F495693
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1785 | 566 | 3570 | 141 |
Family's Representative Sequence
| Representative Sequence | 3300037418|Ga0395900_0000133|Ga0395900_0000133_36234_36698 |
| Length | 154 |
| Sequence | MNFRRHHPEEPEINLIPFIDVLLVVLIFLMLSTTYSKFTELQVTLPTADAQAMHDQPAEVVVAVSADGRYAVNHKAVEGRSVDVLTAELAAAAAGQKDPVVIISADAAATHQSVINVLDAARRAGLPHLTFASQSGGGANGSAPPADEPAPATP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 2 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 3 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 4 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 5 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 6 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 7 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 8 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 9 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 10 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 11 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 12 | 3300003347 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM | Metagenome | Rhizosphere |
| 13 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 14 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 15 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 16 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 17 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 18 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 19 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 20 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 21 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 22 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 23 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 24 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 25 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 26 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 27 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 28 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 29 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 33 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 36 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 38 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 40 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 42 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 50 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 58 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 59 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 60 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 61 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 62 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 63 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 64 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 66 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 69 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 71 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 72 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 73 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 74 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 75 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 76 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 77 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 78 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 79 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 80 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 81 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 82 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 83 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 84 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 85 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 86 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 87 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 88 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 89 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 91 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 92 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 93 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 94 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 95 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 97 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 98 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 99 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300012506 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 | Metagenome | Rhizosphere |
| 113 | 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Metagenome | Rhizosphere |
| 114 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 126 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 130 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 131 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 132 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 134 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 135 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 136 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 137 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 138 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 139 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 140 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 141 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 142 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 143 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 144 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 145 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 146 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 147 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 148 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 149 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 150 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 151 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 152 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 153 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 154 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 155 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 156 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 208 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 216 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 222 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 223 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 224 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 225 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 226 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 227 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 228 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 229 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 230 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 231 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 232 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 233 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 234 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 235 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 236 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 237 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 238 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 239 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 240 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 241 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 242 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 243 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 244 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 245 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 246 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 247 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 248 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 249 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 250 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 251 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 252 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 253 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 254 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 255 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 256 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 257 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 258 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 259 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 260 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 261 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 262 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 263 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 264 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 265 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 266 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 267 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 268 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 269 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 270 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 271 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 272 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 273 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 274 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 275 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 276 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 277 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 278 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 279 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 280 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 281 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 282 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 283 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 284 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 285 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 286 | 3300042000 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 | Metagenome | Rhizosphere |
| 287 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 288 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 289 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 290 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 291 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 292 | 3300042117 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0415F_E14_082316_1937 | Metagenome | Rhizosphere |
| 293 | 3300042120 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 | Metagenome | Rhizosphere |
| 294 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 295 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 296 | 3300042126 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 | Metagenome | Rhizosphere |
| 297 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 298 | 3300042129 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 | Metagenome | Rhizosphere |
| 299 | 3300042132 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 | Metagenome | Rhizosphere |
| 300 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 301 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 302 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 303 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 304 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 305 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 306 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 307 | 3300042533 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 | Metagenome | Rhizosphere |
| 308 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 309 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 310 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 311 | 3300044672 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E | Metagenome | Unclassified |
| 312 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 313 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 314 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 315 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 316 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 317 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 318 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 319 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 320 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 321 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 322 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 323 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 324 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 325 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 326 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 327 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 420 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 421 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 422 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 423 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 424 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 425 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 426 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 427 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 428 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 429 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 430 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 431 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 432 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 433 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 434 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 435 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 436 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 437 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 438 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 439 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 440 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 441 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 442 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 443 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 444 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 445 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 446 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 447 | 3300049128 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 448 | 3300049160 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 449 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 450 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 451 | 3300049514 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought | Metagenome | Rhizosphere |
| 452 | 3300049520 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought | Metagenome | Rhizosphere |
| 453 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 454 | 3300049524 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H21_B_7_control | Metagenome | Rhizosphere |
| 455 | 3300049526 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control | Metagenome | Rhizosphere |
| 456 | 3300049530 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 457 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 458 | 3300049540 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 459 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 460 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 461 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 462 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 463 | 3300049657 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought | Metagenome | Rhizosphere |
| 464 | 3300049658 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought | Metagenome | Rhizosphere |
| 465 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 466 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 467 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 468 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 469 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 470 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 471 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 472 | 3300049687 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought | Metagenome | Rhizosphere |
| 473 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 474 | 3300049706 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control | Metagenome | Rhizosphere |
| 475 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 476 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 477 | 3300049761 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control | Metagenome | Rhizosphere |
| 478 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 479 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 480 | 3300049769 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought | Metagenome | Rhizosphere |
| 481 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 482 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 483 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 484 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 485 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 486 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 487 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 488 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 489 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 490 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 491 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 492 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 493 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 494 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 495 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 496 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 497 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 498 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 499 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 500 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 501 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 502 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 503 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 504 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 505 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 506 | 3300053126 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere | Metagenome | Endosphere |
| 507 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 508 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 509 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 510 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 511 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 512 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 513 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 514 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 515 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 516 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 517 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 518 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 519 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 520 | 3300053726 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 endosphere | Metagenome | Endosphere |
| 521 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 522 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 523 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 524 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 525 | 3300059604 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 526 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 527 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 528 | 2585428057 | Methylibium sp. YR605 | Isolate | Rhizosphere |
| 529 | 2585428058 | Methylibium sp. CF468 | Isolate | Rhizosphere |
| 530 | 2588253510 | Rhizobacter sp. OV335 | Isolate | Rhizosphere |
| 531 | 2600255292 | Janthinobacterium lividum NFR18 | Isolate | Rhizoplane |
| 532 | 2643221544 | Pelomonas sp. Root1444 | Isolate | Unclassified |
| 533 | 2643221556 | Massilia sp. Root1485 | Isolate | Unclassified |
| 534 | 2643221585 | Pelomonas sp. Root662 | Isolate | Unclassified |
| 535 | 2643221592 | Rhizobacter sp. Root16D2 | Isolate | Unclassified |
| 536 | 2643221603 | Noviherbaspirillum sp. Root189 | Isolate | Unclassified |
| 537 | 2643221625 | Rhizobacter sp. Root29 | Isolate | Unclassified |
| 538 | 2643221639 | Pelomonas sp. Root1217 | Isolate | Unclassified |
| 539 | 2643221644 | Rhizobacter sp. Root1221 | Isolate | Unclassified |
| 540 | 2643221645 | Massilia sp. Root351 | Isolate | Unclassified |
| 541 | 2643221646 | Pelomonas sp. Root1237 | Isolate | Unclassified |
| 542 | 2643221648 | Rhizobacter sp. Root1238 | Isolate | Unclassified |
| 543 | 2643221654 | Rhizobacter sp. Root404 | Isolate | Unclassified |
| 544 | 2643221656 | Pelomonas sp. Root405 | Isolate | Unclassified |
| 545 | 2643221660 | Methylibium sp. Root1272 | Isolate | Unclassified |
| 546 | 2643221684 | Massilia sp. Root133 | Isolate | Unclassified |
| 547 | 2738541297 | Duganella sp. GV083 | Isolate | Unclassified |
| 548 | 2738541337 | Pelomonas sp. BT06 | Isolate | Unclassified |
| 549 | 2738541357 | Duganella sp. GV053 | Isolate | Unclassified |
| 550 | 2738543003 | Duganella sp. GV066 | Isolate | Unclassified |
| 551 | 2738543026 | Duganella sp. GV089 | Isolate | Unclassified |
| 552 | 2738543029 | Duganella sp. GV039 | Isolate | Unclassified |
| 553 | 2808606418 | Herbaspirillum sp. SJZ107 | Isolate | Rhizosphere |
| 554 | 2821131069 | Duganella sp. 1224 | Isolate | Unclassified |
| 555 | 2842711865 | Duganella sp. R-73148 | Isolate | Unclassified |
| 556 | 2857547612 | Janthinobacterium sp. R-74502 | Isolate | Unclassified |
| 557 | 2857553236 | Duganella sp. R-74557 | Isolate | Unclassified |
| 558 | 2857558681 | Duganella sp. R-74565 | Isolate | Unclassified |
| 559 | 2857564685 | Duganella sp. R-74599 | Isolate | Unclassified |
| 560 | 2885080285 | Janthinobacterium sp. AD80 | Isolate | Rhizosphere |
| 561 | 2904424332 | Duganella sp. 1411 | Isolate | Rhizosphere |
| 562 | 2919476304 | Duganella sp. 3397 | Isolate | Unclassified |
| 563 | 2919704043 | Hydrogenophaga palleronii 4249 | Isolate | Unclassified |
| 564 | 2932410948 | Janthinobacterium lividum 2829 | Isolate | Rhizosphere |
| 565 | 2932416698 | Janthinobacterium lividum 2830 | Isolate | Rhizosphere |
| 566 | 8047673197 | Telluria mixta LMG 11547 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.25 |
| Metatranscriptomes | 0.56 |
| Isolates | 2.18 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 8.52 |
| Nodule | 0.39 |
| Rhizoplane | 4.09 |
| Rhizosphere | 79.55 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.06 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0395900_0000133 | 3300037418 | Bacteria | 124692 |
| 2 | JGI24740J21852_10016707 | 3300001979 | Bacteria | 2643 |
| 3 | JGI25156J39149_1000114 | 3300002705 | Bacteria | 57756 |
| 4 | JGI25154J39366_1002215 | 3300002738 | Bacteria | 5358 |
| 5 | JGI25154J39366_1003246 | 3300002738 | Bacteria | 3542 |
| 6 | JGI25157J39369_1000015 | 3300002741 | Bacteria | 194042 |
| 7 | JGI25150J39212_1014060 | 3300002774 | Bacteria | 1369 |
| 8 | JGI25159J45721_1006583 | 3300002987 | Bacteria | 3459 |
| 9 | JGI25153J46596_10017655 | 3300003215 | Bacteria | 2803 |
| 10 | rootH2_10058683 | 3300003320 | Bacteria | 2490 |
| 11 | rootL2_10031669 | 3300003322 | Bacteria | 3117 |
| 12 | rootH1_10010269 | 3300003323 | Bacteria | 2239 |
| 13 | JGI26128J50194_1000617 | 3300003347 | Bacteria | 2036 |
| 14 | Ga0055539_1000967 | 3300003752 | Bacteria | 6333 |
| 15 | Ga0055533_1000010 | 3300003756 | Bacteria | 491196 |
| 16 | Ga0055525_1000013 | 3300003759 | Bacteria | 440870 |
