metagRoot

F495694

General Info

Members	Datasets	Scaffolds	Average Seq Length
1785	861	3568	380

Family's Representative Sequence

Representative Sequence	3300037471\|Ga0395905_0000106\|Ga0395905_0000106_132604_133914
Length	436
Sequence	MQAAVLLALAAWRADGVVDERFGHGFLRRKTQYIHFTKRTLGKNLAGDTMIERTLFTPDHEAFRDAFRRFVDKEIAPHHDAWEEQGYIDRELWRKAGANGFLCMTLPEEYGGSGADKLYSVVQMEELARGNYTGVGFGLHSEIVAPYILHYGTDEQKRRWLPRLASGEMIGAIAMSEPAAGSDLQGIKTTAIRQPDGSYLVNGSKTFITNGWHADLVVVVAKTDPQAGAKGTSLVVVERGMKGFEKGQRLKKVGLKAQDTSELFFDNVRVPAGNLLGGAAFENQGFVCLMEQLPWERMQIAVTAIASAQAAIDWTLAYTKDRKVFGQSVASFQNTRYTLAELQTEVQIGRVFVDKCLELVCAGKLDTATASMAKYWTTDLQCKVMDECVQLHGGYGYMWEYPVARAYADARVQRIYGGTNEIMKEVITRAMGIGGR

Samples

	Sample ID	Description	Type	Environment
1	3300037471	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11	Metagenome	Rhizosphere
2	2162886007	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1	Metagenome	Rhizosphere
3	3300001989	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5	Metagenome	Rhizosphere
4	3300002075	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4	Metagenome	Rhizosphere
5	3300002704	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB	Metagenome	Unclassified
6	3300002705	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS	Metagenome	Unclassified
7	3300002737	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA	Metagenome	Endosphere
8	3300002738	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA	Metagenome	Unclassified
9	3300002741	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL	Metagenome	Unclassified
10	3300002771	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB	Metagenome	Endosphere
11	3300002772	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS	Metagenome	Endosphere
12	3300002774	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA	Metagenome	Endosphere
13	3300002987	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB	Metagenome	Endosphere
14	3300003187	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB	Metagenome	Endosphere
15	3300003214	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL	Metagenome	Endosphere
16	3300003215	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF	Metagenome	Endosphere
17	3300003320	Sugarcane root Sample H2	Metagenome	Unclassified
18	3300003323	Sugarcane root Sample H1	Metagenome	Unclassified
19	3300003354	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS	Metagenome	Endosphere
20	3300003374	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF	Metagenome	Endosphere
21	3300003751	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2	Metagenome	Endosphere
22	3300003752	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2	Metagenome	Endosphere
23	3300003756	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2	Metagenome	Endosphere
24	3300003758	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2	Metagenome	Endosphere
25	3300003759	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2	Metagenome	Endosphere
26	3300003761	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2	Metagenome	Endosphere
27	3300003773	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2	Metagenome	Endosphere
28	3300003781	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2	Metagenome	Endosphere
29	3300003784	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2	Metagenome	Endosphere
30	3300003790	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2	Metagenome	Endosphere
31	3300003791	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2	Metagenome	Endosphere
32	3300003792	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2	Metagenome	Endosphere
33	3300003794	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2	Metagenome	Endosphere
34	3300003841	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2	Metagenome	Endosphere
35	3300004625	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2	Metagenome	Endosphere
36	3300005262	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3)	Metagenome	Endosphere
37	3300005288	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2)	Metagenome	Rhizosphere
38	3300005289	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2)	Metagenome	Rhizosphere
39	3300005290	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3)	Metagenome	Rhizosphere
40	3300005293	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2)	Metagenome	Rhizosphere
41	3300005295	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2)	Metagenome	Rhizosphere
42	3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Metagenome	Rhizosphere
43	3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Metagenome	Rhizosphere
44	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
45	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
46	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
47	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
48	3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Metagenome	Rhizosphere
49	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
50	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
51	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
52	3300005345	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG	Metagenome	Rhizosphere
53	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
54	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
55	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
56	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
57	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
58	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
59	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
60	3300005434	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG	Metagenome	Rhizosphere
61	3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Metagenome	Rhizosphere
62	3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Metagenome	Rhizosphere
63	3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Metagenome	Rhizosphere
64	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
65	3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Metagenome	Rhizosphere
66	3300005445	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG	Metagenome	Rhizosphere
67	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
68	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
69	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
70	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
71	3300005466	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG	Metagenome	Rhizosphere
72	3300005467	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG	Metagenome	Rhizosphere
73	3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Metagenome	Rhizosphere
74	3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Metagenome	Rhizosphere
75	3300005536	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG	Metagenome	Rhizosphere
76	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
77	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
78	3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Metagenome	Rhizosphere
79	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
80	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
81	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
82	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
83	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
84	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
85	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
86	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
87	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
88	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
89	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
90	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
91	3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
92	3300005981	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1	Metagenome	Rhizosphere
93	3300005983	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1	Metagenome	Rhizosphere
94	3300005985	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
95	3300006038	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Metagenome	Endosphere
96	3300006042	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3	Metagenome	Endosphere
97	3300006048	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3	Metagenome	Endosphere
98	3300006051	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Metagenome	Endosphere
99	3300006058	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1	Metagenome	Rhizosphere
100	3300006177	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2	Metagenome	Endosphere
101	3300006178	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2	Metagenome	Endosphere
102	3300006186	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4	Metagenome	Endosphere
103	3300006195	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1	Metagenome	Endosphere
104	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
105	3300006353	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5	Metagenome	Endosphere
106	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
107	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
108	3300006880	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Metagenome	Rhizosphere
109	3300006914	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5	Metagenome	Rhizosphere
110	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
111	3300006946	Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG	Metagenome	Nodule
112	3300006948	Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15	Metagenome	Nodule
113	3300007076	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Metagenome	Rhizosphere
114	3300007265	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1	Metagenome	Rhizosphere
115	3300007788	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2	Metagenome	Rhizosphere
116	3300009011	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG	Metagenome	Rhizosphere
117	3300009036	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG	Metagenome	Rhizosphere
118	3300009092	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG	Metagenome	Rhizosphere
119	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
120	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
121	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
122	3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Metagenome	Rhizosphere
123	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
124	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
125	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
126	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
127	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
128	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
129	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
130	3300010159	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3	Metagenome	Rhizosphere
131	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
132	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
133	3300012498	Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410	Metagenome	Rhizosphere
134	3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Metagenome	Rhizosphere
135	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
136	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
137	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
138	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
139	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
140	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
141	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
142	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
143	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
144	3300014497	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG	Metagenome	Rhizosphere
145	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
146	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
147	3300015261	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG	Metagenome	Rhizosphere
148	3300015262	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG	Metagenome	Rhizosphere
149	3300015265	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG	Metagenome	Rhizosphere
150	3300015683	Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04	Metagenome	Rhizosphere
151	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
152	3300021361	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2	Metagenome	Rhizosphere
153	3300021384	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9	Metagenome	Unclassified
154	3300022467	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
155	3300025206	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2)	Metagenome	Unclassified
156	3300025207	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2)	Metagenome	Endosphere
157	3300025224	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
158	3300025225	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
159	3300025226	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
160	3300025229	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
161	3300025230	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2)	Metagenome	Endosphere
162	3300025231	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2)	Metagenome	Endosphere
163	3300025233	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2)	Metagenome	Endosphere
164	3300025242	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
165	3300025245	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3)	Metagenome	Endosphere
166	3300025246	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2)	Metagenome	Unclassified
167	3300025250	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2)	Metagenome	Unclassified
168	3300025253	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
169	3300025256	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2)	Metagenome	Unclassified
170	3300025261	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2)	Metagenome	Endosphere
