0500604_0070068 3300053151 Bacteria 1116
1727 Ga0500604_0318967 3300053151 Bacteria 539
1728 Ga0500619_000008 3300053154 Bacteria 70273
1729 Ga0500619_054905 3300053154 Bacteria 1298
1730 Ga0500622_0007164 3300053156 Bacteria 6360
1731 Ga0500622_0073705 3300053156 Bacteria 1721
1732 Ga0500636_0088358 3300053177 Bacteria 1777
1733 Ga0500636_0133130 3300053177 Bacteria 1383
1734 Ga0500584_055439 3300053726 Bacteria 1779
1735 Ga0500645_008014 3300053730 Bacteria 3639
1736 Ga0500587_000059 3300053739 Bacteria 8925
1737 Ga0500587_003765 3300053739 Bacteria 2107
1738 Ga0500587_073475 3300053739 Bacteria 541
1739 Ga0500661_003928 3300055283 Bacteria 2783
1740 Ga0587083_0075842 3300059505 Bacteria 791
1741 Ga0587098_022566 3300059604 Bacteria 811
1742 Ga0587068_010424 3300059641 Bacteria 1386
1743 Ga0466962_0002387 3300061719 Bacteria 8901
1744 Ga0466962_0033691 3300061719 Bacteria 2451
1745 Ga0466962_0046950 3300061719 Bacteria 2063
1746 Ga0466962_0664925 3300061719 Bacteria 533
1747 2587730469 2585428057 Bacteria 6737412
1748 2587736072 2585428058 Bacteria 6853932
1749 2588293334 2588253510 Bacteria 6901809
1750 2601669595 2600255292 Bacteria 6300551
1751 2643742287 2643221544 Bacteria 5886209
1752 2643800340 2643221556 Bacteria 7251154
1753 2643937108 2643221585 Bacteria 5812563
1754 2643969066 2643221592 Bacteria 6608788
1755 2644030419 2643221603 Bacteria 6147767
1756 2644139666 2643221625 Bacteria 6512927
1757 2644217914 2643221639 Bacteria 6649903
1758 2644247931 2643221644 Bacteria 6865017
1759 2644255300 2643221645 Bacteria 7207331
1760 2644258344 2643221646 Bacteria 6433402
1761 2644275402 2643221648 Bacteria 6521465
1762 2644304505 2643221654 Bacteria 5273570
1763 2644318273 2643221656 Bacteria 5809961
1764 2644341358 2643221660 Bacteria 4208257
1765 2644471880 2643221684 Bacteria 7145183
1766 2738827181 2738541297 Bacteria 6549566
1767 2739057000 2738541337 Bacteria 6183410
1768 2739150978 2738541357 Bacteria 6549408
1769 2739192897 2738543003 Bacteria 6549560
1770 2739319374 2738543026 Bacteria 6549408
1771 2739337615 2738543029 Bacteria 6549249
1772 2809142318 2808606418 Bacteria 6724496
1773 2821134538 2821131069 Bacteria 6108407
1774 2842715045 2842711865 Bacteria 7155354
1775 2857549717 2857547612 Bacteria 6179999
1776 2857557133 2857553236 Bacteria 6166726
1777 2857560562 2857558681 Bacteria 6617694
1778 2857570061 2857564685 Bacteria 6290584
1779 2885082327 2885080285 Bacteria 6355622
1780 2904430318 2904424332 Bacteria 7633521
1781 2919480887 2919476304 Bacteria 5888696
1782 2919704584 2919704043 Bacteria 5560311
1783 2932415799 2932410948 Bacteria 6312192
1784 2932421789 2932416698 Bacteria 6315112
1785 8047675198 8047673197 Bacteria 7395230
1786 Ga0395900_0000133
1787 JGI24740J21852_10016707
1788 JGI25156J39149_1000114
1789 JGI25154J39366_1002215
1790 JGI25154J39366_1003246
1791 JGI25157J39369_1000015
1792 JGI25150J39212_1014060
1793 JGI25159J45721_1006583
1794 JGI25153J46596_10017655
1795 rootH2_10058683
1796 rootL2_10031669
1797 rootH1_10010269
1798 JGI26128J50194_1000617
1799 Ga0055539_1000967
1800 Ga0055533_1000010
1801 Ga0055525_1000013
1802 Ga0055525_1000074
1803 Ga0055525_1001452
1804 Ga0055535_1006711
1805 Ga0055542_1019745
1806 Ga0055529_1000100
1807 Ga0055529_1000303
1808 Ga0055526_1000010
1809 Ga0055526_1000104
1810 Ga0055526_1000410
1811 Ga0055537_1000200
1812 Ga0055524_1000025
1813 Ga0055524_1005355
1814 Ga0055524_1008185
1815 Ga0055534_1000083
1816 Ga0055528_1000372
1817 Ga0055540_1103473
1818 Ga0055531_10000064
1819 Ga0055543_1004761
1820 Ga0055543_1049002
1821 Ga0065165_1000074
1822 Ga0065165_1000120
1823 Ga0065165_1000889
1824 Ga0065165_1005640
1825 Ga0065165_1028015
1826 Ga0065165_1032237
1827 Ga0065707_10107803
1828 Ga0070658_10026499
1829 Ga0070658_10037732
1830 Ga0070658_10141993
1831 Ga0070658_10170300
1832 Ga0070658_11384646
1833 Ga0070676_10095269
1834 Ga0070676_10155113
1835 Ga0070676_10222677
1836 Ga0070676_10366082
1837 Ga0070676_10726973
1838 Ga0070683_100005699
1839 Ga0070683_100109501
1840 Ga0070690_100001536
1841 Ga0070670_100044272
1842 Ga0070670_100045928
1843 Ga0070670_100050278
1844 Ga0070670_100156245
1845 Ga0070670_100393495
1846 Ga0070670_100811054
1847 Ga0070670_101519250
1848 Ga0070677_10007539
1849 Ga0070677_10017613
1850 Ga0070677_10226157
1851 Ga0070677_10269223
1852 Ga0068869_100036690
1853 Ga0068869_100772992
1854 Ga0068869_101050214
1855 Ga0070666_10680537
1856 Ga0070680_100016692
1857 Ga0070680_100593369
1858 Ga0070680_100815715
1859 Ga0070680_100835370
1860 Ga0070682_100050509
1861 Ga0070682_100303495
1862 Ga0068868_100078234
1863 Ga0070660_100025792
1864 Ga0070660_100061600
1865 Ga0070660_100478924
1866 Ga0070660_100806976
1867 Ga0070660_101071812
1868 Ga0070689_100674438
1869 Ga0070661_100004078
1870 Ga0070661_100038941
1871 Ga0070661_100211037
1872 Ga0070661_100542839
1873 Ga0070668_100634446
1874 Ga0070669_100014248
1875 Ga0070669_100037978
1876 Ga0070669_100106693
1877 Ga0070669_100188610
1878 Ga0070669_100264513
1879 Ga0070669_100281790
1880 Ga0070675_100002690
1881 Ga0070675_100011188
1882 Ga0070675_100048103
1883 Ga0070675_100053943
1884 Ga0070675_100104159
1885 Ga0070675_100232111
1886 Ga0070675_100256119
1887 Ga0070675_100301189
1888 Ga0070675_100617491
1889 Ga0070671_100036807
1890 Ga0070671_100038300
1891 Ga0070671_100219491
1892 Ga0070671_100358210
1893 Ga0070671_100529714
1894 Ga0070671_100634338
1895 Ga0070674_100005898
1896 Ga0070674_100186772
1897 Ga0070674_100299279
1898 Ga0070674_100999724
1899 Ga0070674_101106421
1900 Ga0070673_100030293
1901 Ga0070673_100048345
1902 Ga0070673_100171447
1903 Ga0070673_100612918
1904 Ga0070673_100753633
1905 Ga0070673_101552796
1906 Ga0070688_100387313
1907 Ga0070688_100723293
1908 Ga0070659_100000666
1909 Ga0070659_100038040
1910 Ga0070659_100084714