| 17 | Ga0055525_1000074 | 3300003759 | Bacteria | 178058 |
| 18 | Ga0055525_1001452 | 3300003759 | Bacteria | 4263 |
| 19 | Ga0055535_1006711 | 3300003761 | Bacteria | 2292 |
| 20 | Ga0055542_1019745 | 3300003762 | Bacteria | 1000 |
| 21 | Ga0055529_1000100 | 3300003763 | Bacteria | 131049 |
| 22 | Ga0055529_1000303 | 3300003763 | Bacteria | 56663 |
| 23 | Ga0055526_1000010 | 3300003771 | Bacteria | 241512 |
| 24 | Ga0055526_1000104 | 3300003771 | Bacteria | 73451 |
| 25 | Ga0055526_1000410 | 3300003771 | Bacteria | 34678 |
| 26 | Ga0055537_1000200 | 3300003773 | Bacteria | 44838 |
| 27 | Ga0055524_1000025 | 3300003775 | Bacteria | 216427 |
| 28 | Ga0055524_1005355 | 3300003775 | Bacteria | 5748 |
| 29 | Ga0055524_1008185 | 3300003775 | Bacteria | 4365 |
| 30 | Ga0055534_1000083 | 3300003784 | Bacteria | 74541 |
| 31 | Ga0055528_1000372 | 3300003790 | Bacteria | 36454 |
| 32 | Ga0055540_1103473 | 3300003792 | Bacteria | 529 |
| 33 | Ga0055531_10000064 | 3300003794 | Bacteria | 117923 |
| 34 | Ga0055543_1004761 | 3300004625 | Bacteria | 3615 |
| 35 | Ga0055543_1049002 | 3300004625 | Bacteria | 696 |
| 36 | Ga0065165_1000074 | 3300005262 | Bacteria | 164454 |
| 37 | Ga0065165_1000120 | 3300005262 | Bacteria | 134211 |
| 38 | Ga0065165_1000889 | 3300005262 | Bacteria | 38581 |
| 39 | Ga0065165_1005640 | 3300005262 | Bacteria | 6921 |
| 40 | Ga0065165_1028015 | 3300005262 | Bacteria | 1827 |
| 41 | Ga0065165_1032237 | 3300005262 | Bacteria | 1645 |
| 42 | Ga0065707_10107803 | 3300005295 | Bacteria | 2538 |
| 43 | Ga0070658_10026499 | 3300005327 | Bacteria | 4651 |
| 44 | Ga0070658_10037732 | 3300005327 | Bacteria | 3895 |
| 45 | Ga0070658_10141993 | 3300005327 | Bacteria | 2006 |
| 46 | Ga0070658_10170300 | 3300005327 | Bacteria | 1829 |
| 47 | Ga0070658_11384646 | 3300005327 | Bacteria | 610 |
| 48 | Ga0070676_10095269 | 3300005328 | Bacteria | 1830 |
| 49 | Ga0070676_10155113 | 3300005328 | Bacteria | 1469 |
| 50 | Ga0070676_10222677 | 3300005328 | Bacteria | 1247 |
| 51 | Ga0070676_10366082 | 3300005328 | Bacteria | 995 |
| 52 | Ga0070676_10726973 | 3300005328 | Bacteria | 727 |
| 53 | Ga0070683_100005699 | 3300005329 | Bacteria | 10405 |
| 54 | Ga0070683_100109501 | 3300005329 | Bacteria | 2605 |
| 55 | Ga0070690_100001536 | 3300005330 | Bacteria | 12104 |
| 56 | Ga0070670_100044272 | 3300005331 | Bacteria | 3827 |
| 57 | Ga0070670_100045928 | 3300005331 | Bacteria | 3755 |
| 58 | Ga0070670_100050278 | 3300005331 | Bacteria | 3582 |
| 59 | Ga0070670_100156245 | 3300005331 | Bacteria | 1975 |
| 60 | Ga0070670_100393495 | 3300005331 | Bacteria | 1222 |
| 61 | Ga0070670_100811054 | 3300005331 | Bacteria | 845 |
| 62 | Ga0070670_101519250 | 3300005331 | Bacteria | 615 |
| 63 | Ga0070677_10007539 | 3300005333 | Bacteria | 3635 |
| 64 | Ga0070677_10017613 | 3300005333 | Bacteria | 2560 |
| 65 | Ga0070677_10226157 | 3300005333 | Bacteria | 917 |
| 66 | Ga0070677_10269223 | 3300005333 | Bacteria | 853 |
| 67 | Ga0068869_100036690 | 3300005334 | Bacteria | 3481 |
| 68 | Ga0068869_100772992 | 3300005334 | Bacteria | 824 |
| 69 | Ga0068869_101050214 | 3300005334 | Bacteria | 711 |
| 70 | Ga0070666_10680537 | 3300005335 | Bacteria | 754 |
| 71 | Ga0070680_100016692 | 3300005336 | Bacteria | 5780 |
| 72 | Ga0070680_100593369 | 3300005336 | Bacteria | 951 |
| 73 | Ga0070680_100815715 | 3300005336 | Bacteria | 804 |
| 74 | Ga0070680_100835370 | 3300005336 | Bacteria | 794 |
| 75 | Ga0070682_100050509 | 3300005337 | Bacteria | 2597 |
| 76 | Ga0070682_100303495 | 3300005337 | Bacteria | 1173 |
| 77 | Ga0068868_100078234 | 3300005338 | Bacteria | 2647 |
| 78 | Ga0070660_100025792 | 3300005339 | Bacteria | 4371 |
| 79 | Ga0070660_100061600 | 3300005339 | Bacteria | 2913 |
| 80 | Ga0070660_100478924 | 3300005339 | Bacteria | 1034 |
| 81 | Ga0070660_100806976 | 3300005339 | Bacteria | 789 |
| 82 | Ga0070660_101071812 | 3300005339 | Bacteria | 682 |
| 83 | Ga0070689_100674438 | 3300005340 | Bacteria | 901 |
| 84 | Ga0070661_100004078 | 3300005344 | Bacteria | 10061 |
| 85 | Ga0070661_100038941 | 3300005344 | Bacteria | 3462 |
| 86 | Ga0070661_100211037 | 3300005344 | Bacteria | 1486 |
| 87 | Ga0070661_100542839 | 3300005344 | Bacteria | 934 |
| 88 | Ga0070668_100634446 | 3300005347 | Bacteria | 937 |
| 89 | Ga0070669_100014248 | 3300005353 | Bacteria | 5657 |
| 90 | Ga0070669_100037978 | 3300005353 | Bacteria | 3495 |
| 91 | Ga0070669_100106693 | 3300005353 | Bacteria | 2121 |
| 92 | Ga0070669_100188610 | 3300005353 | Bacteria | 1616 |
| 93 | Ga0070669_100264513 | 3300005353 | Bacteria | 1373 |
| 94 | Ga0070669_100281790 | 3300005353 | Bacteria | 1332 |
| 95 | Ga0070675_100002690 | 3300005354 | Bacteria | 13361 |
| 96 | Ga0070675_100011188 | 3300005354 | Bacteria | 7020 |
| 97 | Ga0070675_100048103 | 3300005354 | Bacteria | 3496 |
| 98 | Ga0070675_100053943 | 3300005354 | Bacteria | 3306 |
| 99 | Ga0070675_100104159 | 3300005354 | Bacteria | 2393 |
| 100 | Ga0070675_100232111 | 3300005354 | Bacteria | 1610 |
| 101 | Ga0070675_100256119 | 3300005354 | Bacteria | 1533 |
| 102 | Ga0070675_100301189 | 3300005354 | Bacteria | 1412 |
| 103 | Ga0070675_100617491 | 3300005354 | Bacteria | 984 |
| 104 | Ga0070671_100036807 | 3300005355 | Bacteria | 4057 |
| 105 | Ga0070671_100038300 | 3300005355 | Bacteria | 3979 |
| 106 | Ga0070671_100219491 | 3300005355 | Bacteria | 1613 |
| 107 | Ga0070671_100358210 | 3300005355 | Bacteria | 1245 |
| 108 | Ga0070671_100529714 | 3300005355 | Bacteria | 1015 |
| 109 | Ga0070671_100634338 | 3300005355 | Bacteria | 924 |
| 110 | Ga0070674_100005898 | 3300005356 | Bacteria | 7122 |
| 111 | Ga0070674_100186772 | 3300005356 | Bacteria | 1591 |
| 112 | Ga0070674_100299279 | 3300005356 | Bacteria | 1282 |
| 113 | Ga0070674_100999724 | 3300005356 | Bacteria | 734 |
| 114 | Ga0070674_101106421 | 3300005356 | Bacteria | 700 |
| 115 | Ga0070673_100030293 | 3300005364 | Bacteria | 4046 |
| 116 | Ga0070673_100048345 | 3300005364 | Bacteria | 3315 |
| 117 | Ga0070673_100171447 | 3300005364 | Bacteria | 1852 |
| 118 | Ga0070673_100612918 | 3300005364 | Bacteria | 994 |
| 119 | Ga0070673_100753633 | 3300005364 | Bacteria | 897 |
| 120 | Ga0070673_101552796 | 3300005364 | Bacteria | 625 |
| 121 | Ga0070688_100387313 | 3300005365 | Bacteria | 1032 |
| 122 | Ga0070688_100723293 | 3300005365 | Bacteria | 773 |
| 123 | Ga0070659_100000666 | 3300005366 | Bacteria | 24947 |
| 124 | Ga0070659_100038040 | 3300005366 | Bacteria | 3751 |
| 125 | Ga0070659_100084714 | 3300005366 | Bacteria | 2534 |
| 126 | Ga0070659_100203977 | 3300005366 | Bacteria | 1628 |
| 127 | Ga0070667_100000677 | 3300005367 | Bacteria | 33094 |
| 128 | Ga0070667_100041820 | 3300005367 | Bacteria | 3844 |
| 129 | Ga0070667_100208611 | 3300005367 | Bacteria | 1736 |
| 130 | Ga0070667_100591749 | 3300005367 | Bacteria | 1022 |
| 131 | Ga0070667_101309330 | 3300005367 | Bacteria | 679 |
| 132 | Ga0070714_100406359 | 3300005435 | Bacteria | 1288 |
| 133 | Ga0070708_100199245 | 3300005445 | Bacteria | 1874 |
| 134 | Ga0070663_100006532 | 3300005455 | Bacteria | 7022 |
| 135 | Ga0070663_100280802 | 3300005455 | Bacteria | 1327 |
| 136 | Ga0070663_100292332 | 3300005455 | Bacteria | 1302 |
| 137 | Ga0070663_100351977 | 3300005455 | Bacteria | 1193 |
| 138 | Ga0070663_100524025 | 3300005455 | Bacteria | 987 |
| 139 | Ga0070663_101026899 | 3300005455 | Bacteria | 718 |
| 140 | Ga0070678_100009538 | 3300005456 | Bacteria | 5886 |
| 141 | Ga0070678_100009859 | 3300005456 | Bacteria | 5806 |
| 142 | Ga0070678_100017043 | 3300005456 | Bacteria | 4665 |
| 143 | Ga0070678_100557878 | 3300005456 | Bacteria | 1018 |
| 144 | Ga0070678_101128244 | 3300005456 | Bacteria | 725 |
| 145 | Ga0070678_101445105 | 3300005456 | Bacteria | 643 |
| 146 | Ga0070662_100116572 | 3300005457 | Bacteria | 2041 |
| 147 | Ga0070662_100181759 | 3300005457 | Bacteria | 1658 |
| 148 | Ga0070662_100840551 | 3300005457 | Bacteria | 781 |
| 149 | Ga0070662_101258287 | 3300005457 | Bacteria | 636 |
| 150 | Ga0070681_10026267 | 3300005458 | Bacteria | 5853 |
| 151 | Ga0070681_10358612 | 3300005458 | Bacteria | 1368 |
| 152 | Ga0068867_100003972 | 3300005459 | Bacteria | 10404 |
| 153 | Ga0068867_100004620 | 3300005459 | Bacteria | 9689 |
| 154 | Ga0068867_100006451 | 3300005459 | Bacteria | 8284 |
| 155 | Ga0068867_100012180 | 3300005459 | Bacteria | 6077 |
| 156 | Ga0068867_100148304 | 3300005459 | Bacteria | 1840 |
| 157 | Ga0068867_100221025 | 3300005459 | Bacteria | 1526 |
| 158 | Ga0068867_100284181 | 3300005459 | Bacteria | 1358 |
| 159 | Ga0068867_100847655 | 3300005459 | Bacteria | 818 |
| 160 | Ga0070685_10991557 | 3300005466 | Bacteria | 630 |
| 161 | Ga0070706_100013624 | 3300005467 | Bacteria | 7517 |
| 162 | Ga0070706_100061300 | 3300005467 | Bacteria | 3474 |
| 163 | Ga0070679_100028221 | 3300005530 | Bacteria | 5532 |
| 164 | Ga0070684_100032261 | 3300005535 | Bacteria | 4463 |
| 165 | Ga0070684_100110528 | 3300005535 | Bacteria | 2464 |
| 166 | Ga0068853_100066374 | 3300005539 | Bacteria | 3133 |
| 167 | Ga0068853_100137713 | 3300005539 | Bacteria | 2189 |
| 168 | Ga0068853_100525537 | 3300005539 | Bacteria | 1119 |
| 169 | Ga0068853_100542851 | 3300005539 | Bacteria | 1101 |
| 170 | Ga0070672_100014390 | 3300005543 | Bacteria | 5606 |
| 171 | Ga0070672_100014964 | 3300005543 | Bacteria | 5511 |
| 172 | Ga0070672_100128138 | 3300005543 | Bacteria | 2084 |
| 173 | Ga0070672_100219223 | 3300005543 | Bacteria | 1595 |
| 174 | Ga0070686_100289447 | 3300005544 | Bacteria | 1211 |
| 175 | Ga0070686_100630358 | 3300005544 | Bacteria | 848 |
| 176 | Ga0070693_100064607 | 3300005547 | Bacteria | 2137 |
| 177 | Ga0070693_100155581 | 3300005547 | Bacteria | 1451 |
| 178 | Ga0070693_100418017 | 3300005547 | Bacteria | 934 |
| 179 | Ga0070665_100056462 | 3300005548 | Bacteria | 3936 |
| 180 | Ga0070665_100195862 | 3300005548 | Bacteria | 2021 |
| 181 | Ga0070665_100257967 | 3300005548 | Bacteria | 1744 |
| 182 | Ga0070665_100348547 | 3300005548 | Bacteria | 1486 |
| 183 | Ga0070665_102019592 | 3300005548 | Bacteria | 582 |
| 184 | Ga0068855_100019587 | 3300005563 | Bacteria | 8127 |
| 185 | Ga0068855_100064421 | 3300005563 | Bacteria | 4275 |
| 186 | Ga0068855_100139662 | 3300005563 | Bacteria | 2763 |
| 187 | Ga0068855_100194335 | 3300005563 | Bacteria | 2287 |
| 188 | Ga0068855_100621090 | 3300005563 | Bacteria | 1163 |
| 189 | Ga0068855_100714985 | 3300005563 | Bacteria | 1071 |
| 190 | Ga0070664_100027119 | 3300005564 | Bacteria | 4759 |
| 191 | Ga0070664_100037626 | 3300005564 | Bacteria | 4069 |
| 192 | Ga0070664_100043037 | 3300005564 | Bacteria | 3810 |
| 193 | Ga0070664_100360173 | 3300005564 | Bacteria | 1324 |
| 194 | Ga0070664_100403408 | 3300005564 | Bacteria | 1250 |
| 195 | Ga0070664_100551765 | 3300005564 | Bacteria | 1065 |
| 196 | Ga0070664_100618262 | 3300005564 | Bacteria | 1005 |
| 197 | Ga0070664_100796299 | 3300005564 | Bacteria | 884 |
| 198 | Ga0068857_100729936 | 3300005577 | Bacteria | 942 |
| 199 | Ga0068857_101028775 | 3300005577 | Bacteria | 793 |
| 200 | Ga0068854_100000903 | 3300005578 | Bacteria | 17876 |
| 201 | Ga0068854_100040558 | 3300005578 | Bacteria | 3285 |
| 202 | Ga0068854_100334516 | 3300005578 | Bacteria | 1235 |
| 203 | Ga0068856_100016907 | 3300005614 | Bacteria | 7070 |
| 204 | Ga0068856_100063174 | 3300005614 | Bacteria | 3658 |
| 205 | Ga0068856_100945156 | 3300005614 | Bacteria | 881 |
| 206 | Ga0068856_101153496 | 3300005614 | Bacteria | 792 |
| 207 | Ga0068852_100024399 | 3300005616 | Bacteria | 4886 |
| 208 | Ga0068852_100033409 | 3300005616 | Bacteria | 4270 |
| 209 | Ga0068852_100063334 | 3300005616 | Bacteria | 3220 |
| 210 | Ga0068852_100275484 | 3300005616 | Bacteria | 1620 |
| 211 | Ga0068852_100294866 | 3300005616 | Bacteria | 1568 |
| 212 | Ga0068852_100349956 | 3300005616 | Bacteria | 1442 |
| 213 | Ga0068852_100455717 | 3300005616 | Bacteria | 1267 |
| 214 | Ga0068852_100976152 | 3300005616 | Bacteria | 865 |
| 215 | Ga0068852_101430659 | 3300005616 | Bacteria | 713 |
| 216 | Ga0068859_100027031 | 3300005617 | Bacteria | 5755 |
| 217 | Ga0068859_100035700 | 3300005617 | Bacteria | 4988 |
| 218 | Ga0068859_100083488 | 3300005617 | Bacteria | 3238 |
| 219 | Ga0068859_100272232 | 3300005617 | Bacteria | 1786 |
| 220 | Ga0068859_101077292 | 3300005617 | Bacteria | 884 |
| 221 | Ga0068864_100009238 | 3300005618 | Bacteria | 8129 |
| 222 | Ga0068864_100069099 | 3300005618 | Bacteria | 3071 |
| 223 | Ga0068866_10010005 | 3300005718 | Bacteria | 4051 |
| 224 | Ga0068866_10033904 | 3300005718 | Bacteria | 2482 |
| 225 | Ga0068866_10291282 | 3300005718 | Bacteria | 1015 |
| 226 | Ga0068861_100001416 | 3300005719 | Bacteria | 15100 |
| 227 | Ga0068861_100005119 | 3300005719 | Bacteria | 8841 |
| 228 | Ga0068861_100013239 | 3300005719 | Bacteria | 5771 |
| 229 | Ga0068851_10021738 | 3300005834 | Bacteria | 3116 |
| 230 | Ga0068851_10036008 | 3300005834 | Bacteria | 2477 |
| 231 | Ga0068851_10065777 | 3300005834 | Bacteria | 1866 |
| 232 | Ga0068851_10594962 | 3300005834 | Bacteria | 673 |
| 233 | Ga0068863_100087934 | 3300005841 | Bacteria | 2944 |
| 234 | Ga0068863_100970866 | 3300005841 | Bacteria | 852 |
| 235 | Ga0068863_102153713 | 3300005841 | Bacteria | 568 |
| 236 | Ga0068858_100006788 | 3300005842 | Bacteria | 11135 |
| 237 | Ga0068858_100073500 | 3300005842 | Bacteria | 3173 |
| 238 | Ga0068858_101523109 | 3300005842 | Bacteria | 660 |
| 239 | Ga0068860_100000903 | 3300005843 | Bacteria | 32899 |
| 240 | Ga0068860_100008648 | 3300005843 | Bacteria | 10144 |
| 241 | Ga0068860_100372371 | 3300005843 | Bacteria | 1409 |
| 242 | Ga0068862_100007315 | 3300005844 | Bacteria | 9166 |
| 243 | Ga0068862_100033939 | 3300005844 | Bacteria | 4316 |
| 244 | Ga0068862_100100036 | 3300005844 | Bacteria | 2535 |
| 245 | Ga0068862_100603560 | 3300005844 | Bacteria | 1054 |
| 246 | Ga0068862_101903787 | 3300005844 | Bacteria | 605 |
| 247 | Ga0081455_10154969 | 3300005937 | Bacteria | 1762 |
| 248 | Ga0075363_100191580 | 3300006048 | Bacteria | 1166 |
| 249 | Ga0075364_10686904 | 3300006051 | Bacteria | 699 |
| 250 | Ga0075362_10105057 | 3300006177 | Bacteria | 1324 |
| 251 | Ga0075362_10162763 | 3300006177 | Bacteria | 1075 |
| 252 | Ga0075362_10169259 | 3300006177 | Bacteria | 1055 |
| 253 | Ga0075362_10232140 | 3300006177 | Bacteria | 904 |
| 254 | Ga0075367_10087101 | 3300006178 | Bacteria | 1896 |
| 255 | Ga0075367_10485311 | 3300006178 | Bacteria | 784 |
| 256 | Ga0075366_10023840 | 3300006195 | Bacteria | 3566 |
| 257 | Ga0075366_10069763 | 3300006195 | Bacteria | 2092 |
| 258 | Ga0075366_10161165 | 3300006195 | Bacteria | 1359 |
| 259 | Ga0075366_10245148 | 3300006195 | Bacteria | 1092 |
| 260 | Ga0075366_10506264 | 3300006195 | Bacteria | 747 |
| 261 | Ga0075366_10820974 | 3300006195 | Bacteria | 578 |
| 262 | Ga0075366_10975405 | 3300006195 | Bacteria | 528 |
| 263 | Ga0097621_100098460 | 3300006237 | Bacteria | 2457 |
| 264 | Ga0097621_100293346 | 3300006237 | Bacteria | 1434 |
| 265 | Ga0097621_100806884 | 3300006237 | Bacteria | 870 |
| 266 | Ga0097621_101655116 | 3300006237 | Bacteria | 609 |
| 267 | Ga0075370_10011463 | 3300006353 | Bacteria | 4659 |
| 268 | Ga0075370_10020006 | 3300006353 | Bacteria | 3651 |
| 269 | Ga0075370_10051619 | 3300006353 | Bacteria | 2333 |
| 270 | Ga0075370_10181382 | 3300006353 | Bacteria | 1239 |
| 271 | Ga0075370_10498900 | 3300006353 | Bacteria | 734 |
| 272 | Ga0075370_10647199 | 3300006353 | Bacteria | 641 |
| 273 | Ga0068871_100014710 | 3300006358 | Bacteria | 5839 |
| 274 | Ga0068871_100014932 | 3300006358 | Bacteria | 5806 |
| 275 | Ga0068871_100049440 | 3300006358 | Bacteria | 3399 |
| 276 | Ga0068871_100051168 | 3300006358 | Bacteria | 3344 |
| 277 | Ga0068871_100330659 | 3300006358 | Bacteria | 1344 |
| 278 | Ga0075430_100082328 | 3300006846 | Bacteria | 2697 |
| 279 | Ga0075429_100008833 | 3300006880 | Bacteria | 8761 |
| 280 | Ga0068865_100003663 | 3300006881 | Bacteria | 9226 |
| 281 | Ga0068865_100233935 | 3300006881 | Bacteria | 1443 |
| 282 | Ga0068865_100289236 | 3300006881 | Bacteria | 1307 |
| 283 | Ga0068865_100437424 | 3300006881 | Bacteria | 1079 |
| 284 | Ga0068865_100707074 | 3300006881 | Bacteria | 862 |
| 285 | Ga0068865_100859153 | 3300006881 | Bacteria | 786 |
| 286 | Ga0097620_100027032 | 3300006931 | Bacteria | 5755 |
| 287 | Ga0097620_100035700 | 3300006931 | Bacteria | 4988 |
| 288 | Ga0097620_100083487 | 3300006931 | Bacteria | 3238 |
| 289 | Ga0097620_100272234 | 3300006931 | Bacteria | 1786 |
| 290 | Ga0097620_101077262 | 3300006931 | Bacteria | 884 |
| 291 | Ga0079104_1000273 | 3300006946 | Bacteria | 67267 |
| 292 | Ga0079104_1003849 | 3300006946 | Bacteria | 6724 |
| 293 | Ga0079104_1059468 | 3300006946 | Bacteria | 827 |
| 294 | Ga0099826_10000005 | 3300006948 | Bacteria | 465206 |
| 295 | Ga0075435_101387957 | 3300007076 | Bacteria | 616 |
| 296 | Ga0105244_10002947 | 3300009036 | Bacteria | 12550 |
| 297 | Ga0105244_10004312 | 3300009036 | Bacteria | 9842 |
| 298 | Ga0105244_10162888 | 3300009036 | Bacteria | 1064 |
| 299 | Ga0105244_10280324 | 3300009036 | Bacteria | 773 |
| 300 | Ga0111539_10941517 | 3300009094 | Bacteria | 1004 |
| 301 | Ga0105245_10036044 | 3300009098 | Bacteria | 4392 |
| 302 | Ga0105245_10222432 | 3300009098 | Bacteria | 1822 |
| 303 | Ga0105245_11116907 | 3300009098 | Bacteria | 835 |
| 304 | Ga0114129_10137155 | 3300009147 | Bacteria | 3356 |
| 305 | Ga0105243_10023700 | 3300009148 | Bacteria | 4677 |
| 306 | Ga0105243_10063627 | 3300009148 | Bacteria | 2956 |
| 307 | Ga0105243_10138979 | 3300009148 | Bacteria | 2070 |
| 308 | Ga0105243_10435328 | 3300009148 | Bacteria | 1227 |
| 309 | Ga0105243_10950944 | 3300009148 | Bacteria | 858 |
| 310 | Ga0105241_10023999 | 3300009174 | Bacteria | 4527 |
| 311 | Ga0105241_10242877 | 3300009174 | Bacteria | 1523 |
| 312 | Ga0105241_11022846 | 3300009174 | Bacteria | 774 |
| 313 | Ga0105242_10269981 | 3300009176 | Bacteria | 1540 |
| 314 | Ga0105242_10365056 | 3300009176 | Bacteria | 1337 |
| 315 | Ga0105242_11024226 | 3300009176 | Bacteria | 835 |
| 316 | Ga0105242_11774809 | 3300009176 | Bacteria | 655 |
| 317 | Ga0105248_10000595 | 3300009177 | Bacteria | 41224 |
| 318 | Ga0105248_10027182 | 3300009177 | Bacteria | 6364 |
| 319 | Ga0105248_10112431 | 3300009177 | Bacteria | 3071 |
| 320 | Ga0105248_10204255 | 3300009177 | Bacteria | 2226 |
| 321 | Ga0105248_10498071 | 3300009177 | Bacteria | 1373 |
| 322 | Ga0105248_11331677 | 3300009177 | Bacteria | 812 |
| 323 | Ga0105237_10172915 | 3300009545 | Bacteria | 2160 |
| 324 | Ga0105237_10212870 | 3300009545 | Bacteria | 1932 |
| 325 | Ga0105237_10399046 | 3300009545 | Bacteria | 1380 |
| 326 | Ga0105237_11143531 | 3300009545 | Bacteria | 785 |
| 327 | Ga0105238_10003253 | 3300009551 | Bacteria | 16214 |
| 328 | Ga0105238_10052730 | 3300009551 | Bacteria | 4088 |
| 329 | Ga0105238_10108100 | 3300009551 | Bacteria | 2762 |
| 330 | Ga0105238_10275226 | 3300009551 | Bacteria | 1664 |
| 331 | Ga0105249_10572519 | 3300009553 | Bacteria | 1182 |
| 332 | Ga0105249_12040167 | 3300009553 | Bacteria | 646 |
| 333 | Ga0105239_10080637 | 3300010375 | Bacteria | 3581 |
| 334 | Ga0105239_10785653 | 3300010375 | Bacteria | 1090 |
| 335 | Ga0105246_10400389 | 3300011119 | Bacteria | 1140 |
| 336 | Ga0157324_1035756 | 3300012506 | Bacteria | 585 |
| 337 | Ga0157326_1013205 | 3300012513 | Bacteria | 950 |
| 338 | Ga0157373_10017629 | 3300013100 | Bacteria | 5200 |
| 339 | Ga0157373_10877224 | 3300013100 | Bacteria | 665 |
| 340 | Ga0157371_10171540 | 3300013102 | Bacteria | 1550 |
| 341 | Ga0157371_10430578 | 3300013102 | Bacteria | 968 |
| 342 | Ga0157370_10561401 | 3300013104 | Bacteria | 1046 |
| 343 | Ga0157369_10018014 | 3300013105 | Bacteria | 7924 |
| 344 | Ga0157369_10049207 | 3300013105 | Bacteria | 4570 |
| 345 | Ga0157369_11075203 | 3300013105 | Bacteria | 823 |
| 346 | Ga0157369_11119535 | 3300013105 | Bacteria | 804 |
| 347 | Ga0157369_11530978 | 3300013105 | Bacteria | 678 |
| 348 | Ga0157374_10075363 | 3300013296 | Bacteria | 3188 |
| 349 | Ga0157374_10091458 | 3300013296 | Bacteria | 2902 |
| 350 | Ga0157374_10136709 | 3300013296 | Bacteria | 2376 |
| 351 | Ga0157374_10954611 | 3300013296 | Bacteria | 876 |
| 352 | Ga0157374_11124861 | 3300013296 | Bacteria | 806 |
| 353 | Ga0157374_12440091 | 3300013296 | Bacteria | 550 |
| 354 | Ga0157378_10345680 | 3300013297 | Bacteria | 1452 |
| 355 | Ga0157378_10648722 | 3300013297 | Bacteria | 1071 |
| 356 | Ga0157378_11279228 | 3300013297 | Bacteria | 774 |
| 357 | Ga0157378_11435357 | 3300013297 | Bacteria | 734 |
| 358 | Ga0163162_10040290 | 3300013306 | Bacteria | 4671 |
| 359 | Ga0163162_10154852 | 3300013306 | Bacteria | 2411 |
| 360 | Ga0163162_11211092 | 3300013306 | Bacteria | 857 |
| 361 | Ga0163162_11716639 | 3300013306 | Bacteria | 717 |
| 362 | Ga0157372_10042427 | 3300013307 | Bacteria | 5032 |
| 363 | Ga0157372_10334629 | 3300013307 | Bacteria | 1763 |
| 364 | Ga0157372_10601169 | 3300013307 | Bacteria | 1282 |
| 365 | Ga0157372_10986112 | 3300013307 | Bacteria | 976 |
| 366 | Ga0157372_11281337 | 3300013307 | Bacteria | 846 |
| 367 | Ga0157372_12697135 | 3300013307 | Bacteria | 570 |
| 368 | Ga0157375_10045304 | 3300013308 | Bacteria | 4280 |
| 369 | Ga0157375_10065030 | 3300013308 | Bacteria | 3634 |
| 370 | Ga0157375_10112570 | 3300013308 | Bacteria | 2822 |
| 371 | Ga0157375_10616094 | 3300013308 | Bacteria | 1244 |
| 372 | Ga0163163_10190597 | 3300014325 | Bacteria | 2099 |
| 373 | Ga0163163_11056694 | 3300014325 | Bacteria | 875 |
| 374 | Ga0163163_11516962 | 3300014325 | Bacteria | 731 |
| 375 | Ga0157380_10007364 | 3300014326 | Bacteria | 7813 |
| 376 | Ga0157380_10013785 | 3300014326 | Bacteria | 5903 |
| 377 | Ga0157380_10038853 | 3300014326 | Bacteria | 3698 |
| 378 | Ga0157380_10256033 | 3300014326 | Bacteria | 1587 |
| 379 | Ga0157380_10833381 | 3300014326 | Bacteria | 942 |
| 380 | Ga0182008_10001405 | 3300014497 | Bacteria | 16197 |
| 381 | Ga0182008_10388828 | 3300014497 | Bacteria | 747 |
| 382 | Ga0157377_10000294 | 3300014745 | Bacteria | 23613 |
| 383 | Ga0157377_10586265 | 3300014745 | Bacteria | 793 |
| 384 | Ga0157379_10023168 | 3300014968 | Bacteria | 5507 |
| 385 | Ga0157379_10025892 | 3300014968 | Bacteria | 5215 |
| 386 | Ga0157379_10089602 | 3300014968 | Bacteria | 2760 |
| 387 | Ga0157379_10107716 | 3300014968 | Bacteria | 2502 |
| 388 | Ga0157376_10004653 | 3300014969 | Bacteria | 9562 |
| 389 | Ga0157376_10079761 | 3300014969 | Bacteria | 2807 |
| 390 | Ga0157376_10115009 | 3300014969 | Bacteria | 2375 |
| 391 | Ga0157376_10202284 | 3300014969 | Bacteria | 1828 |
| 392 | Ga0157376_10305066 | 3300014969 | Bacteria | 1508 |
| 393 | Ga0157376_10663038 | 3300014969 | Bacteria | 1045 |
| 394 | Ga0157376_12097438 | 3300014969 | Bacteria | 604 |
| 395 | Ga0182006_1000004 | 3300015261 | Bacteria | 622190 |
| 396 | Ga0182006_1000176 | 3300015261 | Bacteria | 67387 |
| 397 | Ga0182007_10000017 | 3300015262 | Bacteria | 199097 |
| 398 | Ga0182007_10127552 | 3300015262 | Bacteria | 854 |
| 399 | Ga0182007_10189429 | 3300015262 | Bacteria | 715 |
| 400 | Ga0182005_1000005 | 3300015265 | Bacteria | 537378 |
| 401 | Ga0182005_1000030 | 3300015265 | Bacteria | 213092 |
| 402 | Ga0182005_1099447 | 3300015265 | Bacteria | 814 |
| 403 | Ga0163161_10020753 | 3300017792 | Bacteria | 4612 |
| 404 | Ga0163161_10021914 | 3300017792 | Bacteria | 4492 |
| 405 | Ga0163161_10048829 | 3300017792 | Bacteria | 3057 |
| 406 | Ga0163161_10104696 | 3300017792 | Bacteria | 2109 |
| 407 | Ga0163161_10180987 | 3300017792 | Bacteria | 1616 |
| 408 | Ga0163161_10232114 | 3300017792 | Bacteria | 1432 |
| 409 | Ga0163161_10694080 | 3300017792 | Bacteria | 847 |
| 410 | Ga0163161_10722683 | 3300017792 | Bacteria | 831 |
| 411 | Ga0163161_10889649 | 3300017792 | Bacteria | 754 |
| 412 | Ga0213872_10000035 | 3300021361 | Bacteria | 133053 |
| 413 | Ga0213872_10000127 | 3300021361 | Bacteria | 69204 |
| 414 | Ga0213872_10000139 | 3300021361 | Bacteria | 65459 |