171	3300025263	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3)	Metagenome	Endosphere
172	3300025273	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3)	Metagenome	Endosphere
173	3300025284	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2)	Metagenome	Endosphere
174	3300025291	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3)	Metagenome	Endosphere
175	3300025292	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
176	3300025294	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2)	Metagenome	Endosphere
177	3300025298	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
178	3300025299	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3)	Metagenome	Endosphere
179	3300025302	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2)	Metagenome	Endosphere
180	3300025303	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
181	3300025304	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
182	3300025711	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
183	3300025728	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
184	3300025735	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
185	3300025885	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
186	3300025898	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
187	3300025900	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
188	3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2)	Metagenome	Rhizosphere
189	3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
190	3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2)	Metagenome	Rhizosphere
191	3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
192	3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
193	3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
194	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
195	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
196	3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
197	3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
198	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
199	3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
200	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
201	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
202	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
203	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
204	3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
205	3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
206	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
207	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
208	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
209	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
210	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
211	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
212	3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
213	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
214	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
215	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
216	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
217	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
218	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
219	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
220	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
221	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
222	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
223	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
224	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
225	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
226	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
227	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
228	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
229	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
230	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
231	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
232	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
233	3300027111	Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2)	Metagenome	Nodule
234	3300027378	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2)	Metagenome	Rhizosphere
235	3300027512	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2)	Metagenome	Rhizosphere
236	3300027666	Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2)	Metagenome	Nodule
237	3300027671	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2)	Metagenome	Rhizosphere
238	3300027866	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2)	Metagenome	Endosphere
239	3300027907	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3)	Metagenome	Rhizosphere
240	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
241	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
242	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
243	3300028573	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG	Metagenome	Rhizosphere
244	3300028794	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM	Metagenome	Unclassified
245	3300030521	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM	Metagenome	Unclassified
246	3300030731	Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3	Metagenome	Rhizosphere
247	3300030732	Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1	Metagenome	Rhizosphere
248	3300030733	Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2	Metagenome	Rhizosphere
249	3300030735	Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4	Metagenome	Rhizosphere
250	3300030742	Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9	Metagenome	Rhizosphere
251	3300030744	Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7	Metagenome	Rhizosphere
252	3300031235	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG	Metagenome	Rhizosphere
253	3300031238	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG	Metagenome	Rhizosphere
254	3300031241	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG	Metagenome	Rhizosphere
255	3300031247	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG	Metagenome	Rhizosphere
256	3300031250	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG	Metagenome	Rhizosphere
257	3300031251	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG	Metagenome	Rhizosphere
258	3300031456	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM	Metagenome	Unclassified
259	3300031507	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM	Metagenome	Unclassified
260	3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Metagenome	Rhizosphere
261	3300031616	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM	Metagenome	Unclassified
262	3300031649	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM	Metagenome	Unclassified
263	3300031665	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3	Metagenome	Rhizosphere
264	3300031691	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA	Metagenome	Rhizosphere
265	3300031711	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG	Metagenome	Rhizosphere
266	3300031727	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5	Metagenome	Rhizosphere
267	3300031728	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC	Metagenome	Rhizosphere
268	3300031730	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM	Metagenome	Unclassified
269	3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Metagenome	Rhizosphere
270	3300031733	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1	Metagenome	Rhizosphere
271	3300031824	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2	Metagenome	Rhizosphere
272	3300031838	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM	Metagenome	Unclassified
273	3300031852	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3	Metagenome	Rhizosphere
274	3300031901	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2	Metagenome	Rhizosphere
275	3300031903	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1	Metagenome	Rhizosphere
276	3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Metagenome	Rhizosphere
277	3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Metagenome	Rhizosphere
278	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
279	3300032004	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3	Metagenome	Rhizosphere
280	3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Metagenome	Rhizosphere
281	3300032126	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2	Metagenome	Rhizosphere
282	3300032133	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA	Metagenome	Rhizosphere
283	3300032139	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB	Metagenome	Rhizosphere
284	3300032168	Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
285	3300033179	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM	Metagenome	Unclassified
286	3300033180	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM	Metagenome	Unclassified
287	3300033524	Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
288	3300033527	Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
289	3300033529	Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
290	3300033541	Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
291	3300035089	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2	Metagenome	Rhizosphere
292	3300035113	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12	Metagenome	Rhizosphere
293	3300035116	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3	Metagenome	Rhizosphere
294	3300035118	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2	Metagenome	Rhizosphere
295	3300035170	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1	Metagenome	Rhizosphere
296	3300035171	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4	Metagenome	Rhizosphere
297	3300035207	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16	Metagenome	Rhizosphere
298	3300035398	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1	Metagenome	Rhizosphere
299	3300035410	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12	Metagenome	Rhizosphere
300	3300035692	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11	Metagenome	Rhizosphere
301	3300035695	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19	Metagenome	Rhizosphere
302	3300035725	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8	Metagenome	Rhizosphere
303	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
304	3300036647	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA	Metagenome	Rhizosphere
305	3300036712	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA	Metagenome	Rhizosphere
306	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
307	3300037312	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2	Metagenome	Rhizosphere
308	3300037418	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3	Metagenome	Rhizosphere
309	3300037466	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1	Metagenome	Rhizosphere
310	3300037853	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2	Metagenome	Unclassified
311	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
312	3300038726	Seagrass microbial communities from Seahorse Key, FL, USA - TH0319	Metagenome	Unclassified
313	3300039062	Seagrass microbial communities from Seahorse Key, FL, USA - HH0818	Metagenome	Unclassified
314	3300039438	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2	Metagenome	Rhizosphere
315	3300039447	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2	Metagenome	Rhizosphere
316	3300041404	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272	Metagenome	Rhizosphere
317	3300041405	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414	Metagenome	Rhizosphere
318	3300041407	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416	Metagenome	Rhizosphere
319	3300041411	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708	Metagenome	Rhizosphere
320	3300041451	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG	Metagenome	Rhizoplane
321	3300041512	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG	Metagenome	Unclassified
322	3300042002	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616	Metagenome	Rhizosphere
323	3300042004	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619	Metagenome	Rhizosphere
324	3300042005	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216	Metagenome	Rhizosphere
325	3300042006	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437	Metagenome	Rhizosphere
326	3300042007	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290	Metagenome	Rhizosphere
327	3300042009	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348	Metagenome	Rhizosphere
328	3300042010	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431	Metagenome	Rhizosphere
329	3300042013	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339	Metagenome	Rhizosphere
330	3300042016	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357	Metagenome	Rhizosphere
331	3300042115	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642	Metagenome	Rhizosphere
332	3300042122	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496	Metagenome	Rhizosphere
333	3300042124	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423	Metagenome	Rhizosphere
334	3300042127	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91	Metagenome	Rhizosphere
335	3300042134	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126	Metagenome	Rhizosphere
336	3300042138	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379	Metagenome	Rhizosphere
337	3300042145	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581	Metagenome	Rhizosphere
338	3300042146	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979	Metagenome	Rhizosphere
339	3300042184	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630	Metagenome	Rhizosphere
340	3300042435	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613	Metagenome	Rhizosphere
341	3300042436	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520	Metagenome	Rhizosphere
342	3300042439	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363	Metagenome	Rhizosphere