1911 Ga0070659_100203977
1912 Ga0070667_100000677
1913 Ga0070667_100041820
1914 Ga0070667_100208611
1915 Ga0070667_100591749
1916 Ga0070667_101309330
1917 Ga0070714_100406359
1918 Ga0070708_100199245
1919 Ga0070663_100006532
1920 Ga0070663_100280802
1921 Ga0070663_100292332
1922 Ga0070663_100351977
1923 Ga0070663_100524025
1924 Ga0070663_101026899
1925 Ga0070678_100009538
1926 Ga0070678_100009859
1927 Ga0070678_100017043
1928 Ga0070678_100557878
1929 Ga0070678_101128244
1930 Ga0070678_101445105
1931 Ga0070662_100116572
1932 Ga0070662_100181759
1933 Ga0070662_100840551
1934 Ga0070662_101258287
1935 Ga0070681_10026267
1936 Ga0070681_10358612
1937 Ga0068867_100003972
1938 Ga0068867_100004620
1939 Ga0068867_100006451
1940 Ga0068867_100012180
1941 Ga0068867_100148304
1942 Ga0068867_100221025
1943 Ga0068867_100284181
1944 Ga0068867_100847655
1945 Ga0070685_10991557
1946 Ga0070706_100013624
1947 Ga0070706_100061300
1948 Ga0070679_100028221
1949 Ga0070684_100032261
1950 Ga0070684_100110528
1951 Ga0068853_100066374
1952 Ga0068853_100137713
1953 Ga0068853_100525537
1954 Ga0068853_100542851
1955 Ga0070672_100014390
1956 Ga0070672_100014964
1957 Ga0070672_100128138
1958 Ga0070672_100219223
1959 Ga0070686_100289447
1960 Ga0070686_100630358
1961 Ga0070693_100064607
1962 Ga0070693_100155581
1963 Ga0070693_100418017
1964 Ga0070665_100056462
1965 Ga0070665_100195862
1966 Ga0070665_100257967
1967 Ga0070665_100348547
1968 Ga0070665_102019592
1969 Ga0068855_100019587
1970 Ga0068855_100064421
1971 Ga0068855_100139662
1972 Ga0068855_100194335
1973 Ga0068855_100621090
1974 Ga0068855_100714985
1975 Ga0070664_100027119
1976 Ga0070664_100037626
1977 Ga0070664_100043037
1978 Ga0070664_100360173
1979 Ga0070664_100403408
1980 Ga0070664_100551765
1981 Ga0070664_100618262
1982 Ga0070664_100796299
1983 Ga0068857_100729936
1984 Ga0068857_101028775
1985 Ga0068854_100000903
1986 Ga0068854_100040558
1987 Ga0068854_100334516
1988 Ga0068856_100016907
1989 Ga0068856_100063174
1990 Ga0068856_100945156
1991 Ga0068856_101153496
1992 Ga0068852_100024399
1993 Ga0068852_100033409
1994 Ga0068852_100063334
1995 Ga0068852_100275484
1996 Ga0068852_100294866
1997 Ga0068852_100349956
1998 Ga0068852_100455717
1999 Ga0068852_100976152
2000 Ga0068852_101430659
2001 Ga0068859_100027031
2002 Ga0068859_100035700
2003 Ga0068859_100083488
2004 Ga0068859_100272232
2005 Ga0068859_101077292
2006 Ga0068864_100009238
2007 Ga0068864_100069099
2008 Ga0068866_10010005
2009 Ga0068866_10033904
2010 Ga0068866_10291282
2011 Ga0068861_100001416
2012 Ga0068861_100005119
2013 Ga0068861_100013239
2014 Ga0068851_10021738
2015 Ga0068851_10036008
2016 Ga0068851_10065777
2017 Ga0068851_10594962
2018 Ga0068863_100087934
2019 Ga0068863_100970866
2020 Ga0068863_102153713
2021 Ga0068858_100006788
2022 Ga0068858_100073500
2023 Ga0068858_101523109
2024 Ga0068860_100000903
2025 Ga0068860_100008648
2026 Ga0068860_100372371
2027 Ga0068862_100007315
2028 Ga0068862_100033939
2029 Ga0068862_100100036
2030 Ga0068862_100603560
2031 Ga0068862_101903787
2032 Ga0081455_10154969
2033 Ga0075363_100191580
2034 Ga0075364_10686904
2035 Ga0075362_10105057
2036 Ga0075362_10162763
2037 Ga0075362_10169259
2038 Ga0075362_10232140
2039 Ga0075367_10087101
2040 Ga0075367_10485311
2041 Ga0075366_10023840
2042 Ga0075366_10069763
2043 Ga0075366_10161165
2044 Ga0075366_10245148
2045 Ga0075366_10506264
2046 Ga0075366_10820974
2047 Ga0075366_10975405
2048 Ga0097621_100098460
2049 Ga0097621_100293346
2050 Ga0097621_100806884
2051 Ga0097621_101655116
2052 Ga0075370_10011463
2053 Ga0075370_10020006
2054 Ga0075370_10051619
2055 Ga0075370_10181382
2056 Ga0075370_10498900
2057 Ga0075370_10647199
2058 Ga0068871_100014710
2059 Ga0068871_100014932
2060 Ga0068871_100049440
2061 Ga0068871_100051168
2062 Ga0068871_100330659
2063 Ga0075430_100082328
2064 Ga0075429_100008833
2065 Ga0068865_100003663
2066 Ga0068865_100233935
2067 Ga0068865_100289236
2068 Ga0068865_100437424
2069 Ga0068865_100707074
2070 Ga0068865_100859153
2071 Ga0097620_100027032
2072 Ga0097620_100035700
2073 Ga0097620_100083487
2074 Ga0097620_100272234
2075 Ga0097620_101077262
2076 Ga0079104_1000273
2077 Ga0079104_1003849
2078 Ga0079104_1059468
2079 Ga0099826_10000005
2080 Ga0075435_101387957
2081 Ga0105244_10002947
2082 Ga0105244_10004312
2083 Ga0105244_10162888
2084 Ga0105244_10280324
2085 Ga0111539_10941517
2086 Ga0105245_10036044
2087 Ga0105245_10222432
2088 Ga0105245_11116907
2089 Ga0114129_10137155
2090 Ga0105243_10023700
2091 Ga0105243_10063627
2092 Ga0105243_10138979
2093 Ga0105243_10435328
2094 Ga0105243_10950944
2095 Ga0105241_10023999
2096 Ga0105241_10242877
2097 Ga0105241_11022846
2098 Ga0105242_10269981
2099 Ga0105242_10365056
2100 Ga0105242_11024226
2101 Ga0105242_11774809
2102 Ga0105248_10000595
2103 Ga0105248_10027182
2104 Ga0105248_10112431
2105 Ga0105248_10204255
2106 Ga0105248_10498071
2107 Ga0105248_11331677
2108 Ga0105237_10172915
2109 Ga0105237_10212870
2110 Ga0105237_10399046
2111 Ga0105237_11143531
2112 Ga0105238_10003253
2113 Ga0105238_10052730
2114 Ga0105238_10108100
2115 Ga0105238_10275226
2116 Ga0105249_10572519
2117 Ga0105249_12040167
2118 Ga0105239_10080637
2119 Ga0105239_10785653
2120 Ga0105246_10400389
2121 Ga0157324_1035756
2122 Ga0157326_1013205
2123 Ga0157373_10017629
2124 Ga0157373_10877224
2125 Ga0157371_10171540
2126 Ga0157371_10430578
2127 Ga0157370_10561401
2128 Ga0157369_10018014
2129 Ga0157369_10049207
2130 Ga0157369_11075203
2131 Ga0157369_11119535
2132 Ga0157369_11530978
2133 Ga0157374_10075363
2134 Ga0157374_10091458
2135 Ga0157374_10136709
2136 Ga0157374_10954611
2137 Ga0157374_11124861
2138 Ga0157374_12440091
2139 Ga0157378_10345680
2140 Ga0157378_10648722
2141 Ga0157378_11279228
2142 Ga0157378_11435357
2143 Ga0163162_10040290
2144 Ga0163162_10154852
2145 Ga0163162_11211092
2146 Ga0163162_11716639