| 415 | Ga0213872_10000160 | 3300021361 | Bacteria | 61551 |
| 416 | Ga0213872_10000683 | 3300021361 | Bacteria | 25720 |
| 417 | Ga0213872_10018814 | 3300021361 | Bacteria | 3183 |
| 418 | Ga0213872_10028189 | 3300021361 | Bacteria | 2576 |
| 419 | Ga0213872_10158072 | 3300021361 | Bacteria | 987 |
| 420 | Ga0209674_100003 | 3300025226 | Bacteria | 2196646 |
| 421 | Ga0209672_113998 | 3300025228 | Bacteria | 942 |
| 422 | Ga0209563_100003 | 3300025230 | Bacteria | 1932942 |
| 423 | Ga0209563_100010 | 3300025230 | Bacteria | 1337457 |
| 424 | Ga0209563_100025 | 3300025230 | Bacteria | 596456 |
| 425 | Ga0207427_104232 | 3300025231 | Bacteria | 2518 |
| 426 | Ga0209258_100163 | 3300025242 | Bacteria | 149677 |
| 427 | Ga0209258_100627 | 3300025242 | Bacteria | 27977 |
| 428 | Ga0207425_1000376 | 3300025245 | Bacteria | 30569 |
| 429 | Ga0209646_1000036 | 3300025246 | Bacteria | 358864 |
| 430 | Ga0209646_1000138 | 3300025246 | Bacteria | 114892 |
| 431 | Ga0209026_1000021 | 3300025250 | Bacteria | 375165 |
| 432 | Ga0209677_100093 | 3300025253 | Bacteria | 101695 |
| 433 | Ga0209677_100817 | 3300025253 | Bacteria | 15553 |
| 434 | Ga0209677_102569 | 3300025253 | Bacteria | 6689 |
| 435 | Ga0209677_102895 | 3300025253 | Bacteria | 6026 |
| 436 | Ga0209148_1000203 | 3300025254 | Bacteria | 105950 |
| 437 | Ga0209759_1000025 | 3300025256 | Bacteria | 317082 |
| 438 | Ga0209759_1001158 | 3300025256 | Bacteria | 16724 |
| 439 | Ga0209759_1013130 | 3300025256 | Bacteria | 2256 |
| 440 | Ga0209565_1000068 | 3300025263 | Bacteria | 171201 |
| 441 | Ga0209565_1011943 | 3300025263 | Bacteria | 2093 |
| 442 | Ga0209455_1000047 | 3300025272 | Bacteria | 379709 |
| 443 | Ga0209455_1000059 | 3300025272 | Bacteria | 339995 |
| 444 | Ga0209673_1000119 | 3300025273 | Bacteria | 171203 |
| 445 | Ga0209673_1006475 | 3300025273 | Bacteria | 5650 |
| 446 | Ga0209130_1000057 | 3300025284 | Bacteria | 210593 |
| 447 | Ga0209675_1000068 | 3300025291 | Bacteria | 171202 |
| 448 | Ga0209675_1012938 | 3300025291 | Bacteria | 2649 |
| 449 | Ga0209025_1004584 | 3300025294 | Bacteria | 11853 |
| 450 | Ga0209564_1000060 | 3300025295 | Bacteria | 325890 |
| 451 | Ga0209564_1000141 | 3300025295 | Bacteria | 179852 |
| 452 | Ga0209564_1000149 | 3300025295 | Bacteria | 170958 |
| 453 | Ga0209758_1000941 | 3300025297 | Bacteria | 39283 |
| 454 | Ga0209256_1000024 | 3300025299 | Bacteria | 448909 |
| 455 | Ga0209256_1000040 | 3300025299 | Bacteria | 366839 |
| 456 | Ga0209256_1000173 | 3300025299 | Bacteria | 129001 |
| 457 | Ga0209051_1003858 | 3300025303 | Bacteria | 9585 |
| 458 | Ga0209051_1004022 | 3300025303 | Bacteria | 9305 |
| 459 | Ga0209051_1011624 | 3300025303 | Bacteria | 4328 |
| 460 | Ga0209257_1000032 | 3300025304 | Bacteria | 680354 |
| 461 | Ga0207656_10083296 | 3300025321 | Bacteria | 1441 |
| 462 | Ga0207655_1022557 | 3300025728 | Bacteria | 3150 |
| 463 | Ga0207655_1024930 | 3300025728 | Bacteria | 2918 |
| 464 | Ga0207682_10001255 | 3300025893 | Bacteria | 11730 |
| 465 | Ga0207682_10114555 | 3300025893 | Bacteria | 1190 |
| 466 | Ga0207682_10229071 | 3300025893 | Bacteria | 861 |
| 467 | Ga0207682_10297195 | 3300025893 | Bacteria | 757 |
| 468 | Ga0207642_10025093 | 3300025899 | Bacteria | 2406 |
| 469 | Ga0207642_10075539 | 3300025899 | Bacteria | 1619 |
| 470 | Ga0207710_10372598 | 3300025900 | Bacteria | 730 |
| 471 | Ga0207688_10005290 | 3300025901 | Bacteria | 7013 |
| 472 | Ga0207645_10031533 | 3300025907 | Bacteria | 3410 |
| 473 | Ga0207645_10128376 | 3300025907 | Bacteria | 1649 |
| 474 | Ga0207645_10219054 | 3300025907 | Bacteria | 1254 |
| 475 | Ga0207645_10293283 | 3300025907 | Bacteria | 1082 |
| 476 | Ga0207705_10011989 | 3300025909 | Bacteria | 6265 |
| 477 | Ga0207705_11042357 | 3300025909 | Bacteria | 631 |
| 478 | Ga0207654_10021482 | 3300025911 | Bacteria | 3432 |
| 479 | Ga0207707_10108844 | 3300025912 | Bacteria | 2423 |
| 480 | Ga0207695_10080700 | 3300025913 | Bacteria | 3294 |
| 481 | Ga0207695_10084675 | 3300025913 | Bacteria | 3201 |
| 482 | Ga0207671_10164373 | 3300025914 | Bacteria | 1720 |
| 483 | Ga0207660_10004601 | 3300025917 | Bacteria | 8988 |
| 484 | Ga0207660_10590952 | 3300025917 | Bacteria | 904 |
| 485 | Ga0207657_10020777 | 3300025919 | Bacteria | 6197 |
| 486 | Ga0207657_10084454 | 3300025919 | Bacteria | 2661 |
| 487 | Ga0207657_10457320 | 3300025919 | Bacteria | 1001 |
| 488 | Ga0207657_10982071 | 3300025919 | Bacteria | 648 |
| 489 | Ga0207649_10010449 | 3300025920 | Bacteria | 5101 |
| 490 | Ga0207649_10028943 | 3300025920 | Bacteria | 3267 |
| 491 | Ga0207649_10154052 | 3300025920 | Bacteria | 1586 |
| 492 | Ga0207649_10737776 | 3300025920 | Bacteria | 766 |
| 493 | Ga0207652_10080840 | 3300025921 | Bacteria | 2842 |
| 494 | Ga0207652_10452857 | 3300025921 | Bacteria | 1157 |
| 495 | Ga0207681_10032182 | 3300025923 | Bacteria | 3432 |
| 496 | Ga0207681_10037994 | 3300025923 | Bacteria | 3186 |
| 497 | Ga0207681_10043789 | 3300025923 | Bacteria | 2997 |
| 498 | Ga0207681_10061997 | 3300025923 | Bacteria | 2573 |
| 499 | Ga0207681_10499004 | 3300025923 | Bacteria | 996 |
| 500 | Ga0207681_10868202 | 3300025923 | Bacteria | 755 |
| 501 | Ga0207650_10010814 | 3300025925 | Bacteria | 6268 |
| 502 | Ga0207650_10019962 | 3300025925 | Bacteria | 4718 |
| 503 | Ga0207659_10030843 | 3300025926 | Bacteria | 3666 |
| 504 | Ga0207659_10211488 | 3300025926 | Bacteria | 1555 |
| 505 | Ga0207659_10217458 | 3300025926 | Bacteria | 1534 |
| 506 | Ga0207659_10302321 | 3300025926 | Bacteria | 1314 |
| 507 | Ga0207659_10659996 | 3300025926 | Bacteria | 894 |
| 508 | Ga0207687_10008809 | 3300025927 | Bacteria | 6594 |
| 509 | Ga0207687_10406772 | 3300025927 | Bacteria | 1120 |
| 510 | Ga0207687_10430098 | 3300025927 | Bacteria | 1091 |
| 511 | Ga0207687_11132129 | 3300025927 | Bacteria | 672 |
| 512 | Ga0207644_10033398 | 3300025931 | Bacteria | 3595 |
| 513 | Ga0207644_10053041 | 3300025931 | Bacteria | 2917 |
| 514 | Ga0207644_10062491 | 3300025931 | Bacteria | 2701 |
| 515 | Ga0207644_10196003 | 3300025931 | Bacteria | 1591 |
| 516 | Ga0207690_10004038 | 3300025932 | Bacteria | 8665 |
| 517 | Ga0207690_10170685 | 3300025932 | Bacteria | 1629 |
| 518 | Ga0207690_10268912 | 3300025932 | Bacteria | 1323 |
| 519 | Ga0207706_10004089 | 3300025933 | Bacteria | 13782 |
| 520 | Ga0207706_10058771 | 3300025933 | Bacteria | 3386 |
| 521 | Ga0207706_10284462 | 3300025933 | Bacteria | 1442 |
| 522 | Ga0207706_10438292 | 3300025933 | Bacteria | 1131 |
| 523 | Ga0207706_10440688 | 3300025933 | Bacteria | 1128 |
| 524 | Ga0207686_10032006 | 3300025934 | Bacteria | 3127 |
| 525 | Ga0207686_10063522 | 3300025934 | Bacteria | 2348 |
| 526 | Ga0207709_10025634 | 3300025935 | Bacteria | 3377 |
| 527 | Ga0207709_10041325 | 3300025935 | Bacteria | 2766 |
| 528 | Ga0207709_10064766 | 3300025935 | Bacteria | 2296 |
| 529 | Ga0207709_11175023 | 3300025935 | Bacteria | 632 |
| 530 | Ga0207670_10737083 | 3300025936 | Bacteria | 818 |
| 531 | Ga0207669_10112485 | 3300025937 | Bacteria | 1828 |
| 532 | Ga0207669_10611394 | 3300025937 | Bacteria | 887 |
| 533 | Ga0207669_11947629 | 3300025937 | Bacteria | 502 |
| 534 | Ga0207704_10005537 | 3300025938 | Bacteria | 5819 |
| 535 | Ga0207704_10083314 | 3300025938 | Bacteria | 2075 |
| 536 | Ga0207704_10517258 | 3300025938 | Bacteria | 965 |
| 537 | Ga0207691_10011878 | 3300025940 | Bacteria | 8357 |
| 538 | Ga0207691_10057109 | 3300025940 | Bacteria | 3554 |
| 539 | Ga0207691_10272294 | 3300025940 | Bacteria | 1458 |
| 540 | Ga0207691_10315262 | 3300025940 | Bacteria | 1341 |
| 541 | Ga0207711_10001919 | 3300025941 | Bacteria | 18885 |
| 542 | Ga0207711_10006066 | 3300025941 | Bacteria | 10211 |
| 543 | Ga0207711_10749057 | 3300025941 | Bacteria | 911 |
| 544 | Ga0207711_11612572 | 3300025941 | Bacteria | 592 |
| 545 | Ga0207689_10008328 | 3300025942 | Bacteria | 9033 |
| 546 | Ga0207689_10442637 | 3300025942 | Bacteria | 1086 |
| 547 | Ga0207661_10840130 | 3300025944 | Bacteria | 845 |
| 548 | Ga0207679_10016886 | 3300025945 | Bacteria | 4853 |
| 549 | Ga0207679_10024101 | 3300025945 | Bacteria | 4169 |
| 550 | Ga0207679_10060411 | 3300025945 | Bacteria | 2816 |
| 551 | Ga0207679_10162791 | 3300025945 | Bacteria | 1828 |
| 552 | Ga0207679_10376143 | 3300025945 | Bacteria | 1244 |
| 553 | Ga0207679_10593518 | 3300025945 | Bacteria | 997 |
| 554 | Ga0207667_10078788 | 3300025949 | Bacteria | 3414 |
| 555 | Ga0207667_10115407 | 3300025949 | Bacteria | 2768 |
| 556 | Ga0207667_10874050 | 3300025949 | Bacteria | 892 |
| 557 | Ga0207667_11091962 | 3300025949 | Bacteria | 781 |
| 558 | Ga0207651_10013982 | 3300025960 | Bacteria | 4619 |
| 559 | Ga0207651_10134791 | 3300025960 | Bacteria | 1897 |
| 560 | Ga0207651_10172606 | 3300025960 | Bacteria | 1707 |
| 561 | Ga0207651_10198999 | 3300025960 | Bacteria | 1604 |
| 562 | Ga0207651_10217888 | 3300025960 | Bacteria | 1541 |
| 563 | Ga0207651_12023631 | 3300025960 | Bacteria | 517 |
| 564 | Ga0207712_10219856 | 3300025961 | Bacteria | 1518 |
| 565 | Ga0207668_10275466 | 3300025972 | Bacteria | 1377 |
| 566 | Ga0207640_10216373 | 3300025981 | Bacteria | 1463 |
| 567 | Ga0207658_10002360 | 3300025986 | Bacteria | 13877 |
| 568 | Ga0207658_10515090 | 3300025986 | Bacteria | 1067 |
| 569 | Ga0207658_10747993 | 3300025986 | Bacteria | 885 |
| 570 | Ga0207658_10962500 | 3300025986 | Bacteria | 778 |
| 571 | Ga0207658_11037347 | 3300025986 | Bacteria | 748 |
| 572 | Ga0207677_10004412 | 3300026023 | Bacteria | 7546 |
| 573 | Ga0207677_10211222 | 3300026023 | Bacteria | 1550 |
| 574 | Ga0207677_10892895 | 3300026023 | Bacteria | 801 |
| 575 | Ga0207677_11054321 | 3300026023 | Bacteria | 739 |
| 576 | Ga0207677_11257016 | 3300026023 | Bacteria | 679 |
| 577 | Ga0207703_10053412 | 3300026035 | Bacteria | 3284 |
| 578 | Ga0207703_10141302 | 3300026035 | Bacteria | 2090 |
| 579 | Ga0207703_10476025 | 3300026035 | Bacteria | 1170 |
| 580 | Ga0207703_10565636 | 3300026035 | Bacteria | 1073 |
| 581 | Ga0207639_10085207 | 3300026041 | Bacteria | 2512 |
| 582 | Ga0207639_10744272 | 3300026041 | Bacteria | 911 |
| 583 | Ga0207678_10003169 | 3300026067 | Bacteria | 14868 |
| 584 | Ga0207678_10027797 | 3300026067 | Bacteria | 4939 |
| 585 | Ga0207678_10082037 | 3300026067 | Bacteria | 2759 |
| 586 | Ga0207678_10109071 | 3300026067 | Bacteria | 2361 |
| 587 | Ga0207678_10174309 | 3300026067 | Bacteria | 1836 |
| 588 | Ga0207678_10259657 | 3300026067 | Bacteria | 1489 |
| 589 | Ga0207678_10407539 | 3300026067 | Bacteria | 1178 |
| 590 | Ga0207702_10000227 | 3300026078 | Bacteria | 65464 |
| 591 | Ga0207702_10250517 | 3300026078 | Bacteria | 1663 |
| 592 | Ga0207702_10758403 | 3300026078 | Bacteria | 958 |
| 593 | Ga0207702_11178159 | 3300026078 | Bacteria | 760 |
| 594 | Ga0207702_11365627 | 3300026078 | Bacteria | 702 |
| 595 | Ga0207641_10100139 | 3300026088 | Bacteria | 2552 |
| 596 | Ga0207641_10119259 | 3300026088 | Bacteria | 2351 |
| 597 | Ga0207641_10789438 | 3300026088 | Bacteria | 939 |
| 598 | Ga0207648_10004504 | 3300026089 | Bacteria | 14286 |
| 599 | Ga0207648_10010128 | 3300026089 | Bacteria | 8962 |
| 600 | Ga0207648_10024243 | 3300026089 | Bacteria | 5418 |
| 601 | Ga0207648_10074300 | 3300026089 | Bacteria | 2963 |
| 602 | Ga0207648_10117298 | 3300026089 | Bacteria | 2340 |
| 603 | Ga0207648_10363776 | 3300026089 | Bacteria | 1306 |
| 604 | Ga0207676_10009240 | 3300026095 | Bacteria | 7014 |
| 605 | Ga0207676_10080135 | 3300026095 | Bacteria | 2650 |
| 606 | Ga0207674_10091585 | 3300026116 | Bacteria | 3030 |
| 607 | Ga0207675_100001125 | 3300026118 | Bacteria | 26534 |
| 608 | Ga0207675_100005766 | 3300026118 | Bacteria | 11845 |
| 609 | Ga0207675_100105822 | 3300026118 | Bacteria | 2652 |
| 610 | Ga0207675_100408557 | 3300026118 | Bacteria | 1339 |
| 611 | Ga0207683_10007938 | 3300026121 | Bacteria | 9084 |
| 612 | Ga0207683_10012078 | 3300026121 | Bacteria | 7373 |
| 613 | Ga0207683_10215090 | 3300026121 | Bacteria | 1750 |
| 614 | Ga0207683_10295538 | 3300026121 | Bacteria | 1482 |
| 615 | Ga0207683_11291420 | 3300026121 | Bacteria | 676 |
| 616 | Ga0207698_10042094 | 3300026142 | Bacteria | 3410 |
| 617 | Ga0209281_1000416 | 3300027111 | Bacteria | 64290 |
| 618 | Ga0209281_1050051 | 3300027111 | Bacteria | 670 |
| 619 | Ga0209967_1001211 | 3300027364 | Bacteria | 3303 |
| 620 | Ga0210000_1002227 | 3300027462 | Bacteria | 2749 |
| 621 | Ga0209995_1014917 | 3300027471 | Bacteria | 1274 |
| 622 | Ga0209968_1002465 | 3300027526 | Bacteria | 2796 |
| 623 | Ga0209999_1023219 | 3300027543 | Bacteria | 1142 |
| 624 | Ga0209970_1000174 | 3300027614 | Bacteria | 10132 |
| 625 | Ga0209983_1032993 | 3300027665 | Bacteria | 1107 |
| 626 | Ga0209282_1000003 | 3300027666 | Bacteria | 856377 |
| 627 | Ga0209588_1051553 | 3300027671 | Bacteria | 1331 |
| 628 | Ga0209966_1000303 | 3300027695 | Bacteria | 16183 |
| 629 | Ga0268266_10297392 | 3300028379 | Bacteria | 1505 |
| 630 | Ga0268266_10740279 | 3300028379 | Bacteria | 948 |
| 631 | Ga0268265_10175003 | 3300028380 | Bacteria | 1838 |
| 632 | Ga0268265_10180418 | 3300028380 | Bacteria | 1813 |
| 633 | Ga0268265_10207139 | 3300028380 | Bacteria | 1706 |
| 634 | Ga0268265_10558854 | 3300028380 | Bacteria | 1087 |
| 635 | Ga0268265_11675532 | 3300028380 | Bacteria | 641 |
| 636 | Ga0268264_10008380 | 3300028381 | Bacteria | 8594 |
| 637 | Ga0268264_10521151 | 3300028381 | Bacteria | 1162 |
| 638 | Ga0265336_10000051 | 3300028666 | Bacteria | 114796 |
| 639 | Ga0307517_10000052 | 3300028786 | Bacteria | 155904 |
| 640 | Ga0307517_10147490 | 3300028786 | Bacteria | 1627 |
| 641 | Ga0307517_10396630 | 3300028786 | Bacteria | 732 |
| 642 | Ga0307515_10000416 | 3300028794 | Bacteria | 102535 |
| 643 | Ga0307515_10000645 | 3300028794 | Bacteria | 80548 |
| 644 | Ga0307515_10001163 | 3300028794 | Bacteria | 60305 |
| 645 | Ga0307515_10004048 | 3300028794 | Bacteria | 30591 |
| 646 | Ga0307515_10004318 | 3300028794 | Bacteria | 29495 |
| 647 | Ga0307515_10014143 | 3300028794 | Bacteria | 14834 |
| 648 | Ga0307515_10026385 | 3300028794 | Bacteria | 10003 |
| 649 | Ga0307515_10047081 | 3300028794 | Bacteria | 6569 |
| 650 | Ga0307515_10102840 | 3300028794 | Bacteria | 3431 |
| 651 | Ga0307515_10181532 | 3300028794 | Bacteria | 2052 |
| 652 | Ga0307515_10335364 | 3300028794 | Bacteria | 1168 |
| 653 | Ga0307515_10361979 | 3300028794 | Bacteria | 1091 |
| 654 | Ga0265324_10000292 | 3300029957 | Bacteria | 37241 |
| 655 | Ga0265324_10043351 | 3300029957 | Bacteria | 1553 |
| 656 | Ga0307512_10072314 | 3300030522 | Bacteria | 2552 |
| 657 | Ga0307512_10104738 | 3300030522 | Bacteria | 1896 |
| 658 | Ga0316181_1032650 | 3300030744 | Bacteria | 4582 |
| 659 | Ga0265328_10038853 | 3300031239 | Bacteria | 1756 |
| 660 | Ga0265331_10002254 | 3300031250 | Bacteria | 13195 |
| 661 | Ga0265327_10000309 | 3300031251 | Bacteria | 94387 |
| 662 | Ga0265316_10000299 | 3300031344 | Bacteria | 55433 |
| 663 | Ga0307513_10024348 | 3300031456 | Bacteria | 7043 |
| 664 | Ga0307513_10127823 | 3300031456 | Bacteria | 2492 |
| 665 | Ga0307513_10218597 | 3300031456 | Bacteria | 1729 |
| 666 | Ga0307509_10012817 | 3300031507 | Bacteria | 9981 |
| 667 | Ga0307509_10049892 | 3300031507 | Bacteria | 4484 |
| 668 | Ga0307509_10108307 | 3300031507 | Bacteria | 2792 |
| 669 | Ga0307509_10128511 | 3300031507 | Bacteria | 2495 |
| 670 | Ga0307509_10131278 | 3300031507 | Bacteria | 2460 |
| 671 | Ga0307509_10218808 | 3300031507 | Bacteria | 1720 |
| 672 | Ga0307509_10351648 | 3300031507 | Bacteria | 1197 |
| 673 | Ga0307408_100000010 | 3300031548 | Bacteria | 420048 |
| 674 | Ga0307408_100002273 | 3300031548 | Bacteria | 13680 |
| 675 | Ga0307408_100065404 | 3300031548 | Bacteria | 2667 |
| 676 | Ga0307408_100272435 | 3300031548 | Bacteria | 1406 |
| 677 | Ga0307408_100461417 | 3300031548 | Bacteria | 1104 |
| 678 | Ga0307408_100647165 | 3300031548 | Bacteria | 945 |
| 679 | Ga0307508_10000047 | 3300031616 | Bacteria | 137805 |
| 680 | Ga0307508_10001110 | 3300031616 | Bacteria | 31159 |
| 681 | Ga0307508_10012672 | 3300031616 | Bacteria | 7709 |
| 682 | Ga0307508_10400903 | 3300031616 | Bacteria | 963 |
| 683 | Ga0307514_10002133 | 3300031649 | Bacteria | 21325 |
| 684 | Ga0307514_10017955 | 3300031649 | Bacteria | 5812 |
| 685 | Ga0307514_10045424 | 3300031649 | Bacteria | 3438 |
| 686 | Ga0265314_10062809 | 3300031711 | Bacteria | 2523 |
| 687 | Ga0307516_10000038 | 3300031730 | Bacteria | 147103 |
| 688 | Ga0307516_10001369 | 3300031730 | Bacteria | 33766 |
| 689 | Ga0307516_10005900 | 3300031730 | Bacteria | 14498 |
| 690 | Ga0307516_10254243 | 3300031730 | Bacteria | 1450 |
| 691 | Ga0307516_10312345 | 3300031730 | Bacteria | 1245 |
| 692 | Ga0307405_10018925 | 3300031731 | Bacteria | 3812 |
| 693 | Ga0307405_10191108 | 3300031731 | Bacteria | 1479 |
| 694 | Ga0307405_10348696 | 3300031731 | Bacteria | 1141 |
| 695 | Ga0307413_10001478 | 3300031824 | Bacteria | 8945 |
| 696 | Ga0307413_10034527 | 3300031824 | Bacteria | 2892 |
| 697 | Ga0307413_11202310 | 3300031824 | Bacteria | 659 |
| 698 | Ga0307518_10019478 | 3300031838 | Bacteria | 4874 |
| 699 | Ga0307410_10130880 | 3300031852 | Bacteria | 1843 |
| 700 | Ga0307410_10341775 | 3300031852 | Bacteria | 1193 |
| 701 | Ga0307410_10414646 | 3300031852 | Bacteria | 1091 |
| 702 | Ga0307410_10480113 | 3300031852 | Bacteria | 1019 |
| 703 | Ga0307410_10559137 | 3300031852 | Bacteria | 949 |
| 704 | Ga0307406_10007697 | 3300031901 | Bacteria | 5983 |
| 705 | Ga0307406_10606605 | 3300031901 | Bacteria | 903 |
| 706 | Ga0307412_10003056 | 3300031911 | Bacteria | 9276 |
| 707 | Ga0307412_10134632 | 3300031911 | Bacteria | 1801 |
| 708 | Ga0307409_100012773 | 3300031995 | Bacteria | 5367 |
| 709 | Ga0307409_100244130 | 3300031995 | Bacteria | 1637 |
| 710 | Ga0307409_100316229 | 3300031995 | Bacteria | 1459 |
| 711 | Ga0307409_100754418 | 3300031995 | Bacteria | 977 |
| 712 | Ga0307416_100376041 | 3300032002 | Bacteria | 1449 |
| 713 | Ga0307416_100426917 | 3300032002 | Bacteria | 1371 |
| 714 | Ga0307416_101093401 | 3300032002 | Bacteria | 902 |
| 715 | Ga0307416_101355712 | 3300032002 | Bacteria | 817 |
| 716 | Ga0307414_10099483 | 3300032004 | Bacteria | 2185 |
| 717 | Ga0307414_10158522 | 3300032004 | Bacteria | 1794 |
| 718 | Ga0307411_10002067 | 3300032005 | Bacteria | 8629 |
| 719 | Ga0307411_10019462 | 3300032005 | Bacteria | 3922 |
| 720 | Ga0307411_10156038 | 3300032005 | Bacteria | 1703 |
| 721 | Ga0307411_10186301 | 3300032005 | Bacteria | 1580 |
| 722 | Ga0307411_10268406 | 3300032005 | Bacteria | 1352 |
| 723 | Ga0307411_10296460 | 3300032005 | Bacteria | 1295 |
| 724 | Ga0307411_11675038 | 3300032005 | Bacteria | 588 |
| 725 | Ga0307415_100043660 | 3300032126 | Bacteria | 2992 |
| 726 | Ga0307415_100581294 | 3300032126 | Bacteria | 994 |
| 727 | Ga0307415_102208059 | 3300032126 | Bacteria | 539 |
| 728 | Ga0307510_10005294 | 3300033180 | Bacteria | 15345 |
| 729 | Ga0307510_10037378 | 3300033180 | Bacteria | 5387 |
| 730 | Ga0307510_10253556 | 3300033180 | Bacteria | 1245 |
| 731 | Ga0307510_10468508 | 3300033180 | Bacteria | 701 |
| 732 | Ga0373959_0049269 | 3300034820 | Bacteria | 905 |
| 733 | Ga0373929_0090021 | 3300035085 | Bacteria | 760 |
| 734 | Ga0373934_0097225 | 3300035086 | Bacteria | 1189 |
| 735 | Ga0373944_0061421 | 3300035089 | Bacteria | 1206 |
| 736 | Ga0373944_0112318 | 3300035089 | Bacteria | 932 |
| 737 | Ga0373951_0018674 | 3300035091 | Bacteria | 1576 |
| 738 | Ga0373939_0000579 | 3300035114 | Bacteria | 9136 |
| 739 | Ga0373941_0061235 | 3300035115 | Bacteria | 1225 |
| 740 | Ga0373941_0462326 | 3300035115 | Bacteria | 534 |
| 741 | Ga0373943_0969621 | 3300035170 | Bacteria | 509 |
| 742 | Ga0373962_0060087 | 3300035242 | Bacteria | 1114 |
| 743 | Ga0373931_0000228 | 3300035691 | Bacteria | 23922 |
| 744 | Ga0373931_0006809 | 3300035691 | Bacteria | 5370 |
| 745 | Ga0373931_0011745 | 3300035691 | Bacteria | 4233 |
| 746 | Ga0373931_0904443 | 3300035691 | Bacteria | 593 |
| 747 | Ga0373927_0009397 | 3300035695 | Bacteria | 6558 |
| 748 | Ga0373933_0043177 | 3300035724 | Bacteria | 2667 |
| 749 | Ga0373925_0001850 | 3300037068 | Bacteria | 17621 |
| 750 | Ga0373925_0497099 | 3300037068 | Bacteria | 1001 |
| 751 | Ga0395899_0000370 | 3300037312 | Bacteria | 54053 |
| 752 | Ga0395899_0038495 | 3300037312 | Bacteria | 3582 |
| 753 | Ga0395899_0043349 | 3300037312 | Bacteria | 3356 |
| 754 | Ga0395899_0113735 | 3300037312 | Bacteria | 1943 |
| 755 | Ga0395899_0243257 | 3300037312 | Bacteria | 1237 |
| 756 | Ga0395899_0362820 | 3300037312 | Bacteria | 966 |
| 757 | Ga0395899_0494725 | 3300037312 | Bacteria | 794 |
| 758 | Ga0395900_0000640 | 3300037418 | Bacteria | 47118 |
| 759 | Ga0395900_0033983 | 3300037418 | Bacteria | 5248 |
| 760 | Ga0395900_0120467 | 3300037418 | Bacteria | 2692 |
| 761 | Ga0395900_0123750 | 3300037418 | Bacteria | 2652 |
| 762 | Ga0395900_0220142 | 3300037418 | Bacteria | 1913 |
| 763 | Ga0395900_0617867 | 3300037418 | Bacteria | 1023 |
| 764 | Ga0395898_0007053 | 3300037466 | Bacteria | 11937 |
| 765 | Ga0395898_0070112 | 3300037466 | Bacteria | 3390 |
| 766 | Ga0395898_1319919 | 3300037466 | Bacteria | 650 |
| 767 | Ga0395905_0000676 | 3300037471 | Bacteria | 45246 |
| 768 | Ga0395905_0008541 | 3300037471 | Bacteria | 10098 |
| 769 | Ga0395905_0013220 | 3300037471 | Bacteria | 7921 |
| 770 | Ga0395905_0018255 | 3300037471 | Bacteria | 6659 |
| 771 | Ga0395905_0133785 | 3300037471 | Bacteria | 2332 |
| 772 | Ga0395905_0140362 | 3300037471 | Bacteria | 2273 |
| 773 | Ga0395905_0227962 | 3300037471 | Bacteria | 1742 |
| 774 | Ga0395905_0284022 | 3300037471 | Bacteria | 1541 |
| 775 | Ga0395905_0516473 | 3300037471 | Bacteria | 1095 |
| 776 | Ga0395905_0747246 | 3300037471 | Bacteria | 880 |
| 777 | Ga0395905_0873193 | 3300037471 | Bacteria | 802 |
| 778 | Ga0395901_0000074 | 3300038443 | Bacteria | 138735 |
| 779 | Ga0395901_0001733 | 3300038443 | Bacteria | 22534 |
| 780 | Ga0395901_0244277 | 3300038443 | Bacteria | 1871 |
| 781 | Ga0395901_0279774 | 3300038443 | Bacteria | 1733 |
| 782 | Ga0395901_0323079 | 3300038443 | Bacteria | 1596 |
| 783 | Ga0395901_0429941 | 3300038443 | Bacteria | 1353 |
| 784 | Ga0395901_0961672 | 3300038443 | Bacteria | 832 |
| 785 | Ga0436361_0048643 | 3300039447 | Bacteria | 3615 |
| 786 | Ga0436361_0053671 | 3300039447 | Bacteria | 10745 |
| 787 | Ga0436361_0062004 | 3300039447 | Bacteria | 42438 |
| 788 | Ga0436361_0071334 | 3300039447 | Bacteria | 40702 |
| 789 | Ga0436361_0144792 | 3300039447 | Bacteria | 34252 |
| 790 | Ga0436361_0239153 | 3300039447 | Bacteria | 3627 |
| 791 | Ga0436361_0362312 | 3300039447 | Bacteria | 55943 |
| 792 | Ga0436361_0588758 | 3300039447 | Bacteria | 2463 |
| 793 | Ga0436361_0615018 | 3300039447 | Bacteria | 2619 |
| 794 | Ga0436361_0692200 | 3300039447 | Bacteria | 6235 |
| 795 | Ga0436361_0749269 | 3300039447 | Bacteria | 121408 |
| 796 | Ga0436361_1191441 | 3300039447 | Bacteria | 1913 |
| 797 | Ga0436363_1606815 | 3300039450 | Bacteria | 546 |
| 798 | Ga0439453_0015160 | 3300041408 | Bacteria | 1330 |
| 799 | Ga0439465_0221247 | 3300041413 | Bacteria | 694 |
| 800 | Ga0451791_1212493 | 3300041451 | Bacteria | 586 |
| 801 | Ga0451791_1752511 | 3300041451 | Bacteria | 1317 |
| 802 | Ga0451795_1328699 | 3300041456 | Bacteria | 937 |
| 803 | Ga0451798_0266409 | 3300041458 | Bacteria | 709 |
| 804 | Ga0451802_0610707 | 3300041460 | Bacteria | 559 |
| 805 | Ga0451807_1373320 | 3300041486 | Bacteria | 1108 |
| 806 | Ga0451835_1125194 | 3300041492 | Bacteria | 567 |
| 807 | Ga0451837_1627762 | 3300041494 | Bacteria | 534 |
| 808 | Ga0451845_0632488 | 3300041501 | Bacteria | 700 |
| 809 | Ga0451847_0912814 | 3300041503 | Bacteria | 558 |
| 810 | Ga0451849_1092259 | 3300041505 | Bacteria | 1980 |
| 811 | Ga0451851_0023497 | 3300041507 | Bacteria | 1848 |
| 812 | Ga0451851_0889618 | 3300041507 | Bacteria | 546 |
| 813 | Ga0451843_0699320 | 3300041509 | Bacteria | 1896 |