343	3300042531	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253	Metagenome	Rhizosphere
344	3300042876	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED	Metagenome	Rhizosphere
345	3300044656	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R	Metagenome	Rhizosphere
346	3300044673	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED	Metagenome	Rhizosphere
347	3300044683	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R	Metagenome	Rhizosphere
348	3300044684	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R	Metagenome	Rhizosphere
349	3300044693	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R	Metagenome	Rhizosphere
350	3300044694	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R	Metagenome	Rhizosphere
351	3300044706	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R	Metagenome	Rhizosphere
352	3300044712	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED	Metagenome	Rhizosphere
353	3300044719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R	Metagenome	Rhizosphere
354	3300044765	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R	Metagenome	Rhizosphere
355	3300044842	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R	Metagenome	Rhizosphere
356	3300044901	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R	Metagenome	Rhizosphere
357	3300045049	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R	Metagenome	Rhizosphere
358	3300045051	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED	Metagenome	Rhizosphere
359	3300045836	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R	Metagenome	Rhizosphere
360	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
361	3300046452	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere	Metagenome	Rhizosphere
362	3300046453	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere	Metagenome	Rhizosphere
363	3300046455	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere	Metagenome	Rhizosphere
364	3300046457	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere	Metagenome	Rhizosphere
365	3300046458	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere	Metagenome	Rhizosphere
366	3300046459	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere	Metagenome	Rhizosphere
367	3300046460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere	Metagenome	Rhizosphere
368	3300046461	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere	Metagenome	Rhizosphere
369	3300046462	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere	Metagenome	Rhizosphere
370	3300046463	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere	Metagenome	Rhizosphere
371	3300046471	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere	Metagenome	Rhizosphere
372	3300046474	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere	Metagenome	Rhizosphere
373	3300046475	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere	Metagenome	Rhizosphere
374	3300046476	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere	Metagenome	Rhizosphere
375	3300046491	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere	Metagenome	Rhizosphere
376	3300046492	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere	Metagenome	Rhizosphere
377	3300046499	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere	Metagenome	Rhizosphere
378	3300046500	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere	Metagenome	Rhizosphere
379	3300046501	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere	Metagenome	Rhizosphere
380	3300046506	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere	Metagenome	Rhizosphere
381	3300046507	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere	Metagenome	Rhizosphere
382	3300046511	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere	Metagenome	Rhizosphere
383	3300046512	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere	Metagenome	Rhizosphere
384	3300046513	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere	Metagenome	Rhizosphere
385	3300046515	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere	Metagenome	Rhizosphere
386	3300046517	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere	Metagenome	Rhizosphere
387	3300046518	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere	Metagenome	Rhizosphere
388	3300046519	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere	Metagenome	Rhizosphere
389	3300046520	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere	Metagenome	Rhizosphere
390	3300046522	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere	Metagenome	Rhizosphere
391	3300046523	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere	Metagenome	Rhizosphere
392	3300046524	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere	Metagenome	Rhizosphere
393	3300046525	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere	Metagenome	Rhizosphere
394	3300046526	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere	Metagenome	Rhizosphere
395	3300046528	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere	Metagenome	Rhizosphere
396	3300046529	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere	Metagenome	Rhizosphere
397	3300046530	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere	Metagenome	Rhizosphere
398	3300046531	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere	Metagenome	Rhizosphere
399	3300046535	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere	Metagenome	Rhizosphere
400	3300046538	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere	Metagenome	Rhizosphere
401	3300046542	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere	Metagenome	Rhizosphere
402	3300046543	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere	Metagenome	Rhizosphere
403	3300046557	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere	Metagenome	Rhizosphere
404	3300046558	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere	Metagenome	Rhizosphere
405	3300046559	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere	Metagenome	Rhizosphere
406	3300046615	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere	Metagenome	Rhizosphere
407	3300046616	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere	Metagenome	Rhizosphere
408	3300046642	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere	Metagenome	Rhizosphere
409	3300046648	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere	Metagenome	Rhizosphere
410	3300046660	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere	Metagenome	Rhizosphere
411	3300046663	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere	Metagenome	Rhizosphere
412	3300046664	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere	Metagenome	Rhizosphere
413	3300046665	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere	Metagenome	Rhizosphere
414	3300046674	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere	Metagenome	Rhizosphere
415	3300046679	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere	Metagenome	Rhizosphere
416	3300046680	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere	Metagenome	Rhizosphere
417	3300046684	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere	Metagenome	Rhizosphere
418	3300046689	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere	Metagenome	Rhizosphere
419	3300046690	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere	Metagenome	Rhizosphere
420	3300046691	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere	Metagenome	Rhizosphere
421	3300046692	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere	Metagenome	Rhizosphere
422	3300046694	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere	Metagenome	Rhizosphere
423	3300046794	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere	Metagenome	Rhizosphere
424	3300046809	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere	Metagenome	Rhizosphere
425	3300046810	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere	Metagenome	Rhizosphere
426	3300047315	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere	Metagenome	Rhizosphere
427	3300047317	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere	Metagenome	Rhizosphere
428	3300047319	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere	Metagenome	Rhizosphere
429	3300047320	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere	Metagenome	Rhizosphere
430	3300047321	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere	Metagenome	Rhizosphere
431	3300047322	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere	Metagenome	Rhizosphere
432	3300047323	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere	Metagenome	Rhizosphere
433	3300047443	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere	Metagenome	Rhizosphere
434	3300047444	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere	Metagenome	Rhizosphere
435	3300047445	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere	Metagenome	Rhizosphere
436	3300047446	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere	Metagenome	Rhizosphere
437	3300047447	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere	Metagenome	Rhizosphere
438	3300047469	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere	Metagenome	Rhizosphere
439	3300047470	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere	Metagenome	Rhizosphere
440	3300047471	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere	Metagenome	Rhizosphere
441	3300047472	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere	Metagenome	Rhizosphere
442	3300047673	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere	Metagenome	Rhizosphere
443	3300048088	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere	Metagenome	Rhizosphere
444	3300048089	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere	Metagenome	Rhizosphere
445	3300048091	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere	Metagenome	Rhizosphere
446	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
447	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
448	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
449	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
450	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
451	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
452	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
453	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
454	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
455	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
456	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
457	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
458	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
459	3300048919	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled	Metagenome	Unclassified
460	3300048920	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15	Metagenome	Unclassified
461	3300048921	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15	Metagenome	Unclassified
462	3300048922	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15	Metagenome	Unclassified
463	3300048923	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15	Metagenome	Unclassified
464	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
465	3300048925	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled	Metagenome	Unclassified
466	3300048926	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled	Metagenome	Unclassified
467	3300048927	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15	Metagenome	Unclassified
468	3300048928	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15	Metagenome	Unclassified
469	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
470	3300049459	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere	Metagenome	Rhizosphere
471	3300049460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere	Metagenome	Rhizosphere
472	3300049513	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control	Metagenome	Rhizosphere
473	3300049517	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control	Metagenome	Rhizosphere
474	3300049523	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control	Metagenome	Rhizosphere
475	3300049570	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03	Metagenome	Rhizosphere
476	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
477	3300049573	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01	Metagenome	Rhizosphere
478	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
479	3300049578	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03	Metagenome	Rhizosphere
480	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
481	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
482	3300049585	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03	Metagenome	Rhizosphere
483	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
484	3300049587	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02	Metagenome	Rhizosphere
485	3300049588	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03	Metagenome	Rhizosphere
486	3300049591	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03	Metagenome	Rhizosphere
487	3300049592	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01	Metagenome	Rhizosphere
488	3300049653	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control	Metagenome	Rhizosphere
489	3300049669	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought	Metagenome	Rhizosphere
490	3300049705	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought	Metagenome	Rhizosphere
491	3300049741	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01	Metagenome	Rhizosphere
492	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
493	3300049744	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02	Metagenome	Rhizosphere
494	3300049758	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought	Metagenome	Rhizosphere
495	3300049759	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought	Metagenome	Rhizosphere
496	3300049776	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought	Metagenome	Rhizosphere