2147 Ga0157372_10042427
2148 Ga0157372_10334629
2149 Ga0157372_10601169
2150 Ga0157372_10986112
2151 Ga0157372_11281337
2152 Ga0157372_12697135
2153 Ga0157375_10045304
2154 Ga0157375_10065030
2155 Ga0157375_10112570
2156 Ga0157375_10616094
2157 Ga0163163_10190597
2158 Ga0163163_11056694
2159 Ga0163163_11516962
2160 Ga0157380_10007364
2161 Ga0157380_10013785
2162 Ga0157380_10038853
2163 Ga0157380_10256033
2164 Ga0157380_10833381
2165 Ga0182008_10001405
2166 Ga0182008_10388828
2167 Ga0157377_10000294
2168 Ga0157377_10586265
2169 Ga0157379_10023168
2170 Ga0157379_10025892
2171 Ga0157379_10089602
2172 Ga0157379_10107716
2173 Ga0157376_10004653
2174 Ga0157376_10079761
2175 Ga0157376_10115009
2176 Ga0157376_10202284
2177 Ga0157376_10305066
2178 Ga0157376_10663038
2179 Ga0157376_12097438
2180 Ga0182006_1000004
2181 Ga0182006_1000176
2182 Ga0182007_10000017
2183 Ga0182007_10127552
2184 Ga0182007_10189429
2185 Ga0182005_1000005
2186 Ga0182005_1000030
2187 Ga0182005_1099447
2188 Ga0163161_10020753
2189 Ga0163161_10021914
2190 Ga0163161_10048829
2191 Ga0163161_10104696
2192 Ga0163161_10180987
2193 Ga0163161_10232114
2194 Ga0163161_10694080
2195 Ga0163161_10722683
2196 Ga0163161_10889649
2197 Ga0213872_10000035
2198 Ga0213872_10000127
2199 Ga0213872_10000139
2200 Ga0213872_10000160
2201 Ga0213872_10000683
2202 Ga0213872_10018814
2203 Ga0213872_10028189
2204 Ga0213872_10158072
2205 Ga0209674_100003
2206 Ga0209672_113998
2207 Ga0209563_100003
2208 Ga0209563_100010
2209 Ga0209563_100025
2210 Ga0207427_104232
2211 Ga0209258_100163
2212 Ga0209258_100627
2213 Ga0207425_1000376
2214 Ga0209646_1000036
2215 Ga0209646_1000138
2216 Ga0209026_1000021
2217 Ga0209677_100093
2218 Ga0209677_100817
2219 Ga0209677_102569
2220 Ga0209677_102895
2221 Ga0209148_1000203
2222 Ga0209759_1000025
2223 Ga0209759_1001158
2224 Ga0209759_1013130
2225 Ga0209565_1000068
2226 Ga0209565_1011943
2227 Ga0209455_1000047
2228 Ga0209455_1000059
2229 Ga0209673_1000119
2230 Ga0209673_1006475
2231 Ga0209130_1000057
2232 Ga0209675_1000068
2233 Ga0209675_1012938
2234 Ga0209025_1004584
2235 Ga0209564_1000060
2236 Ga0209564_1000141
2237 Ga0209564_1000149
2238 Ga0209758_1000941
2239 Ga0209256_1000024
2240 Ga0209256_1000040
2241 Ga0209256_1000173
2242 Ga0209051_1003858
2243 Ga0209051_1004022
2244 Ga0209051_1011624
2245 Ga0209257_1000032
2246 Ga0207656_10083296
2247 Ga0207655_1022557
2248 Ga0207655_1024930
2249 Ga0207682_10001255
2250 Ga0207682_10114555
2251 Ga0207682_10229071
2252 Ga0207682_10297195
2253 Ga0207642_10025093
2254 Ga0207642_10075539
2255 Ga0207710_10372598
2256 Ga0207688_10005290
2257 Ga0207645_10031533
2258 Ga0207645_10128376
2259 Ga0207645_10219054
2260 Ga0207645_10293283
2261 Ga0207705_10011989
2262 Ga0207705_11042357
2263 Ga0207654_10021482
2264 Ga0207707_10108844
2265 Ga0207695_10080700
2266 Ga0207695_10084675
2267 Ga0207671_10164373
2268 Ga0207660_10004601
2269 Ga0207660_10590952
2270 Ga0207657_10020777
2271 Ga0207657_10084454
2272 Ga0207657_10457320
2273 Ga0207657_10982071
2274 Ga0207649_10010449
2275 Ga0207649_10028943
2276 Ga0207649_10154052
2277 Ga0207649_10737776
2278 Ga0207652_10080840
2279 Ga0207652_10452857
2280 Ga0207681_10032182
2281 Ga0207681_10037994
2282 Ga0207681_10043789
2283 Ga0207681_10061997
2284 Ga0207681_10499004
2285 Ga0207681_10868202
2286 Ga0207650_10010814
2287 Ga0207650_10019962
2288 Ga0207659_10030843
2289 Ga0207659_10211488
2290 Ga0207659_10217458
2291 Ga0207659_10302321
2292 Ga0207659_10659996
2293 Ga0207687_10008809
2294 Ga0207687_10406772
2295 Ga0207687_10430098
2296 Ga0207687_11132129
2297 Ga0207644_10033398
2298 Ga0207644_10053041
2299 Ga0207644_10062491
2300 Ga0207644_10196003
2301 Ga0207690_10004038
2302 Ga0207690_10170685
2303 Ga0207690_10268912
2304 Ga0207706_10004089
2305 Ga0207706_10058771
2306 Ga0207706_10284462
2307 Ga0207706_10438292
2308 Ga0207706_10440688
2309 Ga0207686_10032006
2310 Ga0207686_10063522
2311 Ga0207709_10025634
2312 Ga0207709_10041325
2313 Ga0207709_10064766
2314 Ga0207709_11175023
2315 Ga0207670_10737083
2316 Ga0207669_10112485
2317 Ga0207669_10611394
2318 Ga0207669_11947629
2319 Ga0207704_10005537
2320 Ga0207704_10083314
2321 Ga0207704_10517258
2322 Ga0207691_10011878
2323 Ga0207691_10057109
2324 Ga0207691_10272294
2325 Ga0207691_10315262
2326 Ga0207711_10001919
2327 Ga0207711_10006066
2328 Ga0207711_10749057
2329 Ga0207711_11612572
2330 Ga0207689_10008328
2331 Ga0207689_10442637
2332 Ga0207661_10840130
2333 Ga0207679_10016886
2334 Ga0207679_10024101
2335 Ga0207679_10060411
2336 Ga0207679_10162791
2337 Ga0207679_10376143
2338 Ga0207679_10593518
2339 Ga0207667_10078788
2340 Ga0207667_10115407
2341 Ga0207667_10874050
2342 Ga0207667_11091962
2343 Ga0207651_10013982
2344 Ga0207651_10134791
2345 Ga0207651_10172606
2346 Ga0207651_10198999
2347 Ga0207651_10217888
2348 Ga0207651_12023631
2349 Ga0207712_10219856
2350 Ga0207668_10275466
2351 Ga0207640_10216373
2352 Ga0207658_10002360
2353 Ga0207658_10515090
2354 Ga0207658_10747993
2355 Ga0207658_10962500
2356 Ga0207658_11037347
2357 Ga0207677_10004412
2358 Ga0207677_10211222
2359 Ga0207677_10892895
2360 Ga0207677_11054321
2361 Ga0207677_11257016
2362 Ga0207703_10053412
2363 Ga0207703_10141302
2364 Ga0207703_10476025
2365 Ga0207703_10565636
2366 Ga0207639_10085207
2367 Ga0207639_10744272
2368 Ga0207678_10003169
2369 Ga0207678_10027797
2370 Ga0207678_10082037
2371 Ga0207678_10109071
2372 Ga0207678_10174309
2373 Ga0207678_10259657
2374 Ga0207678_10407539
2375 Ga0207702_10000227
2376 Ga0207702_10250517
2377 Ga0207702_10758403
2378 Ga0207702_11178159
2379 Ga0207702_11365627
2380 Ga0207641_10100139
2381 Ga0207641_10119259
2382 Ga0207641_10789438
2383 Ga0207648_10004504
2384 Ga0207648_10010128
2385 Ga0207648_10024243
2386 Ga0207648_10074300
2387 Ga0207648_10117298
2388 Ga0207648_10363776
2389 Ga0207676_10009240