| 814 | Ga0451853_0907922 | 3300041512 | Bacteria | 896 |
| 815 | Ga0439431_0006166 | 3300041997 | Bacteria | 2648 |
| 816 | Ga0439433_0021226 | 3300041999 | Bacteria | 1452 |
| 817 | Ga0439437_000360 | 3300042000 | Bacteria | 4343 |
| 818 | Ga0439448_0003089 | 3300042005 | Bacteria | 4583 |
| 819 | Ga0439448_0081905 | 3300042005 | Bacteria | 1084 |
| 820 | Ga0439448_0127064 | 3300042005 | Bacteria | 877 |
| 821 | Ga0439448_0172457 | 3300042005 | Bacteria | 755 |
| 822 | Ga0439449_0016561 | 3300042007 | Bacteria | 2770 |
| 823 | Ga0439449_0070323 | 3300042007 | Bacteria | 1290 |
| 824 | Ga0439455_0012754 | 3300042012 | Bacteria | 1892 |
| 825 | Ga0439455_0174098 | 3300042012 | Bacteria | 618 |
| 826 | Ga0439462_0151164 | 3300042015 | Bacteria | 653 |
| 827 | Ga0450911_014457 | 3300042115 | Bacteria | 1049 |
| 828 | Ga0450913_016161 | 3300042117 | Bacteria | 650 |
| 829 | Ga0450917_000369 | 3300042120 | Bacteria | 3371 |
| 830 | Ga0450919_004025 | 3300042121 | Bacteria | 1807 |
| 831 | Ga0450920_014429 | 3300042122 | Bacteria | 1495 |
| 832 | Ga0450888_000895 | 3300042126 | Bacteria | 2838 |
| 833 | Ga0450888_013430 | 3300042126 | Unclassified | 981 |
| 834 | Ga0450890_037914 | 3300042127 | Bacteria | 705 |
| 835 | Ga0450890_078507 | 3300042127 | Bacteria | 536 |
| 836 | Ga0450891_000017 | 3300042129 | Bacteria | 12411 |
| 837 | Ga0450895_006529 | 3300042132 | Bacteria | 956 |
| 838 | Ga0450898_015726 | 3300042134 | Bacteria | 1285 |
| 839 | Ga0450898_026984 | 3300042134 | Bacteria | 1037 |
| 840 | Ga0450898_062501 | 3300042134 | Bacteria | 734 |
| 841 | Ga0450898_084618 | 3300042134 | Bacteria | 648 |
| 842 | Ga0450903_016707 | 3300042138 | Bacteria | 1150 |
| 843 | Ga0450904_000117 | 3300042139 | Bacteria | 17632 |
| 844 | Ga0450906_026774 | 3300042145 | Bacteria | 1024 |
| 845 | Ga0439446_0237398 | 3300042156 | Bacteria | 625 |
| 846 | Ga0439446_0282478 | 3300042156 | Bacteria | 579 |
| 847 | Ga0450918_000764 | 3300042531 | Bacteria | 6808 |
| 848 | Ga0450893_0002946 | 3300042532 | Bacteria | 2678 |
| 849 | Ga0450893_0128648 | 3300042532 | Bacteria | 533 |
| 850 | Ga0450901_017537 | 3300042533 | Bacteria | 758 |
| 851 | Ga0451577_0043475 | 3300042876 | Bacteria | 4024 |
| 852 | Ga0466969_0000037 | 3300044656 | Bacteria | 75663 |
| 853 | Ga0466969_0034564 | 3300044656 | Bacteria | 2560 |
| 854 | Ga0466969_0043321 | 3300044656 | Bacteria | 2243 |
| 855 | Ga0466969_0464173 | 3300044656 | Bacteria | 576 |
| 856 | Ga0466972_0002974 | 3300044658 | Bacteria | 8390 |
| 857 | Ga0466972_0009008 | 3300044658 | Bacteria | 5009 |
| 858 | Ga0466972_0059269 | 3300044658 | Bacteria | 1838 |
| 859 | Ga0466972_0316178 | 3300044658 | Bacteria | 729 |
| 860 | Ga0466982_0034801 | 3300044672 | Bacteria | 3016 |
| 861 | Ga0466965_0004104 | 3300044683 | Bacteria | 6467 |
| 862 | Ga0466965_0017071 | 3300044683 | Bacteria | 3465 |
| 863 | Ga0466965_0030031 | 3300044683 | Bacteria | 2646 |
| 864 | Ga0466965_0043171 | 3300044683 | Bacteria | 2225 |
| 865 | Ga0466965_0077681 | 3300044683 | Bacteria | 1676 |
| 866 | Ga0466965_0081903 | 3300044683 | Bacteria | 1632 |
| 867 | Ga0466965_0125565 | 3300044683 | Bacteria | 1327 |
| 868 | Ga0466965_0263412 | 3300044683 | Bacteria | 927 |
| 869 | Ga0466966_0014648 | 3300044684 | Bacteria | 5190 |
| 870 | Ga0466966_0032499 | 3300044684 | Bacteria | 3381 |
| 871 | Ga0466966_0048223 | 3300044684 | Bacteria | 2713 |
| 872 | Ga0466966_0114801 | 3300044684 | Bacteria | 1658 |
| 873 | Ga0466966_0191066 | 3300044684 | Bacteria | 1240 |
| 874 | Ga0466966_0286152 | 3300044684 | Bacteria | 991 |
| 875 | Ga0466966_0417301 | 3300044684 | Bacteria | 806 |
| 876 | Ga0466966_0444248 | 3300044684 | Bacteria | 779 |
| 877 | Ga0466961_0015995 | 3300044693 | Bacteria | 4816 |
| 878 | Ga0466961_0020395 | 3300044693 | Bacteria | 4263 |
| 879 | Ga0466961_0022942 | 3300044693 | Bacteria | 4014 |
| 880 | Ga0466961_0048858 | 3300044693 | Bacteria | 2704 |
| 881 | Ga0466963_0024612 | 3300044694 | Bacteria | 3832 |
| 882 | Ga0466963_0321315 | 3300044694 | Bacteria | 1089 |
| 883 | Ga0466964_0005515 | 3300044706 | Bacteria | 4697 |
| 884 | Ga0466964_0008450 | 3300044706 | Bacteria | 3868 |
| 885 | Ga0466964_0022795 | 3300044706 | Bacteria | 2431 |
| 886 | Ga0466964_0189517 | 3300044706 | Bacteria | 980 |
| 887 | Ga0466964_0273959 | 3300044706 | Bacteria | 841 |
| 888 | Ga0466964_0493591 | 3300044706 | Bacteria | 656 |
| 889 | Ga0453684_0047302 | 3300044712 | Bacteria | 5707 |
| 890 | Ga0453684_0103481 | 3300044712 | Bacteria | 3479 |
| 891 | Ga0453684_0147265 | 3300044712 | Bacteria | 2803 |
| 892 | Ga0453684_0158290 | 3300044712 | Bacteria | 2682 |
| 893 | Ga0453684_0228640 | 3300044712 | Bacteria | 2149 |
| 894 | Ga0453684_0428150 | 3300044712 | Bacteria | 1477 |
| 895 | Ga0453684_0546938 | 3300044712 | Bacteria | 1276 |
| 896 | Ga0453684_1324140 | 3300044712 | Bacteria | 750 |
| 897 | Ga0466971_0008028 | 3300044719 | Bacteria | 4602 |
| 898 | Ga0466971_0025492 | 3300044719 | Bacteria | 2640 |
| 899 | Ga0466971_0031185 | 3300044719 | Bacteria | 2386 |
| 900 | Ga0466968_0000503 | 3300044735 | Bacteria | 13277 |
| 901 | Ga0466968_0026789 | 3300044735 | Bacteria | 2368 |
| 902 | Ga0466968_0032257 | 3300044735 | Bacteria | 2178 |
| 903 | Ga0466970_0028959 | 3300044765 | Bacteria | 2913 |
| 904 | Ga0466970_0073793 | 3300044765 | Bacteria | 1836 |
| 905 | Ga0466970_0085799 | 3300044765 | Bacteria | 1706 |
| 906 | Ga0466970_0206437 | 3300044765 | Bacteria | 1094 |
| 907 | Ga0466957_0006839 | 3300044842 | Bacteria | 6445 |
| 908 | Ga0466957_0009983 | 3300044842 | Bacteria | 5432 |
| 909 | Ga0466957_0020390 | 3300044842 | Bacteria | 3900 |
| 910 | Ga0466957_0035356 | 3300044842 | Bacteria | 2998 |
| 911 | Ga0466957_0082980 | 3300044842 | Bacteria | 1998 |
| 912 | Ga0466957_0102870 | 3300044842 | Bacteria | 1802 |
| 913 | Ga0466957_0701491 | 3300044842 | Bacteria | 714 |
| 914 | Ga0466957_1018496 | 3300044842 | Bacteria | 595 |
| 915 | Ga0466960_0146279 | 3300044901 | Bacteria | 1259 |
| 916 | Ga0466960_0160039 | 3300044901 | Bacteria | 1208 |
| 917 | Ga0466960_0168693 | 3300044901 | Bacteria | 1180 |
| 918 | Ga0466960_0661791 | 3300044901 | Bacteria | 624 |
| 919 | Ga0466960_0716203 | 3300044901 | Bacteria | 601 |
| 920 | Ga0466959_0006252 | 3300045049 | Bacteria | 8227 |
| 921 | Ga0466959_0110779 | 3300045049 | Bacteria | 1959 |
| 922 | Ga0466959_0112723 | 3300045049 | Bacteria | 1939 |
| 923 | Ga0466959_0117917 | 3300045049 | Bacteria | 1889 |
| 924 | Ga0466959_0125799 | 3300045049 | Bacteria | 1819 |
| 925 | Ga0466959_0528259 | 3300045049 | Bacteria | 796 |
| 926 | Ga0466959_0735569 | 3300045049 | Bacteria | 660 |
| 927 | Ga0451576_0002339 | 3300045051 | Bacteria | 28645 |
| 928 | Ga0451576_0454819 | 3300045051 | Bacteria | 1344 |
| 929 | Ga0451576_0819428 | 3300045051 | Bacteria | 977 |
| 930 | Ga0451576_1458115 | 3300045051 | Bacteria | 711 |
| 931 | Ga0451576_1686886 | 3300045051 | Bacteria | 656 |
| 932 | Ga0466958_0077892 | 3300045836 | Bacteria | 2036 |
| 933 | Ga0466958_0109142 | 3300045836 | Bacteria | 1727 |
| 934 | Ga0466958_0113256 | 3300045836 | Bacteria | 1694 |
| 935 | Ga0466958_0115744 | 3300045836 | Bacteria | 1675 |
| 936 | Ga0466958_0156942 | 3300045836 | Bacteria | 1436 |
| 937 | Ga0466958_0213387 | 3300045836 | Bacteria | 1230 |
| 938 | Ga0466958_0233977 | 3300045836 | Bacteria | 1173 |
| 939 | Ga0466967_0011205 | 3300045976 | Bacteria | 6777 |
| 940 | Ga0466967_0020086 | 3300045976 | Bacteria | 5389 |
| 941 | Ga0466967_0313540 | 3300045976 | Bacteria | 1511 |
| 942 | Ga0466967_0376686 | 3300045976 | Bacteria | 1377 |
| 943 | Ga0466967_0505951 | 3300045976 | Bacteria | 1186 |
| 944 | Ga0495617_000005 | 3300046452 | Bacteria | 404687 |
| 945 | Ga0495617_000026 | 3300046452 | Bacteria | 157675 |
| 946 | Ga0495617_000362 | 3300046452 | Bacteria | 25053 |
| 947 | Ga0495617_004468 | 3300046452 | Bacteria | 5088 |
| 948 | Ga0495617_013150 | 3300046452 | Bacteria | 2818 |
| 949 | Ga0495617_085770 | 3300046452 | Bacteria | 1030 |
| 950 | Ga0495627_000038 | 3300046453 | Bacteria | 198316 |
| 951 | Ga0495627_000043 | 3300046453 | Bacteria | 185855 |
| 952 | Ga0495627_023622 | 3300046453 | Bacteria | 2011 |
| 953 | Ga0495592_0000346 | 3300046454 | Bacteria | 37799 |
| 954 | Ga0495603_0120676 | 3300046455 | Bacteria | 1527 |
| 955 | Ga0495603_0157418 | 3300046455 | Bacteria | 1318 |
| 956 | Ga0495603_0183569 | 3300046455 | Bacteria | 1210 |
| 957 | Ga0495590_0000031 | 3300046457 | Bacteria | 143779 |
| 958 | Ga0495590_0000041 | 3300046457 | Bacteria | 121084 |
| 959 | Ga0495590_0006069 | 3300046457 | Bacteria | 4740 |
| 960 | Ga0495590_0006704 | 3300046457 | Bacteria | 4483 |
| 961 | Ga0495590_0123181 | 3300046457 | Bacteria | 929 |
| 962 | Ga0495590_0195367 | 3300046457 | Bacteria | 742 |
| 963 | Ga0495590_0227942 | 3300046457 | Bacteria | 689 |
| 964 | Ga0495591_000213 | 3300046458 | Bacteria | 58510 |
| 965 | Ga0495629_0001336 | 3300046459 | Bacteria | 19404 |
| 966 | Ga0495629_0094490 | 3300046459 | Bacteria | 2086 |
| 967 | Ga0495629_0182113 | 3300046459 | Bacteria | 1456 |
| 968 | Ga0495629_0655730 | 3300046459 | Bacteria | 699 |
| 969 | Ga0495629_0980435 | 3300046459 | Bacteria | 551 |
| 970 | Ga0495638_0000101 | 3300046460 | Bacteria | 137331 |
| 971 | Ga0495638_0018344 | 3300046460 | Bacteria | 4647 |
| 972 | Ga0495638_0068193 | 3300046460 | Bacteria | 2182 |
| 973 | Ga0495638_0078354 | 3300046460 | Bacteria | 2011 |
| 974 | Ga0495638_0199792 | 3300046460 | Bacteria | 1129 |
| 975 | Ga0495638_0228610 | 3300046460 | Bacteria | 1036 |
| 976 | Ga0495638_0296130 | 3300046460 | Bacteria | 873 |
| 977 | Ga0495638_0296595 | 3300046460 | Bacteria | 872 |
| 978 | Ga0495638_0438618 | 3300046460 | Bacteria | 669 |
| 979 | Ga0495638_0442370 | 3300046460 | Bacteria | 665 |
| 980 | Ga0495638_0484298 | 3300046460 | Bacteria | 626 |
| 981 | Ga0495653_0000031 | 3300046463 | Bacteria | 137159 |
| 982 | Ga0495653_0012591 | 3300046463 | Bacteria | 6908 |
| 983 | Ga0495653_0025416 | 3300046463 | Bacteria | 4760 |
| 984 | Ga0495653_0072599 | 3300046463 | Bacteria | 2569 |
| 985 | Ga0495653_0087730 | 3300046463 | Bacteria | 2284 |
| 986 | Ga0495650_0000230 | 3300046471 | Bacteria | 114025 |
| 987 | Ga0495650_0000274 | 3300046471 | Bacteria | 98605 |
| 988 | Ga0495650_0000288 | 3300046471 | Bacteria | 93448 |
| 989 | Ga0495650_0000504 | 3300046471 | Bacteria | 58448 |
| 990 | Ga0495650_0001351 | 3300046471 | Bacteria | 24390 |
| 991 | Ga0495650_0098457 | 3300046471 | Bacteria | 1101 |
| 992 | Ga0495580_0006752 | 3300046472 | Bacteria | 9309 |
| 993 | Ga0495580_0086525 | 3300046472 | Bacteria | 2183 |
| 994 | Ga0495582_0017018 | 3300046473 | Bacteria | 3980 |
| 995 | Ga0495605_0000071 | 3300046474 | Bacteria | 135203 |
| 996 | Ga0495605_0000113 | 3300046474 | Bacteria | 103900 |
| 997 | Ga0495605_0000186 | 3300046474 | Bacteria | 77457 |
| 998 | Ga0495605_0001197 | 3300046474 | Bacteria | 17283 |
| 999 | Ga0495605_0009878 | 3300046474 | Bacteria | 5352 |
| 1000 | Ga0495605_0050343 | 3300046474 | Bacteria | 2032 |
| 1001 | Ga0495605_0085279 | 3300046474 | Bacteria | 1471 |
| 1002 | Ga0495605_0227370 | 3300046474 | Bacteria | 804 |
| 1003 | Ga0495605_0281587 | 3300046474 | Bacteria | 706 |
| 1004 | Ga0495605_0452653 | 3300046474 | Bacteria | 528 |
| 1005 | Ga0495639_0047800 | 3300046475 | Bacteria | 1940 |
| 1006 | Ga0495664_0225997 | 3300046477 | Bacteria | 1133 |
| 1007 | Ga0495664_0490464 | 3300046477 | Bacteria | 734 |
| 1008 | Ga0495584_0000007 | 3300046491 | Bacteria | 294820 |
| 1009 | Ga0495584_0000252 | 3300046491 | Bacteria | 38603 |
| 1010 | Ga0495584_0004963 | 3300046491 | Bacteria | 7093 |
| 1011 | Ga0495584_0008099 | 3300046491 | Bacteria | 5461 |
| 1012 | Ga0495584_0015762 | 3300046491 | Bacteria | 3853 |
| 1013 | Ga0495584_0021355 | 3300046491 | Bacteria | 3289 |
| 1014 | Ga0495584_0032557 | 3300046491 | Bacteria | 2638 |
| 1015 | Ga0495584_0043442 | 3300046491 | Bacteria | 2268 |
| 1016 | Ga0495584_0144931 | 3300046491 | Bacteria | 1206 |
| 1017 | Ga0495584_0162952 | 3300046491 | Bacteria | 1133 |
| 1018 | Ga0495584_0222395 | 3300046491 | Bacteria | 959 |
| 1019 | Ga0495584_0355275 | 3300046491 | Bacteria | 744 |
| 1020 | Ga0495584_0457278 | 3300046491 | Bacteria | 649 |
| 1021 | Ga0495585_0000090 | 3300046492 | Bacteria | 95790 |
| 1022 | Ga0495585_0000147 | 3300046492 | Bacteria | 76686 |
| 1023 | Ga0495585_0000919 | 3300046492 | Bacteria | 24945 |
| 1024 | Ga0495585_0006598 | 3300046492 | Bacteria | 7174 |
| 1025 | Ga0495585_0012830 | 3300046492 | Bacteria | 4927 |
| 1026 | Ga0495585_0016190 | 3300046492 | Bacteria | 4320 |
| 1027 | Ga0495585_0024549 | 3300046492 | Bacteria | 3455 |
| 1028 | Ga0495585_0025178 | 3300046492 | Bacteria | 3411 |
| 1029 | Ga0495585_0029280 | 3300046492 | Bacteria | 3135 |
| 1030 | Ga0495585_0041940 | 3300046492 | Bacteria | 2565 |
| 1031 | Ga0495585_0058592 | 3300046492 | Bacteria | 2124 |
| 1032 | Ga0495585_0092763 | 3300046492 | Bacteria | 1625 |
| 1033 | Ga0495585_0113717 | 3300046492 | Bacteria | 1437 |
| 1034 | Ga0495585_0189373 | 3300046492 | Bacteria | 1053 |
| 1035 | Ga0495585_0217815 | 3300046492 | Bacteria | 964 |
| 1036 | Ga0495585_0377688 | 3300046492 | Bacteria | 685 |
| 1037 | Ga0495585_0554786 | 3300046492 | Bacteria | 542 |
| 1038 | Ga0495594_0025128 | 3300046499 | Bacteria | 3201 |
| 1039 | Ga0495594_0051651 | 3300046499 | Bacteria | 2262 |
| 1040 | Ga0495594_0107383 | 3300046499 | Bacteria | 1572 |
| 1041 | Ga0495594_0306657 | 3300046499 | Bacteria | 904 |
| 1042 | Ga0495596_0000270 | 3300046500 | Bacteria | 34366 |
| 1043 | Ga0495596_0001876 | 3300046500 | Bacteria | 11668 |
| 1044 | Ga0495596_0001991 | 3300046500 | Bacteria | 11245 |
| 1045 | Ga0495596_0006043 | 3300046500 | Bacteria | 5646 |
| 1046 | Ga0495596_0013973 | 3300046500 | Bacteria | 3390 |
| 1047 | Ga0495596_0015363 | 3300046500 | Bacteria | 3208 |
| 1048 | Ga0495596_0019543 | 3300046500 | Bacteria | 2781 |
| 1049 | Ga0495596_0063271 | 3300046500 | Bacteria | 1439 |
| 1050 | Ga0495596_0079667 | 3300046500 | Bacteria | 1271 |
| 1051 | Ga0495607_0000842 | 3300046501 | Bacteria | 29026 |
| 1052 | Ga0495607_0001791 | 3300046501 | Bacteria | 18333 |
| 1053 | Ga0495607_0002436 | 3300046501 | Bacteria | 15157 |
| 1054 | Ga0495607_0006283 | 3300046501 | Bacteria | 8376 |
| 1055 | Ga0495607_0008025 | 3300046501 | Bacteria | 7249 |
| 1056 | Ga0495607_0010917 | 3300046501 | Bacteria | 6077 |
| 1057 | Ga0495607_0018599 | 3300046501 | Bacteria | 4427 |
| 1058 | Ga0495607_0023678 | 3300046501 | Bacteria | 3840 |
| 1059 | Ga0495607_0083828 | 3300046501 | Bacteria | 1745 |
| 1060 | Ga0495607_0093779 | 3300046501 | Bacteria | 1620 |
| 1061 | Ga0495607_0093985 | 3300046501 | Bacteria | 1618 |
| 1062 | Ga0495607_0096950 | 3300046501 | Bacteria | 1586 |
| 1063 | Ga0495607_0111651 | 3300046501 | Bacteria | 1448 |
| 1064 | Ga0495607_0141005 | 3300046501 | Bacteria | 1243 |
| 1065 | Ga0495607_0215458 | 3300046501 | Bacteria | 942 |
| 1066 | Ga0495607_0455918 | 3300046501 | Bacteria | 573 |
| 1067 | Ga0495583_0000016 | 3300046506 | Bacteria | 312691 |
| 1068 | Ga0495583_0000075 | 3300046506 | Bacteria | 177074 |
| 1069 | Ga0495583_0000194 | 3300046506 | Bacteria | 101824 |
| 1070 | Ga0495583_0000284 | 3300046506 | Bacteria | 81053 |
| 1071 | Ga0495583_0000783 | 3300046506 | Bacteria | 39666 |
| 1072 | Ga0495583_0001150 | 3300046506 | Bacteria | 28793 |
| 1073 | Ga0495583_0005291 | 3300046506 | Bacteria | 8824 |
| 1074 | Ga0495583_0005830 | 3300046506 | Bacteria | 8223 |
| 1075 | Ga0495583_0005871 | 3300046506 | Bacteria | 8181 |
| 1076 | Ga0495583_0012206 | 3300046506 | Bacteria | 4878 |
| 1077 | Ga0495583_0019843 | 3300046506 | Bacteria | 3498 |
| 1078 | Ga0495583_0023530 | 3300046506 | Bacteria | 3114 |
| 1079 | Ga0495606_0000077 | 3300046507 | Bacteria | 166824 |
| 1080 | Ga0495606_0000133 | 3300046507 | Bacteria | 126345 |
| 1081 | Ga0495606_0000474 | 3300046507 | Bacteria | 65914 |
| 1082 | Ga0495606_0001180 | 3300046507 | Bacteria | 36859 |
| 1083 | Ga0495606_0001442 | 3300046507 | Bacteria | 31886 |
| 1084 | Ga0495606_0006254 | 3300046507 | Bacteria | 11053 |
| 1085 | Ga0495606_0006540 | 3300046507 | Bacteria | 10719 |
| 1086 | Ga0495606_0010878 | 3300046507 | Bacteria | 7492 |
| 1087 | Ga0495606_0016609 | 3300046507 | Bacteria | 5603 |
| 1088 | Ga0495606_0022834 | 3300046507 | Bacteria | 4546 |
| 1089 | Ga0495606_0027155 | 3300046507 | Bacteria | 4065 |
| 1090 | Ga0495606_0062093 | 3300046507 | Bacteria | 2386 |
| 1091 | Ga0495606_0287324 | 3300046507 | Bacteria | 896 |
| 1092 | Ga0495606_0355959 | 3300046507 | Bacteria | 775 |
| 1093 | Ga0495606_0442077 | 3300046507 | Bacteria | 668 |
| 1094 | Ga0495608_0747823 | 3300046511 | Bacteria | 579 |
| 1095 | Ga0495610_0000038 | 3300046512 | Bacteria | 181669 |
| 1096 | Ga0495610_0001086 | 3300046512 | Bacteria | 24866 |
| 1097 | Ga0495610_0009405 | 3300046512 | Bacteria | 6187 |
| 1098 | Ga0495610_0016768 | 3300046512 | Bacteria | 4204 |
| 1099 | Ga0495610_0033904 | 3300046512 | Bacteria | 2634 |
| 1100 | Ga0495610_0043657 | 3300046512 | Bacteria | 2231 |
| 1101 | Ga0495610_0078844 | 3300046512 | Bacteria | 1517 |
| 1102 | Ga0495610_0095798 | 3300046512 | Bacteria | 1337 |
| 1103 | Ga0495616_0000048 | 3300046513 | Bacteria | 108577 |
| 1104 | Ga0495616_0002015 | 3300046513 | Bacteria | 13670 |
| 1105 | Ga0495616_0004259 | 3300046513 | Bacteria | 9046 |
| 1106 | Ga0495616_0006556 | 3300046513 | Bacteria | 7028 |
| 1107 | Ga0495616_0010268 | 3300046513 | Bacteria | 5427 |
| 1108 | Ga0495616_0011262 | 3300046513 | Bacteria | 5133 |
| 1109 | Ga0495616_0016471 | 3300046513 | Bacteria | 4091 |
| 1110 | Ga0495616_0030381 | 3300046513 | Bacteria | 2840 |
| 1111 | Ga0495616_0031023 | 3300046513 | Bacteria | 2803 |
| 1112 | Ga0495616_0036660 | 3300046513 | Bacteria | 2529 |
| 1113 | Ga0495616_0067735 | 3300046513 | Bacteria | 1734 |
| 1114 | Ga0495616_0074501 | 3300046513 | Bacteria | 1635 |
| 1115 | Ga0495616_0259799 | 3300046513 | Bacteria | 743 |
| 1116 | Ga0495616_0292678 | 3300046513 | Bacteria | 689 |
| 1117 | Ga0495616_0334098 | 3300046513 | Bacteria | 634 |
| 1118 | Ga0495620_0009384 | 3300046515 | Bacteria | 5208 |
| 1119 | Ga0495620_0294975 | 3300046515 | Bacteria | 616 |
| 1120 | Ga0495628_0212869 | 3300046516 | Bacteria | 1453 |
| 1121 | Ga0495630_0144757 | 3300046517 | Bacteria | 1807 |
| 1122 | Ga0495630_0654721 | 3300046517 | Bacteria | 804 |
| 1123 | Ga0495630_0891788 | 3300046517 | Bacteria | 678 |
| 1124 | Ga0495631_0000684 | 3300046518 | Bacteria | 21916 |
| 1125 | Ga0495631_0002923 | 3300046518 | Bacteria | 9464 |
| 1126 | Ga0495631_0003899 | 3300046518 | Bacteria | 8065 |
| 1127 | Ga0495631_0006452 | 3300046518 | Bacteria | 6054 |
| 1128 | Ga0495631_0014808 | 3300046518 | Bacteria | 3755 |
| 1129 | Ga0495631_0035930 | 3300046518 | Bacteria | 2214 |
| 1130 | Ga0495631_0066285 | 3300046518 | Bacteria | 1562 |
| 1131 | Ga0495631_0181683 | 3300046518 | Bacteria | 901 |
| 1132 | Ga0495632_0000098 | 3300046519 | Bacteria | 88691 |
| 1133 | Ga0495632_0000152 | 3300046519 | Bacteria | 71699 |
| 1134 | Ga0495632_0002349 | 3300046519 | Bacteria | 14506 |
| 1135 | Ga0495632_0003810 | 3300046519 | Bacteria | 10511 |
| 1136 | Ga0495632_0005546 | 3300046519 | Bacteria | 8318 |
| 1137 | Ga0495632_0011269 | 3300046519 | Bacteria | 5229 |
| 1138 | Ga0495632_0014466 | 3300046519 | Bacteria | 4462 |
| 1139 | Ga0495632_0024146 | 3300046519 | Bacteria | 3236 |
| 1140 | Ga0495632_0086630 | 3300046519 | Bacteria | 1489 |
| 1141 | Ga0495632_0130761 | 3300046519 | Bacteria | 1168 |
| 1142 | Ga0495637_0000013 | 3300046520 | Bacteria | 244837 |
| 1143 | Ga0495637_0003644 | 3300046520 | Bacteria | 8158 |
| 1144 | Ga0495637_0012166 | 3300046520 | Bacteria | 4120 |
| 1145 | Ga0495637_0015193 | 3300046520 | Bacteria | 3615 |
| 1146 | Ga0495637_0022638 | 3300046520 | Bacteria | 2864 |
| 1147 | Ga0495637_0035358 | 3300046520 | Bacteria | 2182 |
| 1148 | Ga0495643_0000115 | 3300046522 | Bacteria | 130423 |
| 1149 | Ga0495643_0000204 | 3300046522 | Bacteria | 92222 |
| 1150 | Ga0495643_0000206 | 3300046522 | Bacteria | 91463 |
| 1151 | Ga0495643_0005635 | 3300046522 | Bacteria | 8400 |
| 1152 | Ga0495643_0008875 | 3300046522 | Bacteria | 6322 |
| 1153 | Ga0495643_0010126 | 3300046522 | Bacteria | 5815 |
| 1154 | Ga0495643_0020187 | 3300046522 | Bacteria | 3847 |
| 1155 | Ga0495643_0032309 | 3300046522 | Bacteria | 2906 |
| 1156 | Ga0495643_0032526 | 3300046522 | Bacteria | 2895 |
| 1157 | Ga0495643_0052450 | 3300046522 | Bacteria | 2190 |
| 1158 | Ga0495643_0062241 | 3300046522 | Bacteria | 1976 |
| 1159 | Ga0495643_0121146 | 3300046522 | Bacteria | 1321 |
| 1160 | Ga0495643_0293703 | 3300046522 | Bacteria | 743 |
| 1161 | Ga0495644_0006682 | 3300046523 | Bacteria | 4467 |
| 1162 | Ga0495644_0010702 | 3300046523 | Bacteria | 3533 |
| 1163 | Ga0495644_0012933 | 3300046523 | Bacteria | 3208 |
| 1164 | Ga0495644_0025704 | 3300046523 | Bacteria | 2234 |
| 1165 | Ga0495644_0043410 | 3300046523 | Bacteria | 1692 |
| 1166 | Ga0495644_0051930 | 3300046523 | Bacteria | 1539 |
| 1167 | Ga0495644_0062795 | 3300046523 | Bacteria | 1396 |
| 1168 | Ga0495648_0000089 | 3300046524 | Bacteria | 115026 |
| 1169 | Ga0495648_0000091 | 3300046524 | Bacteria | 113822 |
| 1170 | Ga0495648_0000353 | 3300046524 | Bacteria | 50659 |
| 1171 | Ga0495648_0001746 | 3300046524 | Bacteria | 21012 |
| 1172 | Ga0495648_0010945 | 3300046524 | Bacteria | 6879 |
| 1173 | Ga0495648_0019012 | 3300046524 | Bacteria | 4845 |
| 1174 | Ga0495648_0023916 | 3300046524 | Bacteria | 4172 |
| 1175 | Ga0495648_0032254 | 3300046524 | Bacteria | 3440 |
| 1176 | Ga0495648_0034766 | 3300046524 | Bacteria | 3275 |
| 1177 | Ga0495648_0041778 | 3300046524 | Bacteria | 2892 |
| 1178 | Ga0495648_0076691 | 3300046524 | Bacteria | 1918 |
| 1179 | Ga0495648_0117986 | 3300046524 | Bacteria | 1431 |
| 1180 | Ga0495648_0158085 | 3300046524 | Bacteria | 1175 |
| 1181 | Ga0495648_0177032 | 3300046524 | Bacteria | 1088 |
| 1182 | Ga0495648_0295370 | 3300046524 | Bacteria | 761 |
| 1183 | Ga0495648_0354105 | 3300046524 | Bacteria | 669 |
| 1184 | Ga0495663_0178770 | 3300046525 | Bacteria | 734 |
| 1185 | Ga0495663_0348303 | 3300046525 | Bacteria | 539 |
| 1186 | Ga0495666_0000042 | 3300046526 | Bacteria | 47032 |
| 1187 | Ga0495666_0000406 | 3300046526 | Bacteria | 18977 |
| 1188 | Ga0495666_0066514 | 3300046526 | Bacteria | 1718 |
| 1189 | Ga0495666_0218832 | 3300046526 | Bacteria | 872 |
| 1190 | Ga0495642_0004297 | 3300046528 | Bacteria | 5538 |
| 1191 | Ga0495642_0004327 | 3300046528 | Bacteria | 5515 |
| 1192 | Ga0495642_0005729 | 3300046528 | Bacteria | 4766 |
| 1193 | Ga0495642_0005832 | 3300046528 | Bacteria | 4725 |
| 1194 | Ga0495642_0032927 | 3300046528 | Bacteria | 2082 |
| 1195 | Ga0495642_0141799 | 3300046528 | Bacteria | 1037 |
| 1196 | Ga0495642_0191297 | 3300046528 | Bacteria | 891 |
| 1197 | Ga0495642_0220331 | 3300046528 | Bacteria | 828 |
| 1198 | Ga0495642_0384232 | 3300046528 | Bacteria | 618 |
| 1199 | Ga0495652_0008927 | 3300046529 | Bacteria | 9122 |
| 1200 | Ga0495652_0644009 | 3300046529 | Bacteria | 718 |
| 1201 | Ga0495652_0692160 | 3300046529 | Bacteria | 687 |
| 1202 | Ga0495654_0000047 | 3300046530 | Bacteria | 147597 |
| 1203 | Ga0495654_0010498 | 3300046530 | Bacteria | 5037 |
| 1204 | Ga0495654_0047709 | 3300046530 | Bacteria | 2104 |
| 1205 | Ga0495654_0054606 | 3300046530 | Bacteria | 1937 |
| 1206 | Ga0495654_0108211 | 3300046530 | Bacteria | 1271 |
| 1207 | Ga0495654_0164605 | 3300046530 | Bacteria | 971 |
| 1208 | Ga0495665_0011224 | 3300046531 | Bacteria | 4851 |
| 1209 | Ga0495665_0020612 | 3300046531 | Bacteria | 3539 |
| 1210 | Ga0495665_0351615 | 3300046531 | Bacteria | 750 |
| 1211 | Ga0495665_0430889 | 3300046531 | Bacteria | 667 |
| 1212 | Ga0495640_0563530 | 3300046533 | Bacteria | 690 |
| 1213 | Ga0495586_0003306 | 3300046535 | Bacteria | 8645 |
| 1214 | Ga0495586_0029130 | 3300046535 | Bacteria | 2955 |
| 1215 | Ga0495586_0041477 | 3300046535 | Bacteria | 2478 |