497	3300049778	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control	Metagenome	Rhizosphere
498	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
499	3300050489	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation	Metagenome	Endosphere
500	3300050490	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation	Metagenome	Endosphere
501	3300050492	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation	Metagenome	Endosphere
502	3300050493	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation	Metagenome	Endosphere
503	3300050494	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation	Metagenome	Endosphere
504	3300050495	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation	Metagenome	Endosphere
505	3300050496	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation	Metagenome	Endosphere
506	3300050510	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation	Metagenome	Rhizosphere
507	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
508	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
509	3300050513	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation	Metagenome	Rhizosphere
510	3300050514	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation	Metagenome	Rhizosphere
511	3300050515	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation	Metagenome	Rhizosphere
512	3300050516	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation	Metagenome	Endosphere
513	3300053077	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere	Metagenome	Rhizosphere
514	3300053086	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere	Metagenome	Endosphere
515	3300053087	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere	Metagenome	Endosphere
516	3300053090	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere	Metagenome	Endosphere
517	3300053092	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere	Metagenome	Endosphere
518	3300053096	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere	Metagenome	Endosphere
519	3300053099	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere	Metagenome	Endosphere
520	3300053103	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere	Metagenome	Endosphere
521	3300053104	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere	Metagenome	Endosphere
522	3300053108	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere	Metagenome	Endosphere
523	3300053109	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere	Metagenome	Endosphere
524	3300053111	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere	Metagenome	Endosphere
525	3300053118	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere	Metagenome	Endosphere
526	3300053119	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere	Metagenome	Endosphere
527	3300053131	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere	Metagenome	Endosphere
528	3300053134	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere	Metagenome	Endosphere
529	3300053137	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere	Metagenome	Endosphere
530	3300053138	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere	Metagenome	Endosphere
531	3300053139	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere	Metagenome	Endosphere
532	3300053142	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere	Metagenome	Endosphere
533	3300053149	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere	Metagenome	Endosphere
534	3300053151	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere	Metagenome	Endosphere
535	3300053153	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere	Metagenome	Endosphere
536	3300053156	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere	Metagenome	Endosphere
537	3300053160	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere	Metagenome	Endosphere
538	3300053161	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere	Metagenome	Endosphere
539	3300053730	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere	Metagenome	Endosphere
540	3300053732	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere	Metagenome	Endosphere
541	3300053733	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere	Metagenome	Endosphere
542	3300053739	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere	Metagenome	Endosphere
543	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere
544	3300061719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1	Metagenome	Rhizosphere
545	3300061734	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2)	Metagenome	Rhizosphere
546	2508501009	Bradyrhizobium sp. WSM471	Isolate	Nodule
547	2508501128	Bradyrhizobium sp. ARR65	Isolate	Nodule
548	2511231002	Polaromonas sp. CF318	Isolate	Rhizosphere
549	2511231004	Pseudomonas sp. GM102	Isolate	Nodule
550	2511231006	Pseudomonas sp. GM17	Isolate	Nodule
551	2511231007	Pseudomonas sp. GM18	Isolate	Nodule
552	2511231008	Pseudomonas sp. GM21	Isolate	Nodule
553	2511231010	Pseudomonas sp. GM25	Isolate	Nodule
554	2511231011	Pseudomonas sp. GM30	Isolate	Nodule
555	2511231012	Pseudomonas sp. GM33	Isolate	Nodule
556	2511231014	Pseudomonas sp. GM48	Isolate	Nodule
557	2511231015	Pseudomonas sp. GM49	Isolate	Nodule
558	2511231016	Pseudomonas sp. GM50	Isolate	Nodule
559	2511231017	Pseudomonas sp. GM55	Isolate	Nodule
560	2511231018	Pseudomonas sp. GM60	Isolate	Nodule
561	2511231019	Pseudomonas sp. GM67	Isolate	Nodule
562	2511231020	Pseudomonas sp. GM74	Isolate	Nodule
563	2511231021	Pseudomonas sp. GM78	Isolate	Nodule
564	2511231022	Pseudomonas sp. GM79	Isolate	Nodule
565	2511231023	Pseudomonas sp. GM80	Isolate	Nodule
566	2511231031	Pseudomonas sp. GM16	Isolate	Nodule
567	2511231156	Pseudomonas ogarae F113	Isolate	Rhizosphere
568	2512047018	Pseudomonas chlororaphis chlororaphis GP72	Isolate	Rhizosphere
569	2547132374	Acidovorax radicis N35	Isolate	Unclassified
570	2547132424	Nocardia nova SH22a	Isolate	Unclassified
571	2554235132	Pseudomonas aeruginosa PGPR2	Isolate	Unclassified
572	2554235341	Pseudomonas protegens CHA0	Isolate	Rhizosphere
573	2582580891	Pseudomonas chlororaphis YL-1	Isolate	Unclassified
574	2582581279	Caulobacter henricii OK261	Isolate	Rhizosphere
575	2585428106	Caulobacter sp. OV484	Isolate	Rhizosphere
576	2597489887	Pseudomonas chlororaphis aureofaciens 30-84	Isolate	Rhizosphere
577	2597489888	Pseudomonas fluorescens SS101	Isolate	Rhizosphere
578	2599185160	Pseudomonas sp. NFPP25	Isolate	Rhizoplane
579	2599185161	Pseudomonas sp. NFPP09	Isolate	Rhizoplane
580	2599185162	Pseudomonas sp. NFPP10	Isolate	Rhizoplane
581	2599185163	Pseudomonas sp. NFPP12	Isolate	Rhizoplane
582	2599185164	Pseudomonas sp. NFPP13	Isolate	Rhizoplane
583	2599185165	Pseudomonas sp. NFPP18	Isolate	Rhizoplane
584	2599185166	Pseudomonas sp. NFPP08	Isolate	Rhizoplane
585	2599185168	Pseudomonas sp. NFPP05	Isolate	Rhizoplane
586	2599185181	Pseudomonas sp. NFPP17	Isolate	Rhizoplane
587	2599185182	Pseudomonas sp. NFPP19	Isolate	Rhizoplane
588	2599185185	Pseudomonas sp. NFPP07	Isolate	Rhizoplane
589	2599185186	Pseudomonas sp. NFPP15	Isolate	Rhizoplane
590	2599185188	Pseudomonas sp. NFACC45	Isolate	Rhizoplane
591	2599185189	Pseudomonas sp. NFPP02	Isolate	Rhizoplane
592	2599185190	Pseudomonas sp. NFPP04	Isolate	Rhizoplane
593	2599185212	Pseudomonas sp. NFACC15-1	Isolate	Rhizoplane
594	2599185248	Pseudomonas sp. NFACC08-1	Isolate	Rhizoplane
595	2599185257	Pseudomonas sp. NFACC41-3	Isolate	Rhizoplane
596	2599185288	Pseudomonas sp. NFACC25	Isolate	Rhizoplane
597	2599185289	Pseudomonas sp. NFACC51	Isolate	Rhizoplane
598	2599185290	Pseudomonas sp. NFPP11	Isolate	Rhizoplane
599	2599185291	Pseudomonas sp. NFACC48-1	Isolate	Rhizoplane
600	2599185300	Pseudomonas sp. NFACC39-1	Isolate	Rhizoplane
601	2599185302	Pseudomonas sp. NFACC43	Isolate	Rhizoplane
602	2599185303	Pseudomonas sp. NFACC42-2	Isolate	Rhizoplane
603	2599185304	Pseudomonas sp. NFACC47-1	Isolate	Rhizoplane
604	2599185305	Pseudomonas sp. NFACC07-1	Isolate	Rhizoplane
605	2599185306	Pseudomonas sp. NFACC16-2	Isolate	Rhizoplane
606	2599185308	Pseudomonas sp. NFACC17-2	Isolate	Rhizoplane
607	2599185309	Pseudomonas sp. NFACC49-2	Isolate	Rhizoplane
608	2599185310	Pseudomonas sp. NFACC09-4	Isolate	Rhizoplane
609	2599185311	Pseudomonas sp. NFACC04-2	Isolate	Rhizoplane
610	2599185312	Pseudomonas sp. NFACC32-1	Isolate	Rhizoplane
611	2599185313	Pseudomonas sp. NFACC05-1	Isolate	Rhizoplane
612	2599185314	Pseudomonas sp. NFACC23-1	Isolate	Rhizoplane
613	2599185315	Pseudomonas sp. NFACC44-2	Isolate	Rhizoplane
614	2599185316	Pseudomonas sp. NFACC52	Isolate	Rhizoplane
615	2599185317	Pseudomonas sp. NFACC06-1	Isolate	Rhizoplane
616	2599185318	Pseudomonas sp. NFACC13-1	Isolate	Rhizoplane
617	2599185320	Pseudomonas sp. NFACC36	Isolate	Rhizoplane
618	2599185321	Pseudomonas sp. NFACC54	Isolate	Rhizoplane
619	2599185322	Pseudomonas sp. NFACC14	Isolate	Rhizoplane
620	2599185323	Pseudomonas sp. NFACC37-1	Isolate	Rhizoplane
621	2599185324	Pseudomonas sp. NFACC46-3	Isolate	Rhizoplane
622	2599185325	Pseudomonas sp. NFACC56-3	Isolate	Rhizoplane
623	2599185356	Pseudomonas sp. NFPP14	Isolate	Rhizoplane
624	2600254930	Pseudomonas sp. NFIX10	Isolate	Rhizoplane
625	2600254931	Pseudomonas sp. NFIX28	Isolate	Rhizoplane
626	2600254954	Pseudomonas sp. NFACC19-2	Isolate	Rhizoplane
627	2600255283	Pseudomonas sp. NFR16	Isolate	Rhizoplane
628	2600255296	Pseudomonas sp. NFR02	Isolate	Rhizoplane
629	2600255313	Pseudomonas sp. NFPP16	Isolate	Rhizoplane
630	2600255318	Pseudomonas putida NFIX47	Isolate	Rhizoplane
631	2600255389	Pseudomonas sp. NFPP33	Isolate	Rhizoplane
632	2603880185	Pseudomonas sp. NFIX46	Isolate	Rhizoplane
633	2603880199	Pseudomonas sp. NFIX49	Isolate	Rhizoplane
634	2606217733	Pseudomonas aeruginosa NFHH01	Isolate	Rhizoplane
635	2623620443	Pseudomonas sp. DR 5-09	Isolate	Unclassified
636	2623620446	Pseudomonas sp. GR 6-02	Isolate	Unclassified
637	2643221541	Sphingomonas sp. Root50	Isolate	Unclassified
638	2643221565	Pseudomonas sp. Root562	Isolate	Unclassified
639	2643221570	Acidovorax sp. Root568	Isolate	Unclassified
640	2643221589	Pseudomonas sp. Root68	Isolate	Unclassified
641	2643221596	Acidovorax sp. Root70	Isolate	Unclassified
642	2643221602	Pseudomonas sp. Root71	Isolate	Unclassified
643	2643221604	Nocardioides sp. Root190	Isolate	Unclassified
644	2643221606	Sphingomonas sp. Root720	Isolate	Unclassified
645	2643221609	Acidovorax sp. Root217	Isolate	Unclassified
646	2643221611	Acidovorax sp. Root219	Isolate	Unclassified
647	2643221628	Variovorax sp. Root318D1	Isolate	Unclassified
648	2643221633	Pseudomonas sp. Root329	Isolate	Unclassified
649	2643221640	Caulobacter sp. Root342	Isolate	Unclassified
650	2643221642	Caulobacter sp. Root343	Isolate	Unclassified
651	2643221645	Massilia sp. Root351	Isolate	Unclassified
652	2643221650	Pseudomonas sp. Root401	Isolate	Unclassified
653	2643221652	Acidovorax sp. Root402	Isolate	Unclassified
654	2643221658	Variovorax sp. Root411	Isolate	Unclassified
655	2643221664	Massilia sp. Root418	Isolate	Unclassified
656	2643221671	Sphingomonas sp. Root1294	Isolate	Unclassified
657	2643221683	Variovorax sp. Root473	Isolate	Unclassified
658	2643221713	Pseudomonas sp. Root9	Isolate	Unclassified
659	2643221714	Streptomyces sp. Root264	Isolate	Unclassified
660	2643221717	Acidovorax sp. Root267	Isolate	Unclassified
661	2651869719	Genome Sequence of Pseudomonas fluorescens UM270	Isolate	Rhizosphere
662	2667528170	Pseudomonas sp. NFACC50-1	Isolate	Rhizoplane
663	2667528171	Pseudomonas sp. NFPP22	Isolate	Rhizoplane
664	2667528176	Pseudomonas sp. NFACC11-2	Isolate	Rhizoplane
665	2671180172	Pseudomonas sp. NFIX51	Isolate	Rhizoplane
666	2671180195	Frankia sp. CcI49	Isolate	Nodule
667	2675903420	Pseudomonas fluorescens Ps006	Isolate	Unclassified
668	2675903515	Pseudomonas thivervalensis DSM 13194	Isolate	Unclassified
669	2713897148	Pseudomonas fluorescens SF39a	Isolate	Rhizosphere
670	2713897149	Pseudomonas fluorescens SF4c	Isolate	Rhizosphere
671	2718217725	Pseudomonas fluorescens CREA-C16	Isolate	Rhizosphere
672	2721755607	Pseudomonas fluorescens Pt14	Isolate	Rhizosphere
673	2738541280	Massilia sp. GV090	Isolate	Unclassified
674	2738541294	Pseudomonas sp. GV087	Isolate	Unclassified
675	2738541300	Massilia sp. GV016	Isolate	Unclassified
676	2738541309	Pseudomonas sp. GV047	Isolate	Unclassified
677	2738543004	Pseudomonas sp. GV085	Isolate	Unclassified
678	2738543012	Acidovorax sp. CF301	Isolate	Unclassified
679	2738543013	Variovorax sp. BT01	Isolate	Unclassified
680	2738543015	Pseudomonas sp. GV041	Isolate	Unclassified
681	2738543018	Massilia sp. GV045	Isolate	Unclassified
682	2738543025	Pseudomonas sp. GV091	Isolate	Unclassified
683	2738543030	Massilia sp. GV097	Isolate	Unclassified
684	2739367653	Kocuria sp. OV113	Isolate	Unclassified
685	2740892503	Pseudomonas chlororaphis piscium PCL1391	Isolate	Unclassified
686	2744054611	Aldersonia kunmingensis DSM 45001	Isolate	Rhizosphere
687	2744054620	Pseudomonas thivervalensis LMG 21626	Isolate	Unclassified
688	2772190715	Micromonospora chokoriensis NRRL B-24750	Isolate	Unclassified
689	2773857670	Pseudomonas sp. 478	Isolate	Unclassified
690	2773857673	Pseudomonas sp. 443	Isolate	Unclassified
691	2773857922	Frankia sp. CcI49	Isolate	Nodule
692	2775506901	Microvirga ossetica V5/3m	Isolate	Unclassified
693	2784132063	Pseudomonas sp. 424	Isolate	Unclassified
694	2784132072	Pseudomonas sp. 460	Isolate	Unclassified
695	2784132109	Dermacoccus sp. DS28 SAI-028	Isolate	Unclassified
696	2791355048	Caulobacter flavus CGMCC1 15093	Isolate	Rhizosphere
697	2791355199
698	2791355520	Pseudomonas sp. s211(2017)	Isolate	Unclassified
699	2808606361	Pseudomonas sp. SJZ075	Isolate	Rhizosphere
700	2808606365	Phycicoccus sp. SLBN-51	Isolate	Unclassified
701	2808606376	Pseudomonas sp. SJZ074	Isolate	Rhizosphere
702	2808606377	Pseudomonas sp. SJZ083	Isolate	Rhizosphere
703	2808606378	Pseudomonas sp. SJZ078	Isolate	Rhizosphere
704	2808606379	Pseudomonas sp. SJZ079	Isolate	Rhizosphere
705	2808606380	Pseudomonas sp. SJZ085	Isolate	Rhizosphere