2390 Ga0207676_10080135
2391 Ga0207674_10091585
2392 Ga0207675_100001125
2393 Ga0207675_100005766
2394 Ga0207675_100105822
2395 Ga0207675_100408557
2396 Ga0207683_10007938
2397 Ga0207683_10012078
2398 Ga0207683_10215090
2399 Ga0207683_10295538
2400 Ga0207683_11291420
2401 Ga0207698_10042094
2402 Ga0209281_1000416
2403 Ga0209281_1050051
2404 Ga0209967_1001211
2405 Ga0210000_1002227
2406 Ga0209995_1014917
2407 Ga0209968_1002465
2408 Ga0209999_1023219
2409 Ga0209970_1000174
2410 Ga0209983_1032993
2411 Ga0209282_1000003
2412 Ga0209588_1051553
2413 Ga0209966_1000303
2414 Ga0268266_10297392
2415 Ga0268266_10740279
2416 Ga0268265_10175003
2417 Ga0268265_10180418
2418 Ga0268265_10207139
2419 Ga0268265_10558854
2420 Ga0268265_11675532
2421 Ga0268264_10008380
2422 Ga0268264_10521151
2423 Ga0265336_10000051
2424 Ga0307517_10000052
2425 Ga0307517_10147490
2426 Ga0307517_10396630
2427 Ga0307515_10000416
2428 Ga0307515_10000645
2429 Ga0307515_10001163
2430 Ga0307515_10004048
2431 Ga0307515_10004318
2432 Ga0307515_10014143
2433 Ga0307515_10026385
2434 Ga0307515_10047081
2435 Ga0307515_10102840
2436 Ga0307515_10181532
2437 Ga0307515_10335364
2438 Ga0307515_10361979
2439 Ga0265324_10000292
2440 Ga0265324_10043351
2441 Ga0307512_10072314
2442 Ga0307512_10104738
2443 Ga0316181_1032650
2444 Ga0265328_10038853
2445 Ga0265331_10002254
2446 Ga0265327_10000309
2447 Ga0265316_10000299
2448 Ga0307513_10024348
2449 Ga0307513_10127823
2450 Ga0307513_10218597
2451 Ga0307509_10012817
2452 Ga0307509_10049892
2453 Ga0307509_10108307
2454 Ga0307509_10128511
2455 Ga0307509_10131278
2456 Ga0307509_10218808
2457 Ga0307509_10351648
2458 Ga0307408_100000010
2459 Ga0307408_100002273
2460 Ga0307408_100065404
2461 Ga0307408_100272435
2462 Ga0307408_100461417
2463 Ga0307408_100647165
2464 Ga0307508_10000047
2465 Ga0307508_10001110
2466 Ga0307508_10012672
2467 Ga0307508_10400903
2468 Ga0307514_10002133
2469 Ga0307514_10017955
2470 Ga0307514_10045424
2471 Ga0265314_10062809
2472 Ga0307516_10000038
2473 Ga0307516_10001369
2474 Ga0307516_10005900
2475 Ga0307516_10254243
2476 Ga0307516_10312345
2477 Ga0307405_10018925
2478 Ga0307405_10191108
2479 Ga0307405_10348696
2480 Ga0307413_10001478
2481 Ga0307413_10034527
2482 Ga0307413_11202310
2483 Ga0307518_10019478
2484 Ga0307410_10130880
2485 Ga0307410_10341775
2486 Ga0307410_10414646
2487 Ga0307410_10480113
2488 Ga0307410_10559137
2489 Ga0307406_10007697
2490 Ga0307406_10606605
2491 Ga0307412_10003056
2492 Ga0307412_10134632
2493 Ga0307409_100012773
2494 Ga0307409_100244130
2495 Ga0307409_100316229
2496 Ga0307409_100754418
2497 Ga0307416_100376041
2498 Ga0307416_100426917
2499 Ga0307416_101093401
2500 Ga0307416_101355712
2501 Ga0307414_10099483
2502 Ga0307414_10158522
2503 Ga0307411_10002067
2504 Ga0307411_10019462
2505 Ga0307411_10156038
2506 Ga0307411_10186301
2507 Ga0307411_10268406
2508 Ga0307411_10296460
2509 Ga0307411_11675038
2510 Ga0307415_100043660
2511 Ga0307415_100581294
2512 Ga0307415_102208059
2513 Ga0307510_10005294
2514 Ga0307510_10037378
2515 Ga0307510_10253556
2516 Ga0307510_10468508
2517 Ga0373959_0049269
2518 Ga0373929_0090021
2519 Ga0373934_0097225
2520 Ga0373944_0061421
2521 Ga0373944_0112318
2522 Ga0373951_0018674
2523 Ga0373939_0000579
2524 Ga0373941_0061235
2525 Ga0373941_0462326
2526 Ga0373943_0969621
2527 Ga0373962_0060087
2528 Ga0373931_0000228
2529 Ga0373931_0006809
2530 Ga0373931_0011745
2531 Ga0373931_0904443
2532 Ga0373927_0009397
2533 Ga0373933_0043177
2534 Ga0373925_0001850
2535 Ga0373925_0497099
2536 Ga0395899_0000370
2537 Ga0395899_0038495
2538 Ga0395899_0043349
2539 Ga0395899_0113735
2540 Ga0395899_0243257
2541 Ga0395899_0362820
2542 Ga0395899_0494725
2543 Ga0395900_0000640
2544 Ga0395900_0033983
2545 Ga0395900_0120467
2546 Ga0395900_0123750
2547 Ga0395900_0220142
2548 Ga0395900_0617867
2549 Ga0395898_0007053
2550 Ga0395898_0070112
2551 Ga0395898_1319919
2552 Ga0395905_0000676
2553 Ga0395905_0008541
2554 Ga0395905_0013220
2555 Ga0395905_0018255
2556 Ga0395905_0133785
2557 Ga0395905_0140362
2558 Ga0395905_0227962
2559 Ga0395905_0284022
2560 Ga0395905_0516473
2561 Ga0395905_0747246
2562 Ga0395905_0873193
2563 Ga0395901_0000074
2564 Ga0395901_0001733
2565 Ga0395901_0244277
2566 Ga0395901_0279774
2567 Ga0395901_0323079
2568 Ga0395901_0429941
2569 Ga0395901_0961672
2570 Ga0436361_0048643
2571 Ga0436361_0053671
2572 Ga0436361_0062004
2573 Ga0436361_0071334
2574 Ga0436361_0144792
2575 Ga0436361_0239153
2576 Ga0436361_0362312
2577 Ga0436361_0588758
2578 Ga0436361_0615018
2579 Ga0436361_0692200
2580 Ga0436361_0749269
2581 Ga0436361_1191441
2582 Ga0436363_1606815
2583 Ga0439453_0015160
2584 Ga0439465_0221247
2585 Ga0451791_1212493
2586 Ga0451791_1752511
2587 Ga0451795_1328699
2588 Ga0451798_0266409
2589 Ga0451802_0610707
2590 Ga0451807_1373320
2591 Ga0451835_1125194
2592 Ga0451837_1627762
2593 Ga0451845_0632488
2594 Ga0451847_0912814
2595 Ga0451849_1092259
2596 Ga0451851_0023497
2597 Ga0451851_0889618
2598 Ga0451843_0699320
2599 Ga0451853_0907922
2600 Ga0439431_0006166
2601 Ga0439433_0021226
2602 Ga0439437_000360
2603 Ga0439448_0003089
2604 Ga0439448_0081905
2605 Ga0439448_0127064
2606 Ga0439448_0172457
2607 Ga0439449_0016561
2608 Ga0439449_0070323
2609 Ga0439455_0012754
2610 Ga0439455_0174098
2611 Ga0439462_0151164
2612 Ga0450911_014457
2613 Ga0450913_016161
2614 Ga0450917_000369
2615 Ga0450919_004025
2616 Ga0450920_014429
2617 Ga0450888_000895
2618 Ga0450888_013430
2619 Ga0450890_037914
2620 Ga0450890_078507
2621 Ga0450891_000017
2622 Ga0450895_006529
2623 Ga0450898_015726
2624 Ga0450898_026984
2625 Ga0450898_062501
2626 Ga0450898_084618
2627 Ga0450903_016707
2628 Ga0450904_000117
2629 Ga0450906_026774
2630 Ga0439446_0237398
2631 Ga0439446_0282478
2632 Ga0450918_000764
2633 Ga0450893_0002946
2634 Ga0450893_0128648
2635 Ga0450901_017537