| 1216 | Ga0495586_0068372 | 3300046535 | Bacteria | 1937 |
| 1217 | Ga0495587_0025272 | 3300046536 | Bacteria | 3629 |
| 1218 | Ga0495587_0222801 | 3300046536 | Bacteria | 1063 |
| 1219 | Ga0495609_0000022 | 3300046538 | Bacteria | 279488 |
| 1220 | Ga0495609_0000482 | 3300046538 | Bacteria | 31993 |
| 1221 | Ga0495609_0000525 | 3300046538 | Bacteria | 30623 |
| 1222 | Ga0495609_0000817 | 3300046538 | Bacteria | 23240 |
| 1223 | Ga0495609_0004242 | 3300046538 | Bacteria | 7918 |
| 1224 | Ga0495609_0011455 | 3300046538 | Bacteria | 4222 |
| 1225 | Ga0495609_0015753 | 3300046538 | Bacteria | 3534 |
| 1226 | Ga0495609_0027835 | 3300046538 | Bacteria | 2581 |
| 1227 | Ga0495609_0040439 | 3300046538 | Bacteria | 2098 |
| 1228 | Ga0495609_0045080 | 3300046538 | Bacteria | 1976 |
| 1229 | Ga0495609_0064246 | 3300046538 | Bacteria | 1619 |
| 1230 | Ga0495609_0092309 | 3300046538 | Bacteria | 1316 |
| 1231 | Ga0495609_0129507 | 3300046538 | Bacteria | 1081 |
| 1232 | Ga0495609_0212564 | 3300046538 | Bacteria | 805 |
| 1233 | Ga0495621_0003510 | 3300046539 | Bacteria | 4327 |
| 1234 | Ga0495597_0000104 | 3300046542 | Bacteria | 75532 |
| 1235 | Ga0495597_0000246 | 3300046542 | Bacteria | 49396 |
| 1236 | Ga0495597_0000771 | 3300046542 | Bacteria | 25342 |
| 1237 | Ga0495597_0000806 | 3300046542 | Bacteria | 24735 |
| 1238 | Ga0495597_0004134 | 3300046542 | Bacteria | 8071 |
| 1239 | Ga0495597_0004503 | 3300046542 | Bacteria | 7633 |
| 1240 | Ga0495597_0051448 | 3300046542 | Bacteria | 1816 |
| 1241 | Ga0495597_0218038 | 3300046542 | Bacteria | 758 |
| 1242 | Ga0495645_0519153 | 3300046543 | Bacteria | 742 |
| 1243 | Ga0495622_0000015 | 3300046557 | Bacteria | 179054 |
| 1244 | Ga0495622_0000598 | 3300046557 | Bacteria | 21004 |
| 1245 | Ga0495622_0003085 | 3300046557 | Bacteria | 7901 |
| 1246 | Ga0495622_0027127 | 3300046557 | Bacteria | 2673 |
| 1247 | Ga0495622_0178754 | 3300046557 | Bacteria | 952 |
| 1248 | Ga0495633_0000110 | 3300046558 | Bacteria | 110302 |
| 1249 | Ga0495633_0000189 | 3300046558 | Bacteria | 80465 |
| 1250 | Ga0495633_0000253 | 3300046558 | Bacteria | 63420 |
| 1251 | Ga0495633_0003539 | 3300046558 | Bacteria | 10342 |
| 1252 | Ga0495633_0004049 | 3300046558 | Bacteria | 9473 |
| 1253 | Ga0495633_0005097 | 3300046558 | Bacteria | 8158 |
| 1254 | Ga0495633_0006064 | 3300046558 | Bacteria | 7247 |
| 1255 | Ga0495633_0019372 | 3300046558 | Bacteria | 3443 |
| 1256 | Ga0495633_0024369 | 3300046558 | Bacteria | 2991 |
| 1257 | Ga0495633_0027835 | 3300046558 | Bacteria | 2759 |
| 1258 | Ga0495633_0045331 | 3300046558 | Bacteria | 2082 |
| 1259 | Ga0495633_0053117 | 3300046558 | Bacteria | 1907 |
| 1260 | Ga0495633_0058702 | 3300046558 | Bacteria | 1805 |
| 1261 | Ga0495633_0077901 | 3300046558 | Bacteria | 1543 |
| 1262 | Ga0495633_0186950 | 3300046558 | Bacteria | 953 |
| 1263 | Ga0495667_0409249 | 3300046559 | Bacteria | 854 |
| 1264 | Ga0495656_0046421 | 3300046615 | Bacteria | 1838 |
| 1265 | Ga0495656_0295828 | 3300046615 | Bacteria | 828 |
| 1266 | Ga0495656_0413918 | 3300046615 | Bacteria | 706 |
| 1267 | Ga0495656_0542329 | 3300046615 | Bacteria | 619 |
| 1268 | Ga0495656_0543884 | 3300046615 | Bacteria | 618 |
| 1269 | Ga0495668_0000064 | 3300046616 | Bacteria | 180583 |
| 1270 | Ga0495668_0000131 | 3300046616 | Bacteria | 112755 |
| 1271 | Ga0495668_0000245 | 3300046616 | Bacteria | 77566 |
| 1272 | Ga0495668_0000434 | 3300046616 | Bacteria | 53950 |
| 1273 | Ga0495668_0001415 | 3300046616 | Bacteria | 23352 |
| 1274 | Ga0495668_0001765 | 3300046616 | Bacteria | 19790 |
| 1275 | Ga0495668_0005921 | 3300046616 | Bacteria | 8133 |
| 1276 | Ga0495668_0006701 | 3300046616 | Bacteria | 7502 |
| 1277 | Ga0495668_0037092 | 3300046616 | Bacteria | 2729 |
| 1278 | Ga0495668_0112999 | 3300046616 | Bacteria | 1485 |
| 1279 | Ga0495668_0181098 | 3300046616 | Bacteria | 1154 |
| 1280 | Ga0495668_0574453 | 3300046616 | Bacteria | 622 |
| 1281 | Ga0495668_0642286 | 3300046616 | Bacteria | 586 |
| 1282 | Ga0495634_0006153 | 3300046642 | Bacteria | 9139 |
| 1283 | Ga0495634_0420950 | 3300046642 | Bacteria | 791 |
| 1284 | Ga0495611_0003458 | 3300046648 | Bacteria | 6962 |
| 1285 | Ga0495611_0008445 | 3300046648 | Bacteria | 4360 |
| 1286 | Ga0495611_0016209 | 3300046648 | Bacteria | 3185 |
| 1287 | Ga0495611_0024536 | 3300046648 | Bacteria | 2623 |
| 1288 | Ga0495625_0000188 | 3300046660 | Bacteria | 97649 |
| 1289 | Ga0495625_0001292 | 3300046660 | Bacteria | 31449 |
| 1290 | Ga0495625_0001624 | 3300046660 | Bacteria | 26504 |
| 1291 | Ga0495625_0011006 | 3300046660 | Bacteria | 7423 |
| 1292 | Ga0495625_0011060 | 3300046660 | Bacteria | 7395 |
| 1293 | Ga0495625_0023122 | 3300046660 | Bacteria | 4751 |
| 1294 | Ga0495625_0051373 | 3300046660 | Bacteria | 2955 |
| 1295 | Ga0495625_0093430 | 3300046660 | Bacteria | 2077 |
| 1296 | Ga0495625_0138509 | 3300046660 | Bacteria | 1643 |
| 1297 | Ga0495625_0140960 | 3300046660 | Bacteria | 1626 |
| 1298 | Ga0495625_0175871 | 3300046660 | Bacteria | 1426 |
| 1299 | Ga0495625_0179402 | 3300046660 | Bacteria | 1409 |
| 1300 | Ga0495625_0454015 | 3300046660 | Bacteria | 791 |
| 1301 | Ga0495625_0463659 | 3300046660 | Bacteria | 780 |
| 1302 | Ga0495635_0005244 | 3300046663 | Bacteria | 9016 |
| 1303 | Ga0495659_0000679 | 3300046664 | Bacteria | 12343 |
| 1304 | Ga0495659_0001640 | 3300046664 | Bacteria | 7513 |
| 1305 | Ga0495661_0000502 | 3300046665 | Bacteria | 40792 |
| 1306 | Ga0495661_0001265 | 3300046665 | Bacteria | 21757 |
| 1307 | Ga0495661_0005726 | 3300046665 | Bacteria | 8799 |
| 1308 | Ga0495661_0009038 | 3300046665 | Bacteria | 6857 |
| 1309 | Ga0495661_0015856 | 3300046665 | Bacteria | 5016 |
| 1310 | Ga0495661_0027532 | 3300046665 | Bacteria | 3647 |
| 1311 | Ga0495661_0031420 | 3300046665 | Bacteria | 3370 |
| 1312 | Ga0495661_0035252 | 3300046665 | Bacteria | 3141 |
| 1313 | Ga0495661_0043898 | 3300046665 | Bacteria | 2744 |
| 1314 | Ga0495661_0049104 | 3300046665 | Bacteria | 2560 |
| 1315 | Ga0495661_0083814 | 3300046665 | Bacteria | 1831 |
| 1316 | Ga0495661_0087827 | 3300046665 | Bacteria | 1776 |
| 1317 | Ga0495661_0089152 | 3300046665 | Bacteria | 1759 |
| 1318 | Ga0495661_0104665 | 3300046665 | Bacteria | 1586 |
| 1319 | Ga0495661_0105438 | 3300046665 | Bacteria | 1578 |
| 1320 | Ga0495661_0112456 | 3300046665 | Bacteria | 1515 |
| 1321 | Ga0495661_0123683 | 3300046665 | Bacteria | 1425 |
| 1322 | Ga0495661_0210079 | 3300046665 | Bacteria | 1014 |
| 1323 | Ga0495661_0401328 | 3300046665 | Bacteria | 666 |
| 1324 | Ga0495661_0437020 | 3300046665 | Bacteria | 631 |
| 1325 | Ga0495588_0000148 | 3300046674 | Bacteria | 100600 |
| 1326 | Ga0495588_0017071 | 3300046674 | Bacteria | 3518 |
| 1327 | Ga0495588_0074754 | 3300046674 | Bacteria | 1764 |
| 1328 | Ga0495588_0081574 | 3300046674 | Bacteria | 1688 |
| 1329 | Ga0495588_0151054 | 3300046674 | Bacteria | 1227 |
| 1330 | Ga0495599_0420424 | 3300046678 | Bacteria | 794 |
| 1331 | Ga0495623_0023548 | 3300046679 | Bacteria | 3974 |
| 1332 | Ga0495623_0030990 | 3300046679 | Bacteria | 3440 |
| 1333 | Ga0495623_0033544 | 3300046679 | Bacteria | 3294 |
| 1334 | Ga0495647_0082352 | 3300046681 | Bacteria | 1307 |
| 1335 | Ga0495658_0678181 | 3300046683 | Bacteria | 660 |
| 1336 | Ga0495669_0000355 | 3300046684 | Bacteria | 23402 |
| 1337 | Ga0495669_0001964 | 3300046684 | Bacteria | 8448 |
| 1338 | Ga0495669_0007315 | 3300046684 | Bacteria | 4625 |
| 1339 | Ga0495669_0016714 | 3300046684 | Bacteria | 3145 |
| 1340 | Ga0495669_0027926 | 3300046684 | Bacteria | 2469 |
| 1341 | Ga0495613_0009841 | 3300046689 | Bacteria | 7111 |
| 1342 | Ga0495613_0232461 | 3300046689 | Bacteria | 1291 |
| 1343 | Ga0495613_0890572 | 3300046689 | Bacteria | 576 |
| 1344 | Ga0495624_0018263 | 3300046690 | Bacteria | 4691 |
| 1345 | Ga0495670_0003213 | 3300046691 | Bacteria | 8042 |
| 1346 | Ga0495670_0011444 | 3300046691 | Bacteria | 4364 |
| 1347 | Ga0495670_0030214 | 3300046691 | Bacteria | 2691 |
| 1348 | Ga0495670_0086312 | 3300046691 | Bacteria | 1602 |
| 1349 | Ga0495670_0108500 | 3300046691 | Bacteria | 1435 |
| 1350 | Ga0495670_0156969 | 3300046691 | Bacteria | 1194 |
| 1351 | Ga0495670_0374453 | 3300046691 | Bacteria | 768 |
| 1352 | Ga0495670_0421203 | 3300046691 | Bacteria | 722 |
| 1353 | Ga0495670_0440460 | 3300046691 | Bacteria | 706 |
| 1354 | Ga0495670_0562660 | 3300046691 | Bacteria | 620 |
| 1355 | Ga0495671_0000044 | 3300046692 | Bacteria | 160337 |
| 1356 | Ga0495671_0000426 | 3300046692 | Bacteria | 33503 |
| 1357 | Ga0495671_0019650 | 3300046692 | Bacteria | 3566 |
| 1358 | Ga0495671_0028581 | 3300046692 | Bacteria | 2871 |
| 1359 | Ga0495671_0038152 | 3300046692 | Bacteria | 2428 |
| 1360 | Ga0495671_0073066 | 3300046692 | Bacteria | 1683 |
| 1361 | Ga0495671_0290865 | 3300046692 | Bacteria | 786 |
| 1362 | Ga0495671_0312540 | 3300046692 | Bacteria | 755 |
| 1363 | Ga0495649_0000806 | 3300046694 | Bacteria | 25272 |
| 1364 | Ga0495649_0005148 | 3300046694 | Bacteria | 8387 |
| 1365 | Ga0495649_0019253 | 3300046694 | Bacteria | 3835 |
| 1366 | Ga0495649_0040661 | 3300046694 | Bacteria | 2544 |
| 1367 | Ga0495649_0102632 | 3300046694 | Bacteria | 1519 |
| 1368 | Ga0495649_0110028 | 3300046694 | Bacteria | 1461 |
| 1369 | Ga0495649_0218377 | 3300046694 | Bacteria | 986 |
| 1370 | Ga0495649_0337019 | 3300046694 | Bacteria | 763 |
| 1371 | Ga0495649_0480981 | 3300046694 | Bacteria | 618 |
| 1372 | Ga0495589_0000017 | 3300046794 | Bacteria | 206113 |
| 1373 | Ga0495589_0000508 | 3300046794 | Bacteria | 27530 |
| 1374 | Ga0495589_0006901 | 3300046794 | Bacteria | 5969 |
| 1375 | Ga0495589_0009727 | 3300046794 | Bacteria | 4995 |
| 1376 | Ga0495589_0015977 | 3300046794 | Bacteria | 3859 |
| 1377 | Ga0495589_0049188 | 3300046794 | Bacteria | 2086 |
| 1378 | Ga0495589_0052782 | 3300046794 | Bacteria | 2007 |
| 1379 | Ga0495589_0091798 | 3300046794 | Bacteria | 1474 |
| 1380 | Ga0495600_0123284 | 3300046809 | Bacteria | 1685 |
| 1381 | Ga0495660_0000162 | 3300046810 | Bacteria | 71874 |
| 1382 | Ga0495660_0000403 | 3300046810 | Bacteria | 37269 |
| 1383 | Ga0495660_0005437 | 3300046810 | Bacteria | 7627 |
| 1384 | Ga0495660_0007545 | 3300046810 | Bacteria | 6385 |
| 1385 | Ga0495660_0015676 | 3300046810 | Bacteria | 4376 |
| 1386 | Ga0495660_0021946 | 3300046810 | Bacteria | 3650 |
| 1387 | Ga0495660_0023195 | 3300046810 | Bacteria | 3541 |
| 1388 | Ga0495660_0035577 | 3300046810 | Bacteria | 2781 |
| 1389 | Ga0495660_0086023 | 3300046810 | Bacteria | 1641 |
| 1390 | Ga0495660_0139169 | 3300046810 | Bacteria | 1209 |
| 1391 | Ga0495660_0261881 | 3300046810 | Bacteria | 798 |
| 1392 | Ga0495660_0314563 | 3300046810 | Bacteria | 705 |
| 1393 | Ga0495660_0429093 | 3300046810 | Bacteria | 574 |
| 1394 | Ga0495581_0027074 | 3300047315 | Bacteria | 3325 |
| 1395 | Ga0495581_0068577 | 3300047315 | Bacteria | 2050 |
| 1396 | Ga0495581_0138604 | 3300047315 | Bacteria | 1418 |
| 1397 | Ga0495581_0351395 | 3300047315 | Bacteria | 860 |
| 1398 | Ga0495604_0006708 | 3300047317 | Bacteria | 9127 |
| 1399 | Ga0495604_0044087 | 3300047317 | Bacteria | 3488 |
| 1400 | Ga0495604_0150900 | 3300047317 | Bacteria | 1651 |
| 1401 | Ga0495604_0349592 | 3300047317 | Bacteria | 982 |
| 1402 | Ga0495636_0005184 | 3300047318 | Bacteria | 5111 |
| 1403 | Ga0495636_0050921 | 3300047318 | Bacteria | 1734 |
| 1404 | Ga0495636_0163907 | 3300047318 | Bacteria | 1002 |
| 1405 | Ga0495636_0339180 | 3300047318 | Bacteria | 708 |
| 1406 | Ga0495674_0006559 | 3300047319 | Bacteria | 11166 |
| 1407 | Ga0495672_0000111 | 3300047320 | Bacteria | 130829 |
| 1408 | Ga0495672_0000142 | 3300047320 | Bacteria | 105843 |
| 1409 | Ga0495672_0000152 | 3300047320 | Bacteria | 100381 |
| 1410 | Ga0495672_0000167 | 3300047320 | Bacteria | 95937 |
| 1411 | Ga0495672_0000559 | 3300047320 | Bacteria | 42288 |
| 1412 | Ga0495672_0000581 | 3300047320 | Bacteria | 41296 |
| 1413 | Ga0495672_0038378 | 3300047320 | Bacteria | 2922 |
| 1414 | Ga0495672_0070711 | 3300047320 | Bacteria | 1976 |
| 1415 | Ga0495672_0075445 | 3300047320 | Bacteria | 1896 |
| 1416 | Ga0495672_0097259 | 3300047320 | Bacteria | 1603 |
| 1417 | Ga0495676_0000123 | 3300047321 | Bacteria | 59710 |
| 1418 | Ga0495676_0069412 | 3300047321 | Bacteria | 2719 |
| 1419 | Ga0495676_0588180 | 3300047321 | Bacteria | 725 |
| 1420 | Ga0495680_0007799 | 3300047322 | Bacteria | 9775 |
| 1421 | Ga0495680_0060600 | 3300047322 | Bacteria | 2916 |
| 1422 | Ga0495683_0000069 | 3300047323 | Bacteria | 110339 |
| 1423 | Ga0495683_0000098 | 3300047323 | Bacteria | 88510 |
| 1424 | Ga0495683_0002101 | 3300047323 | Bacteria | 12334 |
| 1425 | Ga0495683_0014744 | 3300047323 | Bacteria | 4072 |
| 1426 | Ga0495683_0019856 | 3300047323 | Bacteria | 3466 |
| 1427 | Ga0495683_0026681 | 3300047323 | Bacteria | 2955 |
| 1428 | Ga0495683_0044801 | 3300047323 | Bacteria | 2225 |
| 1429 | Ga0495683_0046896 | 3300047323 | Bacteria | 2169 |
| 1430 | Ga0495683_0068070 | 3300047323 | Bacteria | 1752 |
| 1431 | Ga0495683_0116851 | 3300047323 | Bacteria | 1269 |
| 1432 | Ga0495687_000113 | 3300047443 | Bacteria | 123712 |
| 1433 | Ga0495687_000140 | 3300047443 | Bacteria | 109311 |
| 1434 | Ga0495687_000175 | 3300047443 | Bacteria | 94911 |
| 1435 | Ga0495687_000236 | 3300047443 | Bacteria | 76970 |
| 1436 | Ga0495687_002221 | 3300047443 | Bacteria | 16034 |
| 1437 | Ga0495687_007947 | 3300047443 | Bacteria | 6160 |
| 1438 | Ga0495687_010281 | 3300047443 | Bacteria | 5141 |
| 1439 | Ga0495687_044949 | 3300047443 | Bacteria | 1915 |
| 1440 | Ga0495675_0012446 | 3300047444 | Bacteria | 5355 |
| 1441 | Ga0495675_0109769 | 3300047444 | Bacteria | 1722 |
| 1442 | Ga0495675_0113683 | 3300047444 | Bacteria | 1688 |
| 1443 | Ga0495675_0200665 | 3300047444 | Bacteria | 1214 |
| 1444 | Ga0495677_0000002 | 3300047445 | Bacteria | 346767 |
| 1445 | Ga0495677_0000079 | 3300047445 | Bacteria | 49339 |
| 1446 | Ga0495677_0000140 | 3300047445 | Bacteria | 34650 |
| 1447 | Ga0495677_0000530 | 3300047445 | Bacteria | 15886 |
| 1448 | Ga0495677_0002486 | 3300047445 | Bacteria | 7231 |
| 1449 | Ga0495677_0004215 | 3300047445 | Bacteria | 5543 |
| 1450 | Ga0495677_0005141 | 3300047445 | Bacteria | 4980 |
| 1451 | Ga0495677_0006745 | 3300047445 | Bacteria | 4319 |
| 1452 | Ga0495677_0056288 | 3300047445 | Bacteria | 1452 |
| 1453 | Ga0495677_0100590 | 3300047445 | Bacteria | 1094 |
| 1454 | Ga0495679_009955 | 3300047446 | Bacteria | 3766 |
| 1455 | Ga0495679_011673 | 3300047446 | Bacteria | 3375 |
| 1456 | Ga0495679_021210 | 3300047446 | Bacteria | 2248 |
| 1457 | Ga0495679_034304 | 3300047446 | Bacteria | 1616 |
| 1458 | Ga0495679_041740 | 3300047446 | Bacteria | 1418 |
| 1459 | Ga0495679_048811 | 3300047446 | Bacteria | 1278 |
| 1460 | Ga0495679_058770 | 3300047446 | Bacteria | 1133 |
| 1461 | Ga0495679_173340 | 3300047446 | Bacteria | 573 |
| 1462 | Ga0495685_000035 | 3300047447 | Bacteria | 55942 |
| 1463 | Ga0495685_007306 | 3300047447 | Bacteria | 3644 |
| 1464 | Ga0495685_017962 | 3300047447 | Bacteria | 2423 |
| 1465 | Ga0495685_040764 | 3300047447 | Bacteria | 1587 |
| 1466 | Ga0495685_068902 | 3300047447 | Bacteria | 1187 |
| 1467 | Ga0495673_0000060 | 3300047469 | Bacteria | 231642 |
| 1468 | Ga0495673_0000085 | 3300047469 | Bacteria | 193245 |
| 1469 | Ga0495673_0000149 | 3300047469 | Bacteria | 122863 |
| 1470 | Ga0495673_0002074 | 3300047469 | Bacteria | 14639 |
| 1471 | Ga0495673_0011481 | 3300047469 | Bacteria | 4760 |
| 1472 | Ga0495673_0138910 | 3300047469 | Bacteria | 949 |
| 1473 | Ga0495681_0000824 | 3300047470 | Bacteria | 23910 |
| 1474 | Ga0495681_0008558 | 3300047470 | Bacteria | 6401 |
| 1475 | Ga0495681_0012074 | 3300047470 | Bacteria | 5094 |
| 1476 | Ga0495681_0022943 | 3300047470 | Bacteria | 3327 |
| 1477 | Ga0495681_0037046 | 3300047470 | Bacteria | 2406 |
| 1478 | Ga0495681_0069635 | 3300047470 | Bacteria | 1597 |
| 1479 | Ga0495681_0071377 | 3300047470 | Bacteria | 1572 |
| 1480 | Ga0495681_0132533 | 3300047470 | Bacteria | 1059 |
| 1481 | Ga0495686_0000169 | 3300047472 | Bacteria | 123511 |
| 1482 | Ga0495686_0001301 | 3300047472 | Bacteria | 28115 |
| 1483 | Ga0495686_0001456 | 3300047472 | Bacteria | 25789 |
| 1484 | Ga0495686_0022113 | 3300047472 | Bacteria | 4210 |
| 1485 | Ga0495686_0045233 | 3300047472 | Bacteria | 2785 |
| 1486 | Ga0495686_0051556 | 3300047472 | Bacteria | 2581 |
| 1487 | Ga0495686_0063418 | 3300047472 | Bacteria | 2290 |
| 1488 | Ga0495686_0176616 | 3300047472 | Bacteria | 1239 |
| 1489 | Ga0495686_0193354 | 3300047472 | Bacteria | 1171 |
| 1490 | Ga0495686_0640205 | 3300047472 | Bacteria | 547 |
| 1491 | Ga0495593_0007070 | 3300047673 | Bacteria | 6583 |
| 1492 | Ga0495593_0027236 | 3300047673 | Bacteria | 3148 |
| 1493 | Ga0495593_0334876 | 3300047673 | Bacteria | 756 |
| 1494 | Ga0495602_0013704 | 3300048088 | Bacteria | 8268 |
| 1495 | Ga0495602_0038029 | 3300048088 | Bacteria | 4456 |
| 1496 | Ga0495602_1165652 | 3300048088 | Bacteria | 503 |
| 1497 | Ga0495614_0005675 | 3300048089 | Bacteria | 5625 |
| 1498 | Ga0495614_0259825 | 3300048089 | Bacteria | 796 |
| 1499 | Ga0495614_0275022 | 3300048089 | Bacteria | 774 |
| 1500 | Ga0495615_0251393 | 3300048090 | Bacteria | 560 |
| 1501 | Ga0495626_0000076 | 3300048091 | Bacteria | 131125 |
| 1502 | Ga0495626_0000170 | 3300048091 | Bacteria | 80445 |
| 1503 | Ga0495626_0000882 | 3300048091 | Bacteria | 26543 |
| 1504 | Ga0495626_0002487 | 3300048091 | Bacteria | 12748 |
| 1505 | Ga0495626_0014577 | 3300048091 | Bacteria | 4049 |
| 1506 | Ga0495626_0016369 | 3300048091 | Bacteria | 3768 |
| 1507 | Ga0495626_0018299 | 3300048091 | Bacteria | 3521 |
| 1508 | Ga0495626_0020538 | 3300048091 | Bacteria | 3288 |
| 1509 | Ga0495626_0055268 | 3300048091 | Bacteria | 1820 |
| 1510 | Ga0495626_0063415 | 3300048091 | Bacteria | 1676 |
| 1511 | Ga0495626_0077862 | 3300048091 | Bacteria | 1477 |
| 1512 | Ga0495626_0086070 | 3300048091 | Bacteria | 1389 |
| 1513 | Ga0495626_0102698 | 3300048091 | Bacteria | 1245 |
| 1514 | Ga0495626_0240270 | 3300048091 | Bacteria | 729 |
| 1515 | Ga0495626_0294420 | 3300048091 | Bacteria | 642 |
| 1516 | Ga0496100_0008425 | 3300048903 | Bacteria | 5749 |
| 1517 | Ga0496100_0091449 | 3300048903 | Bacteria | 2077 |
| 1518 | Ga0496100_0425875 | 3300048903 | Bacteria | 1014 |
| 1519 | Ga0496101_0119689 | 3300048904 | Bacteria | 1989 |
| 1520 | Ga0496101_0407770 | 3300048904 | Bacteria | 1071 |
| 1521 | Ga0496101_0818837 | 3300048904 | Bacteria | 734 |
| 1522 | Ga0496102_0000156 | 3300048905 | Bacteria | 92538 |
| 1523 | Ga0496102_0026637 | 3300048905 | Bacteria | 5160 |
| 1524 | Ga0496102_0035916 | 3300048905 | Bacteria | 4463 |
| 1525 | Ga0496102_0040492 | 3300048905 | Bacteria | 4215 |
| 1526 | Ga0496102_0241353 | 3300048905 | Bacteria | 1704 |
| 1527 | Ga0496102_1601529 | 3300048905 | Bacteria | 569 |
| 1528 | Ga0496103_0001871 | 3300048906 | Bacteria | 13677 |
| 1529 | Ga0496103_0050964 | 3300048906 | Bacteria | 2561 |
| 1530 | Ga0496103_0314841 | 3300048906 | Bacteria | 1007 |
| 1531 | Ga0496103_0481771 | 3300048906 | Bacteria | 795 |
| 1532 | Ga0496103_0685025 | 3300048906 | Bacteria | 650 |
| 1533 | Ga0496104_0031258 | 3300048907 | Bacteria | 4951 |
| 1534 | Ga0496104_0145130 | 3300048907 | Bacteria | 2279 |
| 1535 | Ga0496104_0308104 | 3300048907 | Bacteria | 1496 |
| 1536 | Ga0496104_0772260 | 3300048907 | Bacteria | 867 |
| 1537 | Ga0496105_0086137 | 3300048908 | Bacteria | 2596 |
| 1538 | Ga0496105_0115503 | 3300048908 | Bacteria | 2214 |
| 1539 | Ga0496105_0277813 | 3300048908 | Bacteria | 1351 |
| 1540 | Ga0496105_0336785 | 3300048908 | Bacteria | 1207 |
| 1541 | Ga0496105_1046679 | 3300048908 | Bacteria | 608 |
| 1542 | Ga0496106_0092083 | 3300048909 | Bacteria | 2341 |
| 1543 | Ga0496106_0163178 | 3300048909 | Bacteria | 1763 |
| 1544 | Ga0496106_0206902 | 3300048909 | Bacteria | 1562 |
| 1545 | Ga0496106_0758867 | 3300048909 | Bacteria | 771 |
| 1546 | Ga0496106_1265917 | 3300048909 | Bacteria | 573 |
| 1547 | Ga0496107_0145371 | 3300048910 | Bacteria | 1753 |
| 1548 | Ga0496107_0186240 | 3300048910 | Bacteria | 1542 |
| 1549 | Ga0496107_0496247 | 3300048910 | Bacteria | 906 |
| 1550 | Ga0496107_0705493 | 3300048910 | Bacteria | 742 |
| 1551 | Ga0496108_0148228 | 3300048911 | Bacteria | 2024 |
| 1552 | Ga0496108_0489275 | 3300048911 | Bacteria | 1075 |
| 1553 | Ga0496108_1235550 | 3300048911 | Bacteria | 631 |
| 1554 | Ga0496108_1759002 | 3300048911 | Bacteria | 509 |
| 1555 | Ga0496109_0061400 | 3300048912 | Bacteria | 3436 |
| 1556 | Ga0496109_0103067 | 3300048912 | Bacteria | 2648 |
| 1557 | Ga0496109_0161761 | 3300048912 | Bacteria | 2097 |
| 1558 | Ga0496109_0202296 | 3300048912 | Bacteria | 1867 |
| 1559 | Ga0496109_0713198 | 3300048912 | Bacteria | 941 |
| 1560 | Ga0496110_0015273 | 3300048913 | Bacteria | 6387 |
| 1561 | Ga0496110_0317709 | 3300048913 | Bacteria | 1418 |
| 1562 | Ga0496110_0759304 | 3300048913 | Bacteria | 873 |
| 1563 | Ga0496110_1197560 | 3300048913 | Bacteria | 668 |
| 1564 | Ga0496111_0133500 | 3300048914 | Bacteria | 1838 |
| 1565 | Ga0496111_0403271 | 3300048914 | Bacteria | 1010 |
| 1566 | Ga0496112_0059576 | 3300048915 | Bacteria | 3762 |
| 1567 | Ga0496113_0040930 | 3300048916 | Bacteria | 3417 |
| 1568 | Ga0496113_0050671 | 3300048916 | Bacteria | 3096 |
| 1569 | Ga0496113_0065917 | 3300048916 | Bacteria | 2741 |
| 1570 | Ga0496113_0358311 | 3300048916 | Bacteria | 1170 |
| 1571 | Ga0496113_0375616 | 3300048916 | Bacteria | 1141 |
| 1572 | Ga0496114_0005419 | 3300048917 | Bacteria | 9979 |
| 1573 | Ga0496114_0017437 | 3300048917 | Bacteria | 5796 |
| 1574 | Ga0496114_0065449 | 3300048917 | Bacteria | 3046 |
| 1575 | Ga0496114_0517560 | 3300048917 | Bacteria | 1055 |
| 1576 | Ga0496115_0031336 | 3300048918 | Bacteria | 4190 |
| 1577 | Ga0496115_0118488 | 3300048918 | Bacteria | 2177 |
| 1578 | Ga0496115_0169903 | 3300048918 | Bacteria | 1803 |
| 1579 | Ga0496115_0189893 | 3300048918 | Bacteria | 1697 |
| 1580 | Ga0496115_0502819 | 3300048918 | Bacteria | 974 |
| 1581 | Ga0496115_0712322 | 3300048918 | Bacteria | 788 |
| 1582 | Ga0496116_0026975 | 3300048919 | Bacteria | 4188 |
| 1583 | Ga0496116_0075945 | 3300048919 | Bacteria | 2107 |
| 1584 | Ga0496116_0207566 | 3300048919 | Bacteria | 1018 |
| 1585 | Ga0496117_0000011 | 3300048920 | Bacteria | 610930 |
| 1586 | Ga0496117_0389840 | 3300048920 | Bacteria | 706 |
| 1587 | Ga0496118_0000010 | 3300048921 | Bacteria | 610930 |
| 1588 | Ga0496118_0402302 | 3300048921 | Bacteria | 711 |
| 1589 | Ga0496120_0055568 | 3300048923 | Bacteria | 2238 |
| 1590 | Ga0496121_0014685 | 3300048924 | Bacteria | 8279 |
| 1591 | Ga0496121_0020684 | 3300048924 | Bacteria | 6493 |
| 1592 | Ga0496121_0072058 | 3300048924 | Bacteria | 2775 |
| 1593 | Ga0496121_0089685 | 3300048924 | Bacteria | 2406 |
| 1594 | Ga0496121_0091909 | 3300048924 | Bacteria | 2367 |
| 1595 | Ga0496121_0537109 | 3300048924 | Bacteria | 734 |
| 1596 | Ga0496122_0000653 | 3300048925 | Bacteria | 70150 |
| 1597 | Ga0496122_0000691 | 3300048925 | Bacteria | 67209 |
| 1598 | Ga0496122_0055165 | 3300048925 | Bacteria | 2976 |
| 1599 | Ga0496122_0059591 | 3300048925 | Bacteria | 2817 |
| 1600 | Ga0496123_0000196 | 3300048926 | Bacteria | 122955 |
| 1601 | Ga0496123_0003602 | 3300048926 | Bacteria | 17162 |
| 1602 | Ga0496123_0008397 | 3300048926 | Bacteria | 9492 |
| 1603 | Ga0496123_0023456 | 3300048926 | Bacteria | 4721 |
| 1604 | Ga0496123_0362392 | 3300048926 | Bacteria | 671 |
| 1605 | Ga0496124_0001079 | 3300048927 | Bacteria | 43104 |
| 1606 | Ga0496124_0007424 | 3300048927 | Bacteria | 11656 |
| 1607 | Ga0496124_0047741 | 3300048927 | Bacteria | 3661 |
| 1608 | Ga0496124_0280248 | 3300048927 | Bacteria | 1216 |
| 1609 | Ga0496124_0295836 | 3300048927 | Bacteria | 1172 |
| 1610 | Ga0496124_0342286 | 3300048927 | Bacteria | 1061 |
| 1611 | Ga0496125_0003108 | 3300048928 | Bacteria | 20666 |
| 1612 | Ga0496125_0052257 | 3300048928 | Bacteria | 3361 |
| 1613 | Ga0496125_0052557 | 3300048928 | Bacteria | 3349 |