706	2808606381	Pseudomonas sp. SJZ077	Isolate	Rhizosphere
707	2808606382	Pseudomonas sp. SJZ080	Isolate	Rhizosphere
708	2808606383	Pseudomonas sp. SJZ124	Isolate	Rhizosphere
709	2808606385	Pseudomonas sp. SJZ103	Isolate	Rhizosphere
710	2808606388	Pseudomonas sp. SJZ094	Isolate	Rhizosphere
711	2808606389	Pseudomonas sp. SJZ101	Isolate	Rhizosphere
712	2808606445	Pseudomonas sp. SJZ131	Isolate	Rhizosphere
713	2811994881	Pseudomonas sp. SLBN-26	Isolate	Unclassified
714	2816332133	Acidovorax radicis 2721A	Isolate	Unclassified
715	2816332139	Pseudonocardia kunmingensis DSM 45301	Isolate	Unclassified
716	2816332305	Kocuria rhizophila FDAARGOS_302	Isolate	Rhizosphere
717	2818991456	Pseudomonas koreensis 3286	Isolate	Rhizosphere
718	2818991464	Pseudomonas protegens 3295	Isolate	Rhizosphere
719	2823421272	Pseudomonas mendocina S5.2	Isolate	Rhizoplane
720	2824671348	Bradyrhizobium sp. HAMBI 2125	Isolate	Unclassified
721	2824687955	Bradyrhizobium sp. HAMBI 2126	Isolate	Unclassified
722	2824704595	Bradyrhizobium sp. HAMBI 2150	Isolate	Unclassified
723	2824753945	Bradyrhizobium sp. HAMBI 2128	Isolate	Unclassified
724	2824763712	Bradyrhizobium sp. HAMBI 2129	Isolate	Unclassified
725	2825651385	Pseudomonas brassicacearum L13-6-12	Isolate	Rhizosphere
726	2834028612	Pseudomonas fluorescens 513	Isolate	Unclassified
727	2842134933	Mycolicibacterium obuense SEMIA 442	Isolate	Nodule
728	2842677519	Variovorax sp. R-72495	Isolate	Unclassified
729	2842826826	Pseudomonas sp. R-72172	Isolate	Unclassified
730	2842832357	Pseudomonas sp. R-72164	Isolate	Unclassified
731	2842837860	Pseudomonas sp. R-72102	Isolate	Unclassified
732	2842843487	Pseudomonas sp. R-72074	Isolate	Unclassified
733	2842854478	Pseudomonas sp. R-71998	Isolate	Unclassified
734	2843744320	Caulobacter flavus RHGG3	Isolate	Unclassified
735	2844665904	Pseudomonas protegens H1F10C	Isolate	Unclassified
736	2847930680	Bradyrhizobium zhanjiangense CCBAU 51778	Isolate	Unclassified
737	2849560528	Caulobacter zeae 410	Isolate	Unclassified
738	2851153111	Caulobacter radicis 736	Isolate	Unclassified
739	2852612431	Pseudomonas sp. SJZ073	Isolate	Rhizosphere
740	2852657418	Pseudomonas sp. JAI115	Isolate	Rhizosphere
741	2852667396	Pseudomonas sp. JAI120	Isolate	Rhizosphere
742	2855670206	Micromonospora noduli Lupac 07	Isolate	Nodule
743	2855676851	Micromonospora saelicesensis GAR05	Isolate	Unclassified
744	2857288857	Micromonospora noduli ONO23	Isolate	Unclassified
745	2857504554	Caulobacter sp. R-72291	Isolate	Unclassified
746	2857727296	Kocuria sp. R-72562	Isolate	Unclassified
747	2858848962	Micromonospora saelicesensis GAR06	Isolate	Unclassified
748	2858882152	Micromonospora noduli MED15	Isolate	Nodule
749	2858888857	Micromonospora saelicesensis Lupac 06	Isolate	Unclassified
750	2858895516	Micromonospora saelicesensis PSN13	Isolate	Unclassified
751	2860339153	Pseudomonas sp. JAI111	Isolate	Rhizosphere
752	2860867994	Pseudomonas sp. R1-43-08	Isolate	Rhizosphere
753	2862507626	Streptomyces sp. NWU339	Isolate	Unclassified
754	2867302475	Micromonospora globbae WPS1-2	Isolate	Unclassified
755	2867312974	Micromonospora musae NGC1-4	Isolate	Unclassified
756	2867319477	Micromonospora musae MS1-9	Isolate	Unclassified
757	2869048445	Micromonospora saelicesensis PSN01	Isolate	Unclassified
758	2869061728	Micromonospora noduli ONO86	Isolate	Unclassified
759	2869068681	Micromonospora noduli GUI43	Isolate	Unclassified
760	2878029506	Pseudomonas fluorescens DR397	Isolate	Rhizosphere
761	2880230671	Pseudomonas fluorescens LBUM677	Isolate	Unclassified
762	2880489317	Micromonospora ureilytica DSM 101692	Isolate	Unclassified
763	2880495981	Micromonospora vinacea DSM 101695	Isolate	Unclassified
764	2881665667	Bradyrhizobium vignae LMG 28791	Isolate	Unclassified
765	2885192300	Variovorax sp. MHTC-1	Isolate	Rhizosphere
766	2885409591	Bradyrhizobium sp. NAS80.1	Isolate	Unclassified
767	2898329390	Caulobacter sp. 602-2	Isolate	Rhizosphere
768	2904449895	Variovorax sp. 1763	Isolate	Rhizosphere
769	2904456579	Variovorax sp. 2002	Isolate	Unclassified
770	2904518522	Pseudomonas fluorescens 4488	Isolate	Rhizosphere
771	2904550169	Stutzerimonas stutzeri 1099	Isolate	Rhizosphere
772	2904690495	Bradyrhizobium ivorense CI-1B	Isolate	Nodule
773	2904711408	Bradyrhizobium sp. USDA 3456	Isolate	Unclassified
774	2908756301	Bradyrhizobium ivorense CI-41S	Isolate	Nodule
775	2913036834	Pseudomonas viciae 11K1	Isolate	Rhizosphere
776	2916699645	Acinetobacter ursingii M3	Isolate	Unclassified
777	2917070673	Pseudomonas protegens CHA0	Isolate	Rhizosphere
778	2919063839	Pseudomonas pharyngis 1098	Isolate	Rhizosphere
779	2919385768	Pseudomonas sp. 2957	Isolate	Unclassified
780	2919446982	Phycicoccus sp. 3266	Isolate	Rhizosphere
781	2919456309	Pseudomonas sp. 3296	Isolate	Rhizosphere
782	2919462493	Variovorax sp. 3319	Isolate	Rhizosphere
783	2919481497	Pseudomonas brassicacearum 3432	Isolate	Unclassified
784	2919487758	Pseudomonas koreensis 3441	Isolate	Unclassified
785	2919501602	Pseudomonas alcaliphila 3512	Isolate	Unclassified
786	2919697872	Pseudomonas frederiksbergensis 4169	Isolate	Unclassified
787	2919704043	Hydrogenophaga palleronii 4249	Isolate	Unclassified
788	2919713450	Nocardia kruczakiae 4272	Isolate	Rhizosphere
789	2923153595	Pseudomonas chlororaphis piscium PCL1391	Isolate	Unclassified
790	2923519811	Pseudomonas otitidis SLBN-103	Isolate	Rhizosphere
791	2923586266	Pseudomonas fluorescens 1550	Isolate	Rhizosphere
792	2926063275	Pseudomonas sp. 3400	Isolate	Unclassified
793	2928531327	Caulobacter sp. 1776	Isolate	Rhizosphere
794	2929144301	Pseudomonas sp. R-71838 Hybrid assembly	Isolate	Unclassified
795	2929212328	Mycolicibacterium sp. R-73050 Hybrid assembly	Isolate	Unclassified
796	2929219909	Micromonospora sp. R-75348 Hybrid assembly	Isolate	Unclassified
797	2929226422	Micromonospora sp. R-74116 Hybrid assembly	Isolate	Unclassified
798	2929520902	Variovorax beijingensis 502	Isolate	Unclassified
799	2931369376	Pseudomonas fluorescens DR133	Isolate	Rhizosphere
800	2931396565	Pseudomonas sp. DR48	Isolate	Rhizosphere
801	2935353572	Pseudomonas protegens TECH19	Isolate	Unclassified
802	2935675223	Bradyrhizobium sp. LA2.1	Isolate	Nodule
803	2935684952	Bradyrhizobium sp. LA3.X	Isolate	Nodule
804	2935713505	Bradyrhizobium sp. LA6.12	Isolate	Nodule
805	2935722832	Bradyrhizobium sp. LA6.3	Isolate	Nodule
806	2935732158	Bradyrhizobium sp. LA6.4	Isolate	Nodule
807	2935741537	Bradyrhizobium sp. LA6.7	Isolate	Nodule
808	2935750917	Bradyrhizobium sp. LA6.8	Isolate	Nodule
809	2939636861	Pseudomonas sp. 2725	Isolate	Rhizosphere
810	2940556831	Bradyrhizobium sp. LA8.1	Isolate	Nodule
811	2945928738	Pseudomonas cedrina W1I11	Isolate	Rhizosphere
812	2945945610	Variovorax paradoxus W1I18	Isolate	Rhizosphere
813	2945961074	Pseudomonas sp. W2I6	Isolate	Rhizosphere
814	2945972063	Variovorax paradoxus W2I8	Isolate	Rhizosphere
815	2969304461	Pseudomonas sp. R84	Isolate	Rhizosphere
816	2974289157	Pseudomonas fluorescens SORGH_AS 191	Isolate	Unclassified
817	2984286254	Pseudomonas chlororaphis aurantiaca JD37	Isolate	Rhizosphere
818	2984568884	Acinetobacter baylyi SORGH_AS893	Isolate	Aerial Root
819	2988728565	Pseudomonas corrugata RM1-1-4	Isolate	Rhizosphere
820	2990710928	Acidovorax delafieldii SLBN-75	Isolate	Rhizosphere
821	2998139840	Pseudomonas iranensis SWRI54	Isolate	Rhizosphere
822	3007395558	Pseudomonas chlororaphis PCL1601	Isolate	Rhizosphere
823	3007511990	Pseudomonas fluorescens G20-18	Isolate	Rhizosphere
824	3007614139	Pseudomonas sp. PB106	Isolate	Unclassified
825	3007619802	Pseudomonas sp. PB120	Isolate	Unclassified
826	3007855910	Pseudomonas khorasanensis SWRI153	Isolate	Rhizosphere
827	3007861166	Pseudomonas hamedanensis SWRI65	Isolate	Rhizosphere
828	3007866637	Pseudomonas marvdashtae SWRI102	Isolate	Rhizosphere
829	637000220	Pseudomonas protegens Pf-5	Isolate	Rhizoplane
830	8002775197	Frankia nepalensis CN7	Isolate	Nodule
831	8002784119	Frankia sp. AgB1.9	Isolate	Nodule
832	8003830390	Micromonospora parastrephiae STR1_7	Isolate	Rhizosphere
833	8003870546	Micromonospora tarensis STR1s_6	Isolate	Rhizosphere
834	8006984368	Bradyrhizobium sp. SRL28	Isolate	Unclassified
835	8011350971	Pseudomonas sp. 30_B	Isolate	Rhizosphere
836	8015687852	Pseudomonas chlororaphis aurantiaca RP4	Isolate	Rhizosphere
837	8019619141	Bradyrhizobium sp. GM7.3	Isolate	Nodule
838	8019629233	Bradyrhizobium sp. GM6.1	Isolate	Nodule
839	8019769354	Pseudomonas sp. MSSRFD41	Isolate	Rhizosphere
840	8019775933	Pseudomonas sp. PvR083	Isolate	Rhizosphere
841	8029995093	Pseudomonas atacamensis SM1	Isolate	Rhizosphere
842	8034962539	Pseudomonas sediminis PI11	Isolate	Rhizosphere
843	8054347763	Pseudomonas carnis NWU Be30	Isolate	Unclassified
844	8054503363	Pseudomonas sivasensis BsEB-1	Isolate	Unclassified
845	8054704163	Micromonospora trifolii NIE79	Isolate	Nodule
846	8054727385	Micromonospora alfalfae MED01	Isolate	Nodule
847	8054734606	Micromonospora hortensis NIE111	Isolate	Nodule
848	8055770955	Pseudomonas chlororaphis qlu-1	Isolate	Rhizosphere
849	8055817908	Pseudomonas pergaminensis 1008	Isolate	Rhizosphere
850	8056125926	Pseudomonas azerbaijanorientalis SWRI123	Isolate	Rhizosphere
851	8056131705	Pseudomonas asgharzadehiana SWRI132	Isolate	Rhizosphere
852	8056143049	Pseudomonas alvandae SWRI17	Isolate	Rhizosphere
853	8056155041	Pseudomonas farris SWRI79	Isolate	Rhizosphere
854	8056161164	Pseudomonas azadiae SWRI103	Isolate	Rhizosphere
855	8056166840	Pseudomonas triticicola SWRI88	Isolate	Rhizosphere
856	8056172158	Pseudomonas ekonensis COR58	Isolate	Rhizosphere
857	8056177738	Pseudomonas azerbaijanoccidentalis SWRI74	Isolate	Rhizosphere
858	8056569372	Pseudomonas serboccidentalis IT-P374	Isolate	Rhizosphere
859	8056689827	Bradyrhizobium semiaridum WSM 1704	Isolate	Nodule
860	8056967851	Bradyrhizobium zhengyangense WYCCWR 12678	Isolate	Nodule
861	8057798959	Pseudomonas piscis BW16M1	Isolate	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	81.5
Metatranscriptomes	0.5
Isolates	17.99

Biome Distribution

Category	Percentage (%)
Aerial Root	0.06
Bulb	0
Endosphere	12.27
Nodule	2.97
Rhizoplane	5.21
Rhizosphere	66.95
Stem	0
Stem Tuber	0
Unclassified	0.11

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	Ga0395905_0000106	3300037471	Bacteria	140180
2	SwRhRL2b_contig_3359380	2162886007	Bacteria	4051
3	SwRhRL2b_contig_451342	2162886007	Bacteria	1539
4	JGI24739J22299_10027560	3300001989	Bacteria	1985
5	JGI24738J21930_10013006	3300002075	Bacteria	1808
6	JGI25155J39150_1000002	3300002704	Bacteria	292156
7	JGI25156J39149_1000003	3300002705	Bacteria	305434
8	JGI25162J39368_1000194	3300002737	Bacteria	63841
9	JGI25162J39368_1000671	3300002737	Bacteria	24136
10	JGI25154J39366_1000009	3300002738	Bacteria	305408
11	JGI25157J39369_1000002	3300002741	Bacteria	305434
12	JGI25163J39215_1000690	3300002771	Bacteria	8910
13	JGI25163J39215_1001497	3300002771	Bacteria	3723
14	JGI25164J39214_1000160	3300002772	Bacteria	63841
15	JGI25164J39214_1000417	3300002772	Bacteria	24136
16	JGI25150J39212_1004255	3300002774	Bacteria	3211
17	JGI25150J39212_1005462	3300002774	Bacteria	2709
18	JGI25159J45721_1001036	3300002987	Bacteria	11877
19	JGI25159J45721_1012731	3300002987	Bacteria	1988
20	JGI25151J46595_10009599	3300003187	Bacteria	4566
21	JGI25165J46597_1000290	3300003214	Bacteria	63841
22	JGI25165J46597_1000470	3300003214	Bacteria	39839
23	JGI25165J46597_1000770	3300003214	Bacteria	24485
24	JGI25153J46596_10037698	3300003215	Bacteria	1533
25	rootH2_10012126	3300003320	Bacteria	23852
26	rootH1_10147960	3300003323	Bacteria	8308
27	JGI25160J50197_1000305	3300003354	Bacteria	34747
28	JGI25161J50226_1000018	3300003374	Bacteria	172599
29	Ga0055538_1000036	3300003751	Bacteria	190579
30	Ga0055539_1000047	3300003752	Bacteria	190579
31	Ga0055533_1000058	3300003756	Bacteria	190579
32	Ga0055532_1000087	3300003758	Bacteria	107251
33	Ga0055525_1000209	3300003759	Bacteria	65994
34	Ga0055535_1003122	3300003761	Bacteria	4974
35	Ga0055537_1000127	3300003773	Bacteria	58289
36	Ga0055536_1002216	3300003781	Bacteria	11061
37	Ga0055536_1004611	3300003781	Bacteria	6982
38	Ga0055536_1004659	3300003781	Bacteria	6932
39	Ga0055536_1004690	3300003781	Bacteria	6890
40	Ga0055534_1000340	3300003784	Bacteria	30297
41	Ga0055534_1005703	3300003784	Bacteria	3278
42	Ga0055528_1001503	3300003790	Bacteria	14133
43	Ga0055530_10001779	3300003791	Bacteria	14985
44	Ga0055530_10004594	3300003791	Bacteria	7037
45	Ga0055530_10005180	3300003791	Bacteria	6346
46	Ga0055540_1001314	3300003792	Bacteria	14985
47	Ga0055540_1002441	3300003792	Bacteria	9802
48	Ga0055540_1003847	3300003792	Bacteria	7045
49	Ga0055540_1005246	3300003792	Bacteria	5527
50	Ga0055540_1009711	3300003792	Bacteria	3288
51	Ga0055531_10000348	3300003794	Bacteria	45293
52	Ga0055531_10001138	3300003794	Bacteria	20582
53	Ga0055541_1000034	3300003841	Bacteria	190579
54	Ga0055543_1000418	3300004625	Bacteria	26839
55	Ga0065165_1002126	3300005262	Bacteria	18020
56	Ga0065714_10004456	3300005288	Bacteria	4902
57	Ga0065714_10013374	3300005288	Bacteria	2920
58	Ga0065714_10028410	3300005288	Bacteria	1462
59	Ga0065714_10068674	3300005288	Bacteria	4597
60	Ga0065714_10068918	3300005288	Bacteria	4476
61	Ga0065714_10078586	3300005288	Bacteria	2586
62	Ga0065714_10078707	3300005288	Bacteria	2576
63	Ga0065714_10085116	3300005288	Bacteria	2164
64	Ga0065704_10001910	3300005289	Bacteria	7577
65	Ga0065704_10005418	3300005289	Bacteria	5517
66	Ga0065712_10011733	3300005290	Bacteria	3213
67	Ga0065712_10073972	3300005290	Bacteria	4222
68	Ga0065715_10092771	3300005293	Bacteria	4948
69	Ga0065707_10015660	3300005295	Bacteria	1835
70	Ga0070658_10147124	3300005327	Bacteria	1970
71	Ga0070658_10156080	3300005327	Bacteria	1913
72	Ga0070676_10001154	3300005328	Bacteria	13192
73	Ga0070676_10072377	3300005328	Bacteria	2072
74	Ga0070683_100024533	3300005329	Bacteria	5403
75	Ga0070683_100080286	3300005329	Bacteria	3053
76	Ga0070670_100102289	3300005331	Bacteria	2467