2636 Ga0451577_0043475
2637 Ga0466969_0000037
2638 Ga0466969_0034564
2639 Ga0466969_0043321
2640 Ga0466969_0464173
2641 Ga0466972_0002974
2642 Ga0466972_0009008
2643 Ga0466972_0059269
2644 Ga0466972_0316178
2645 Ga0466982_0034801
2646 Ga0466965_0004104
2647 Ga0466965_0017071
2648 Ga0466965_0030031
2649 Ga0466965_0043171
2650 Ga0466965_0077681
2651 Ga0466965_0081903
2652 Ga0466965_0125565
2653 Ga0466965_0263412
2654 Ga0466966_0014648
2655 Ga0466966_0032499
2656 Ga0466966_0048223
2657 Ga0466966_0114801
2658 Ga0466966_0191066
2659 Ga0466966_0286152
2660 Ga0466966_0417301
2661 Ga0466966_0444248
2662 Ga0466961_0015995
2663 Ga0466961_0020395
2664 Ga0466961_0022942
2665 Ga0466961_0048858
2666 Ga0466963_0024612
2667 Ga0466963_0321315
2668 Ga0466964_0005515
2669 Ga0466964_0008450
2670 Ga0466964_0022795
2671 Ga0466964_0189517
2672 Ga0466964_0273959
2673 Ga0466964_0493591
2674 Ga0453684_0047302
2675 Ga0453684_0103481
2676 Ga0453684_0147265
2677 Ga0453684_0158290
2678 Ga0453684_0228640
2679 Ga0453684_0428150
2680 Ga0453684_0546938
2681 Ga0453684_1324140
2682 Ga0466971_0008028
2683 Ga0466971_0025492
2684 Ga0466971_0031185
2685 Ga0466968_0000503
2686 Ga0466968_0026789
2687 Ga0466968_0032257
2688 Ga0466970_0028959
2689 Ga0466970_0073793
2690 Ga0466970_0085799
2691 Ga0466970_0206437
2692 Ga0466957_0006839
2693 Ga0466957_0009983
2694 Ga0466957_0020390
2695 Ga0466957_0035356
2696 Ga0466957_0082980
2697 Ga0466957_0102870
2698 Ga0466957_0701491
2699 Ga0466957_1018496
2700 Ga0466960_0146279
2701 Ga0466960_0160039
2702 Ga0466960_0168693
2703 Ga0466960_0661791
2704 Ga0466960_0716203
2705 Ga0466959_0006252
2706 Ga0466959_0110779
2707 Ga0466959_0112723
2708 Ga0466959_0117917
2709 Ga0466959_0125799
2710 Ga0466959_0528259
2711 Ga0466959_0735569
2712 Ga0451576_0002339
2713 Ga0451576_0454819
2714 Ga0451576_0819428
2715 Ga0451576_1458115
2716 Ga0451576_1686886
2717 Ga0466958_0077892
2718 Ga0466958_0109142
2719 Ga0466958_0113256
2720 Ga0466958_0115744
2721 Ga0466958_0156942
2722 Ga0466958_0213387
2723 Ga0466958_0233977
2724 Ga0466967_0011205
2725 Ga0466967_0020086
2726 Ga0466967_0313540
2727 Ga0466967_0376686
2728 Ga0466967_0505951
2729 Ga0495617_000005
2730 Ga0495617_000026
2731 Ga0495617_000362
2732 Ga0495617_004468
2733 Ga0495617_013150
2734 Ga0495617_085770
2735 Ga0495627_000038
2736 Ga0495627_000043
2737 Ga0495627_023622
2738 Ga0495592_0000346
2739 Ga0495603_0120676
2740 Ga0495603_0157418
2741 Ga0495603_0183569
2742 Ga0495590_0000031
2743 Ga0495590_0000041
2744 Ga0495590_0006069
2745 Ga0495590_0006704
2746 Ga0495590_0123181
2747 Ga0495590_0195367
2748 Ga0495590_0227942
2749 Ga0495591_000213
2750 Ga0495629_0001336
2751 Ga0495629_0094490
2752 Ga0495629_0182113
2753 Ga0495629_0655730
2754 Ga0495629_0980435
2755 Ga0495638_0000101
2756 Ga0495638_0018344
2757 Ga0495638_0068193
2758 Ga0495638_0078354
2759 Ga0495638_0199792
2760 Ga0495638_0228610
2761 Ga0495638_0296130
2762 Ga0495638_0296595
2763 Ga0495638_0438618
2764 Ga0495638_0442370
2765 Ga0495638_0484298
2766 Ga0495653_0000031
2767 Ga0495653_0012591
2768 Ga0495653_0025416
2769 Ga0495653_0072599
2770 Ga0495653_0087730
2771 Ga0495650_0000230
2772 Ga0495650_0000274
2773 Ga0495650_0000288
2774 Ga0495650_0000504
2775 Ga0495650_0001351
2776 Ga0495650_0098457
2777 Ga0495580_0006752
2778 Ga0495580_0086525
2779 Ga0495582_0017018
2780 Ga0495605_0000071
2781 Ga0495605_0000113
2782 Ga0495605_0000186
2783 Ga0495605_0001197
2784 Ga0495605_0009878
2785 Ga0495605_0050343
2786 Ga0495605_0085279
2787 Ga0495605_0227370
2788 Ga0495605_0281587
2789 Ga0495605_0452653
2790 Ga0495639_0047800
2791 Ga0495664_0225997
2792 Ga0495664_0490464
2793 Ga0495584_0000007
2794 Ga0495584_0000252
2795 Ga0495584_0004963
2796 Ga0495584_0008099
2797 Ga0495584_0015762
2798 Ga0495584_0021355
2799 Ga0495584_0032557
2800 Ga0495584_0043442
2801 Ga0495584_0144931
2802 Ga0495584_0162952
2803 Ga0495584_0222395
2804 Ga0495584_0355275
2805 Ga0495584_0457278
2806 Ga0495585_0000090
2807 Ga0495585_0000147
2808 Ga0495585_0000919
2809 Ga0495585_0006598
2810 Ga0495585_0012830
2811 Ga0495585_0016190
2812 Ga0495585_0024549
2813 Ga0495585_0025178
2814 Ga0495585_0029280
2815 Ga0495585_0041940
2816 Ga0495585_0058592
2817 Ga0495585_0092763
2818 Ga0495585_0113717
2819 Ga0495585_0189373
2820 Ga0495585_0217815
2821 Ga0495585_0377688
2822 Ga0495585_0554786
2823 Ga0495594_0025128
2824 Ga0495594_0051651
2825 Ga0495594_0107383
2826 Ga0495594_0306657
2827 Ga0495596_0000270
2828 Ga0495596_0001876
2829 Ga0495596_0001991
2830 Ga0495596_0006043
2831 Ga0495596_0013973
2832 Ga0495596_0015363
2833 Ga0495596_0019543
2834 Ga0495596_0063271
2835 Ga0495596_0079667
2836 Ga0495607_0000842
2837 Ga0495607_0001791
2838 Ga0495607_0002436
2839 Ga0495607_0006283
2840 Ga0495607_0008025
2841 Ga0495607_0010917
2842 Ga0495607_0018599
2843 Ga0495607_0023678
2844 Ga0495607_0083828
2845 Ga0495607_0093779
2846 Ga0495607_0093985
2847 Ga0495607_0096950
2848 Ga0495607_0111651
2849 Ga0495607_0141005
2850 Ga0495607_0215458
2851 Ga0495607_0455918
2852 Ga0495583_0000016
2853 Ga0495583_0000075
2854 Ga0495583_0000194
2855 Ga0495583_0000284
2856 Ga0495583_0000783
2857 Ga0495583_0001150
2858 Ga0495583_0005291
2859 Ga0495583_0005830
2860 Ga0495583_0005871
2861 Ga0495583_0012206
2862 Ga0495583_0019843
2863 Ga0495583_0023530
2864 Ga0495606_0000077
2865 Ga0495606_0000133
2866 Ga0495606_0000474
2867 Ga0495606_0001180
2868 Ga0495606_0001442
2869 Ga0495606_0006254
2870 Ga0495606_0006540
2871 Ga0495606_0010878
2872 Ga0495606_0016609
2873 Ga0495606_0022834
2874 Ga0495606_0027155
2875 Ga0495606_0062093
2876 Ga0495606_0287324
2877 Ga0495606_0355959
2878 Ga0495606_0442077
2879 Ga0495608_0747823
2880 Ga0495610_0000038
2881 Ga0495610_0001086
2882 Ga0495610_0009405
2883 Ga0495610_0016768
2884 Ga0495610_0033904
2885 Ga0495610_0043657
2886 Ga0495610_0078844
2887 Ga0495610_0095798