| 1614 | Ga0496125_0200621 | 3300048928 | Bacteria | 1306 |
| 1615 | Ga0496126_0011408 | 3300048929 | Bacteria | 9204 |
| 1616 | Ga0496126_0324301 | 3300048929 | Bacteria | 1265 |
| 1617 | Ga0496126_0565907 | 3300048929 | Bacteria | 900 |
| 1618 | Ga0501306_031055 | 3300049127 | Bacteria | 794 |
| 1619 | Ga0501308_012646 | 3300049128 | Bacteria | 967 |
| 1620 | Ga0501304_014766 | 3300049160 | Bacteria | 726 |
| 1621 | Ga0501304_017110 | 3300049160 | Bacteria | 691 |
| 1622 | Ga0495678_000001 | 3300049459 | Bacteria | 1060340 |
| 1623 | Ga0495678_000458 | 3300049459 | Bacteria | 40497 |
| 1624 | Ga0495678_000745 | 3300049459 | Bacteria | 29532 |
| 1625 | Ga0495678_001248 | 3300049459 | Bacteria | 20698 |
| 1626 | Ga0495678_013374 | 3300049459 | Bacteria | 3856 |
| 1627 | Ga0495678_016943 | 3300049459 | Bacteria | 3314 |
| 1628 | Ga0495678_018139 | 3300049459 | Bacteria | 3171 |
| 1629 | Ga0495678_055256 | 3300049459 | Bacteria | 1516 |
| 1630 | Ga0495682_0002062 | 3300049460 | Bacteria | 9827 |
| 1631 | Ga0495682_0002194 | 3300049460 | Bacteria | 9446 |
| 1632 | Ga0495682_0003012 | 3300049460 | Bacteria | 7672 |
| 1633 | Ga0495682_0036004 | 3300049460 | Bacteria | 1822 |
| 1634 | Ga0501291_003206 | 3300049514 | Bacteria | 2022 |
| 1635 | Ga0501297_008226 | 3300049520 | Bacteria | 1146 |
| 1636 | Ga0501300_011751 | 3300049523 | Bacteria | 1275 |
| 1637 | Ga0501301_018626 | 3300049524 | Bacteria | 649 |
| 1638 | Ga0501303_017177 | 3300049526 | Bacteria | 739 |
| 1639 | Ga0501314_002322 | 3300049530 | Bacteria | 1459 |
| 1640 | Ga0501315_060558 | 3300049531 | Bacteria | 612 |
| 1641 | Ga0501324_026192 | 3300049540 | Bacteria | 618 |
| 1642 | Ga0501036_0833410 | 3300049572 | Bacteria | 759 |
| 1643 | Ga0501041_0447632 | 3300049577 | Bacteria | 820 |
| 1644 | Ga0501041_0955430 | 3300049577 | Bacteria | 551 |
| 1645 | Ga0501198_000020 | 3300049649 | Bacteria | 75919 |
| 1646 | Ga0501202_077752 | 3300049652 | Bacteria | 775 |
| 1647 | Ga0501210_006741 | 3300049657 | Bacteria | 849 |
| 1648 | Ga0501211_000342 | 3300049658 | Bacteria | 4336 |
| 1649 | Ga0501222_000025 | 3300049662 | Bacteria | 64191 |
| 1650 | Ga0501222_001535 | 3300049662 | Bacteria | 3221 |
| 1651 | Ga0501222_008087 | 3300049662 | Bacteria | 1398 |
| 1652 | Ga0501223_007317 | 3300049663 | Bacteria | 2262 |
| 1653 | Ga0501227_060815 | 3300049665 | Bacteria | 968 |
| 1654 | Ga0501233_013732 | 3300049668 | Bacteria | 1647 |
| 1655 | Ga0501235_006749 | 3300049669 | Bacteria | 2499 |
| 1656 | Ga0501238_026390 | 3300049671 | Bacteria | 833 |
| 1657 | Ga0501257_089156 | 3300049686 | Bacteria | 801 |
| 1658 | Ga0501258_003044 | 3300049687 | Bacteria | 1514 |
| 1659 | Ga0501221_019756 | 3300049704 | Bacteria | 1311 |
| 1660 | Ga0501229_002483 | 3300049706 | Bacteria | 2178 |
| 1661 | Ga0501079_0175184 | 3300049741 | Bacteria | 1673 |
| 1662 | Ga0501262_033377 | 3300049759 | Bacteria | 748 |
| 1663 | Ga0501264_014637 | 3300049761 | Bacteria | 786 |
| 1664 | Ga0501266_094602 | 3300049763 | Bacteria | 523 |
| 1665 | Ga0501269_001764 | 3300049766 | Bacteria | 2754 |
| 1666 | Ga0501272_010980 | 3300049769 | Bacteria | 1015 |
| 1667 | Ga0501283_028357 | 3300049779 | Bacteria | 929 |
| 1668 | Ga0501283_059939 | 3300049779 | Bacteria | 686 |
| 1669 | Ga0501035_0018470 | 3300049822 | Bacteria | 6424 |
| 1670 | Ga0501044_0164982 | 3300049823 | Bacteria | 2190 |
| 1671 | nmdc:mga03683_106114_c1 | 3300050489 | Bacteria | 1238 |
| 1672 | nmdc:mga03683_218867_c1 | 3300050489 | Bacteria | 878 |
| 1673 | nmdc:mga03n38_95341_c1 | 3300050490 | Bacteria | 1425 |
| 1674 | nmdc:mga00v17_823376_c1 | 3300050491 | Bacteria | 591 |
| 1675 | nmdc:mga0k408_140886_c1 | 3300050493 | Bacteria | 1435 |
| 1676 | nmdc:mga0k408_167711_c1 | 3300050493 | Bacteria | 1309 |
| 1677 | nmdc:mga0k408_17968_c1 | 3300050493 | Bacteria | 3942 |
| 1678 | nmdc:mga0k408_215628_c1 | 3300050493 | Bacteria | 1146 |
| 1679 | nmdc:mga0k408_303971_c1 | 3300050493 | Bacteria | 952 |
| 1680 | nmdc:mga0k408_432820_c1 | 3300050493 | Bacteria | 782 |
| 1681 | nmdc:mga0k408_471718_c1 | 3300050493 | Bacteria | 745 |
| 1682 | nmdc:mga0k408_48281_c1 | 3300050493 | Bacteria | 2462 |
| 1683 | nmdc:mga06z11_388436_c1 | 3300050494 | Bacteria | 839 |
| 1684 | nmdc:mga07m45_216290_c1 | 3300050496 | Bacteria | 1115 |
| 1685 | nmdc:mga07m45_418293_c1 | 3300050496 | Bacteria | 778 |
| 1686 | nmdc:mga07m45_602165_c1 | 3300050496 | Bacteria | 635 |
| 1687 | nmdc:mga07m45_70331_c1 | 3300050496 | Bacteria | 1991 |
| 1688 | nmdc:mga07m45_89189_c1 | 3300050496 | Bacteria | 1766 |
| 1689 | nmdc:mga07m45_9660_c1 | 3300050496 | Bacteria | 5013 |
| 1690 | nmdc:mga07m45_9841_c1 | 3300050496 | Bacteria | 4973 |
| 1691 | nmdc:mga09592_1296_c1 | 3300050508 | Bacteria | 20095 |
| 1692 | nmdc:mga0qj67_11367_c1 | 3300050509 | Bacteria | 6669 |
| 1693 | nmdc:mga0qj67_142534_c1 | 3300050509 | Bacteria | 1943 |
| 1694 | nmdc:mga0rr50_1435808_c1 | 3300050513 | Bacteria | 584 |
| 1695 | Ga0500635_0000077 | 3300053080 | Bacteria | 63561 |
| 1696 | Ga0500635_0191967 | 3300053080 | Bacteria | 792 |
| 1697 | Ga0500578_0000013 | 3300053086 | Bacteria | 185921 |
| 1698 | Ga0500644_0299089 | 3300053088 | Bacteria | 688 |
| 1699 | Ga0500646_0058230 | 3300053090 | Bacteria | 1130 |
| 1700 | Ga0500583_0302745 | 3300053092 | Bacteria | 782 |
| 1701 | Ga0500651_0021759 | 3300053093 | Bacteria | 4001 |
| 1702 | Ga0500650_0276913 | 3300053098 | Bacteria | 747 |
| 1703 | Ga0500557_211979 | 3300053105 | Bacteria | 619 |
| 1704 | Ga0500562_031435 | 3300053108 | Bacteria | 1401 |
| 1705 | Ga0500569_016845 | 3300053109 | Bacteria | 1858 |
| 1706 | Ga0500594_0001239 | 3300053118 | Bacteria | 5521 |
| 1707 | Ga0500594_0003144 | 3300053118 | Bacteria | 3610 |
| 1708 | Ga0500607_109745 | 3300053121 | Bacteria | 1355 |
| 1709 | Ga0500618_004758 | 3300053125 | Bacteria | 4249 |
| 1710 | Ga0500618_006553 | 3300053125 | Bacteria | 3405 |
| 1711 | Ga0500621_258815 | 3300053126 | Bacteria | 580 |
| 1712 | Ga0500642_0022296 | 3300053130 | Bacteria | 2524 |
| 1713 | Ga0500642_0070947 | 3300053130 | Bacteria | 1585 |
| 1714 | Ga0500652_001857 | 3300053131 | Bacteria | 6377 |
| 1715 | Ga0500652_193579 | 3300053131 | Bacteria | 828 |
| 1716 | Ga0500658_0025758 | 3300053134 | Bacteria | 2262 |
| 1717 | Ga0500559_0003197 | 3300053136 | Bacteria | 8144 |
| 1718 | Ga0500559_0043745 | 3300053136 | Bacteria | 1957 |
| 1719 | Ga0500559_0490266 | 3300053136 | Bacteria | 565 |
| 1720 | Ga0500564_124046 | 3300053138 | Bacteria | 1123 |
| 1721 | Ga0500568_0001164 | 3300053139 | Bacteria | 17590 |
| 1722 | Ga0500568_0013489 | 3300053139 | Bacteria | 3723 |
| 1723 | Ga0500577_0003430 | 3300053142 | Bacteria | 4117 |
| 1724 | Ga0500586_007537 | 3300053145 | Bacteria | 2909 |
| 1725 | Ga0500589_202111 | 3300053147 | Bacteria | 762 |
| 1726 | Ga0500604_0070068 | 3300053151 | Bacteria | 1116 |
| 1727 | Ga0500604_0318967 | 3300053151 | Bacteria | 539 |
| 1728 | Ga0500619_000008 | 3300053154 | Bacteria | 70273 |
| 1729 | Ga0500619_054905 | 3300053154 | Bacteria | 1298 |
| 1730 | Ga0500622_0007164 | 3300053156 | Bacteria | 6360 |
| 1731 | Ga0500622_0073705 | 3300053156 | Bacteria | 1721 |
| 1732 | Ga0500636_0088358 | 3300053177 | Bacteria | 1777 |
| 1733 | Ga0500636_0133130 | 3300053177 | Bacteria | 1383 |
| 1734 | Ga0500584_055439 | 3300053726 | Bacteria | 1779 |
| 1735 | Ga0500645_008014 | 3300053730 | Bacteria | 3639 |
| 1736 | Ga0500587_000059 | 3300053739 | Bacteria | 8925 |
| 1737 | Ga0500587_003765 | 3300053739 | Bacteria | 2107 |
| 1738 | Ga0500587_073475 | 3300053739 | Bacteria | 541 |
| 1739 | Ga0500661_003928 | 3300055283 | Bacteria | 2783 |
| 1740 | Ga0587083_0075842 | 3300059505 | Bacteria | 791 |
| 1741 | Ga0587098_022566 | 3300059604 | Bacteria | 811 |
| 1742 | Ga0587068_010424 | 3300059641 | Bacteria | 1386 |
| 1743 | Ga0466962_0002387 | 3300061719 | Bacteria | 8901 |
| 1744 | Ga0466962_0033691 | 3300061719 | Bacteria | 2451 |
| 1745 | Ga0466962_0046950 | 3300061719 | Bacteria | 2063 |
| 1746 | Ga0466962_0664925 | 3300061719 | Bacteria | 533 |
| 1747 | 2587730469 | 2585428057 | Bacteria | 6737412 |
| 1748 | 2587736072 | 2585428058 | Bacteria | 6853932 |
| 1749 | 2588293334 | 2588253510 | Bacteria | 6901809 |
| 1750 | 2601669595 | 2600255292 | Bacteria | 6300551 |
| 1751 | 2643742287 | 2643221544 | Bacteria | 5886209 |
| 1752 | 2643800340 | 2643221556 | Bacteria | 7251154 |
| 1753 | 2643937108 | 2643221585 | Bacteria | 5812563 |
| 1754 | 2643969066 | 2643221592 | Bacteria | 6608788 |
| 1755 | 2644030419 | 2643221603 | Bacteria | 6147767 |
| 1756 | 2644139666 | 2643221625 | Bacteria | 6512927 |
| 1757 | 2644217914 | 2643221639 | Bacteria | 6649903 |
| 1758 | 2644247931 | 2643221644 | Bacteria | 6865017 |
| 1759 | 2644255300 | 2643221645 | Bacteria | 7207331 |
| 1760 | 2644258344 | 2643221646 | Bacteria | 6433402 |
| 1761 | 2644275402 | 2643221648 | Bacteria | 6521465 |
| 1762 | 2644304505 | 2643221654 | Bacteria | 5273570 |
| 1763 | 2644318273 | 2643221656 | Bacteria | 5809961 |
| 1764 | 2644341358 | 2643221660 | Bacteria | 4208257 |
| 1765 | 2644471880 | 2643221684 | Bacteria | 7145183 |
| 1766 | 2738827181 | 2738541297 | Bacteria | 6549566 |
| 1767 | 2739057000 | 2738541337 | Bacteria | 6183410 |
| 1768 | 2739150978 | 2738541357 | Bacteria | 6549408 |
| 1769 | 2739192897 | 2738543003 | Bacteria | 6549560 |
| 1770 | 2739319374 | 2738543026 | Bacteria | 6549408 |
| 1771 | 2739337615 | 2738543029 | Bacteria | 6549249 |
| 1772 | 2809142318 | 2808606418 | Bacteria | 6724496 |
| 1773 | 2821134538 | 2821131069 | Bacteria | 6108407 |
| 1774 | 2842715045 | 2842711865 | Bacteria | 7155354 |
| 1775 | 2857549717 | 2857547612 | Bacteria | 6179999 |
| 1776 | 2857557133 | 2857553236 | Bacteria | 6166726 |
| 1777 | 2857560562 | 2857558681 | Bacteria | 6617694 |
| 1778 | 2857570061 | 2857564685 | Bacteria | 6290584 |
| 1779 | 2885082327 | 2885080285 | Bacteria | 6355622 |
| 1780 | 2904430318 | 2904424332 | Bacteria | 7633521 |
| 1781 | 2919480887 | 2919476304 | Bacteria | 5888696 |
| 1782 | 2919704584 | 2919704043 | Bacteria | 5560311 |
| 1783 | 2932415799 | 2932410948 | Bacteria | 6312192 |
| 1784 | 2932421789 | 2932416698 | Bacteria | 6315112 |
| 1785 | 8047675198 | 8047673197 | Bacteria | 7395230 |
| 1786 | Ga0395900_0000133 | |||
| 1787 | JGI24740J21852_10016707 | |||
| 1788 | JGI25156J39149_1000114 | |||
| 1789 | JGI25154J39366_1002215 | |||
| 1790 | JGI25154J39366_1003246 | |||
| 1791 | JGI25157J39369_1000015 | |||
| 1792 | JGI25150J39212_1014060 | |||
| 1793 | JGI25159J45721_1006583 | |||
| 1794 | JGI25153J46596_10017655 | |||
| 1795 | rootH2_10058683 | |||
| 1796 | rootL2_10031669 | |||
| 1797 | rootH1_10010269 | |||
| 1798 | JGI26128J50194_1000617 | |||
| 1799 | Ga0055539_1000967 | |||
| 1800 | Ga0055533_1000010 | |||
| 1801 | Ga0055525_1000013 | |||
| 1802 | Ga0055525_1000074 | |||
| 1803 | Ga0055525_1001452 | |||
| 1804 | Ga0055535_1006711 | |||
| 1805 | Ga0055542_1019745 | |||
| 1806 | Ga0055529_1000100 | |||
| 1807 | Ga0055529_1000303 | |||
| 1808 | Ga0055526_1000010 | |||
| 1809 | Ga0055526_1000104 | |||
| 1810 | Ga0055526_1000410 | |||
| 1811 | Ga0055537_1000200 | |||
| 1812 | Ga0055524_1000025 | |||
| 1813 | Ga0055524_1005355 | |||
| 1814 | Ga0055524_1008185 | |||
| 1815 | Ga0055534_1000083 | |||
| 1816 | Ga0055528_1000372 | |||
| 1817 | Ga0055540_1103473 | |||
| 1818 | Ga0055531_10000064 | |||
| 1819 | Ga0055543_1004761 | |||
| 1820 | Ga0055543_1049002 | |||
| 1821 | Ga0065165_1000074 | |||
| 1822 | Ga0065165_1000120 | |||
| 1823 | Ga0065165_1000889 | |||
| 1824 | Ga0065165_1005640 | |||
| 1825 | Ga0065165_1028015 | |||
| 1826 | Ga0065165_1032237 | |||
| 1827 | Ga0065707_10107803 | |||
| 1828 | Ga0070658_10026499 | |||
| 1829 | Ga0070658_10037732 | |||
| 1830 | Ga0070658_10141993 | |||
| 1831 | Ga0070658_10170300 | |||
| 1832 | Ga0070658_11384646 | |||
| 1833 | Ga0070676_10095269 | |||
| 1834 | Ga0070676_10155113 | |||
| 1835 | Ga0070676_10222677 | |||
| 1836 | Ga0070676_10366082 | |||
| 1837 | Ga0070676_10726973 | |||
| 1838 | Ga0070683_100005699 | |||
| 1839 | Ga0070683_100109501 | |||
| 1840 | Ga0070690_100001536 | |||
| 1841 | Ga0070670_100044272 | |||
| 1842 | Ga0070670_100045928 | |||
| 1843 | Ga0070670_100050278 | |||
| 1844 | Ga0070670_100156245 | |||
| 1845 | Ga0070670_100393495 | |||
| 1846 | Ga0070670_100811054 | |||
| 1847 | Ga0070670_101519250 | |||
| 1848 | Ga0070677_10007539 | |||
| 1849 | Ga0070677_10017613 | |||
| 1850 | Ga0070677_10226157 | |||
| 1851 | Ga0070677_10269223 | |||
| 1852 | Ga0068869_100036690 | |||
| 1853 | Ga0068869_100772992 | |||
| 1854 | Ga0068869_101050214 | |||
| 1855 | Ga0070666_10680537 | |||
| 1856 | Ga0070680_100016692 | |||
| 1857 | Ga0070680_100593369 | |||
| 1858 | Ga0070680_100815715 | |||
| 1859 | Ga0070680_100835370 | |||
| 1860 | Ga0070682_100050509 | |||
| 1861 | Ga0070682_100303495 | |||
| 1862 | Ga0068868_100078234 | |||
| 1863 | Ga0070660_100025792 | |||
| 1864 | Ga0070660_100061600 | |||
| 1865 | Ga0070660_100478924 | |||
| 1866 | Ga0070660_100806976 | |||
| 1867 | Ga0070660_101071812 | |||
| 1868 | Ga0070689_100674438 | |||
| 1869 | Ga0070661_100004078 | |||
| 1870 | Ga0070661_100038941 | |||
| 1871 | Ga0070661_100211037 | |||
| 1872 | Ga0070661_100542839 | |||
| 1873 | Ga0070668_100634446 | |||
| 1874 | Ga0070669_100014248 | |||
| 1875 | Ga0070669_100037978 | |||
| 1876 | Ga0070669_100106693 | |||
| 1877 | Ga0070669_100188610 | |||
| 1878 | Ga0070669_100264513 | |||
| 1879 | Ga0070669_100281790 | |||
| 1880 | Ga0070675_100002690 | |||
| 1881 | Ga0070675_100011188 | |||
| 1882 | Ga0070675_100048103 | |||
| 1883 | Ga0070675_100053943 | |||
| 1884 | Ga0070675_100104159 | |||
| 1885 | Ga0070675_100232111 | |||
| 1886 | Ga0070675_100256119 | |||
| 1887 | Ga0070675_100301189 | |||
| 1888 | Ga0070675_100617491 | |||
| 1889 | Ga0070671_100036807 | |||
| 1890 | Ga0070671_100038300 | |||
| 1891 | Ga0070671_100219491 | |||
| 1892 | Ga0070671_100358210 | |||
| 1893 | Ga0070671_100529714 | |||
| 1894 | Ga0070671_100634338 | |||
| 1895 | Ga0070674_100005898 | |||
| 1896 | Ga0070674_100186772 | |||
| 1897 | Ga0070674_100299279 | |||
| 1898 | Ga0070674_100999724 | |||
| 1899 | Ga0070674_101106421 | |||
| 1900 | Ga0070673_100030293 | |||
| 1901 | Ga0070673_100048345 | |||
| 1902 | Ga0070673_100171447 | |||
| 1903 | Ga0070673_100612918 | |||
| 1904 | Ga0070673_100753633 | |||
| 1905 | Ga0070673_101552796 | |||
| 1906 | Ga0070688_100387313 | |||
| 1907 | Ga0070688_100723293 | |||
| 1908 | Ga0070659_100000666 | |||
| 1909 | Ga0070659_100038040 | |||
| 1910 | Ga0070659_100084714 | |||
| 1911 | Ga0070659_100203977 | |||
| 1912 | Ga0070667_100000677 | |||
| 1913 | Ga0070667_100041820 | |||
| 1914 | Ga0070667_100208611 | |||
| 1915 | Ga0070667_100591749 | |||
| 1916 | Ga0070667_101309330 | |||
| 1917 | Ga0070714_100406359 | |||
| 1918 | Ga0070708_100199245 | |||
| 1919 | Ga0070663_100006532 | |||
| 1920 | Ga0070663_100280802 | |||
| 1921 | Ga0070663_100292332 | |||
| 1922 | Ga0070663_100351977 | |||
| 1923 | Ga0070663_100524025 | |||
| 1924 | Ga0070663_101026899 | |||
| 1925 | Ga0070678_100009538 | |||
| 1926 | Ga0070678_100009859 | |||
| 1927 | Ga0070678_100017043 | |||
| 1928 | Ga0070678_100557878 | |||
| 1929 | Ga0070678_101128244 | |||
| 1930 | Ga0070678_101445105 | |||
| 1931 | Ga0070662_100116572 | |||
| 1932 | Ga0070662_100181759 | |||
| 1933 | Ga0070662_100840551 | |||
| 1934 | Ga0070662_101258287 | |||
| 1935 | Ga0070681_10026267 | |||
| 1936 | Ga0070681_10358612 | |||
| 1937 | Ga0068867_100003972 | |||
| 1938 | Ga0068867_100004620 | |||
| 1939 | Ga0068867_100006451 | |||
| 1940 | Ga0068867_100012180 | |||
| 1941 | Ga0068867_100148304 | |||
| 1942 | Ga0068867_100221025 | |||
| 1943 | Ga0068867_100284181 | |||
| 1944 | Ga0068867_100847655 | |||
| 1945 | Ga0070685_10991557 | |||
| 1946 | Ga0070706_100013624 | |||
| 1947 | Ga0070706_100061300 | |||
| 1948 | Ga0070679_100028221 | |||
| 1949 | Ga0070684_100032261 | |||
| 1950 | Ga0070684_100110528 | |||
| 1951 | Ga0068853_100066374 | |||
| 1952 | Ga0068853_100137713 | |||
| 1953 | Ga0068853_100525537 | |||
| 1954 | Ga0068853_100542851 | |||
| 1955 | Ga0070672_100014390 | |||
| 1956 | Ga0070672_100014964 | |||
| 1957 | Ga0070672_100128138 | |||
| 1958 | Ga0070672_100219223 | |||
| 1959 | Ga0070686_100289447 | |||
| 1960 | Ga0070686_100630358 | |||
| 1961 | Ga0070693_100064607 | |||
| 1962 | Ga0070693_100155581 | |||
| 1963 | Ga0070693_100418017 | |||
| 1964 | Ga0070665_100056462 | |||
| 1965 | Ga0070665_100195862 | |||
| 1966 | Ga0070665_100257967 | |||
| 1967 | Ga0070665_100348547 | |||
| 1968 | Ga0070665_102019592 | |||
| 1969 | Ga0068855_100019587 | |||
| 1970 | Ga0068855_100064421 | |||
| 1971 | Ga0068855_100139662 | |||
| 1972 | Ga0068855_100194335 | |||
| 1973 | Ga0068855_100621090 | |||
| 1974 | Ga0068855_100714985 | |||
| 1975 | Ga0070664_100027119 | |||
| 1976 | Ga0070664_100037626 | |||
| 1977 | Ga0070664_100043037 | |||
| 1978 | Ga0070664_100360173 | |||
| 1979 | Ga0070664_100403408 | |||
| 1980 | Ga0070664_100551765 | |||
| 1981 | Ga0070664_100618262 | |||
| 1982 | Ga0070664_100796299 | |||
| 1983 | Ga0068857_100729936 | |||
| 1984 | Ga0068857_101028775 | |||
| 1985 | Ga0068854_100000903 | |||
| 1986 | Ga0068854_100040558 | |||
| 1987 | Ga0068854_100334516 | |||
| 1988 | Ga0068856_100016907 | |||
| 1989 | Ga0068856_100063174 | |||
| 1990 | Ga0068856_100945156 | |||
| 1991 | Ga0068856_101153496 | |||
| 1992 | Ga0068852_100024399 | |||
| 1993 | Ga0068852_100033409 | |||
| 1994 | Ga0068852_100063334 | |||
| 1995 | Ga0068852_100275484 | |||
| 1996 | Ga0068852_100294866 | |||
| 1997 | Ga0068852_100349956 | |||
| 1998 | Ga0068852_100455717 | |||
| 1999 | Ga0068852_100976152 | |||
| 2000 | Ga0068852_101430659 | |||
| 2001 | Ga0068859_100027031 | |||
| 2002 | Ga0068859_100035700 | |||
| 2003 | Ga0068859_100083488 | |||
| 2004 | Ga0068859_100272232 | |||
| 2005 | Ga0068859_101077292 | |||
| 2006 | Ga0068864_100009238 | |||
| 2007 | Ga0068864_100069099 | |||
| 2008 | Ga0068866_10010005 | |||
| 2009 | Ga0068866_10033904 | |||
| 2010 | Ga0068866_10291282 | |||
| 2011 | Ga0068861_100001416 | |||
| 2012 | Ga0068861_100005119 | |||
| 2013 | Ga0068861_100013239 | |||
| 2014 | Ga0068851_10021738 | |||
| 2015 | Ga0068851_10036008 | |||
| 2016 | Ga0068851_10065777 | |||
| 2017 | Ga0068851_10594962 | |||
| 2018 | Ga0068863_100087934 | |||
| 2019 | Ga0068863_100970866 | |||
| 2020 | Ga0068863_102153713 | |||
| 2021 | Ga0068858_100006788 | |||
| 2022 | Ga0068858_100073500 | |||
| 2023 | Ga0068858_101523109 | |||
| 2024 | Ga0068860_100000903 | |||
| 2025 | Ga0068860_100008648 | |||
| 2026 | Ga0068860_100372371 | |||
| 2027 | Ga0068862_100007315 | |||
| 2028 | Ga0068862_100033939 | |||
| 2029 | Ga0068862_100100036 | |||
| 2030 | Ga0068862_100603560 | |||
| 2031 | Ga0068862_101903787 | |||
| 2032 | Ga0081455_10154969 | |||
| 2033 | Ga0075363_100191580 | |||
| 2034 | Ga0075364_10686904 | |||
| 2035 | Ga0075362_10105057 | |||
| 2036 | Ga0075362_10162763 | |||
| 2037 | Ga0075362_10169259 | |||
| 2038 | Ga0075362_10232140 | |||
| 2039 | Ga0075367_10087101 | |||
| 2040 | Ga0075367_10485311 | |||
| 2041 | Ga0075366_10023840 | |||
| 2042 | Ga0075366_10069763 | |||
| 2043 | Ga0075366_10161165 | |||
| 2044 | Ga0075366_10245148 | |||
| 2045 | Ga0075366_10506264 | |||
| 2046 | Ga0075366_10820974 | |||
| 2047 | Ga0075366_10975405 | |||
| 2048 | Ga0097621_100098460 | |||
| 2049 | Ga0097621_100293346 | |||
| 2050 | Ga0097621_100806884 | |||
| 2051 | Ga0097621_101655116 | |||
| 2052 | Ga0075370_10011463 | |||
| 2053 | Ga0075370_10020006 | |||
| 2054 | Ga0075370_10051619 | |||
| 2055 | Ga0075370_10181382 | |||
| 2056 | Ga0075370_10498900 | |||
| 2057 | Ga0075370_10647199 | |||
| 2058 | Ga0068871_100014710 | |||
| 2059 | Ga0068871_100014932 | |||
| 2060 | Ga0068871_100049440 | |||
| 2061 | Ga0068871_100051168 | |||
| 2062 | Ga0068871_100330659 | |||
| 2063 | Ga0075430_100082328 | |||
| 2064 | Ga0075429_100008833 | |||
| 2065 | Ga0068865_100003663 | |||
| 2066 | Ga0068865_100233935 | |||
| 2067 | Ga0068865_100289236 | |||
| 2068 | Ga0068865_100437424 | |||
| 2069 | Ga0068865_100707074 | |||
| 2070 | Ga0068865_100859153 | |||
| 2071 | Ga0097620_100027032 | |||
| 2072 | Ga0097620_100035700 | |||
| 2073 | Ga0097620_100083487 | |||
| 2074 | Ga0097620_100272234 | |||
| 2075 | Ga0097620_101077262 | |||
| 2076 | Ga0079104_1000273 | |||
| 2077 | Ga0079104_1003849 | |||
| 2078 | Ga0079104_1059468 | |||
| 2079 | Ga0099826_10000005 | |||
| 2080 | Ga0075435_101387957 | |||
| 2081 | Ga0105244_10002947 | |||
| 2082 | Ga0105244_10004312 | |||
| 2083 | Ga0105244_10162888 | |||
| 2084 | Ga0105244_10280324 | |||
| 2085 | Ga0111539_10941517 | |||
| 2086 | Ga0105245_10036044 | |||
| 2087 | Ga0105245_10222432 | |||
| 2088 | Ga0105245_11116907 | |||
| 2089 | Ga0114129_10137155 | |||
| 2090 | Ga0105243_10023700 | |||
| 2091 | Ga0105243_10063627 | |||
| 2092 | Ga0105243_10138979 | |||
| 2093 | Ga0105243_10435328 | |||
| 2094 | Ga0105243_10950944 | |||
| 2095 | Ga0105241_10023999 | |||
| 2096 | Ga0105241_10242877 | |||
| 2097 | Ga0105241_11022846 | |||
| 2098 | Ga0105242_10269981 | |||
| 2099 | Ga0105242_10365056 | |||
| 2100 | Ga0105242_11024226 | |||
| 2101 | Ga0105242_11774809 | |||
| 2102 | Ga0105248_10000595 | |||
| 2103 | Ga0105248_10027182 | |||
| 2104 | Ga0105248_10112431 | |||
| 2105 | Ga0105248_10204255 | |||
| 2106 | Ga0105248_10498071 | |||
| 2107 | Ga0105248_11331677 | |||
| 2108 | Ga0105237_10172915 | |||
| 2109 | Ga0105237_10212870 | |||
| 2110 | Ga0105237_10399046 | |||
| 2111 | Ga0105237_11143531 | |||
| 2112 | Ga0105238_10003253 | |||
| 2113 | Ga0105238_10052730 | |||
| 2114 | Ga0105238_10108100 | |||
| 2115 | Ga0105238_10275226 | |||
| 2116 | Ga0105249_10572519 | |||
| 2117 | Ga0105249_12040167 | |||
| 2118 | Ga0105239_10080637 | |||
| 2119 | Ga0105239_10785653 | |||
| 2120 | Ga0105246_10400389 | |||
| 2121 | Ga0157324_1035756 | |||
| 2122 | Ga0157326_1013205 | |||
| 2123 | Ga0157373_10017629 | |||
| 2124 | Ga0157373_10877224 | |||
| 2125 | Ga0157371_10171540 | |||
| 2126 | Ga0157371_10430578 | |||
| 2127 | Ga0157370_10561401 | |||
| 2128 | Ga0157369_10018014 | |||
| 2129 | Ga0157369_10049207 | |||
| 2130 | Ga0157369_11075203 | |||
| 2131 | Ga0157369_11119535 | |||
| 2132 | Ga0157369_11530978 | |||
| 2133 | Ga0157374_10075363 | |||
| 2134 | Ga0157374_10091458 | |||
| 2135 | Ga0157374_10136709 | |||
| 2136 | Ga0157374_10954611 | |||
| 2137 | Ga0157374_11124861 | |||
| 2138 | Ga0157374_12440091 | |||
| 2139 | Ga0157378_10345680 | |||
| 2140 | Ga0157378_10648722 | |||
| 2141 | Ga0157378_11279228 | |||
| 2142 | Ga0157378_11435357 | |||
| 2143 | Ga0163162_10040290 | |||
| 2144 | Ga0163162_10154852 | |||
| 2145 | Ga0163162_11211092 | |||
| 2146 | Ga0163162_11716639 | |||
| 2147 | Ga0157372_10042427 | |||
| 2148 | Ga0157372_10334629 | |||
| 2149 | Ga0157372_10601169 | |||
| 2150 | Ga0157372_10986112 | |||
| 2151 | Ga0157372_11281337 | |||
| 2152 | Ga0157372_12697135 | |||
| 2153 | Ga0157375_10045304 | |||
| 2154 | Ga0157375_10065030 | |||
| 2155 | Ga0157375_10112570 | |||
| 2156 | Ga0157375_10616094 | |||
| 2157 | Ga0163163_10190597 | |||
| 2158 | Ga0163163_11056694 | |||
| 2159 | Ga0163163_11516962 | |||
| 2160 | Ga0157380_10007364 | |||
| 2161 | Ga0157380_10013785 | |||
| 2162 | Ga0157380_10038853 | |||
| 2163 | Ga0157380_10256033 | |||
| 2164 | Ga0157380_10833381 | |||
| 2165 | Ga0182008_10001405 | |||
| 2166 | Ga0182008_10388828 | |||
| 2167 | Ga0157377_10000294 | |||
| 2168 | Ga0157377_10586265 | |||
| 2169 | Ga0157379_10023168 | |||
| 2170 | Ga0157379_10025892 | |||
| 2171 | Ga0157379_10089602 | |||
| 2172 | Ga0157379_10107716 | |||
| 2173 | Ga0157376_10004653 | |||
| 2174 | Ga0157376_10079761 | |||
| 2175 | Ga0157376_10115009 | |||
| 2176 | Ga0157376_10202284 | |||
| 2177 | Ga0157376_10305066 | |||
| 2178 | Ga0157376_10663038 | |||
| 2179 | Ga0157376_12097438 | |||
| 2180 | Ga0182006_1000004 | |||
| 2181 | Ga0182006_1000176 | |||
| 2182 | Ga0182007_10000017 | |||