77	Ga0068869_100009902	3300005334	Bacteria	6192
78	Ga0070680_100113882	3300005336	Bacteria	2253
79	Ga0070682_100053087	3300005337	Bacteria	2539
80	Ga0068868_100016222	3300005338	Bacteria	5527
81	Ga0068868_100061632	3300005338	Bacteria	2972
82	Ga0070660_100013873	3300005339	Bacteria	5797
83	Ga0070661_100018565	3300005344	Bacteria	4946
84	Ga0070661_100059704	3300005344	Bacteria	2797
85	Ga0070692_10000512	3300005345	Bacteria	11948
86	Ga0070668_100009698	3300005347	Bacteria	7139
87	Ga0070669_100024903	3300005353	Bacteria	4295
88	Ga0070675_100260801	3300005354	Bacteria	1519
89	Ga0070671_100041590	3300005355	Bacteria	3820
90	Ga0070673_100020456	3300005364	Bacteria	4775
91	Ga0070659_100173768	3300005366	Bacteria	1766
92	Ga0070659_100210719	3300005366	Bacteria	1601
93	Ga0070667_100020196	3300005367	Bacteria	5530
94	Ga0070709_10162048	3300005434	Bacteria	1556
95	Ga0070714_100059826	3300005435	Bacteria	3267
96	Ga0070714_100313253	3300005435	Bacteria	1466
97	Ga0070711_100051889	3300005439	Bacteria	2820
98	Ga0070705_100017433	3300005440	Bacteria	3749
99	Ga0070700_100033850	3300005441	Bacteria	3081
100	Ga0070694_100001309	3300005444	Bacteria	14482
101	Ga0070708_100395296	3300005445	Bacteria	1303
102	Ga0070663_100032125	3300005455	Bacteria	3615
103	Ga0070663_100038070	3300005455	Bacteria	3352
104	Ga0070662_100007601	3300005457	Bacteria	7035
105	Ga0070662_100063517	3300005457	Bacteria	2701
106	Ga0070681_10000400	3300005458	Bacteria	35179
107	Ga0068867_100032250	3300005459	Bacteria	3787
108	Ga0070685_10147476	3300005466	Bacteria	1488
109	Ga0070706_100030535	3300005467	Bacteria	4967
110	Ga0070706_100054161	3300005467	Bacteria	3703
111	Ga0070698_100001061	3300005471	Bacteria	30184
112	Ga0070698_100002279	3300005471	Bacteria	21244
113	Ga0070698_100123942	3300005471	Bacteria	2541
114	Ga0070699_100008172	3300005518	Bacteria	9079
115	Ga0070699_100341163	3300005518	Bacteria	1348
116	Ga0070697_100346371	3300005536	Bacteria	1283
117	Ga0068853_100043783	3300005539	Bacteria	3830
118	Ga0068853_100152766	3300005539	Bacteria	2079
119	Ga0070665_100023785	3300005548	Bacteria	6172
120	Ga0070665_100027573	3300005548	Bacteria	5720
121	Ga0070665_100102347	3300005548	Bacteria	2867
122	Ga0070665_100130171	3300005548	Bacteria	2519
123	Ga0070704_100159796	3300005549	Bacteria	1781
124	Ga0068855_100036615	3300005563	Bacteria	5839
125	Ga0068855_100053696	3300005563	Bacteria	4739
126	Ga0068855_100090213	3300005563	Bacteria	3537
127	Ga0068855_100104660	3300005563	Bacteria	3255
128	Ga0068855_100113368	3300005563	Bacteria	3110
129	Ga0068855_100127821	3300005563	Bacteria	2904
130	Ga0068855_100269037	3300005563	Bacteria	1895
131	Ga0070664_100023382	3300005564	Bacteria	5104
132	Ga0068854_100003802	3300005578	Bacteria	9439
133	Ga0068856_100032092	3300005614	Bacteria	5141
134	Ga0068856_100093249	3300005614	Bacteria	2996
135	Ga0068856_100195683	3300005614	Bacteria	2036
136	Ga0068856_100359627	3300005614	Bacteria	1474
137	Ga0068852_100032842	3300005616	Bacteria	4302
138	Ga0068852_100038545	3300005616	Bacteria	4017
139	Ga0068859_100055102	3300005617	Bacteria	4001
140	Ga0068864_100018695	3300005618	Bacteria	5791
141	Ga0068861_100005124	3300005719	Bacteria	8834
142	Ga0068861_100084712	3300005719	Bacteria	2489
143	Ga0068861_100150464	3300005719	Bacteria	1909
144	Ga0068863_100188142	3300005841	Bacteria	1984
145	Ga0068858_100015717	3300005842	Bacteria	7119
146	Ga0068858_100082134	3300005842	Bacteria	2995
147	Ga0068860_100001000	3300005843	Bacteria	31313
148	Ga0068860_100003227	3300005843	Bacteria	16817
149	Ga0068860_100039138	3300005843	Bacteria	4535
150	Ga0068860_100245381	3300005843	Bacteria	1742
151	Ga0068862_100008139	3300005844	Bacteria	8669
152	Ga0068862_100070727	3300005844	Bacteria	3012
153	Ga0068862_100164663	3300005844	Bacteria	1981
154	Ga0081455_10000535	3300005937	Bacteria	49312
155	Ga0081455_10002583	3300005937	Bacteria	21474
156	Ga0081455_10003074	3300005937	Bacteria	19454
157	Ga0081455_10006365	3300005937	Bacteria	12673
158	Ga0081455_10076181	3300005937	Bacteria	2764
159	Ga0081538_10000336	3300005981	Bacteria	53233
160	Ga0081538_10104838	3300005981	Bacteria	1409
161	Ga0081540_1005124	3300005983	Bacteria	9820
162	Ga0081540_1016510	3300005983	Bacteria	4615
163	Ga0081540_1018707	3300005983	Bacteria	4239
164	Ga0081539_10000322	3300005985	Bacteria	106875
165	Ga0081539_10001500	3300005985	Bacteria	39463
166	Ga0081539_10010735	3300005985	Bacteria	7381
167	Ga0081539_10055915	3300005985	Bacteria	2193
168	Ga0075365_10001038	3300006038	Bacteria	11956
169	Ga0075365_10002515	3300006038	Bacteria	9035
170	Ga0075365_10147569	3300006038	Bacteria	1635
171	Ga0075365_10151217	3300006038	Bacteria	1615
172	Ga0075365_10153319	3300006038	Bacteria	1603
173	Ga0075368_10028500	3300006042	Bacteria	2157
174	Ga0075363_100063220	3300006048	Bacteria	1997
175	Ga0075363_100064246	3300006048	Bacteria	1982
176	Ga0075363_100072682	3300006048	Bacteria	1870
177	Ga0075364_10056443	3300006051	Bacteria	2571
178	Ga0075364_10099254	3300006051	Bacteria	1938
179	Ga0075432_10000475	3300006058	Bacteria	11942
180	Ga0075432_10001254	3300006058	Bacteria	8177
181	Ga0075432_10004055	3300006058	Bacteria	5000
182	Ga0075432_10009780	3300006058	Bacteria	3261
183	Ga0075432_10019754	3300006058	Bacteria	2303
184	Ga0075362_10003219	3300006177	Bacteria	5659
185	Ga0075362_10009581	3300006177	Bacteria	3751
186	Ga0075362_10024455	3300006177	Bacteria	2562
187	Ga0075362_10081741	3300006177	Bacteria	1490
188	Ga0075367_10001008	3300006178	Bacteria	11566
189	Ga0075367_10114691	3300006178	Bacteria	1656
190	Ga0075369_10000014	3300006186	Bacteria	63974
191	Ga0075369_10013629	3300006186	Bacteria	3233
192	Ga0075369_10019212	3300006186	Bacteria	2788
193	Ga0075369_10020019	3300006186	Bacteria	2738
194	Ga0075369_10067738	3300006186	Bacteria	1568
195	Ga0075366_10007780	3300006195	Bacteria	5932
196	Ga0075366_10022363	3300006195	Bacteria	3677
197	Ga0075366_10030145	3300006195	Bacteria	3188
198	Ga0075366_10031183	3300006195	Bacteria	3137
199	Ga0075366_10034453	3300006195	Bacteria	2982
200	Ga0075366_10078636	3300006195	Bacteria	1968
201	Ga0075366_10078687	3300006195	Bacteria	1968
202	Ga0097621_100321685	3300006237	Bacteria	1370
203	Ga0075370_10000325	3300006353	Bacteria	17244
204	Ga0075370_10003407	3300006353	Bacteria	7560
205	Ga0075370_10004598	3300006353	Bacteria	6730
206	Ga0075370_10006184	3300006353	Bacteria	6007
207	Ga0075370_10034028	3300006353	Bacteria	2855
208	Ga0075370_10041253	3300006353	Bacteria	2605
209	Ga0075370_10124616	3300006353	Bacteria	1501
210	Ga0075428_100092590	3300006844	Bacteria	3295
211	Ga0075434_100000910	3300006871	Bacteria	23742
212	Ga0075434_100337786	3300006871	Bacteria	1527
213	Ga0075429_100202575	3300006880	Bacteria	1739
214	Ga0075436_100001623	3300006914	Bacteria	15389
215	Ga0075436_100061626	3300006914	Bacteria	2592
216	Ga0075436_100112691	3300006914	Bacteria	1899
217	Ga0097620_100055105	3300006931	Bacteria	4001
218	Ga0079104_1000259	3300006946	Bacteria	70490
219	Ga0079104_1001901	3300006946	Bacteria	12606
220	Ga0079104_1012883	3300006946	Bacteria	2603
221	Ga0099826_10005506	3300006948	Bacteria	9091
222	Ga0075435_100003979	3300007076	Bacteria	10099
223	Ga0075435_100145488	3300007076	Bacteria	1991
224	Ga0099794_10000175	3300007265	Bacteria	23393
225	Ga0099794_10004144	3300007265	Bacteria	5649
226	Ga0099795_10001474	3300007788	Bacteria	5122
227	Ga0099795_10003195	3300007788	Bacteria	4024
228	Ga0099795_10010610	3300007788	Bacteria	2719
229	Ga0105251_10000030	3300009011	Bacteria	124407
230	Ga0105251_10000152	3300009011	Bacteria	70853
231	Ga0105251_10024552	3300009011	Bacteria	3094
232	Ga0105251_10032369	3300009011	Bacteria	2607
233	Ga0105251_10041514	3300009011	Bacteria	2238
234	Ga0105251_10065625	3300009011	Bacteria	1698
235	Ga0105251_10071251	3300009011	Bacteria	1617
236	Ga0105244_10002080	3300009036	Bacteria	15407
237	Ga0105244_10017319	3300009036	Bacteria	4074
238	Ga0105244_10031407	3300009036	Bacteria	2818
239	Ga0105244_10061539	3300009036	Bacteria	1889
240	Ga0105244_10067547	3300009036	Bacteria	1788
241	Ga0105244_10088231	3300009036	Bacteria	1528
242	Ga0105244_10094234	3300009036	Bacteria	1470
243	Ga0105250_10003748	3300009092	Bacteria	7140
244	Ga0105250_10003832	3300009092	Bacteria	7052
245	Ga0105250_10021069	3300009092	Bacteria	2632
246	Ga0105250_10023281	3300009092	Bacteria	2496
247	Ga0105250_10046896	3300009092	Bacteria	1733
248	Ga0105240_10043773	3300009093	Bacteria	5693
249	Ga0105240_10046877	3300009093	Bacteria	5473
250	Ga0105240_10197731	3300009093	Bacteria	2358
251	Ga0111539_10000980	3300009094	Bacteria	37481
252	Ga0111539_10144775	3300009094	Bacteria	2782
253	Ga0111539_10293622	3300009094	Bacteria	1891
254	Ga0105245_10027202	3300009098	Bacteria	5039
255	Ga0105245_10098259	3300009098	Bacteria	2705
256	Ga0105245_10166475	3300009098	Bacteria	2096
257	Ga0105247_10000503	3300009101	Bacteria	32160
258	Ga0105247_10001684	3300009101	Bacteria	15604
259	Ga0105243_10000655	3300009148	Bacteria	34289
260	Ga0105243_10009254	3300009148	Bacteria	7521
261	Ga0105243_10012936	3300009148	Bacteria	6306
262	Ga0105243_10041601	3300009148	Bacteria	3594
263	Ga0105243_10109570	3300009148	Bacteria	2307
264	Ga0105241_10037920	3300009174	Bacteria	3633
265	Ga0105241_10054340	3300009174	Bacteria	3065
266	Ga0105241_10061580	3300009174	Bacteria	2890
267	Ga0105241_10063731	3300009174	Bacteria	2845
268	Ga0105242_10000361	3300009176	Bacteria	36302
269	Ga0105248_10044791	3300009177	Bacteria	4962
270	Ga0105248_10120457	3300009177	Bacteria	2960
271	Ga0105237_10000304	3300009545	Bacteria	68213
272	Ga0105237_10034592	3300009545	Bacteria	5116
273	Ga0105237_10046264	3300009545	Bacteria	4377
274	Ga0105238_10042238	3300009551	Bacteria	4618
275	Ga0105238_10065111	3300009551	Bacteria	3645
276	Ga0105249_10013528	3300009553	Bacteria	7206
277	Ga0105249_10025312	3300009553	Bacteria	5341
278	Ga0105249_10025451	3300009553	Bacteria	5328
279	Ga0105249_10035390	3300009553	Bacteria	4530
280	Ga0105249_10183864	3300009553	Bacteria	2035
281	Ga0099796_10000071	3300010159	Bacteria	18016
282	Ga0099796_10005817	3300010159	Bacteria	3108
283	Ga0105239_10011662	3300010375	Bacteria	9810
284	Ga0105239_10028219	3300010375	Bacteria	6174
285	Ga0105239_10037516	3300010375	Bacteria	5310
286	Ga0105239_10051508	3300010375	Bacteria	4513
287	Ga0105239_10058071	3300010375	Bacteria	4245
288	Ga0105239_10483861	3300010375	Bacteria	1406
289	Ga0105246_10006848	3300011119	Bacteria	6970
290	Ga0105246_10019968	3300011119	Bacteria	4293
291	Ga0105246_10031877	3300011119	Bacteria	3491
292	Ga0105246_10035944	3300011119	Bacteria	3315
293	Ga0105246_10059559	3300011119	Bacteria	2650
294	Ga0105246_10098707	3300011119	Bacteria	2122
295	Ga0157345_1000313	3300012498	Bacteria	6192
296	Ga0157373_10013085	3300013100	Bacteria	6089
297	Ga0157373_10017472	3300013100	Bacteria	5224
298	Ga0157373_10053162	3300013100	Bacteria	2880
299	Ga0157373_10055121	3300013100	Bacteria	2824
300	Ga0157373_10059368	3300013100	Bacteria	2710
301	Ga0157373_10069451	3300013100	Bacteria	2491
302	Ga0157373_10073727	3300013100	Bacteria	2408
303	Ga0157373_10074182	3300013100	Bacteria	2400
304	Ga0157373_10077737	3300013100	Bacteria	2341
305	Ga0157373_10077887	3300013100	Bacteria	2339
306	Ga0157373_10093958	3300013100	Bacteria	2112
307	Ga0157371_10010968	3300013102	Bacteria	7023
308	Ga0157371_10013341	3300013102	Bacteria	6247
309	Ga0157371_10031628	3300013102	Bacteria	3813
310	Ga0157370_10021210	3300013104	Bacteria	6477
311	Ga0157370_10046488	3300013104	Bacteria	4161
312	Ga0157370_10088370	3300013104	Bacteria	2910
313	Ga0157370_10140117	3300013104	Bacteria	2253
314	Ga0157370_10344520	3300013104	Bacteria	1374
315	Ga0157369_10046843	3300013105	Bacteria	4698
316	Ga0157369_10071871	3300013105	Bacteria	3713
317	Ga0157369_10091976	3300013105	Bacteria	3237
318	Ga0157369_10191438	3300013105	Bacteria	2149
319	Ga0157378_10017744	3300013297	Bacteria	6249
320	Ga0157378_10018043	3300013297	Bacteria	6196
321	Ga0163162_10027887	3300013306	Bacteria	5585
322	Ga0163162_10057535	3300013306	Unclassified	3916
323	Ga0163162_10071260	3300013306	Bacteria	3528
324	Ga0163162_10105479	3300013306	Bacteria	2913
325	Ga0157372_10074657	3300013307	Bacteria	3824
326	Ga0157375_10051881	3300013308	Bacteria	4030
327	Ga0157375_10157882	3300013308	Bacteria	2408
328	Ga0157375_10161590	3300013308	Bacteria	2382
329	Ga0157375_10198054	3300013308	Bacteria	2164
330	Ga0157375_10465470	3300013308	Bacteria	1430
331	Ga0163163_10074657	3300014325	Bacteria	3383
332	Ga0157380_10009376	3300014326	Bacteria	7010
333	Ga0182008_10000118	3300014497	Bacteria	59429
334	Ga0182008_10004546	3300014497	Bacteria	8094
335	Ga0182008_10012781	3300014497	Bacteria	4426
336	Ga0182008_10013518	3300014497	Bacteria	4292
337	Ga0182008_10015320	3300014497	Bacteria	4002
338	Ga0182008_10015537	3300014497	Bacteria	3970
339	Ga0182008_10041546	3300014497	Bacteria	2294
340	Ga0182008_10048088	3300014497	Bacteria	2118
341	Ga0182008_10122169	3300014497	Bacteria	1295
342	Ga0157379_10207440	3300014968	Bacteria	1773
343	Ga0157376_10003956	3300014969	Bacteria	10251
344	Ga0157376_10242683	3300014969	Bacteria	1679
345	Ga0182006_1004584	3300015261	Bacteria	6788
346	Ga0182006_1005243	3300015261	Bacteria	6205
347	Ga0182006_1008050	3300015261	Bacteria	4788
348	Ga0182006_1009122	3300015261	Bacteria	4459
349	Ga0182006_1015792	3300015261	Bacteria	3230
350	Ga0182006_1071688	3300015261	Bacteria	1283
351	Ga0182007_10006325	3300015262	Bacteria	5094
352	Ga0182005_1008720	3300015265	Bacteria	2977
353	Ga0182005_1012383	3300015265	Bacteria	2411
354	Ga0182005_1013939	3300015265	Bacteria	2256
355	Ga0183362_10009	3300015683	Bacteria	154236
356	Ga0163161_10004717	3300017792	Bacteria	9480
357	Ga0163161_10005146	3300017792	Bacteria	9094
358	Ga0163161_10018973	3300017792	Bacteria	4821
359	Ga0163161_10079763	3300017792	Bacteria	2408
360	Ga0163161_10084671	3300017792	Bacteria	2338
361	Ga0163161_10101313	3300017792	Bacteria	2144
362	Ga0163161_10123266	3300017792	Bacteria	1949
363	Ga0163161_10129480	3300017792	Bacteria	1902