2888 Ga0495616_0000048
2889 Ga0495616_0002015
2890 Ga0495616_0004259
2891 Ga0495616_0006556
2892 Ga0495616_0010268
2893 Ga0495616_0011262
2894 Ga0495616_0016471
2895 Ga0495616_0030381
2896 Ga0495616_0031023
2897 Ga0495616_0036660
2898 Ga0495616_0067735
2899 Ga0495616_0074501
2900 Ga0495616_0259799
2901 Ga0495616_0292678
2902 Ga0495616_0334098
2903 Ga0495620_0009384
2904 Ga0495620_0294975
2905 Ga0495628_0212869
2906 Ga0495630_0144757
2907 Ga0495630_0654721
2908 Ga0495630_0891788
2909 Ga0495631_0000684
2910 Ga0495631_0002923
2911 Ga0495631_0003899
2912 Ga0495631_0006452
2913 Ga0495631_0014808
2914 Ga0495631_0035930
2915 Ga0495631_0066285
2916 Ga0495631_0181683
2917 Ga0495632_0000098
2918 Ga0495632_0000152
2919 Ga0495632_0002349
2920 Ga0495632_0003810
2921 Ga0495632_0005546
2922 Ga0495632_0011269
2923 Ga0495632_0014466
2924 Ga0495632_0024146
2925 Ga0495632_0086630
2926 Ga0495632_0130761
2927 Ga0495637_0000013
2928 Ga0495637_0003644
2929 Ga0495637_0012166
2930 Ga0495637_0015193
2931 Ga0495637_0022638
2932 Ga0495637_0035358
2933 Ga0495643_0000115
2934 Ga0495643_0000204
2935 Ga0495643_0000206
2936 Ga0495643_0005635
2937 Ga0495643_0008875
2938 Ga0495643_0010126
2939 Ga0495643_0020187
2940 Ga0495643_0032309
2941 Ga0495643_0032526
2942 Ga0495643_0052450
2943 Ga0495643_0062241
2944 Ga0495643_0121146
2945 Ga0495643_0293703
2946 Ga0495644_0006682
2947 Ga0495644_0010702
2948 Ga0495644_0012933
2949 Ga0495644_0025704
2950 Ga0495644_0043410
2951 Ga0495644_0051930
2952 Ga0495644_0062795
2953 Ga0495648_0000089
2954 Ga0495648_0000091
2955 Ga0495648_0000353
2956 Ga0495648_0001746
2957 Ga0495648_0010945
2958 Ga0495648_0019012
2959 Ga0495648_0023916
2960 Ga0495648_0032254
2961 Ga0495648_0034766
2962 Ga0495648_0041778
2963 Ga0495648_0076691
2964 Ga0495648_0117986
2965 Ga0495648_0158085
2966 Ga0495648_0177032
2967 Ga0495648_0295370
2968 Ga0495648_0354105
2969 Ga0495663_0178770
2970 Ga0495663_0348303
2971 Ga0495666_0000042
2972 Ga0495666_0000406
2973 Ga0495666_0066514
2974 Ga0495666_0218832
2975 Ga0495642_0004297
2976 Ga0495642_0004327
2977 Ga0495642_0005729
2978 Ga0495642_0005832
2979 Ga0495642_0032927
2980 Ga0495642_0141799
2981 Ga0495642_0191297
2982 Ga0495642_0220331
2983 Ga0495642_0384232
2984 Ga0495652_0008927
2985 Ga0495652_0644009
2986 Ga0495652_0692160
2987 Ga0495654_0000047
2988 Ga0495654_0010498
2989 Ga0495654_0047709
2990 Ga0495654_0054606
2991 Ga0495654_0108211
2992 Ga0495654_0164605
2993 Ga0495665_0011224
2994 Ga0495665_0020612
2995 Ga0495665_0351615
2996 Ga0495665_0430889
2997 Ga0495640_0563530
2998 Ga0495586_0003306
2999 Ga0495586_0029130
3000 Ga0495586_0041477
3001 Ga0495586_0068372
3002 Ga0495587_0025272
3003 Ga0495587_0222801
3004 Ga0495609_0000022
3005 Ga0495609_0000482
3006 Ga0495609_0000525
3007 Ga0495609_0000817
3008 Ga0495609_0004242
3009 Ga0495609_0011455
3010 Ga0495609_0015753
3011 Ga0495609_0027835
3012 Ga0495609_0040439
3013 Ga0495609_0045080
3014 Ga0495609_0064246
3015 Ga0495609_0092309
3016 Ga0495609_0129507
3017 Ga0495609_0212564
3018 Ga0495621_0003510
3019 Ga0495597_0000104
3020 Ga0495597_0000246
3021 Ga0495597_0000771
3022 Ga0495597_0000806
3023 Ga0495597_0004134
3024 Ga0495597_0004503
3025 Ga0495597_0051448
3026 Ga0495597_0218038
3027 Ga0495645_0519153
3028 Ga0495622_0000015
3029 Ga0495622_0000598
3030 Ga0495622_0003085
3031 Ga0495622_0027127
3032 Ga0495622_0178754
3033 Ga0495633_0000110
3034 Ga0495633_0000189
3035 Ga0495633_0000253
3036 Ga0495633_0003539
3037 Ga0495633_0004049
3038 Ga0495633_0005097
3039 Ga0495633_0006064
3040 Ga0495633_0019372
3041 Ga0495633_0024369
3042 Ga0495633_0027835
3043 Ga0495633_0045331
3044 Ga0495633_0053117
3045 Ga0495633_0058702
3046 Ga0495633_0077901
3047 Ga0495633_0186950
3048 Ga0495667_0409249
3049 Ga0495656_0046421
3050 Ga0495656_0295828
3051 Ga0495656_0413918
3052 Ga0495656_0542329
3053 Ga0495656_0543884
3054 Ga0495668_0000064
3055 Ga0495668_0000131
3056 Ga0495668_0000245
3057 Ga0495668_0000434
3058 Ga0495668_0001415
3059 Ga0495668_0001765
3060 Ga0495668_0005921
3061 Ga0495668_0006701
3062 Ga0495668_0037092
3063 Ga0495668_0112999
3064 Ga0495668_0181098
3065 Ga0495668_0574453
3066 Ga0495668_0642286
3067 Ga0495634_0006153
3068 Ga0495634_0420950
3069 Ga0495611_0003458
3070 Ga0495611_0008445
3071 Ga0495611_0016209
3072 Ga0495611_0024536
3073 Ga0495625_0000188
3074 Ga0495625_0001292
3075 Ga0495625_0001624
3076 Ga0495625_0011006
3077 Ga0495625_0011060
3078 Ga0495625_0023122
3079 Ga0495625_0051373
3080 Ga0495625_0093430
3081 Ga0495625_0138509
3082 Ga0495625_0140960
3083 Ga0495625_0175871
3084 Ga0495625_0179402
3085 Ga0495625_0454015
3086 Ga0495625_0463659
3087 Ga0495635_0005244
3088 Ga0495659_0000679
3089 Ga0495659_0001640
3090 Ga0495661_0000502
3091 Ga0495661_0001265
3092 Ga0495661_0005726
3093 Ga0495661_0009038
3094 Ga0495661_0015856
3095 Ga0495661_0027532
3096 Ga0495661_0031420
3097 Ga0495661_0035252
3098 Ga0495661_0043898
3099 Ga0495661_0049104
3100 Ga0495661_0083814
3101 Ga0495661_0087827
3102 Ga0495661_0089152
3103 Ga0495661_0104665
3104 Ga0495661_0105438
3105 Ga0495661_0112456
3106 Ga0495661_0123683
3107 Ga0495661_0210079
3108 Ga0495661_0401328
3109 Ga0495661_0437020
3110 Ga0495588_0000148
3111 Ga0495588_0017071
3112 Ga0495588_0074754
3113 Ga0495588_0081574
3114 Ga0495588_0151054
3115 Ga0495599_0420424
3116 Ga0495623_0023548
3117 Ga0495623_0030990
3118 Ga0495623_0033544
3119 Ga0495647_0082352
3120 Ga0495658_0678181
3121 Ga0495669_0000355
3122 Ga0495669_0001964
3123 Ga0495669_0007315
3124 Ga0495669_0016714
3125 Ga0495669_0027926
3126 Ga0495613_0009841
3127 Ga0495613_0232461
3128 Ga0495613_0890572
3129 Ga0495624_0018263
3130 Ga0495670_0003213
3131 Ga0495670_0011444
3132 Ga0495670_0030214
3133 Ga0495670_0086312
3134 Ga0495670_0108500
3135 Ga0495670_0156969
3136 Ga0495670_0374453
3137 Ga0495670_0421203
3138 Ga0495670_0440460