| 2183 | Ga0182007_10127552 | |||
| 2184 | Ga0182007_10189429 | |||
| 2185 | Ga0182005_1000005 | |||
| 2186 | Ga0182005_1000030 | |||
| 2187 | Ga0182005_1099447 | |||
| 2188 | Ga0163161_10020753 | |||
| 2189 | Ga0163161_10021914 | |||
| 2190 | Ga0163161_10048829 | |||
| 2191 | Ga0163161_10104696 | |||
| 2192 | Ga0163161_10180987 | |||
| 2193 | Ga0163161_10232114 | |||
| 2194 | Ga0163161_10694080 | |||
| 2195 | Ga0163161_10722683 | |||
| 2196 | Ga0163161_10889649 | |||
| 2197 | Ga0213872_10000035 | |||
| 2198 | Ga0213872_10000127 | |||
| 2199 | Ga0213872_10000139 | |||
| 2200 | Ga0213872_10000160 | |||
| 2201 | Ga0213872_10000683 | |||
| 2202 | Ga0213872_10018814 | |||
| 2203 | Ga0213872_10028189 | |||
| 2204 | Ga0213872_10158072 | |||
| 2205 | Ga0209674_100003 | |||
| 2206 | Ga0209672_113998 | |||
| 2207 | Ga0209563_100003 | |||
| 2208 | Ga0209563_100010 | |||
| 2209 | Ga0209563_100025 | |||
| 2210 | Ga0207427_104232 | |||
| 2211 | Ga0209258_100163 | |||
| 2212 | Ga0209258_100627 | |||
| 2213 | Ga0207425_1000376 | |||
| 2214 | Ga0209646_1000036 | |||
| 2215 | Ga0209646_1000138 | |||
| 2216 | Ga0209026_1000021 | |||
| 2217 | Ga0209677_100093 | |||
| 2218 | Ga0209677_100817 | |||
| 2219 | Ga0209677_102569 | |||
| 2220 | Ga0209677_102895 | |||
| 2221 | Ga0209148_1000203 | |||
| 2222 | Ga0209759_1000025 | |||
| 2223 | Ga0209759_1001158 | |||
| 2224 | Ga0209759_1013130 | |||
| 2225 | Ga0209565_1000068 | |||
| 2226 | Ga0209565_1011943 | |||
| 2227 | Ga0209455_1000047 | |||
| 2228 | Ga0209455_1000059 | |||
| 2229 | Ga0209673_1000119 | |||
| 2230 | Ga0209673_1006475 | |||
| 2231 | Ga0209130_1000057 | |||
| 2232 | Ga0209675_1000068 | |||
| 2233 | Ga0209675_1012938 | |||
| 2234 | Ga0209025_1004584 | |||
| 2235 | Ga0209564_1000060 | |||
| 2236 | Ga0209564_1000141 | |||
| 2237 | Ga0209564_1000149 | |||
| 2238 | Ga0209758_1000941 | |||
| 2239 | Ga0209256_1000024 | |||
| 2240 | Ga0209256_1000040 | |||
| 2241 | Ga0209256_1000173 | |||
| 2242 | Ga0209051_1003858 | |||
| 2243 | Ga0209051_1004022 | |||
| 2244 | Ga0209051_1011624 | |||
| 2245 | Ga0209257_1000032 | |||
| 2246 | Ga0207656_10083296 | |||
| 2247 | Ga0207655_1022557 | |||
| 2248 | Ga0207655_1024930 | |||
| 2249 | Ga0207682_10001255 | |||
| 2250 | Ga0207682_10114555 | |||
| 2251 | Ga0207682_10229071 | |||
| 2252 | Ga0207682_10297195 | |||
| 2253 | Ga0207642_10025093 | |||
| 2254 | Ga0207642_10075539 | |||
| 2255 | Ga0207710_10372598 | |||
| 2256 | Ga0207688_10005290 | |||
| 2257 | Ga0207645_10031533 | |||
| 2258 | Ga0207645_10128376 | |||
| 2259 | Ga0207645_10219054 | |||
| 2260 | Ga0207645_10293283 | |||
| 2261 | Ga0207705_10011989 | |||
| 2262 | Ga0207705_11042357 | |||
| 2263 | Ga0207654_10021482 | |||
| 2264 | Ga0207707_10108844 | |||
| 2265 | Ga0207695_10080700 | |||
| 2266 | Ga0207695_10084675 | |||
| 2267 | Ga0207671_10164373 | |||
| 2268 | Ga0207660_10004601 | |||
| 2269 | Ga0207660_10590952 | |||
| 2270 | Ga0207657_10020777 | |||
| 2271 | Ga0207657_10084454 | |||
| 2272 | Ga0207657_10457320 | |||
| 2273 | Ga0207657_10982071 | |||
| 2274 | Ga0207649_10010449 | |||
| 2275 | Ga0207649_10028943 | |||
| 2276 | Ga0207649_10154052 | |||
| 2277 | Ga0207649_10737776 | |||
| 2278 | Ga0207652_10080840 | |||
| 2279 | Ga0207652_10452857 | |||
| 2280 | Ga0207681_10032182 | |||
| 2281 | Ga0207681_10037994 | |||
| 2282 | Ga0207681_10043789 | |||
| 2283 | Ga0207681_10061997 | |||
| 2284 | Ga0207681_10499004 | |||
| 2285 | Ga0207681_10868202 | |||
| 2286 | Ga0207650_10010814 | |||
| 2287 | Ga0207650_10019962 | |||
| 2288 | Ga0207659_10030843 | |||
| 2289 | Ga0207659_10211488 | |||
| 2290 | Ga0207659_10217458 | |||
| 2291 | Ga0207659_10302321 | |||
| 2292 | Ga0207659_10659996 | |||
| 2293 | Ga0207687_10008809 | |||
| 2294 | Ga0207687_10406772 | |||
| 2295 | Ga0207687_10430098 | |||
| 2296 | Ga0207687_11132129 | |||
| 2297 | Ga0207644_10033398 | |||
| 2298 | Ga0207644_10053041 | |||
| 2299 | Ga0207644_10062491 | |||
| 2300 | Ga0207644_10196003 | |||
| 2301 | Ga0207690_10004038 | |||
| 2302 | Ga0207690_10170685 | |||
| 2303 | Ga0207690_10268912 | |||
| 2304 | Ga0207706_10004089 | |||
| 2305 | Ga0207706_10058771 | |||
| 2306 | Ga0207706_10284462 | |||
| 2307 | Ga0207706_10438292 | |||
| 2308 | Ga0207706_10440688 | |||
| 2309 | Ga0207686_10032006 | |||
| 2310 | Ga0207686_10063522 | |||
| 2311 | Ga0207709_10025634 | |||
| 2312 | Ga0207709_10041325 | |||
| 2313 | Ga0207709_10064766 | |||
| 2314 | Ga0207709_11175023 | |||
| 2315 | Ga0207670_10737083 | |||
| 2316 | Ga0207669_10112485 | |||
| 2317 | Ga0207669_10611394 | |||
| 2318 | Ga0207669_11947629 | |||
| 2319 | Ga0207704_10005537 | |||
| 2320 | Ga0207704_10083314 | |||
| 2321 | Ga0207704_10517258 | |||
| 2322 | Ga0207691_10011878 | |||
| 2323 | Ga0207691_10057109 | |||
| 2324 | Ga0207691_10272294 | |||
| 2325 | Ga0207691_10315262 | |||
| 2326 | Ga0207711_10001919 | |||
| 2327 | Ga0207711_10006066 | |||
| 2328 | Ga0207711_10749057 | |||
| 2329 | Ga0207711_11612572 | |||
| 2330 | Ga0207689_10008328 | |||
| 2331 | Ga0207689_10442637 | |||
| 2332 | Ga0207661_10840130 | |||
| 2333 | Ga0207679_10016886 | |||
| 2334 | Ga0207679_10024101 | |||
| 2335 | Ga0207679_10060411 | |||
| 2336 | Ga0207679_10162791 | |||
| 2337 | Ga0207679_10376143 | |||
| 2338 | Ga0207679_10593518 | |||
| 2339 | Ga0207667_10078788 | |||
| 2340 | Ga0207667_10115407 | |||
| 2341 | Ga0207667_10874050 | |||
| 2342 | Ga0207667_11091962 | |||
| 2343 | Ga0207651_10013982 | |||
| 2344 | Ga0207651_10134791 | |||
| 2345 | Ga0207651_10172606 | |||
| 2346 | Ga0207651_10198999 | |||
| 2347 | Ga0207651_10217888 | |||
| 2348 | Ga0207651_12023631 | |||
| 2349 | Ga0207712_10219856 | |||
| 2350 | Ga0207668_10275466 | |||
| 2351 | Ga0207640_10216373 | |||
| 2352 | Ga0207658_10002360 | |||
| 2353 | Ga0207658_10515090 | |||
| 2354 | Ga0207658_10747993 | |||
| 2355 | Ga0207658_10962500 | |||
| 2356 | Ga0207658_11037347 | |||
| 2357 | Ga0207677_10004412 | |||
| 2358 | Ga0207677_10211222 | |||
| 2359 | Ga0207677_10892895 | |||
| 2360 | Ga0207677_11054321 | |||
| 2361 | Ga0207677_11257016 | |||
| 2362 | Ga0207703_10053412 | |||
| 2363 | Ga0207703_10141302 | |||
| 2364 | Ga0207703_10476025 | |||
| 2365 | Ga0207703_10565636 | |||
| 2366 | Ga0207639_10085207 | |||
| 2367 | Ga0207639_10744272 | |||
| 2368 | Ga0207678_10003169 | |||
| 2369 | Ga0207678_10027797 | |||
| 2370 | Ga0207678_10082037 | |||
| 2371 | Ga0207678_10109071 | |||
| 2372 | Ga0207678_10174309 | |||
| 2373 | Ga0207678_10259657 | |||
| 2374 | Ga0207678_10407539 | |||
| 2375 | Ga0207702_10000227 | |||
| 2376 | Ga0207702_10250517 | |||
| 2377 | Ga0207702_10758403 | |||
| 2378 | Ga0207702_11178159 | |||
| 2379 | Ga0207702_11365627 | |||
| 2380 | Ga0207641_10100139 | |||
| 2381 | Ga0207641_10119259 | |||
| 2382 | Ga0207641_10789438 | |||
| 2383 | Ga0207648_10004504 | |||
| 2384 | Ga0207648_10010128 | |||
| 2385 | Ga0207648_10024243 | |||
| 2386 | Ga0207648_10074300 | |||
| 2387 | Ga0207648_10117298 | |||
| 2388 | Ga0207648_10363776 | |||
| 2389 | Ga0207676_10009240 | |||
| 2390 | Ga0207676_10080135 | |||
| 2391 | Ga0207674_10091585 | |||
| 2392 | Ga0207675_100001125 | |||
| 2393 | Ga0207675_100005766 | |||
| 2394 | Ga0207675_100105822 | |||
| 2395 | Ga0207675_100408557 | |||
| 2396 | Ga0207683_10007938 | |||
| 2397 | Ga0207683_10012078 | |||
| 2398 | Ga0207683_10215090 | |||
| 2399 | Ga0207683_10295538 | |||
| 2400 | Ga0207683_11291420 | |||
| 2401 | Ga0207698_10042094 | |||
| 2402 | Ga0209281_1000416 | |||
| 2403 | Ga0209281_1050051 | |||
| 2404 | Ga0209967_1001211 | |||
| 2405 | Ga0210000_1002227 | |||
| 2406 | Ga0209995_1014917 | |||
| 2407 | Ga0209968_1002465 | |||
| 2408 | Ga0209999_1023219 | |||
| 2409 | Ga0209970_1000174 | |||
| 2410 | Ga0209983_1032993 | |||
| 2411 | Ga0209282_1000003 | |||
| 2412 | Ga0209588_1051553 | |||
| 2413 | Ga0209966_1000303 | |||
| 2414 | Ga0268266_10297392 | |||
| 2415 | Ga0268266_10740279 | |||
| 2416 | Ga0268265_10175003 | |||
| 2417 | Ga0268265_10180418 | |||
| 2418 | Ga0268265_10207139 | |||
| 2419 | Ga0268265_10558854 | |||
| 2420 | Ga0268265_11675532 | |||
| 2421 | Ga0268264_10008380 | |||
| 2422 | Ga0268264_10521151 | |||
| 2423 | Ga0265336_10000051 | |||
| 2424 | Ga0307517_10000052 | |||
| 2425 | Ga0307517_10147490 | |||
| 2426 | Ga0307517_10396630 | |||
| 2427 | Ga0307515_10000416 | |||
| 2428 | Ga0307515_10000645 | |||
| 2429 | Ga0307515_10001163 | |||
| 2430 | Ga0307515_10004048 | |||
| 2431 | Ga0307515_10004318 | |||
| 2432 | Ga0307515_10014143 | |||
| 2433 | Ga0307515_10026385 | |||
| 2434 | Ga0307515_10047081 | |||
| 2435 | Ga0307515_10102840 | |||
| 2436 | Ga0307515_10181532 | |||
| 2437 | Ga0307515_10335364 | |||
| 2438 | Ga0307515_10361979 | |||
| 2439 | Ga0265324_10000292 | |||
| 2440 | Ga0265324_10043351 | |||
| 2441 | Ga0307512_10072314 | |||
| 2442 | Ga0307512_10104738 | |||
| 2443 | Ga0316181_1032650 | |||
| 2444 | Ga0265328_10038853 | |||
| 2445 | Ga0265331_10002254 | |||
| 2446 | Ga0265327_10000309 | |||
| 2447 | Ga0265316_10000299 | |||
| 2448 | Ga0307513_10024348 | |||
| 2449 | Ga0307513_10127823 | |||
| 2450 | Ga0307513_10218597 | |||
| 2451 | Ga0307509_10012817 | |||
| 2452 | Ga0307509_10049892 | |||
| 2453 | Ga0307509_10108307 | |||
| 2454 | Ga0307509_10128511 | |||
| 2455 | Ga0307509_10131278 | |||
| 2456 | Ga0307509_10218808 | |||
| 2457 | Ga0307509_10351648 | |||
| 2458 | Ga0307408_100000010 | |||
| 2459 | Ga0307408_100002273 | |||
| 2460 | Ga0307408_100065404 | |||
| 2461 | Ga0307408_100272435 | |||
| 2462 | Ga0307408_100461417 | |||
| 2463 | Ga0307408_100647165 | |||
| 2464 | Ga0307508_10000047 | |||
| 2465 | Ga0307508_10001110 | |||
| 2466 | Ga0307508_10012672 | |||
| 2467 | Ga0307508_10400903 | |||
| 2468 | Ga0307514_10002133 | |||
| 2469 | Ga0307514_10017955 | |||
| 2470 | Ga0307514_10045424 | |||
| 2471 | Ga0265314_10062809 | |||
| 2472 | Ga0307516_10000038 | |||
| 2473 | Ga0307516_10001369 | |||
| 2474 | Ga0307516_10005900 | |||
| 2475 | Ga0307516_10254243 | |||
| 2476 | Ga0307516_10312345 | |||
| 2477 | Ga0307405_10018925 | |||
| 2478 | Ga0307405_10191108 | |||
| 2479 | Ga0307405_10348696 | |||
| 2480 | Ga0307413_10001478 | |||
| 2481 | Ga0307413_10034527 | |||
| 2482 | Ga0307413_11202310 | |||
| 2483 | Ga0307518_10019478 | |||
| 2484 | Ga0307410_10130880 | |||
| 2485 | Ga0307410_10341775 | |||
| 2486 | Ga0307410_10414646 | |||
| 2487 | Ga0307410_10480113 | |||
| 2488 | Ga0307410_10559137 | |||
| 2489 | Ga0307406_10007697 | |||
| 2490 | Ga0307406_10606605 | |||
| 2491 | Ga0307412_10003056 | |||
| 2492 | Ga0307412_10134632 | |||
| 2493 | Ga0307409_100012773 | |||
| 2494 | Ga0307409_100244130 | |||
| 2495 | Ga0307409_100316229 | |||
| 2496 | Ga0307409_100754418 | |||
| 2497 | Ga0307416_100376041 | |||
| 2498 | Ga0307416_100426917 | |||
| 2499 | Ga0307416_101093401 | |||
| 2500 | Ga0307416_101355712 | |||
| 2501 | Ga0307414_10099483 | |||
| 2502 | Ga0307414_10158522 | |||
| 2503 | Ga0307411_10002067 | |||
| 2504 | Ga0307411_10019462 | |||
| 2505 | Ga0307411_10156038 | |||
| 2506 | Ga0307411_10186301 | |||
| 2507 | Ga0307411_10268406 | |||
| 2508 | Ga0307411_10296460 | |||
| 2509 | Ga0307411_11675038 | |||
| 2510 | Ga0307415_100043660 | |||
| 2511 | Ga0307415_100581294 | |||
| 2512 | Ga0307415_102208059 | |||
| 2513 | Ga0307510_10005294 | |||
| 2514 | Ga0307510_10037378 | |||
| 2515 | Ga0307510_10253556 | |||
| 2516 | Ga0307510_10468508 | |||
| 2517 | Ga0373959_0049269 | |||
| 2518 | Ga0373929_0090021 | |||
| 2519 | Ga0373934_0097225 | |||
| 2520 | Ga0373944_0061421 | |||
| 2521 | Ga0373944_0112318 | |||
| 2522 | Ga0373951_0018674 | |||
| 2523 | Ga0373939_0000579 | |||
| 2524 | Ga0373941_0061235 | |||
| 2525 | Ga0373941_0462326 | |||
| 2526 | Ga0373943_0969621 | |||
| 2527 | Ga0373962_0060087 | |||
| 2528 | Ga0373931_0000228 | |||
| 2529 | Ga0373931_0006809 | |||
| 2530 | Ga0373931_0011745 | |||
| 2531 | Ga0373931_0904443 | |||
| 2532 | Ga0373927_0009397 | |||
| 2533 | Ga0373933_0043177 | |||
| 2534 | Ga0373925_0001850 | |||
| 2535 | Ga0373925_0497099 | |||
| 2536 | Ga0395899_0000370 | |||
| 2537 | Ga0395899_0038495 | |||
| 2538 | Ga0395899_0043349 | |||
| 2539 | Ga0395899_0113735 | |||
| 2540 | Ga0395899_0243257 | |||
| 2541 | Ga0395899_0362820 | |||
| 2542 | Ga0395899_0494725 | |||
| 2543 | Ga0395900_0000640 | |||
| 2544 | Ga0395900_0033983 | |||
| 2545 | Ga0395900_0120467 | |||
| 2546 | Ga0395900_0123750 | |||
| 2547 | Ga0395900_0220142 | |||
| 2548 | Ga0395900_0617867 | |||
| 2549 | Ga0395898_0007053 | |||
| 2550 | Ga0395898_0070112 | |||
| 2551 | Ga0395898_1319919 | |||
| 2552 | Ga0395905_0000676 | |||
| 2553 | Ga0395905_0008541 | |||
| 2554 | Ga0395905_0013220 | |||
| 2555 | Ga0395905_0018255 | |||
| 2556 | Ga0395905_0133785 | |||
| 2557 | Ga0395905_0140362 | |||
| 2558 | Ga0395905_0227962 | |||
| 2559 | Ga0395905_0284022 | |||
| 2560 | Ga0395905_0516473 | |||
| 2561 | Ga0395905_0747246 | |||
| 2562 | Ga0395905_0873193 | |||
| 2563 | Ga0395901_0000074 | |||
| 2564 | Ga0395901_0001733 | |||
| 2565 | Ga0395901_0244277 | |||
| 2566 | Ga0395901_0279774 | |||
| 2567 | Ga0395901_0323079 | |||
| 2568 | Ga0395901_0429941 | |||
| 2569 | Ga0395901_0961672 | |||
| 2570 | Ga0436361_0048643 | |||
| 2571 | Ga0436361_0053671 | |||
| 2572 | Ga0436361_0062004 | |||
| 2573 | Ga0436361_0071334 | |||
| 2574 | Ga0436361_0144792 | |||
| 2575 | Ga0436361_0239153 | |||
| 2576 | Ga0436361_0362312 | |||
| 2577 | Ga0436361_0588758 | |||
| 2578 | Ga0436361_0615018 | |||
| 2579 | Ga0436361_0692200 | |||
| 2580 | Ga0436361_0749269 | |||
| 2581 | Ga0436361_1191441 | |||
| 2582 | Ga0436363_1606815 | |||
| 2583 | Ga0439453_0015160 | |||
| 2584 | Ga0439465_0221247 | |||
| 2585 | Ga0451791_1212493 | |||
| 2586 | Ga0451791_1752511 | |||
| 2587 | Ga0451795_1328699 | |||
| 2588 | Ga0451798_0266409 | |||
| 2589 | Ga0451802_0610707 | |||
| 2590 | Ga0451807_1373320 | |||
| 2591 | Ga0451835_1125194 | |||
| 2592 | Ga0451837_1627762 | |||
| 2593 | Ga0451845_0632488 | |||
| 2594 | Ga0451847_0912814 | |||
| 2595 | Ga0451849_1092259 | |||
| 2596 | Ga0451851_0023497 | |||
| 2597 | Ga0451851_0889618 | |||
| 2598 | Ga0451843_0699320 | |||
| 2599 | Ga0451853_0907922 | |||
| 2600 | Ga0439431_0006166 | |||
| 2601 | Ga0439433_0021226 | |||
| 2602 | Ga0439437_000360 | |||
| 2603 | Ga0439448_0003089 | |||
| 2604 | Ga0439448_0081905 | |||
| 2605 | Ga0439448_0127064 | |||
| 2606 | Ga0439448_0172457 | |||
| 2607 | Ga0439449_0016561 | |||
| 2608 | Ga0439449_0070323 | |||
| 2609 | Ga0439455_0012754 | |||
| 2610 | Ga0439455_0174098 | |||
| 2611 | Ga0439462_0151164 | |||
| 2612 | Ga0450911_014457 | |||
| 2613 | Ga0450913_016161 | |||
| 2614 | Ga0450917_000369 | |||
| 2615 | Ga0450919_004025 | |||
| 2616 | Ga0450920_014429 | |||
| 2617 | Ga0450888_000895 | |||
| 2618 | Ga0450888_013430 | |||
| 2619 | Ga0450890_037914 | |||
| 2620 | Ga0450890_078507 | |||
| 2621 | Ga0450891_000017 | |||
| 2622 | Ga0450895_006529 | |||
| 2623 | Ga0450898_015726 | |||
| 2624 | Ga0450898_026984 | |||
| 2625 | Ga0450898_062501 | |||
| 2626 | Ga0450898_084618 | |||
| 2627 | Ga0450903_016707 | |||
| 2628 | Ga0450904_000117 | |||
| 2629 | Ga0450906_026774 | |||
| 2630 | Ga0439446_0237398 | |||
| 2631 | Ga0439446_0282478 | |||
| 2632 | Ga0450918_000764 | |||
| 2633 | Ga0450893_0002946 | |||
| 2634 | Ga0450893_0128648 | |||
| 2635 | Ga0450901_017537 | |||
| 2636 | Ga0451577_0043475 | |||
| 2637 | Ga0466969_0000037 | |||
| 2638 | Ga0466969_0034564 | |||
| 2639 | Ga0466969_0043321 | |||
| 2640 | Ga0466969_0464173 | |||
| 2641 | Ga0466972_0002974 | |||
| 2642 | Ga0466972_0009008 | |||
| 2643 | Ga0466972_0059269 | |||
| 2644 | Ga0466972_0316178 | |||
| 2645 | Ga0466982_0034801 | |||
| 2646 | Ga0466965_0004104 | |||
| 2647 | Ga0466965_0017071 | |||
| 2648 | Ga0466965_0030031 | |||
| 2649 | Ga0466965_0043171 | |||
| 2650 | Ga0466965_0077681 | |||
| 2651 | Ga0466965_0081903 | |||
| 2652 | Ga0466965_0125565 | |||
| 2653 | Ga0466965_0263412 | |||
| 2654 | Ga0466966_0014648 | |||
| 2655 | Ga0466966_0032499 | |||
| 2656 | Ga0466966_0048223 | |||
| 2657 | Ga0466966_0114801 | |||
| 2658 | Ga0466966_0191066 | |||
| 2659 | Ga0466966_0286152 | |||
| 2660 | Ga0466966_0417301 | |||
| 2661 | Ga0466966_0444248 | |||
| 2662 | Ga0466961_0015995 | |||
| 2663 | Ga0466961_0020395 | |||
| 2664 | Ga0466961_0022942 | |||
| 2665 | Ga0466961_0048858 | |||
| 2666 | Ga0466963_0024612 | |||
| 2667 | Ga0466963_0321315 | |||
| 2668 | Ga0466964_0005515 | |||
| 2669 | Ga0466964_0008450 | |||
| 2670 | Ga0466964_0022795 | |||
| 2671 | Ga0466964_0189517 | |||
| 2672 | Ga0466964_0273959 | |||
| 2673 | Ga0466964_0493591 | |||
| 2674 | Ga0453684_0047302 | |||
| 2675 | Ga0453684_0103481 | |||
| 2676 | Ga0453684_0147265 | |||
| 2677 | Ga0453684_0158290 | |||
| 2678 | Ga0453684_0228640 | |||
| 2679 | Ga0453684_0428150 | |||
| 2680 | Ga0453684_0546938 | |||
| 2681 | Ga0453684_1324140 | |||
| 2682 | Ga0466971_0008028 | |||
| 2683 | Ga0466971_0025492 | |||
| 2684 | Ga0466971_0031185 | |||
| 2685 | Ga0466968_0000503 | |||
| 2686 | Ga0466968_0026789 | |||
| 2687 | Ga0466968_0032257 | |||
| 2688 | Ga0466970_0028959 | |||
| 2689 | Ga0466970_0073793 | |||
| 2690 | Ga0466970_0085799 | |||
| 2691 | Ga0466970_0206437 | |||
| 2692 | Ga0466957_0006839 | |||
| 2693 | Ga0466957_0009983 | |||
| 2694 | Ga0466957_0020390 | |||
| 2695 | Ga0466957_0035356 | |||
| 2696 | Ga0466957_0082980 | |||
| 2697 | Ga0466957_0102870 | |||
| 2698 | Ga0466957_0701491 | |||
| 2699 | Ga0466957_1018496 | |||
| 2700 | Ga0466960_0146279 | |||
| 2701 | Ga0466960_0160039 | |||
| 2702 | Ga0466960_0168693 | |||
| 2703 | Ga0466960_0661791 | |||
| 2704 | Ga0466960_0716203 | |||
| 2705 | Ga0466959_0006252 | |||
| 2706 | Ga0466959_0110779 | |||
| 2707 | Ga0466959_0112723 | |||
| 2708 | Ga0466959_0117917 | |||
| 2709 | Ga0466959_0125799 | |||
| 2710 | Ga0466959_0528259 | |||
| 2711 | Ga0466959_0735569 | |||
| 2712 | Ga0451576_0002339 | |||
| 2713 | Ga0451576_0454819 | |||
| 2714 | Ga0451576_0819428 | |||
| 2715 | Ga0451576_1458115 | |||
| 2716 | Ga0451576_1686886 | |||
| 2717 | Ga0466958_0077892 | |||
| 2718 | Ga0466958_0109142 | |||
| 2719 | Ga0466958_0113256 | |||
| 2720 | Ga0466958_0115744 | |||
| 2721 | Ga0466958_0156942 | |||
| 2722 | Ga0466958_0213387 | |||
| 2723 | Ga0466958_0233977 | |||
| 2724 | Ga0466967_0011205 | |||
| 2725 | Ga0466967_0020086 | |||
| 2726 | Ga0466967_0313540 | |||
| 2727 | Ga0466967_0376686 | |||
| 2728 | Ga0466967_0505951 | |||
| 2729 | Ga0495617_000005 | |||
| 2730 | Ga0495617_000026 | |||
| 2731 | Ga0495617_000362 | |||
| 2732 | Ga0495617_004468 | |||
| 2733 | Ga0495617_013150 | |||
| 2734 | Ga0495617_085770 | |||
| 2735 | Ga0495627_000038 | |||
| 2736 | Ga0495627_000043 | |||
| 2737 | Ga0495627_023622 | |||
| 2738 | Ga0495592_0000346 | |||
| 2739 | Ga0495603_0120676 | |||
| 2740 | Ga0495603_0157418 | |||
| 2741 | Ga0495603_0183569 | |||
| 2742 | Ga0495590_0000031 | |||
| 2743 | Ga0495590_0000041 | |||
| 2744 | Ga0495590_0006069 | |||
| 2745 | Ga0495590_0006704 | |||
| 2746 | Ga0495590_0123181 | |||
| 2747 | Ga0495590_0195367 | |||
| 2748 | Ga0495590_0227942 | |||
| 2749 | Ga0495591_000213 | |||
| 2750 | Ga0495629_0001336 | |||
| 2751 | Ga0495629_0094490 | |||
| 2752 | Ga0495629_0182113 | |||
| 2753 | Ga0495629_0655730 | |||
| 2754 | Ga0495629_0980435 | |||
| 2755 | Ga0495638_0000101 | |||
| 2756 | Ga0495638_0018344 | |||
| 2757 | Ga0495638_0068193 | |||
| 2758 | Ga0495638_0078354 | |||
| 2759 | Ga0495638_0199792 | |||
| 2760 | Ga0495638_0228610 | |||
| 2761 | Ga0495638_0296130 | |||
| 2762 | Ga0495638_0296595 | |||
| 2763 | Ga0495638_0438618 | |||
| 2764 | Ga0495638_0442370 | |||
| 2765 | Ga0495638_0484298 | |||
| 2766 | Ga0495653_0000031 | |||
| 2767 | Ga0495653_0012591 | |||
| 2768 | Ga0495653_0025416 | |||
| 2769 | Ga0495653_0072599 | |||
| 2770 | Ga0495653_0087730 | |||
| 2771 | Ga0495650_0000230 | |||
| 2772 | Ga0495650_0000274 | |||
| 2773 | Ga0495650_0000288 | |||
| 2774 | Ga0495650_0000504 | |||
| 2775 | Ga0495650_0001351 | |||
| 2776 | Ga0495650_0098457 | |||
| 2777 | Ga0495580_0006752 | |||
| 2778 | Ga0495580_0086525 | |||
| 2779 | Ga0495582_0017018 | |||
| 2780 | Ga0495605_0000071 | |||
| 2781 | Ga0495605_0000113 | |||
| 2782 | Ga0495605_0000186 | |||
| 2783 | Ga0495605_0001197 | |||
| 2784 | Ga0495605_0009878 | |||
| 2785 | Ga0495605_0050343 | |||
| 2786 | Ga0495605_0085279 | |||
| 2787 | Ga0495605_0227370 | |||
| 2788 | Ga0495605_0281587 | |||
| 2789 | Ga0495605_0452653 | |||
| 2790 | Ga0495639_0047800 | |||
| 2791 | Ga0495664_0225997 | |||
| 2792 | Ga0495664_0490464 | |||
| 2793 | Ga0495584_0000007 | |||
| 2794 | Ga0495584_0000252 | |||
| 2795 | Ga0495584_0004963 | |||
| 2796 | Ga0495584_0008099 | |||
| 2797 | Ga0495584_0015762 | |||
| 2798 | Ga0495584_0021355 | |||
| 2799 | Ga0495584_0032557 | |||
| 2800 | Ga0495584_0043442 | |||
| 2801 | Ga0495584_0144931 | |||
| 2802 | Ga0495584_0162952 | |||
| 2803 | Ga0495584_0222395 | |||
| 2804 | Ga0495584_0355275 | |||
| 2805 | Ga0495584_0457278 | |||
| 2806 | Ga0495585_0000090 | |||
| 2807 | Ga0495585_0000147 | |||
| 2808 | Ga0495585_0000919 | |||
| 2809 | Ga0495585_0006598 | |||
| 2810 | Ga0495585_0012830 | |||
| 2811 | Ga0495585_0016190 | |||
| 2812 | Ga0495585_0024549 | |||
| 2813 | Ga0495585_0025178 | |||
| 2814 | Ga0495585_0029280 | |||
| 2815 | Ga0495585_0041940 | |||
| 2816 | Ga0495585_0058592 | |||
| 2817 | Ga0495585_0092763 | |||
| 2818 | Ga0495585_0113717 | |||
| 2819 | Ga0495585_0189373 | |||
| 2820 | Ga0495585_0217815 | |||
| 2821 | Ga0495585_0377688 | |||
| 2822 | Ga0495585_0554786 | |||
| 2823 | Ga0495594_0025128 | |||
| 2824 | Ga0495594_0051651 | |||
| 2825 | Ga0495594_0107383 | |||
| 2826 | Ga0495594_0306657 | |||
| 2827 | Ga0495596_0000270 | |||
| 2828 | Ga0495596_0001876 | |||
| 2829 | Ga0495596_0001991 | |||
| 2830 | Ga0495596_0006043 | |||
| 2831 | Ga0495596_0013973 | |||
| 2832 | Ga0495596_0015363 | |||
| 2833 | Ga0495596_0019543 | |||
| 2834 | Ga0495596_0063271 | |||
| 2835 | Ga0495596_0079667 | |||
| 2836 | Ga0495607_0000842 | |||
| 2837 | Ga0495607_0001791 | |||
| 2838 | Ga0495607_0002436 | |||
| 2839 | Ga0495607_0006283 | |||
| 2840 | Ga0495607_0008025 | |||
| 2841 | Ga0495607_0010917 | |||
| 2842 | Ga0495607_0018599 | |||
| 2843 | Ga0495607_0023678 | |||
| 2844 | Ga0495607_0083828 | |||
| 2845 | Ga0495607_0093779 | |||
| 2846 | Ga0495607_0093985 | |||
| 2847 | Ga0495607_0096950 | |||
| 2848 | Ga0495607_0111651 | |||
| 2849 | Ga0495607_0141005 | |||
| 2850 | Ga0495607_0215458 | |||
| 2851 | Ga0495607_0455918 | |||
| 2852 | Ga0495583_0000016 | |||
| 2853 | Ga0495583_0000075 | |||
| 2854 | Ga0495583_0000194 | |||
| 2855 | Ga0495583_0000284 | |||
| 2856 | Ga0495583_0000783 | |||
| 2857 | Ga0495583_0001150 | |||
| 2858 | Ga0495583_0005291 | |||
| 2859 | Ga0495583_0005830 | |||
| 2860 | Ga0495583_0005871 | |||
| 2861 | Ga0495583_0012206 | |||
| 2862 | Ga0495583_0019843 | |||
| 2863 | Ga0495583_0023530 | |||
| 2864 | Ga0495606_0000077 | |||
| 2865 | Ga0495606_0000133 | |||
| 2866 | Ga0495606_0000474 | |||
| 2867 | Ga0495606_0001180 | |||
| 2868 | Ga0495606_0001442 | |||
| 2869 | Ga0495606_0006254 | |||
| 2870 | Ga0495606_0006540 | |||
| 2871 | Ga0495606_0010878 | |||
| 2872 | Ga0495606_0016609 | |||
| 2873 | Ga0495606_0022834 | |||
| 2874 | Ga0495606_0027155 | |||
| 2875 | Ga0495606_0062093 | |||
| 2876 | Ga0495606_0287324 | |||
| 2877 | Ga0495606_0355959 | |||
| 2878 | Ga0495606_0442077 | |||
| 2879 | Ga0495608_0747823 | |||
| 2880 | Ga0495610_0000038 | |||
| 2881 | Ga0495610_0001086 | |||
| 2882 | Ga0495610_0009405 | |||
| 2883 | Ga0495610_0016768 | |||
| 2884 | Ga0495610_0033904 | |||
| 2885 | Ga0495610_0043657 | |||
| 2886 | Ga0495610_0078844 | |||
| 2887 | Ga0495610_0095798 | |||
| 2888 | Ga0495616_0000048 | |||
| 2889 | Ga0495616_0002015 | |||
| 2890 | Ga0495616_0004259 | |||
| 2891 | Ga0495616_0006556 | |||
| 2892 | Ga0495616_0010268 | |||
| 2893 | Ga0495616_0011262 | |||
| 2894 | Ga0495616_0016471 | |||
| 2895 | Ga0495616_0030381 | |||
| 2896 | Ga0495616_0031023 | |||
| 2897 | Ga0495616_0036660 | |||
| 2898 | Ga0495616_0067735 | |||