364	Ga0163161_10135634	3300017792	Bacteria	1860
365	Ga0213872_10000052	3300021361	Bacteria	106278
366	Ga0213872_10000094	3300021361	Bacteria	82769
367	Ga0213872_10000146	3300021361	Bacteria	64624
368	Ga0213872_10000918	3300021361	Bacteria	20961
369	Ga0213872_10009810	3300021361	Bacteria	4576
370	Ga0213872_10083774	3300021361	Bacteria	1431
371	Ga0213876_10096573	3300021384	Bacteria	1565
372	Ga0224712_10005870	3300022467	Bacteria	3459
373	Ga0209435_100001	3300025206	Bacteria	1424171
374	Ga0209760_100085	3300025207	Bacteria	74397
375	Ga0209760_100408	3300025207	Bacteria	10541
376	Ga0209784_100050	3300025224	Bacteria	191780
377	Ga0209566_100063	3300025225	Bacteria	191780
378	Ga0209674_100084	3300025226	Bacteria	191780
379	Ga0209147_100083	3300025229	Bacteria	191212
380	Ga0209563_100084	3300025230	Bacteria	191780
381	Ga0209563_100623	3300025230	Bacteria	11450
382	Ga0207427_100007	3300025231	Bacteria	746220
383	Ga0207427_100038	3300025231	Bacteria	292975
384	Ga0209437_100006	3300025233	Bacteria	1042724
385	Ga0209437_100009	3300025233	Bacteria	915954
386	Ga0209258_100113	3300025242	Bacteria	191178
387	Ga0207425_1004215	3300025245	Bacteria	4368
388	Ga0209646_1000001	3300025246	Bacteria	3092932
389	Ga0209646_1000302	3300025246	Bacteria	40042
390	Ga0209026_1000003	3300025250	Bacteria	1060571
391	Ga0209677_100047	3300025253	Bacteria	191780
392	Ga0209759_1000001	3300025256	Bacteria	2799452
393	Ga0209759_1004130	3300025256	Bacteria	5536
394	Ga0209233_1000059	3300025261	Bacteria	414562
395	Ga0209233_1000074	3300025261	Bacteria	357367
396	Ga0209233_1000155	3300025261	Bacteria	167981
397	Ga0209565_1000070	3300025263	Bacteria	168957
398	Ga0209565_1000418	3300025263	Bacteria	34964
399	Ga0209673_1000234	3300025273	Bacteria	107514
400	Ga0209673_1014753	3300025273	Bacteria	3010
401	Ga0209130_1000050	3300025284	Bacteria	222092
402	Ga0209130_1002622	3300025284	Bacteria	8657
403	Ga0209675_1000069	3300025291	Bacteria	170538
404	Ga0209675_1000643	3300025291	Bacteria	24820
405	Ga0209675_1004382	3300025291	Bacteria	6294
406	Ga0209675_1005889	3300025291	Bacteria	5029
407	Ga0209676_1000006	3300025292	Bacteria	1039588
408	Ga0209676_1000010	3300025292	Bacteria	954025
409	Ga0209676_1000376	3300025292	Bacteria	82203
410	Ga0209676_1001281	3300025292	Bacteria	26028
411	Ga0209676_1002525	3300025292	Bacteria	12767
412	Ga0209676_1002985	3300025292	Bacteria	11008
413	Ga0209676_1006892	3300025292	Bacteria	5490
414	Ga0209676_1008984	3300025292	Bacteria	4377
415	Ga0209676_1009706	3300025292	Bacteria	4118
416	Ga0209676_1033370	3300025292	Bacteria	1534
417	Ga0209025_1000113	3300025294	Bacteria	218943
418	Ga0209025_1001851	3300025294	Bacteria	24838
419	Ga0209025_1041557	3300025294	Bacteria	1967
420	Ga0209025_1049694	3300025294	Bacteria	1684
421	Ga0209050_1000019	3300025298	Bacteria	608757
422	Ga0209050_1000027	3300025298	Bacteria	483261
423	Ga0209050_1000494	3300025298	Bacteria	67818
424	Ga0209050_1002573	3300025298	Bacteria	15095
425	Ga0209050_1007216	3300025298	Bacteria	6310
426	Ga0209050_1014545	3300025298	Bacteria	3380
427	Ga0209256_1002634	3300025299	Bacteria	14142
428	Ga0207426_1000071	3300025302	Bacteria	329539
429	Ga0207426_1015277	3300025302	Bacteria	2788
430	Ga0209051_1000102	3300025303	Bacteria	162911
431	Ga0209051_1000356	3300025303	Bacteria	67818
432	Ga0209051_1000367	3300025303	Bacteria	65677
433	Ga0209051_1000383	3300025303	Bacteria	62847
434	Ga0209051_1000506	3300025303	Bacteria	49427
435	Ga0209051_1000975	3300025303	Bacteria	27889
436	Ga0209051_1008938	3300025303	Bacteria	5231
437	Ga0209051_1011394	3300025303	Bacteria	4392
438	Ga0209257_1000012	3300025304	Bacteria	1111138
439	Ga0209257_1000357	3300025304	Bacteria	93431
440	Ga0209257_1006431	3300025304	Bacteria	7573
441	Ga0209257_1008166	3300025304	Bacteria	6061
442	Ga0207696_1000052	3300025711	Bacteria	272880
443	Ga0207696_1000054	3300025711	Bacteria	266962
444	Ga0207696_1000213	3300025711	Bacteria	87128
445	Ga0207696_1003518	3300025711	Bacteria	7082
446	Ga0207696_1006973	3300025711	Bacteria	4477
447	Ga0207696_1016721	3300025711	Bacteria	2447
448	Ga0207696_1025093	3300025711	Bacteria	1862
449	Ga0207655_1003610	3300025728	Bacteria	11441
450	Ga0207655_1003693	3300025728	Bacteria	11274
451	Ga0207655_1007731	3300025728	Bacteria	6934
452	Ga0207655_1014269	3300025728	Bacteria	4502
453	Ga0207655_1021841	3300025728	Bacteria	3231
454	Ga0207655_1028430	3300025728	Bacteria	2638
455	Ga0207655_1028973	3300025728	Bacteria	2601
456	Ga0207655_1030543	3300025728	Bacteria	2504
457	Ga0207655_1037648	3300025728	Bacteria	2127
458	Ga0207713_1000013	3300025735	Bacteria	475751
459	Ga0207713_1010035	3300025735	Bacteria	5280
460	Ga0207713_1011872	3300025735	Bacteria	4700
461	Ga0207713_1025915	3300025735	Bacteria	2697
462	Ga0207713_1029894	3300025735	Bacteria	2433
463	Ga0207713_1030331	3300025735	Bacteria	2409
464	Ga0207653_10004328	3300025885	Bacteria	4462
465	Ga0207692_10006623	3300025898	Bacteria	4707
466	Ga0207710_10000929	3300025900	Bacteria	15612
467	Ga0207688_10003465	3300025901	Bacteria	8609
468	Ga0207680_10064388	3300025903	Bacteria	2247
469	Ga0207647_10006579	3300025904	Bacteria	8442
470	Ga0207647_10099355	3300025904	Bacteria	1728
471	Ga0207647_10148515	3300025904	Bacteria	1371
472	Ga0207645_10056064	3300025907	Bacteria	2516
473	Ga0207645_10076737	3300025907	Bacteria	2140
474	Ga0207684_10098803	3300025910	Bacteria	2493
475	Ga0207684_10139138	3300025910	Bacteria	2086
476	Ga0207654_10017811	3300025911	Bacteria	3721
477	Ga0207654_10111953	3300025911	Bacteria	1700
478	Ga0207707_10052071	3300025912	Bacteria	3565
479	Ga0207671_10000295	3300025914	Bacteria	73382
480	Ga0207671_10021914	3300025914	Bacteria	4840
481	Ga0207671_10157044	3300025914	Bacteria	1760
482	Ga0207693_10068379	3300025915	Bacteria	2780
483	Ga0207663_10102138	3300025916	Bacteria	1928
484	Ga0207657_10020579	3300025919	Bacteria	6231
485	Ga0207657_10080794	3300025919	Bacteria	2732
486	Ga0207657_10258386	3300025919	Bacteria	1387
487	Ga0207649_10020234	3300025920	Bacteria	3814
488	Ga0207649_10026837	3300025920	Bacteria	3373
489	Ga0207652_10060219	3300025921	Bacteria	3275
490	Ga0207681_10117514	3300025923	Bacteria	1945
491	Ga0207681_10138791	3300025923	Bacteria	1808
492	Ga0207694_10012539	3300025924	Bacteria	6390
493	Ga0207694_10015367	3300025924	Bacteria	5774
494	Ga0207694_10067030	3300025924	Bacteria	2802
495	Ga0207650_10000575	3300025925	Bacteria	29658
496	Ga0207700_10020622	3300025928	Bacteria	4481
497	Ga0207664_10024049	3300025929	Bacteria	4574
498	Ga0207664_10215329	3300025929	Bacteria	1664
499	Ga0207644_10098875	3300025931	Bacteria	2188
500	Ga0207690_10100236	3300025932	Bacteria	2067
501	Ga0207706_10013343	3300025933	Bacteria	7473
502	Ga0207706_10018193	3300025933	Bacteria	6322
503	Ga0207706_10027670	3300025933	Bacteria	5069
504	Ga0207686_10000422	3300025934	Bacteria	28890
505	Ga0207709_10000224	3300025935	Bacteria	71687
506	Ga0207709_10000259	3300025935	Bacteria	63214
507	Ga0207709_10002095	3300025935	Bacteria	12847
508	Ga0207709_10052206	3300025935	Bacteria	2510
509	Ga0207709_10070423	3300025935	Bacteria	2218
510	Ga0207709_10089043	3300025935	Bacteria	2011
511	Ga0207669_10068168	3300025937	Bacteria	2221
512	Ga0207665_10036669	3300025939	Bacteria	3262
513	Ga0207711_10074730	3300025941	Bacteria	2948
514	Ga0207711_10104954	3300025941	Bacteria	2505
515	Ga0207689_10008566	3300025942	Bacteria	8912
516	Ga0207667_10039611	3300025949	Bacteria	5022
517	Ga0207667_10048683	3300025949	Bacteria	4480
518	Ga0207667_10056651	3300025949	Bacteria	4117
519	Ga0207667_10118152	3300025949	Bacteria	2733
520	Ga0207667_10142833	3300025949	Bacteria	2465
521	Ga0207651_10123234	3300025960	Bacteria	1970
522	Ga0207712_10000615	3300025961	Bacteria	28133
523	Ga0207712_10103052	3300025961	Bacteria	2126
524	Ga0207712_10221159	3300025961	Bacteria	1514
525	Ga0207668_10012628	3300025972	Bacteria	5177
526	Ga0207640_10049644	3300025981	Bacteria	2718
527	Ga0207658_10165783	3300025986	Bacteria	1815
528	Ga0207658_10263303	3300025986	Bacteria	1470
529	Ga0207677_10010989	3300026023	Bacteria	5143
530	Ga0207703_10005208	3300026035	Bacteria	10509
531	Ga0207703_10071366	3300026035	Bacteria	2868
532	Ga0207639_10148435	3300026041	Bacteria	1961
533	Ga0207639_10149851	3300026041	Bacteria	1953
534	Ga0207678_10002939	3300026067	Bacteria	15441
535	Ga0207678_10036589	3300026067	Bacteria	4273
536	Ga0207678_10090542	3300026067	Bacteria	2614
537	Ga0207708_10055402	3300026075	Bacteria	3023
538	Ga0207708_10109741	3300026075	Bacteria	2141
539	Ga0207641_10013381	3300026088	Bacteria	6728
540	Ga0207648_10007662	3300026089	Bacteria	10568
541	Ga0207648_10135581	3300026089	Bacteria	2168
542	Ga0207676_10049626	3300026095	Bacteria	3266
543	Ga0207674_10077343	3300026116	Bacteria	3333
544	Ga0207674_10167153	3300026116	Bacteria	2153
545	Ga0207674_10403555	3300026116	Bacteria	1321
546	Ga0207675_100007150	3300026118	Bacteria	10547
547	Ga0207675_100062183	3300026118	Bacteria	3486
548	Ga0207675_100089155	3300026118	Bacteria	2898
549	Ga0207675_100310072	3300026118	Bacteria	1539
550	Ga0207683_10004481	3300026121	Bacteria	12058
551	Ga0207683_10019750	3300026121	Bacteria	5756
552	Ga0207683_10033130	3300026121	Bacteria	4487
553	Ga0207683_10047584	3300026121	Bacteria	3756
554	Ga0207698_10028300	3300026142	Bacteria	3994
555	Ga0207698_10335607	3300026142	Bacteria	1422
556	Ga0209281_1000015	3300027111	Bacteria	590084
557	Ga0209281_1000228	3300027111	Bacteria	118988
558	Ga0209281_1007083	3300027111	Bacteria	2839
559	Ga0209981_1002891	3300027378	Bacteria	2207
560	Ga0209179_1002693	3300027512	Bacteria	2446
561	Ga0209179_1002990	3300027512	Bacteria	2371
562	Ga0209282_1000561	3300027666	Bacteria	18044
563	Ga0209588_1001992	3300027671	Bacteria	5489
564	Ga0209588_1005473	3300027671	Bacteria	3644
565	Ga0209588_1012327	3300027671	Bacteria	2594
566	Ga0209813_10024784	3300027866	Bacteria	1719
567	Ga0207428_10000407	3300027907	Bacteria	53529
568	Ga0207428_10046285	3300027907	Bacteria	3499
569	Ga0207428_10094763	3300027907	Bacteria	2313
570	Ga0207428_10097940	3300027907	Bacteria	2270
571	Ga0268266_10016663	3300028379	Bacteria	6279
572	Ga0268266_10016765	3300028379	Bacteria	6261
573	Ga0268266_10043060	3300028379	Bacteria	3857
574	Ga0268266_10083205	3300028379	Bacteria	2793
575	Ga0268265_10185946	3300028380	Bacteria	1789
576	Ga0268264_10000860	3300028381	Bacteria	32169
577	Ga0268264_10009372	3300028381	Bacteria	8103
578	Ga0268264_10017159	3300028381	Bacteria	5928
579	Ga0268264_10041558	3300028381	Bacteria	3804
580	Ga0265334_10031233	3300028573	Bacteria	2129
581	Ga0307515_10000651	3300028794	Bacteria	80257
582	Ga0307515_10021511	3300028794	Bacteria	11431
583	Ga0307515_10077307	3300028794	Bacteria	4398
584	Ga0307511_10000022	3300030521	Bacteria	116875
585	Ga0307511_10000355	3300030521	Bacteria	48642
586	Ga0307511_10081071	3300030521	Bacteria	2281
587	Ga0307511_10170050	3300030521	Bacteria	1200
588	Ga0316177_1002614	3300030731	Bacteria	3613
589	Ga0316177_1165457	3300030731	Bacteria	1619
590	Ga0316176_1145635	3300030732	Bacteria	2577
591	Ga0314311_1019612	3300030733	Bacteria	3806
592	Ga0314311_1084958	3300030733	Bacteria	7213
593	Ga0316178_1061339	3300030735	Bacteria	40218
594	Ga0316183_1093439	3300030742	Bacteria	4401
595	Ga0316183_1162789	3300030742	Bacteria	3297
596	Ga0316183_1174315	3300030742	Bacteria	2125
597	Ga0316181_1090505	3300030744	Bacteria	3179
598	Ga0265330_10000116	3300031235	Bacteria	64622
599	Ga0265332_10000003	3300031238	Bacteria	482849
600	Ga0265332_10000012	3300031238	Bacteria	272641
601	Ga0265332_10000033	3300031238	Bacteria	153334
602	Ga0265325_10007177	3300031241	Bacteria	6702
603	Ga0265340_10056000	3300031247	Bacteria	1898
604	Ga0265331_10000006	3300031250	Bacteria	418907
605	Ga0265327_10000001	3300031251	Bacteria	894475
606	Ga0265327_10000049	3300031251	Bacteria	268046
607	Ga0265327_10000798	3300031251	Bacteria	48300
608	Ga0265327_10044922	3300031251	Bacteria	2351
609	Ga0307513_10000014	3300031456	Bacteria	303157
610	Ga0307513_10000019	3300031456	Bacteria	231194
611	Ga0307513_10012715	3300031456	Bacteria	10366
612	Ga0307513_10019068	3300031456	Bacteria	8177
613	Ga0307513_10147427	3300031456	Bacteria	2269
614	Ga0307513_10148518	3300031456	Bacteria	2258
615	Ga0307513_10176591	3300031456	Bacteria	2005
616	Ga0307509_10071671	3300031507	Bacteria	3613
617	Ga0307509_10179427	3300031507	Bacteria	1985
618	Ga0307408_100000020	3300031548	Bacteria	340408
619	Ga0307408_100011048	3300031548	Bacteria	5959
620	Ga0307408_100024832	3300031548	Bacteria	4097
621	Ga0307408_100035977	3300031548	Bacteria	3477
622	Ga0307408_100044323	3300031548	Bacteria	3169
623	Ga0307408_100075697	3300031548	Bacteria	2501
624	Ga0307408_100080766	3300031548	Bacteria	2429
625	Ga0307408_100150165	3300031548	Bacteria	1838
626	Ga0307408_100278762	3300031548	Bacteria	1391
627	Ga0307408_100295096	3300031548	Bacteria	1355
628	Ga0307508_10112483	3300031616	Bacteria	2323
629	Ga0307514_10001125	3300031649	Bacteria	37028
630	Ga0307514_10008781	3300031649	Bacteria	8559
631	Ga0307514_10106507	3300031649	Bacteria	1999
632	Ga0316575_10000138	3300031665	Bacteria	18312
633	Ga0316575_10029883	3300031665	Bacteria	2129
634	Ga0316579_10025936	3300031691	Bacteria	2649
635	Ga0316579_10027749	3300031691	Unclassified	2573
636	Ga0316579_10030600	3300031691	Bacteria	2461
637	Ga0265314_10000029	3300031711	Bacteria	272506
638	Ga0265314_10005268	3300031711	Bacteria	11703
639	Ga0265314_10024671	3300031711	Bacteria	4554
640	Ga0265314_10034512	3300031711	Bacteria	3698
641	Ga0316576_10000111	3300031727	Bacteria	30423
642	Ga0316576_10004205	3300031727	Bacteria	8597
643	Ga0316576_10037777	3300031727	Bacteria	3459
644	Ga0316576_10090890	3300031727	Bacteria	2274
645	Ga0316576_10161610	3300031727	Bacteria	1689
646	Ga0316578_10002226	3300031728	Bacteria	8394
647	Ga0316578_10033864	3300031728	Bacteria	2930
648	Ga0316578_10077036	3300031728	Bacteria	1980
649	Ga0307516_10006735	3300031730	Bacteria	13430
650	Ga0307516_10043969	3300031730	Bacteria	4423
651	Ga0307405_10002086	3300031731	Bacteria	8717