3139 Ga0495670_0562660
3140 Ga0495671_0000044
3141 Ga0495671_0000426
3142 Ga0495671_0019650
3143 Ga0495671_0028581
3144 Ga0495671_0038152
3145 Ga0495671_0073066
3146 Ga0495671_0290865
3147 Ga0495671_0312540
3148 Ga0495649_0000806
3149 Ga0495649_0005148
3150 Ga0495649_0019253
3151 Ga0495649_0040661
3152 Ga0495649_0102632
3153 Ga0495649_0110028
3154 Ga0495649_0218377
3155 Ga0495649_0337019
3156 Ga0495649_0480981
3157 Ga0495589_0000017
3158 Ga0495589_0000508
3159 Ga0495589_0006901
3160 Ga0495589_0009727
3161 Ga0495589_0015977
3162 Ga0495589_0049188
3163 Ga0495589_0052782
3164 Ga0495589_0091798
3165 Ga0495600_0123284
3166 Ga0495660_0000162
3167 Ga0495660_0000403
3168 Ga0495660_0005437
3169 Ga0495660_0007545
3170 Ga0495660_0015676
3171 Ga0495660_0021946
3172 Ga0495660_0023195
3173 Ga0495660_0035577
3174 Ga0495660_0086023
3175 Ga0495660_0139169
3176 Ga0495660_0261881
3177 Ga0495660_0314563
3178 Ga0495660_0429093
3179 Ga0495581_0027074
3180 Ga0495581_0068577
3181 Ga0495581_0138604
3182 Ga0495581_0351395
3183 Ga0495604_0006708
3184 Ga0495604_0044087
3185 Ga0495604_0150900
3186 Ga0495604_0349592
3187 Ga0495636_0005184
3188 Ga0495636_0050921
3189 Ga0495636_0163907
3190 Ga0495636_0339180
3191 Ga0495674_0006559
3192 Ga0495672_0000111
3193 Ga0495672_0000142
3194 Ga0495672_0000152
3195 Ga0495672_0000167
3196 Ga0495672_0000559
3197 Ga0495672_0000581
3198 Ga0495672_0038378
3199 Ga0495672_0070711
3200 Ga0495672_0075445
3201 Ga0495672_0097259
3202 Ga0495676_0000123
3203 Ga0495676_0069412
3204 Ga0495676_0588180
3205 Ga0495680_0007799
3206 Ga0495680_0060600
3207 Ga0495683_0000069
3208 Ga0495683_0000098
3209 Ga0495683_0002101
3210 Ga0495683_0014744
3211 Ga0495683_0019856
3212 Ga0495683_0026681
3213 Ga0495683_0044801
3214 Ga0495683_0046896
3215 Ga0495683_0068070
3216 Ga0495683_0116851
3217 Ga0495687_000113
3218 Ga0495687_000140
3219 Ga0495687_000175
3220 Ga0495687_000236
3221 Ga0495687_002221
3222 Ga0495687_007947
3223 Ga0495687_010281
3224 Ga0495687_044949
3225 Ga0495675_0012446
3226 Ga0495675_0109769
3227 Ga0495675_0113683
3228 Ga0495675_0200665
3229 Ga0495677_0000002
3230 Ga0495677_0000079
3231 Ga0495677_0000140
3232 Ga0495677_0000530
3233 Ga0495677_0002486
3234 Ga0495677_0004215
3235 Ga0495677_0005141
3236 Ga0495677_0006745
3237 Ga0495677_0056288
3238 Ga0495677_0100590
3239 Ga0495679_009955
3240 Ga0495679_011673
3241 Ga0495679_021210
3242 Ga0495679_034304
3243 Ga0495679_041740
3244 Ga0495679_048811
3245 Ga0495679_058770
3246 Ga0495679_173340
3247 Ga0495685_000035
3248 Ga0495685_007306
3249 Ga0495685_017962
3250 Ga0495685_040764
3251 Ga0495685_068902
3252 Ga0495673_0000060
3253 Ga0495673_0000085
3254 Ga0495673_0000149
3255 Ga0495673_0002074
3256 Ga0495673_0011481
3257 Ga0495673_0138910
3258 Ga0495681_0000824
3259 Ga0495681_0008558
3260 Ga0495681_0012074
3261 Ga0495681_0022943
3262 Ga0495681_0037046
3263 Ga0495681_0069635
3264 Ga0495681_0071377
3265 Ga0495681_0132533
3266 Ga0495686_0000169
3267 Ga0495686_0001301
3268 Ga0495686_0001456
3269 Ga0495686_0022113
3270 Ga0495686_0045233
3271 Ga0495686_0051556
3272 Ga0495686_0063418
3273 Ga0495686_0176616
3274 Ga0495686_0193354
3275 Ga0495686_0640205
3276 Ga0495593_0007070
3277 Ga0495593_0027236
3278 Ga0495593_0334876
3279 Ga0495602_0013704
3280 Ga0495602_0038029
3281 Ga0495602_1165652
3282 Ga0495614_0005675
3283 Ga0495614_0259825
3284 Ga0495614_0275022
3285 Ga0495615_0251393
3286 Ga0495626_0000076
3287 Ga0495626_0000170
3288 Ga0495626_0000882
3289 Ga0495626_0002487
3290 Ga0495626_0014577
3291 Ga0495626_0016369
3292 Ga0495626_0018299
3293 Ga0495626_0020538
3294 Ga0495626_0055268
3295 Ga0495626_0063415
3296 Ga0495626_0077862
3297 Ga0495626_0086070
3298 Ga0495626_0102698
3299 Ga0495626_0240270
3300 Ga0495626_0294420
3301 Ga0496100_0008425
3302 Ga0496100_0091449
3303 Ga0496100_0425875
3304 Ga0496101_0119689
3305 Ga0496101_0407770
3306 Ga0496101_0818837
3307 Ga0496102_0000156
3308 Ga0496102_0026637
3309 Ga0496102_0035916
3310 Ga0496102_0040492
3311 Ga0496102_0241353
3312 Ga0496102_1601529
3313 Ga0496103_0001871
3314 Ga0496103_0050964
3315 Ga0496103_0314841
3316 Ga0496103_0481771
3317 Ga0496103_0685025
3318 Ga0496104_0031258
3319 Ga0496104_0145130
3320 Ga0496104_0308104
3321 Ga0496104_0772260
3322 Ga0496105_0086137
3323 Ga0496105_0115503
3324 Ga0496105_0277813
3325 Ga0496105_0336785
3326 Ga0496105_1046679
3327 Ga0496106_0092083
3328 Ga0496106_0163178
3329 Ga0496106_0206902
3330 Ga0496106_0758867
3331 Ga0496106_1265917
3332 Ga0496107_0145371
3333 Ga0496107_0186240
3334 Ga0496107_0496247
3335 Ga0496107_0705493
3336 Ga0496108_0148228
3337 Ga0496108_0489275
3338 Ga0496108_1235550
3339 Ga0496108_1759002
3340 Ga0496109_0061400
3341 Ga0496109_0103067
3342 Ga0496109_0161761
3343 Ga0496109_0202296
3344 Ga0496109_0713198
3345 Ga0496110_0015273
3346 Ga0496110_0317709
3347 Ga0496110_0759304
3348 Ga0496110_1197560
3349 Ga0496111_0133500
3350 Ga0496111_0403271
3351 Ga0496112_0059576
3352 Ga0496113_0040930
3353 Ga0496113_0050671
3354 Ga0496113_0065917
3355 Ga0496113_0358311
3356 Ga0496113_0375616
3357 Ga0496114_0005419
3358 Ga0496114_0017437
3359 Ga0496114_0065449
3360 Ga0496114_0517560
3361 Ga0496115_0031336
3362 Ga0496115_0118488
3363 Ga0496115_0169903
3364 Ga0496115_0189893
3365 Ga0496115_0502819
3366 Ga0496115_0712322
3367 Ga0496116_0026975
3368 Ga0496116_0075945
3369 Ga0496116_0207566
3370 Ga0496117_0000011
3371 Ga0496117_0389840
3372 Ga0496118_0000010
3373 Ga0496118_0402302
3374 Ga0496120_0055568
3375 Ga0496121_0014685
3376 Ga0496121_0020684
3377 Ga0496121_0072058
3378 Ga0496121_0089685
3379 Ga0496121_0091909
3380 Ga0496121_0537109
3381 Ga0496122_0000653
3382 Ga0496122_0000691
3383 Ga0496122_0055165
3384 Ga0496122_0059591
3385 Ga0496123_0000196
3386 Ga0496123_0003602
3387 Ga0496123_0008397
3388 Ga0496123_0023456
3389 Ga0496123_0362392
3390 Ga0496124_0001079