| 2899 | Ga0495616_0074501 | |||
| 2900 | Ga0495616_0259799 | |||
| 2901 | Ga0495616_0292678 | |||
| 2902 | Ga0495616_0334098 | |||
| 2903 | Ga0495620_0009384 | |||
| 2904 | Ga0495620_0294975 | |||
| 2905 | Ga0495628_0212869 | |||
| 2906 | Ga0495630_0144757 | |||
| 2907 | Ga0495630_0654721 | |||
| 2908 | Ga0495630_0891788 | |||
| 2909 | Ga0495631_0000684 | |||
| 2910 | Ga0495631_0002923 | |||
| 2911 | Ga0495631_0003899 | |||
| 2912 | Ga0495631_0006452 | |||
| 2913 | Ga0495631_0014808 | |||
| 2914 | Ga0495631_0035930 | |||
| 2915 | Ga0495631_0066285 | |||
| 2916 | Ga0495631_0181683 | |||
| 2917 | Ga0495632_0000098 | |||
| 2918 | Ga0495632_0000152 | |||
| 2919 | Ga0495632_0002349 | |||
| 2920 | Ga0495632_0003810 | |||
| 2921 | Ga0495632_0005546 | |||
| 2922 | Ga0495632_0011269 | |||
| 2923 | Ga0495632_0014466 | |||
| 2924 | Ga0495632_0024146 | |||
| 2925 | Ga0495632_0086630 | |||
| 2926 | Ga0495632_0130761 | |||
| 2927 | Ga0495637_0000013 | |||
| 2928 | Ga0495637_0003644 | |||
| 2929 | Ga0495637_0012166 | |||
| 2930 | Ga0495637_0015193 | |||
| 2931 | Ga0495637_0022638 | |||
| 2932 | Ga0495637_0035358 | |||
| 2933 | Ga0495643_0000115 | |||
| 2934 | Ga0495643_0000204 | |||
| 2935 | Ga0495643_0000206 | |||
| 2936 | Ga0495643_0005635 | |||
| 2937 | Ga0495643_0008875 | |||
| 2938 | Ga0495643_0010126 | |||
| 2939 | Ga0495643_0020187 | |||
| 2940 | Ga0495643_0032309 | |||
| 2941 | Ga0495643_0032526 | |||
| 2942 | Ga0495643_0052450 | |||
| 2943 | Ga0495643_0062241 | |||
| 2944 | Ga0495643_0121146 | |||
| 2945 | Ga0495643_0293703 | |||
| 2946 | Ga0495644_0006682 | |||
| 2947 | Ga0495644_0010702 | |||
| 2948 | Ga0495644_0012933 | |||
| 2949 | Ga0495644_0025704 | |||
| 2950 | Ga0495644_0043410 | |||
| 2951 | Ga0495644_0051930 | |||
| 2952 | Ga0495644_0062795 | |||
| 2953 | Ga0495648_0000089 | |||
| 2954 | Ga0495648_0000091 | |||
| 2955 | Ga0495648_0000353 | |||
| 2956 | Ga0495648_0001746 | |||
| 2957 | Ga0495648_0010945 | |||
| 2958 | Ga0495648_0019012 | |||
| 2959 | Ga0495648_0023916 | |||
| 2960 | Ga0495648_0032254 | |||
| 2961 | Ga0495648_0034766 | |||
| 2962 | Ga0495648_0041778 | |||
| 2963 | Ga0495648_0076691 | |||
| 2964 | Ga0495648_0117986 | |||
| 2965 | Ga0495648_0158085 | |||
| 2966 | Ga0495648_0177032 | |||
| 2967 | Ga0495648_0295370 | |||
| 2968 | Ga0495648_0354105 | |||
| 2969 | Ga0495663_0178770 | |||
| 2970 | Ga0495663_0348303 | |||
| 2971 | Ga0495666_0000042 | |||
| 2972 | Ga0495666_0000406 | |||
| 2973 | Ga0495666_0066514 | |||
| 2974 | Ga0495666_0218832 | |||
| 2975 | Ga0495642_0004297 | |||
| 2976 | Ga0495642_0004327 | |||
| 2977 | Ga0495642_0005729 | |||
| 2978 | Ga0495642_0005832 | |||
| 2979 | Ga0495642_0032927 | |||
| 2980 | Ga0495642_0141799 | |||
| 2981 | Ga0495642_0191297 | |||
| 2982 | Ga0495642_0220331 | |||
| 2983 | Ga0495642_0384232 | |||
| 2984 | Ga0495652_0008927 | |||
| 2985 | Ga0495652_0644009 | |||
| 2986 | Ga0495652_0692160 | |||
| 2987 | Ga0495654_0000047 | |||
| 2988 | Ga0495654_0010498 | |||
| 2989 | Ga0495654_0047709 | |||
| 2990 | Ga0495654_0054606 | |||
| 2991 | Ga0495654_0108211 | |||
| 2992 | Ga0495654_0164605 | |||
| 2993 | Ga0495665_0011224 | |||
| 2994 | Ga0495665_0020612 | |||
| 2995 | Ga0495665_0351615 | |||
| 2996 | Ga0495665_0430889 | |||
| 2997 | Ga0495640_0563530 | |||
| 2998 | Ga0495586_0003306 | |||
| 2999 | Ga0495586_0029130 | |||
| 3000 | Ga0495586_0041477 | |||
| 3001 | Ga0495586_0068372 | |||
| 3002 | Ga0495587_0025272 | |||
| 3003 | Ga0495587_0222801 | |||
| 3004 | Ga0495609_0000022 | |||
| 3005 | Ga0495609_0000482 | |||
| 3006 | Ga0495609_0000525 | |||
| 3007 | Ga0495609_0000817 | |||
| 3008 | Ga0495609_0004242 | |||
| 3009 | Ga0495609_0011455 | |||
| 3010 | Ga0495609_0015753 | |||
| 3011 | Ga0495609_0027835 | |||
| 3012 | Ga0495609_0040439 | |||
| 3013 | Ga0495609_0045080 | |||
| 3014 | Ga0495609_0064246 | |||
| 3015 | Ga0495609_0092309 | |||
| 3016 | Ga0495609_0129507 | |||
| 3017 | Ga0495609_0212564 | |||
| 3018 | Ga0495621_0003510 | |||
| 3019 | Ga0495597_0000104 | |||
| 3020 | Ga0495597_0000246 | |||
| 3021 | Ga0495597_0000771 | |||
| 3022 | Ga0495597_0000806 | |||
| 3023 | Ga0495597_0004134 | |||
| 3024 | Ga0495597_0004503 | |||
| 3025 | Ga0495597_0051448 | |||
| 3026 | Ga0495597_0218038 | |||
| 3027 | Ga0495645_0519153 | |||
| 3028 | Ga0495622_0000015 | |||
| 3029 | Ga0495622_0000598 | |||
| 3030 | Ga0495622_0003085 | |||
| 3031 | Ga0495622_0027127 | |||
| 3032 | Ga0495622_0178754 | |||
| 3033 | Ga0495633_0000110 | |||
| 3034 | Ga0495633_0000189 | |||
| 3035 | Ga0495633_0000253 | |||
| 3036 | Ga0495633_0003539 | |||
| 3037 | Ga0495633_0004049 | |||
| 3038 | Ga0495633_0005097 | |||
| 3039 | Ga0495633_0006064 | |||
| 3040 | Ga0495633_0019372 | |||
| 3041 | Ga0495633_0024369 | |||
| 3042 | Ga0495633_0027835 | |||
| 3043 | Ga0495633_0045331 | |||
| 3044 | Ga0495633_0053117 | |||
| 3045 | Ga0495633_0058702 | |||
| 3046 | Ga0495633_0077901 | |||
| 3047 | Ga0495633_0186950 | |||
| 3048 | Ga0495667_0409249 | |||
| 3049 | Ga0495656_0046421 | |||
| 3050 | Ga0495656_0295828 | |||
| 3051 | Ga0495656_0413918 | |||
| 3052 | Ga0495656_0542329 | |||
| 3053 | Ga0495656_0543884 | |||
| 3054 | Ga0495668_0000064 | |||
| 3055 | Ga0495668_0000131 | |||
| 3056 | Ga0495668_0000245 | |||
| 3057 | Ga0495668_0000434 | |||
| 3058 | Ga0495668_0001415 | |||
| 3059 | Ga0495668_0001765 | |||
| 3060 | Ga0495668_0005921 | |||
| 3061 | Ga0495668_0006701 | |||
| 3062 | Ga0495668_0037092 | |||
| 3063 | Ga0495668_0112999 | |||
| 3064 | Ga0495668_0181098 | |||
| 3065 | Ga0495668_0574453 | |||
| 3066 | Ga0495668_0642286 | |||
| 3067 | Ga0495634_0006153 | |||
| 3068 | Ga0495634_0420950 | |||
| 3069 | Ga0495611_0003458 | |||
| 3070 | Ga0495611_0008445 | |||
| 3071 | Ga0495611_0016209 | |||
| 3072 | Ga0495611_0024536 | |||
| 3073 | Ga0495625_0000188 | |||
| 3074 | Ga0495625_0001292 | |||
| 3075 | Ga0495625_0001624 | |||
| 3076 | Ga0495625_0011006 | |||
| 3077 | Ga0495625_0011060 | |||
| 3078 | Ga0495625_0023122 | |||
| 3079 | Ga0495625_0051373 | |||
| 3080 | Ga0495625_0093430 | |||
| 3081 | Ga0495625_0138509 | |||
| 3082 | Ga0495625_0140960 | |||
| 3083 | Ga0495625_0175871 | |||
| 3084 | Ga0495625_0179402 | |||
| 3085 | Ga0495625_0454015 | |||
| 3086 | Ga0495625_0463659 | |||
| 3087 | Ga0495635_0005244 | |||
| 3088 | Ga0495659_0000679 | |||
| 3089 | Ga0495659_0001640 | |||
| 3090 | Ga0495661_0000502 | |||
| 3091 | Ga0495661_0001265 | |||
| 3092 | Ga0495661_0005726 | |||
| 3093 | Ga0495661_0009038 | |||
| 3094 | Ga0495661_0015856 | |||
| 3095 | Ga0495661_0027532 | |||
| 3096 | Ga0495661_0031420 | |||
| 3097 | Ga0495661_0035252 | |||
| 3098 | Ga0495661_0043898 | |||
| 3099 | Ga0495661_0049104 | |||
| 3100 | Ga0495661_0083814 | |||
| 3101 | Ga0495661_0087827 | |||
| 3102 | Ga0495661_0089152 | |||
| 3103 | Ga0495661_0104665 | |||
| 3104 | Ga0495661_0105438 | |||
| 3105 | Ga0495661_0112456 | |||
| 3106 | Ga0495661_0123683 | |||
| 3107 | Ga0495661_0210079 | |||
| 3108 | Ga0495661_0401328 | |||
| 3109 | Ga0495661_0437020 | |||
| 3110 | Ga0495588_0000148 | |||
| 3111 | Ga0495588_0017071 | |||
| 3112 | Ga0495588_0074754 | |||
| 3113 | Ga0495588_0081574 | |||
| 3114 | Ga0495588_0151054 | |||
| 3115 | Ga0495599_0420424 | |||
| 3116 | Ga0495623_0023548 | |||
| 3117 | Ga0495623_0030990 | |||
| 3118 | Ga0495623_0033544 | |||
| 3119 | Ga0495647_0082352 | |||
| 3120 | Ga0495658_0678181 | |||
| 3121 | Ga0495669_0000355 | |||
| 3122 | Ga0495669_0001964 | |||
| 3123 | Ga0495669_0007315 | |||
| 3124 | Ga0495669_0016714 | |||
| 3125 | Ga0495669_0027926 | |||
| 3126 | Ga0495613_0009841 | |||
| 3127 | Ga0495613_0232461 | |||
| 3128 | Ga0495613_0890572 | |||
| 3129 | Ga0495624_0018263 | |||
| 3130 | Ga0495670_0003213 | |||
| 3131 | Ga0495670_0011444 | |||
| 3132 | Ga0495670_0030214 | |||
| 3133 | Ga0495670_0086312 | |||
| 3134 | Ga0495670_0108500 | |||
| 3135 | Ga0495670_0156969 | |||
| 3136 | Ga0495670_0374453 | |||
| 3137 | Ga0495670_0421203 | |||
| 3138 | Ga0495670_0440460 | |||
| 3139 | Ga0495670_0562660 | |||
| 3140 | Ga0495671_0000044 | |||
| 3141 | Ga0495671_0000426 | |||
| 3142 | Ga0495671_0019650 | |||
| 3143 | Ga0495671_0028581 | |||
| 3144 | Ga0495671_0038152 | |||
| 3145 | Ga0495671_0073066 | |||
| 3146 | Ga0495671_0290865 | |||
| 3147 | Ga0495671_0312540 | |||
| 3148 | Ga0495649_0000806 | |||
| 3149 | Ga0495649_0005148 | |||
| 3150 | Ga0495649_0019253 | |||
| 3151 | Ga0495649_0040661 | |||
| 3152 | Ga0495649_0102632 | |||
| 3153 | Ga0495649_0110028 | |||
| 3154 | Ga0495649_0218377 | |||
| 3155 | Ga0495649_0337019 | |||
| 3156 | Ga0495649_0480981 | |||
| 3157 | Ga0495589_0000017 | |||
| 3158 | Ga0495589_0000508 | |||
| 3159 | Ga0495589_0006901 | |||
| 3160 | Ga0495589_0009727 | |||
| 3161 | Ga0495589_0015977 | |||
| 3162 | Ga0495589_0049188 | |||
| 3163 | Ga0495589_0052782 | |||
| 3164 | Ga0495589_0091798 | |||
| 3165 | Ga0495600_0123284 | |||
| 3166 | Ga0495660_0000162 | |||
| 3167 | Ga0495660_0000403 | |||
| 3168 | Ga0495660_0005437 | |||
| 3169 | Ga0495660_0007545 | |||
| 3170 | Ga0495660_0015676 | |||
| 3171 | Ga0495660_0021946 | |||
| 3172 | Ga0495660_0023195 | |||
| 3173 | Ga0495660_0035577 | |||
| 3174 | Ga0495660_0086023 | |||
| 3175 | Ga0495660_0139169 | |||
| 3176 | Ga0495660_0261881 | |||
| 3177 | Ga0495660_0314563 | |||
| 3178 | Ga0495660_0429093 | |||
| 3179 | Ga0495581_0027074 | |||
| 3180 | Ga0495581_0068577 | |||
| 3181 | Ga0495581_0138604 | |||
| 3182 | Ga0495581_0351395 | |||
| 3183 | Ga0495604_0006708 | |||
| 3184 | Ga0495604_0044087 | |||
| 3185 | Ga0495604_0150900 | |||
| 3186 | Ga0495604_0349592 | |||
| 3187 | Ga0495636_0005184 | |||
| 3188 | Ga0495636_0050921 | |||
| 3189 | Ga0495636_0163907 | |||
| 3190 | Ga0495636_0339180 | |||
| 3191 | Ga0495674_0006559 | |||
| 3192 | Ga0495672_0000111 | |||
| 3193 | Ga0495672_0000142 | |||
| 3194 | Ga0495672_0000152 | |||
| 3195 | Ga0495672_0000167 | |||
| 3196 | Ga0495672_0000559 | |||
| 3197 | Ga0495672_0000581 | |||
| 3198 | Ga0495672_0038378 | |||
| 3199 | Ga0495672_0070711 | |||
| 3200 | Ga0495672_0075445 | |||
| 3201 | Ga0495672_0097259 | |||
| 3202 | Ga0495676_0000123 | |||
| 3203 | Ga0495676_0069412 | |||
| 3204 | Ga0495676_0588180 | |||
| 3205 | Ga0495680_0007799 | |||
| 3206 | Ga0495680_0060600 | |||
| 3207 | Ga0495683_0000069 | |||
| 3208 | Ga0495683_0000098 | |||
| 3209 | Ga0495683_0002101 | |||
| 3210 | Ga0495683_0014744 | |||
| 3211 | Ga0495683_0019856 | |||
| 3212 | Ga0495683_0026681 | |||
| 3213 | Ga0495683_0044801 | |||
| 3214 | Ga0495683_0046896 | |||
| 3215 | Ga0495683_0068070 | |||
| 3216 | Ga0495683_0116851 | |||
| 3217 | Ga0495687_000113 | |||
| 3218 | Ga0495687_000140 | |||
| 3219 | Ga0495687_000175 | |||
| 3220 | Ga0495687_000236 | |||
| 3221 | Ga0495687_002221 | |||
| 3222 | Ga0495687_007947 | |||
| 3223 | Ga0495687_010281 | |||
| 3224 | Ga0495687_044949 | |||
| 3225 | Ga0495675_0012446 | |||
| 3226 | Ga0495675_0109769 | |||
| 3227 | Ga0495675_0113683 | |||
| 3228 | Ga0495675_0200665 | |||
| 3229 | Ga0495677_0000002 | |||
| 3230 | Ga0495677_0000079 | |||
| 3231 | Ga0495677_0000140 | |||
| 3232 | Ga0495677_0000530 | |||
| 3233 | Ga0495677_0002486 | |||
| 3234 | Ga0495677_0004215 | |||
| 3235 | Ga0495677_0005141 | |||
| 3236 | Ga0495677_0006745 | |||
| 3237 | Ga0495677_0056288 | |||
| 3238 | Ga0495677_0100590 | |||
| 3239 | Ga0495679_009955 | |||
| 3240 | Ga0495679_011673 | |||
| 3241 | Ga0495679_021210 | |||
| 3242 | Ga0495679_034304 | |||
| 3243 | Ga0495679_041740 | |||
| 3244 | Ga0495679_048811 | |||
| 3245 | Ga0495679_058770 | |||
| 3246 | Ga0495679_173340 | |||
| 3247 | Ga0495685_000035 | |||
| 3248 | Ga0495685_007306 | |||
| 3249 | Ga0495685_017962 | |||
| 3250 | Ga0495685_040764 | |||
| 3251 | Ga0495685_068902 | |||
| 3252 | Ga0495673_0000060 | |||
| 3253 | Ga0495673_0000085 | |||
| 3254 | Ga0495673_0000149 | |||
| 3255 | Ga0495673_0002074 | |||
| 3256 | Ga0495673_0011481 | |||
| 3257 | Ga0495673_0138910 | |||
| 3258 | Ga0495681_0000824 | |||
| 3259 | Ga0495681_0008558 | |||
| 3260 | Ga0495681_0012074 | |||
| 3261 | Ga0495681_0022943 | |||
| 3262 | Ga0495681_0037046 | |||
| 3263 | Ga0495681_0069635 | |||
| 3264 | Ga0495681_0071377 | |||
| 3265 | Ga0495681_0132533 | |||
| 3266 | Ga0495686_0000169 | |||
| 3267 | Ga0495686_0001301 | |||
| 3268 | Ga0495686_0001456 | |||
| 3269 | Ga0495686_0022113 | |||
| 3270 | Ga0495686_0045233 | |||
| 3271 | Ga0495686_0051556 | |||
| 3272 | Ga0495686_0063418 | |||
| 3273 | Ga0495686_0176616 | |||
| 3274 | Ga0495686_0193354 | |||
| 3275 | Ga0495686_0640205 | |||
| 3276 | Ga0495593_0007070 | |||
| 3277 | Ga0495593_0027236 | |||
| 3278 | Ga0495593_0334876 | |||
| 3279 | Ga0495602_0013704 | |||
| 3280 | Ga0495602_0038029 | |||
| 3281 | Ga0495602_1165652 | |||
| 3282 | Ga0495614_0005675 | |||
| 3283 | Ga0495614_0259825 | |||
| 3284 | Ga0495614_0275022 | |||
| 3285 | Ga0495615_0251393 | |||
| 3286 | Ga0495626_0000076 | |||
| 3287 | Ga0495626_0000170 | |||
| 3288 | Ga0495626_0000882 | |||
| 3289 | Ga0495626_0002487 | |||
| 3290 | Ga0495626_0014577 | |||
| 3291 | Ga0495626_0016369 | |||
| 3292 | Ga0495626_0018299 | |||
| 3293 | Ga0495626_0020538 | |||
| 3294 | Ga0495626_0055268 | |||
| 3295 | Ga0495626_0063415 | |||
| 3296 | Ga0495626_0077862 | |||
| 3297 | Ga0495626_0086070 | |||
| 3298 | Ga0495626_0102698 | |||
| 3299 | Ga0495626_0240270 | |||
| 3300 | Ga0495626_0294420 | |||
| 3301 | Ga0496100_0008425 | |||
| 3302 | Ga0496100_0091449 | |||
| 3303 | Ga0496100_0425875 | |||
| 3304 | Ga0496101_0119689 | |||
| 3305 | Ga0496101_0407770 | |||
| 3306 | Ga0496101_0818837 | |||
| 3307 | Ga0496102_0000156 | |||
| 3308 | Ga0496102_0026637 | |||
| 3309 | Ga0496102_0035916 | |||
| 3310 | Ga0496102_0040492 | |||
| 3311 | Ga0496102_0241353 | |||
| 3312 | Ga0496102_1601529 | |||
| 3313 | Ga0496103_0001871 | |||
| 3314 | Ga0496103_0050964 | |||
| 3315 | Ga0496103_0314841 | |||
| 3316 | Ga0496103_0481771 | |||
| 3317 | Ga0496103_0685025 | |||
| 3318 | Ga0496104_0031258 | |||
| 3319 | Ga0496104_0145130 | |||
| 3320 | Ga0496104_0308104 | |||
| 3321 | Ga0496104_0772260 | |||
| 3322 | Ga0496105_0086137 | |||
| 3323 | Ga0496105_0115503 | |||
| 3324 | Ga0496105_0277813 | |||
| 3325 | Ga0496105_0336785 | |||
| 3326 | Ga0496105_1046679 | |||
| 3327 | Ga0496106_0092083 | |||
| 3328 | Ga0496106_0163178 | |||
| 3329 | Ga0496106_0206902 | |||
| 3330 | Ga0496106_0758867 | |||
| 3331 | Ga0496106_1265917 | |||
| 3332 | Ga0496107_0145371 | |||
| 3333 | Ga0496107_0186240 | |||
| 3334 | Ga0496107_0496247 | |||
| 3335 | Ga0496107_0705493 | |||
| 3336 | Ga0496108_0148228 | |||
| 3337 | Ga0496108_0489275 | |||
| 3338 | Ga0496108_1235550 | |||
| 3339 | Ga0496108_1759002 | |||
| 3340 | Ga0496109_0061400 | |||
| 3341 | Ga0496109_0103067 | |||
| 3342 | Ga0496109_0161761 | |||
| 3343 | Ga0496109_0202296 | |||
| 3344 | Ga0496109_0713198 | |||
| 3345 | Ga0496110_0015273 | |||
| 3346 | Ga0496110_0317709 | |||
| 3347 | Ga0496110_0759304 | |||
| 3348 | Ga0496110_1197560 | |||
| 3349 | Ga0496111_0133500 | |||
| 3350 | Ga0496111_0403271 | |||
| 3351 | Ga0496112_0059576 | |||
| 3352 | Ga0496113_0040930 | |||
| 3353 | Ga0496113_0050671 | |||
| 3354 | Ga0496113_0065917 | |||
| 3355 | Ga0496113_0358311 | |||
| 3356 | Ga0496113_0375616 | |||
| 3357 | Ga0496114_0005419 | |||
| 3358 | Ga0496114_0017437 | |||
| 3359 | Ga0496114_0065449 | |||
| 3360 | Ga0496114_0517560 | |||
| 3361 | Ga0496115_0031336 | |||
| 3362 | Ga0496115_0118488 | |||
| 3363 | Ga0496115_0169903 | |||
| 3364 | Ga0496115_0189893 | |||
| 3365 | Ga0496115_0502819 | |||
| 3366 | Ga0496115_0712322 | |||
| 3367 | Ga0496116_0026975 | |||
| 3368 | Ga0496116_0075945 | |||
| 3369 | Ga0496116_0207566 | |||
| 3370 | Ga0496117_0000011 | |||
| 3371 | Ga0496117_0389840 | |||
| 3372 | Ga0496118_0000010 | |||
| 3373 | Ga0496118_0402302 | |||
| 3374 | Ga0496120_0055568 | |||
| 3375 | Ga0496121_0014685 | |||
| 3376 | Ga0496121_0020684 | |||
| 3377 | Ga0496121_0072058 | |||
| 3378 | Ga0496121_0089685 | |||
| 3379 | Ga0496121_0091909 | |||
| 3380 | Ga0496121_0537109 | |||
| 3381 | Ga0496122_0000653 | |||
| 3382 | Ga0496122_0000691 | |||
| 3383 | Ga0496122_0055165 | |||
| 3384 | Ga0496122_0059591 | |||
| 3385 | Ga0496123_0000196 | |||
| 3386 | Ga0496123_0003602 | |||
| 3387 | Ga0496123_0008397 | |||
| 3388 | Ga0496123_0023456 | |||
| 3389 | Ga0496123_0362392 | |||
| 3390 | Ga0496124_0001079 | |||
| 3391 | Ga0496124_0007424 | |||
| 3392 | Ga0496124_0047741 | |||
| 3393 | Ga0496124_0280248 | |||
| 3394 | Ga0496124_0295836 | |||
| 3395 | Ga0496124_0342286 | |||
| 3396 | Ga0496125_0003108 | |||
| 3397 | Ga0496125_0052257 | |||
| 3398 | Ga0496125_0052557 | |||
| 3399 | Ga0496125_0200621 | |||
| 3400 | Ga0496126_0011408 | |||
| 3401 | Ga0496126_0324301 | |||
| 3402 | Ga0496126_0565907 | |||
| 3403 | Ga0501306_031055 | |||
| 3404 | Ga0501308_012646 | |||
| 3405 | Ga0501304_014766 | |||
| 3406 | Ga0501304_017110 | |||
| 3407 | Ga0495678_000001 | |||
| 3408 | Ga0495678_000458 | |||
| 3409 | Ga0495678_000745 | |||
| 3410 | Ga0495678_001248 | |||
| 3411 | Ga0495678_013374 | |||
| 3412 | Ga0495678_016943 | |||
| 3413 | Ga0495678_018139 | |||
| 3414 | Ga0495678_055256 | |||
| 3415 | Ga0495682_0002062 | |||
| 3416 | Ga0495682_0002194 | |||
| 3417 | Ga0495682_0003012 | |||
| 3418 | Ga0495682_0036004 | |||
| 3419 | Ga0501291_003206 | |||
| 3420 | Ga0501297_008226 | |||
| 3421 | Ga0501300_011751 | |||
| 3422 | Ga0501301_018626 | |||
| 3423 | Ga0501303_017177 | |||
| 3424 | Ga0501314_002322 | |||
| 3425 | Ga0501315_060558 | |||
| 3426 | Ga0501324_026192 | |||
| 3427 | Ga0501036_0833410 | |||
| 3428 | Ga0501041_0447632 | |||
| 3429 | Ga0501041_0955430 | |||
| 3430 | Ga0501198_000020 | |||
| 3431 | Ga0501202_077752 | |||
| 3432 | Ga0501210_006741 | |||
| 3433 | Ga0501211_000342 | |||
| 3434 | Ga0501222_000025 | |||
| 3435 | Ga0501222_001535 | |||
| 3436 | Ga0501222_008087 | |||
| 3437 | Ga0501223_007317 | |||
| 3438 | Ga0501227_060815 | |||
| 3439 | Ga0501233_013732 | |||
| 3440 | Ga0501235_006749 | |||
| 3441 | Ga0501238_026390 | |||
| 3442 | Ga0501257_089156 | |||
| 3443 | Ga0501258_003044 | |||
| 3444 | Ga0501221_019756 | |||
| 3445 | Ga0501229_002483 | |||
| 3446 | Ga0501079_0175184 | |||
| 3447 | Ga0501262_033377 | |||
| 3448 | Ga0501264_014637 | |||
| 3449 | Ga0501266_094602 | |||
| 3450 | Ga0501269_001764 | |||
| 3451 | Ga0501272_010980 | |||
| 3452 | Ga0501283_028357 | |||
| 3453 | Ga0501283_059939 | |||
| 3454 | Ga0501035_0018470 | |||
| 3455 | Ga0501044_0164982 | |||
| 3456 | nmdc:mga03683_106114_c1 | |||
| 3457 | nmdc:mga03683_218867_c1 | |||
| 3458 | nmdc:mga03n38_95341_c1 | |||
| 3459 | nmdc:mga00v17_823376_c1 | |||
| 3460 | nmdc:mga0k408_140886_c1 | |||
| 3461 | nmdc:mga0k408_167711_c1 | |||
| 3462 | nmdc:mga0k408_17968_c1 | |||
| 3463 | nmdc:mga0k408_215628_c1 | |||
| 3464 | nmdc:mga0k408_303971_c1 | |||
| 3465 | nmdc:mga0k408_432820_c1 | |||
| 3466 | nmdc:mga0k408_471718_c1 | |||
| 3467 | nmdc:mga0k408_48281_c1 | |||
| 3468 | nmdc:mga06z11_388436_c1 | |||
| 3469 | nmdc:mga07m45_216290_c1 | |||
| 3470 | nmdc:mga07m45_418293_c1 | |||
| 3471 | nmdc:mga07m45_602165_c1 | |||
| 3472 | nmdc:mga07m45_70331_c1 | |||
| 3473 | nmdc:mga07m45_89189_c1 | |||
| 3474 | nmdc:mga07m45_9660_c1 | |||
| 3475 | nmdc:mga07m45_9841_c1 | |||
| 3476 | nmdc:mga09592_1296_c1 | |||
| 3477 | nmdc:mga0qj67_11367_c1 | |||
| 3478 | nmdc:mga0qj67_142534_c1 | |||
| 3479 | nmdc:mga0rr50_1435808_c1 | |||
| 3480 | Ga0500635_0000077 | |||
| 3481 | Ga0500635_0191967 | |||
| 3482 | Ga0500578_0000013 | |||
| 3483 | Ga0500644_0299089 | |||
| 3484 | Ga0500646_0058230 | |||
| 3485 | Ga0500583_0302745 | |||
| 3486 | Ga0500651_0021759 | |||
| 3487 | Ga0500650_0276913 | |||
| 3488 | Ga0500557_211979 | |||
| 3489 | Ga0500562_031435 | |||
| 3490 | Ga0500569_016845 | |||
| 3491 | Ga0500594_0001239 | |||
| 3492 | Ga0500594_0003144 | |||
| 3493 | Ga0500607_109745 | |||
| 3494 | Ga0500618_004758 | |||
| 3495 | Ga0500618_006553 | |||
| 3496 | Ga0500621_258815 | |||
| 3497 | Ga0500642_0022296 | |||
| 3498 | Ga0500642_0070947 | |||
| 3499 | Ga0500652_001857 | |||
| 3500 | Ga0500652_193579 | |||
| 3501 | Ga0500658_0025758 | |||
| 3502 | Ga0500559_0003197 | |||
| 3503 | Ga0500559_0043745 | |||
| 3504 | Ga0500559_0490266 | |||
| 3505 | Ga0500564_124046 | |||
| 3506 | Ga0500568_0001164 | |||
| 3507 | Ga0500568_0013489 | |||
| 3508 | Ga0500577_0003430 | |||
| 3509 | Ga0500586_007537 | |||
| 3510 | Ga0500589_202111 | |||
| 3511 | Ga0500604_0070068 | |||
| 3512 | Ga0500604_0318967 | |||
| 3513 | Ga0500619_000008 | |||
| 3514 | Ga0500619_054905 | |||
| 3515 | Ga0500622_0007164 | |||
| 3516 | Ga0500622_0073705 | |||
| 3517 | Ga0500636_0088358 | |||
| 3518 | Ga0500636_0133130 | |||
| 3519 | Ga0500584_055439 | |||
| 3520 | Ga0500645_008014 | |||
| 3521 | Ga0500587_000059 | |||
| 3522 | Ga0500587_003765 | |||
| 3523 | Ga0500587_073475 | |||
| 3524 | Ga0500661_003928 | |||
| 3525 | Ga0587083_0075842 | |||
| 3526 | Ga0587098_022566 | |||
| 3527 | Ga0587068_010424 | |||
| 3528 | Ga0466962_0002387 | |||
| 3529 | Ga0466962_0033691 | |||
| 3530 | Ga0466962_0046950 | |||
| 3531 | Ga0466962_0664925 | |||
| 3532 | 2587730469 | |||
| 3533 | 2587736072 | |||
| 3534 | 2588293334 | |||
| 3535 | 2601669595 | |||
| 3536 | 2643742287 | |||
| 3537 | 2643800340 | |||
| 3538 | 2643937108 | |||
| 3539 | 2643969066 | |||
| 3540 | 2644030419 | |||
| 3541 | 2644139666 | |||
| 3542 | 2644217914 | |||
| 3543 | 2644247931 | |||
| 3544 | 2644255300 | |||
| 3545 | 2644258344 | |||
| 3546 | 2644275402 | |||
| 3547 | 2644304505 | |||
| 3548 | 2644318273 | |||
| 3549 | 2644341358 | |||
| 3550 | 2644471880 | |||
| 3551 | 2738827181 | |||
| 3552 | 2739057000 | |||
| 3553 | 2739150978 | |||
| 3554 | 2739192897 | |||
| 3555 | 2739319374 | |||
| 3556 | 2739337615 | |||
| 3557 | 2809142318 | |||
| 3558 | 2821134538 | |||
| 3559 | 2842715045 | |||
| 3560 | 2857549717 | |||
| 3561 | 2857557133 | |||
| 3562 | 2857560562 | |||
| 3563 | 2857570061 | |||
| 3564 | 2885082327 | |||
| 3565 | 2904430318 | |||
| 3566 | 2919480887 | |||
| 3567 | 2919704584 | |||
| 3568 | 2932415799 | |||
| 3569 | 2932421789 | |||
| 3570 | 8047675198 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8p9r-assembly1.cif.gz_B | structure of the periplasmic domain of exbd from e. coli in complex with tonb | 0.9011 | 60 | 135 |
| 8p9r-assembly1.cif.gz_B | structure of the periplasmic domain of exbd from e. coli in complex with tonb | 0.89 | 60 | 135 |
| 8pek-assembly1.cif.gz_B | structure of the dimeric, periplasmic domain of exbd | 0.7508 | 44 | 141 |
| 4ipt-assembly1.cif.gz_A | the crystal structure of a short-chain dehydrogenases/reductase (ethylated) from veillonella parvula dsm 2008 | 0.7484 | 82 | 138 |
| 2jwl-assembly1.cif.gz_B | solution structure of periplasmic domain of tolr from h. influenzae with saxs data | 0.7258 | 60 | 128 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2jwlB00 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5; | 0.7258 | 60 | 128 | 3.30.420.270 |
| 1u04A03 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.7141 | 80 | 134 | 3.40.50.2300 |
| af_Q86IH8_5_206_3.30.420.40 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain | 0.7104 | 77 | 134 | 3.30.420.40 |
| af_Q6L4S6_46_242_3.30.420.40 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain | 0.7021 | 78 | 134 | 3.30.420.40 |
| 2b3yB02 | Alpha Beta;3-Layer(aba) Sandwich;Aconitase; Domain 2;Aconitase, Domain 2 | 0.7012 | 84 | 133 | 3.40.1060.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1Y5Q6K5-F1-model_v4 | Biopolymer transport protein ExbD/TolR | 0.9508 | 63 | 134 |
GO:0005886
GO:0015031 GO:0022857 |
| AF-A0A5C7VJF9-F1-model_v4 | Biopolymer transporter ExbD | 0.9411 | 62 | 139 |
GO:0005886
GO:0015031 GO:0022857 |
| AF-A0A3B9DG87-F1-model_v4 | Biopolymer transporter ExbD | 0.9021 | 56 | 139 |
GO:0005886
GO:0015031 GO:0022857 |
| AF-A0A139DB72-F1-model_v4 | Biopolymer transport protein ExbD | 0.9011 | 60 | 141 |
GO:0005886
GO:0015031 GO:0022857 |
| AF-F3LFH7-F1-model_v4 | Biopolymer transport protein ExbD/TolR | 0.8989 | 60 | 141 |
GO:0005886
GO:0015031 GO:0022857 |