3391 Ga0496124_0007424
3392 Ga0496124_0047741
3393 Ga0496124_0280248
3394 Ga0496124_0295836
3395 Ga0496124_0342286
3396 Ga0496125_0003108
3397 Ga0496125_0052257
3398 Ga0496125_0052557
3399 Ga0496125_0200621
3400 Ga0496126_0011408
3401 Ga0496126_0324301
3402 Ga0496126_0565907
3403 Ga0501306_031055
3404 Ga0501308_012646
3405 Ga0501304_014766
3406 Ga0501304_017110
3407 Ga0495678_000001
3408 Ga0495678_000458
3409 Ga0495678_000745
3410 Ga0495678_001248
3411 Ga0495678_013374
3412 Ga0495678_016943
3413 Ga0495678_018139
3414 Ga0495678_055256
3415 Ga0495682_0002062
3416 Ga0495682_0002194
3417 Ga0495682_0003012
3418 Ga0495682_0036004
3419 Ga0501291_003206
3420 Ga0501297_008226
3421 Ga0501300_011751
3422 Ga0501301_018626
3423 Ga0501303_017177
3424 Ga0501314_002322
3425 Ga0501315_060558
3426 Ga0501324_026192
3427 Ga0501036_0833410
3428 Ga0501041_0447632
3429 Ga0501041_0955430
3430 Ga0501198_000020
3431 Ga0501202_077752
3432 Ga0501210_006741
3433 Ga0501211_000342
3434 Ga0501222_000025
3435 Ga0501222_001535
3436 Ga0501222_008087
3437 Ga0501223_007317
3438 Ga0501227_060815
3439 Ga0501233_013732
3440 Ga0501235_006749
3441 Ga0501238_026390
3442 Ga0501257_089156
3443 Ga0501258_003044
3444 Ga0501221_019756
3445 Ga0501229_002483
3446 Ga0501079_0175184
3447 Ga0501262_033377
3448 Ga0501264_014637
3449 Ga0501266_094602
3450 Ga0501269_001764
3451 Ga0501272_010980
3452 Ga0501283_028357
3453 Ga0501283_059939
3454 Ga0501035_0018470
3455 Ga0501044_0164982
3456 nmdc:mga03683_106114_c1
3457 nmdc:mga03683_218867_c1
3458 nmdc:mga03n38_95341_c1
3459 nmdc:mga00v17_823376_c1
3460 nmdc:mga0k408_140886_c1
3461 nmdc:mga0k408_167711_c1
3462 nmdc:mga0k408_17968_c1
3463 nmdc:mga0k408_215628_c1
3464 nmdc:mga0k408_303971_c1
3465 nmdc:mga0k408_432820_c1
3466 nmdc:mga0k408_471718_c1
3467 nmdc:mga0k408_48281_c1
3468 nmdc:mga06z11_388436_c1
3469 nmdc:mga07m45_216290_c1
3470 nmdc:mga07m45_418293_c1
3471 nmdc:mga07m45_602165_c1
3472 nmdc:mga07m45_70331_c1
3473 nmdc:mga07m45_89189_c1
3474 nmdc:mga07m45_9660_c1
3475 nmdc:mga07m45_9841_c1
3476 nmdc:mga09592_1296_c1
3477 nmdc:mga0qj67_11367_c1
3478 nmdc:mga0qj67_142534_c1
3479 nmdc:mga0rr50_1435808_c1
3480 Ga0500635_0000077
3481 Ga0500635_0191967
3482 Ga0500578_0000013
3483 Ga0500644_0299089
3484 Ga0500646_0058230
3485 Ga0500583_0302745
3486 Ga0500651_0021759
3487 Ga0500650_0276913
3488 Ga0500557_211979
3489 Ga0500562_031435
3490 Ga0500569_016845
3491 Ga0500594_0001239
3492 Ga0500594_0003144
3493 Ga0500607_109745
3494 Ga0500618_004758
3495 Ga0500618_006553
3496 Ga0500621_258815
3497 Ga0500642_0022296
3498 Ga0500642_0070947
3499 Ga0500652_001857
3500 Ga0500652_193579
3501 Ga0500658_0025758
3502 Ga0500559_0003197
3503 Ga0500559_0043745
3504 Ga0500559_0490266
3505 Ga0500564_124046
3506 Ga0500568_0001164
3507 Ga0500568_0013489
3508 Ga0500577_0003430
3509 Ga0500586_007537
3510 Ga0500589_202111
3511 Ga0500604_0070068
3512 Ga0500604_0318967
3513 Ga0500619_000008
3514 Ga0500619_054905
3515 Ga0500622_0007164
3516 Ga0500622_0073705
3517 Ga0500636_0088358
3518 Ga0500636_0133130
3519 Ga0500584_055439
3520 Ga0500645_008014
3521 Ga0500587_000059
3522 Ga0500587_003765
3523 Ga0500587_073475
3524 Ga0500661_003928
3525 Ga0587083_0075842
3526 Ga0587098_022566
3527 Ga0587068_010424
3528 Ga0466962_0002387
3529 Ga0466962_0033691
3530 Ga0466962_0046950
3531 Ga0466962_0664925
3532 2587730469
3533 2587736072
3534 2588293334
3535 2601669595
3536 2643742287
3537 2643800340
3538 2643937108
3539 2643969066
3540 2644030419
3541 2644139666
3542 2644217914
3543 2644247931
3544 2644255300
3545 2644258344
3546 2644275402
3547 2644304505
3548 2644318273
3549 2644341358
3550 2644471880
3551 2738827181
3552 2739057000
3553 2739150978
3554 2739192897
3555 2739319374
3556 2739337615
3557 2809142318
3558 2821134538
3559 2842715045
3560 2857549717
3561 2857557133
3562 2857560562
3563 2857570061
3564 2885082327
3565 2904430318
3566 2919480887
3567 2919704584
3568 2932415799
3569 2932421789
3570 8047675198

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02472

ExbD

Biopolymer transport protein ExbD/TolR

6

136

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
8p9r-assembly1.cif.gz_B structure of the periplasmic domain of exbd from e. coli in complex with tonb 0.9011 60 135
8p9r-assembly1.cif.gz_B structure of the periplasmic domain of exbd from e. coli in complex with tonb 0.89 60 135
8pek-assembly1.cif.gz_B structure of the dimeric, periplasmic domain of exbd 0.7508 44 141
4ipt-assembly1.cif.gz_A the crystal structure of a short-chain dehydrogenases/reductase (ethylated) from veillonella parvula dsm 2008 0.7484 82 138
2jwl-assembly1.cif.gz_B solution structure of periplasmic domain of tolr from h. influenzae with saxs data 0.7258 60 128
ID Description Score Start End Superfamily
2jwlB00 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5; 0.7258 60 128 3.30.420.270
1u04A03 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.7141 80 134 3.40.50.2300
af_Q86IH8_5_206_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.7104 77 134 3.30.420.40
af_Q6L4S6_46_242_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.7021 78 134 3.30.420.40
2b3yB02 Alpha Beta;3-Layer(aba) Sandwich;Aconitase; Domain 2;Aconitase, Domain 2 0.7012 84 133 3.40.1060.10
ID Description Score Start End GO Terms
AF-A0A1Y5Q6K5-F1-model_v4 Biopolymer transport protein ExbD/TolR 0.9508 63 134 GO:0005886
GO:0015031
GO:0022857
AF-A0A5C7VJF9-F1-model_v4 Biopolymer transporter ExbD 0.9411 62 139 GO:0005886
GO:0015031
GO:0022857
AF-A0A3B9DG87-F1-model_v4 Biopolymer transporter ExbD 0.9021 56 139 GO:0005886
GO:0015031
GO:0022857
AF-A0A139DB72-F1-model_v4 Biopolymer transport protein ExbD 0.9011 60 141 GO:0005886
GO:0015031
GO:0022857
AF-F3LFH7-F1-model_v4 Biopolymer transport protein ExbD/TolR 0.8989 60 141 GO:0005886
GO:0015031
GO:0022857

Map