652	Ga0307405_10004473	3300031731	Bacteria	6609
653	Ga0307405_10015127	3300031731	Bacteria	4169
654	Ga0307405_10032537	3300031731	Bacteria	3083
655	Ga0307405_10077115	3300031731	Bacteria	2164
656	Ga0316577_10062893	3300031733	Bacteria	2072
657	Ga0316577_10074258	3300031733	Bacteria	1899
658	Ga0307413_10004156	3300031824	Bacteria	6249
659	Ga0307413_10057078	3300031824	Bacteria	2385
660	Ga0307518_10131298	3300031838	Bacteria	1760
661	Ga0307410_10001553	3300031852	Bacteria	10471
662	Ga0307406_10000178	3300031901	Bacteria	38000
663	Ga0307406_10000505	3300031901	Bacteria	22399
664	Ga0307406_10008832	3300031901	Bacteria	5632
665	Ga0307406_10248885	3300031901	Bacteria	1337
666	Ga0307407_10003421	3300031903	Bacteria	6503
667	Ga0307407_10062192	3300031903	Bacteria	2185
668	Ga0307407_10094250	3300031903	Bacteria	1843
669	Ga0307412_10002073	3300031911	Bacteria	11130
670	Ga0307412_10031473	3300031911	Bacteria	3351
671	Ga0307412_10054709	3300031911	Bacteria	2650
672	Ga0307412_10061526	3300031911	Bacteria	2524
673	Ga0307412_10072118	3300031911	Bacteria	2359
674	Ga0307412_10086868	3300031911	Bacteria	2177
675	Ga0307412_10100552	3300031911	Bacteria	2044
676	Ga0307409_100000015	3300031995	Bacteria	61871
677	Ga0307409_100035588	3300031995	Bacteria	3651
678	Ga0307409_100047441	3300031995	Bacteria	3260
679	Ga0307416_100000138	3300032002	Bacteria	42771
680	Ga0307414_10037379	3300032004	Bacteria	3250
681	Ga0307414_10120348	3300032004	Bacteria	2017
682	Ga0307414_10146213	3300032004	Bacteria	1857
683	Ga0307411_10042190	3300032005	Bacteria	2908
684	Ga0307411_10123617	3300032005	Bacteria	1877
685	Ga0307415_100001768	3300032126	Bacteria	10562
686	Ga0307415_100048368	3300032126	Bacteria	2870
687	Ga0316583_10005041	3300032133	Bacteria	4728
688	Ga0316583_10033410	3300032133	Bacteria	1827
689	Ga0316583_10045324	3300032133	Bacteria	1553
690	Ga0316580_10007364	3300032139	Bacteria	3276
691	Ga0316593_10015135	3300032168	Bacteria	2316
692	Ga0307507_10000090	3300033179	Bacteria	142457
693	Ga0307510_10000009	3300033180	Bacteria	409702
694	Ga0307510_10016374	3300033180	Bacteria	8750
695	Ga0307510_10030629	3300033180	Bacteria	6096
696	Ga0316592_1009497	3300033524	Bacteria	1948
697	Ga0316586_1004284	3300033527	Bacteria	1937
698	Ga0316586_1007462	3300033527	Bacteria	1595
699	Ga0316587_1004502	3300033529	Bacteria	2032
700	Ga0316587_1016477	3300033529	Bacteria	1233
701	Ga0316596_1010863	3300033541	Bacteria	2214
702	Ga0316596_1020885	3300033541	Bacteria	1667
703	Ga0373944_0003538	3300035089	Bacteria	4039
704	Ga0373936_0018269	3300035113	Bacteria	2706
705	Ga0373945_0000855	3300035116	Bacteria	8962
706	Ga0373954_0042059	3300035118	Bacteria	2131
707	Ga0373943_0002078	3300035170	Bacteria	9090
708	Ga0373946_0004768	3300035171	Bacteria	4878
709	Ga0373942_0004061	3300035207	Bacteria	3416
710	Ga0316574_0003852	3300035398	Bacteria	7796
711	Ga0316574_0006709	3300035398	Bacteria	6248
712	Ga0316574_0025896	3300035398	Bacteria	3524
713	Ga0316574_0077729	3300035398	Bacteria	2103
714	Ga0373924_0009036	3300035410	Bacteria	3644
715	Ga0373935_0016263	3300035692	Bacteria	4503
716	Ga0373927_0003917	3300035695	Bacteria	10551
717	Ga0373927_0149454	3300035695	Bacteria	1530
718	Ga0373947_0078367	3300035725	Bacteria	2039
719	Ga0373937_0013115	3300036401	Bacteria	7299
720	Ga0316582_0000873	3300036647	Bacteria	12317
721	Ga0316582_0016084	3300036647	Bacteria	4295
722	Ga0316582_0043181	3300036647	Bacteria	2827
723	Ga0316584_0008780	3300036712	Bacteria	6980
724	Ga0316584_0032725	3300036712	Bacteria	3849
725	Ga0316584_0099844	3300036712	Bacteria	2173
726	Ga0316584_0151414	3300036712	Bacteria	1727
727	Ga0373925_0003143	3300037068	Bacteria	12957
728	Ga0373925_0004751	3300037068	Bacteria	10231
729	Ga0395899_0012444	3300037312	Bacteria	6518
730	Ga0395899_0139380	3300037312	Bacteria	1727
731	Ga0395900_0007913	3300037418	Bacteria	10946
732	Ga0395900_0058978	3300037418	Bacteria	3951
733	Ga0395900_0245020	3300037418	Bacteria	1796
734	Ga0395900_0290311	3300037418	Bacteria	1624
735	Ga0395900_0324384	3300037418	Bacteria	1519
736	Ga0395898_0008707	3300037466	Bacteria	10706
737	Ga0395898_0041290	3300037466	Bacteria	4557
738	Ga0395898_0087958	3300037466	Bacteria	2992
739	Ga0395905_0000421	3300037471	Bacteria	59264
740	Ga0395905_0006752	3300037471	Bacteria	11492
741	Ga0395905_0074312	3300037471	Bacteria	3185
742	Ga0395905_0152648	3300037471	Bacteria	2172
743	Ga0436364_0049303	3300037853	Bacteria	3274
744	Ga0395901_0016740	3300038443	Bacteria	7470
745	Ga0395901_0120638	3300038443	Bacteria	2755
746	Ga0395901_0207423	3300038443	Bacteria	2052
747	Ga0400490_03855	3300038726	Bacteria	16037
748	Ga0400483_017318	3300039062	Bacteria	2209
749	Ga0400483_101085	3300039062	Bacteria	2068
750	Ga0400483_147535	3300039062	Bacteria	2801
751	Ga0400483_268849	3300039062	Bacteria	1271
752	Ga0436360_1263943	3300039438	Bacteria	1862
753	Ga0436361_0160207	3300039447	Bacteria	1369
754	Ga0436361_0200270	3300039447	Bacteria	32952
755	Ga0436361_0442101	3300039447	Bacteria	6881
756	Ga0436361_0544128	3300039447	Bacteria	1689
757	Ga0436361_0572917	3300039447	Bacteria	1843
758	Ga0436361_1148233	3300039447	Bacteria	10382
759	Ga0439436_0000138	3300041404	Bacteria	16615
760	Ga0439436_0001818	3300041404	Bacteria	6278
761	Ga0439438_001842	3300041405	Bacteria	9282
762	Ga0439438_001948	3300041405	Bacteria	9012
763	Ga0439438_002481	3300041405	Bacteria	7845
764	Ga0439438_006466	3300041405	Bacteria	4125
765	Ga0439438_007515	3300041405	Bacteria	3719
766	Ga0439438_010612	3300041405	Bacteria	2903
767	Ga0439438_012365	3300041405	Bacteria	2619
768	Ga0439438_014653	3300041405	Bacteria	2328
769	Ga0439438_019261	3300041405	Bacteria	1930
770	Ga0439438_022238	3300041405	Bacteria	1760
771	Ga0439438_022371	3300041405	Bacteria	1754
772	Ga0439447_001126	3300041407	Bacteria	9721
773	Ga0439447_006157	3300041407	Bacteria	3917
774	Ga0439447_006722	3300041407	Bacteria	3702
775	Ga0439447_017208	3300041407	Bacteria	1970
776	Ga0439466_0001318	3300041411	Bacteria	9674
777	Ga0439466_0001689	3300041411	Bacteria	8615
778	Ga0439466_0005601	3300041411	Bacteria	4792
779	Ga0439466_0007320	3300041411	Bacteria	4181
780	Ga0439466_0013558	3300041411	Bacteria	2983
781	Ga0439466_0013846	3300041411	Bacteria	2947
782	Ga0439466_0014258	3300041411	Bacteria	2897
783	Ga0439466_0030847	3300041411	Bacteria	1836
784	Ga0439466_0031853	3300041411	Bacteria	1801
785	Ga0451791_0140369	3300041451	Bacteria	1463
786	Ga0451853_2692520	3300041512	Bacteria	3798
787	Ga0451853_3310022	3300041512	Bacteria	1625
788	Ga0439442_001679	3300042002	Bacteria	4344
789	Ga0439442_003187	3300042002	Bacteria	3246
790	Ga0439442_005695	3300042002	Bacteria	2495
791	Ga0439442_007164	3300042002	Bacteria	2242
792	Ga0439445_0001026	3300042004	Bacteria	5950
793	Ga0439448_0056989	3300042005	Bacteria	1287
794	Ga0439432_014042	3300042006	Bacteria	2713
795	Ga0439432_015231	3300042006	Bacteria	2597
796	Ga0439432_020579	3300042006	Bacteria	2191
797	Ga0439432_050335	3300042006	Bacteria	1300
798	Ga0439449_0004493	3300042007	Bacteria	5389
799	Ga0439449_0004625	3300042007	Bacteria	5316
800	Ga0439451_005260	3300042009	Bacteria	2635
801	Ga0439452_001086	3300042010	Bacteria	11983
802	Ga0439452_002005	3300042010	Bacteria	7790
803	Ga0439452_005451	3300042010	Bacteria	4093
804	Ga0439452_020021	3300042010	Bacteria	1760
805	Ga0439456_001525	3300042013	Bacteria	4665
806	Ga0439456_021075	3300042013	Bacteria	1377
807	Ga0439463_003818	3300042016	Bacteria	3799
808	Ga0439463_006913	3300042016	Bacteria	2798
809	Ga0450911_000723	3300042115	Bacteria	9607
810	Ga0450911_002416	3300042115	Bacteria	3667
811	Ga0450920_003684	3300042122	Bacteria	2664
812	Ga0450920_021789	3300042122	Bacteria	1240
813	Ga0450922_001378	3300042124	Bacteria	2390
814	Ga0450890_004121	3300042127	Bacteria	1909
815	Ga0450898_008554	3300042134	Bacteria	1618
816	Ga0450903_002198	3300042138	Bacteria	3484
817	Ga0450903_003627	3300042138	Bacteria	2665
818	Ga0450906_001427	3300042145	Bacteria	5200
819	Ga0450906_002475	3300042145	Bacteria	4041
820	Ga0450907_004153	3300042146	Bacteria	2507
821	Ga0450907_006980	3300042146	Bacteria	1883
822	Ga0450907_010887	3300042146	Bacteria	1510
823	Ga0450908_000493	3300042184	Bacteria	7592
824	Ga0450908_002247	3300042184	Bacteria	3773
825	Ga0450908_005161	3300042184	Bacteria	2504
826	Ga0450908_006674	3300042184	Bacteria	2184
827	Ga0439434_0006636	3300042435	Bacteria	3384
828	Ga0439434_0022258	3300042435	Bacteria	1905
829	Ga0439435_0000022	3300042436	Bacteria	17156
830	Ga0439435_0022174	3300042436	Bacteria	1656
831	Ga0439464_0004446	3300042439	Bacteria	3589
832	Ga0439464_0007291	3300042439	Bacteria	2890
833	Ga0439464_0029767	3300042439	Bacteria	1526
834	Ga0450918_001411	3300042531	Bacteria	4777
835	Ga0451577_0187857	3300042876	Bacteria	1863
836	Ga0466969_0030782	3300044656	Bacteria	2733
837	Ga0453683_0012491	3300044673	Bacteria	5565
838	Ga0453683_0025390	3300044673	Bacteria	3766
839	Ga0453683_0034078	3300044673	Bacteria	3210
840	Ga0466965_0000307	3300044683	Bacteria	16337
841	Ga0466965_0008582	3300044683	Bacteria	4728
842	Ga0466966_0000823	3300044684	Bacteria	19761
843	Ga0466966_0113694	3300044684	Bacteria	1667
844	Ga0466961_0002256	3300044693	Bacteria	11971
845	Ga0466961_0007903	3300044693	Bacteria	6777
846	Ga0466961_0013122	3300044693	Bacteria	5300
847	Ga0466961_0020864	3300044693	Bacteria	4215
848	Ga0466963_0000120	3300044694	Bacteria	29251
849	Ga0466963_0113056	3300044694	Bacteria	1865
850	Ga0466964_0008855	3300044706	Bacteria	3783
851	Ga0453684_0155070	3300044712	Bacteria	2716
852	Ga0453684_0251482	3300044712	Bacteria	2029
853	Ga0466971_0000158	3300044719	Bacteria	25444
854	Ga0466971_0004232	3300044719	Bacteria	6185
855	Ga0466971_0047759	3300044719	Bacteria	1924
856	Ga0466970_0000653	3300044765	Bacteria	17057
857	Ga0466970_0032783	3300044765	Bacteria	2745
858	Ga0466970_0107638	3300044765	Bacteria	1521
859	Ga0466957_0000565	3300044842	Bacteria	18681
860	Ga0466960_0000375	3300044901	Bacteria	15277
861	Ga0466959_0003565	3300045049	Bacteria	10239
862	Ga0466959_0209940	3300045049	Bacteria	1353
863	Ga0451576_0000492	3300045051	Bacteria	87364
864	Ga0451576_0008715	3300045051	Bacteria	11870
865	Ga0451576_0342005	3300045051	Bacteria	1566
866	Ga0466958_0000064	3300045836	Bacteria	31891
867	Ga0466958_0059251	3300045836	Bacteria	2329
868	Ga0466958_0148066	3300045836	Bacteria	1480
869	Ga0466967_0000207	3300045976	Bacteria	24750
870	Ga0466967_0069371	3300045976	Bacteria	3150
871	Ga0495617_000419	3300046452	Bacteria	23175
872	Ga0495617_010992	3300046452	Bacteria	3093
873	Ga0495617_011341	3300046452	Bacteria	3040
874	Ga0495617_045579	3300046452	Bacteria	1461
875	Ga0495627_004232	3300046453	Bacteria	6063
876	Ga0495627_009904	3300046453	Bacteria	3488
877	Ga0495627_015563	3300046453	Bacteria	2623
878	Ga0495627_016444	3300046453	Bacteria	2531
879	Ga0495603_0001278	3300046455	Bacteria	14649
880	Ga0495603_0053806	3300046455	Bacteria	2388
881	Ga0495603_0087552	3300046455	Bacteria	1822
882	Ga0495590_0000311	3300046457	Bacteria	25443
883	Ga0495590_0002272	3300046457	Bacteria	8021
884	Ga0495590_0017911	3300046457	Bacteria	2541
885	Ga0495590_0023350	3300046457	Bacteria	2183
886	Ga0495591_005006	3300046458	Bacteria	6251
887	Ga0495591_005182	3300046458	Bacteria	6107
888	Ga0495591_008931	3300046458	Bacteria	4040
889	Ga0495591_016701	3300046458	Bacteria	2544
890	Ga0495591_026752	3300046458	Bacteria	1787
891	Ga0495629_0001057	3300046459	Bacteria	22014
892	Ga0495638_0000690	3300046460	Bacteria	36616
893	Ga0495638_0005968	3300046460	Bacteria	8939
894	Ga0495638_0009156	3300046460	Bacteria	6964
895	Ga0495638_0021865	3300046460	Bacteria	4205
896	Ga0495638_0022412	3300046460	Bacteria	4147
897	Ga0495638_0050623	3300046460	Bacteria	2593
898	Ga0495638_0094164	3300046460	Bacteria	1800
899	Ga0495638_0125659	3300046460	Bacteria	1511
900	Ga0495638_0201175	3300046460	Bacteria	1124
901	Ga0495641_0020992	3300046461	Bacteria	3296
902	Ga0495651_0000646	3300046462	Bacteria	26896
903	Ga0495651_0120592	3300046462	Bacteria	1927
904	Ga0495653_0040212	3300046463	Bacteria	3656
905	Ga0495653_0043497	3300046463	Bacteria	3491
906	Ga0495653_0047939	3300046463	Bacteria	3301
907	Ga0495653_0065228	3300046463	Bacteria	2741
908	Ga0495653_0077378	3300046463	Bacteria	2470
909	Ga0495650_0000254	3300046471	Bacteria	103512
910	Ga0495650_0010806	3300046471	Bacteria	5063
911	Ga0495650_0015050	3300046471	Bacteria	3989
912	Ga0495650_0058664	3300046471	Bacteria	1552
913	Ga0495650_0058849	3300046471	Bacteria	1549
914	Ga0495650_0073013	3300046471	Bacteria	1341
915	Ga0495605_0000152	3300046474	Bacteria	89123
916	Ga0495605_0003305	3300046474	Bacteria	9653
917	Ga0495605_0009172	3300046474	Bacteria	5563
918	Ga0495605_0054444	3300046474	Bacteria	1937
919	Ga0495605_0056403	3300046474	Bacteria	1895
920	Ga0495639_0003410	3300046475	Bacteria	6886
921	Ga0495662_0024046	3300046476	Bacteria	2940
922	Ga0495584_0003579	3300046491	Bacteria	8482
923	Ga0495584_0011393	3300046491	Bacteria	4554
924	Ga0495584_0023705	3300046491	Bacteria	3111
925	Ga0495584_0059484	3300046491	Bacteria	1922
926	Ga0495584_0066578	3300046491	Bacteria	1811
927	Ga0495584_0072515	3300046491	Bacteria	1730
928	Ga0495584_0095164	3300046491	Bacteria	1503
929	Ga0495584_0143288	3300046491	Bacteria	1213
930	Ga0495585_0002697	3300046492	Bacteria	12444
931	Ga0495585_0004014	3300046492	Bacteria	9689
932	Ga0495585_0016536	3300046492	Bacteria	4274
933	Ga0495585_0017338	3300046492	Bacteria	4161
934	Ga0495585_0028914	3300046492	Bacteria	3158
935	Ga0495585_0049782	3300046492	Bacteria	2325
936	Ga0495585_0117920	3300046492	Bacteria	1406
937	Ga0495594_0025112	3300046499	Bacteria	3202
938	Ga0495594_0050960	3300046499	Bacteria	2278
939	Ga0495594_0056704	3300046499	Bacteria	2162
940	Ga0495596_0004342	3300046500	Bacteria	6931
941	Ga0495607_0008226	3300046501	Bacteria	7138
942	Ga0495607_0024512	3300046501	Bacteria	3760
943	Ga0495607_0032477	3300046501	Bacteria	3185
944	Ga0495607_0047283	3300046501	Bacteria	2521
945	Ga0495607_0056231	3300046501	Bacteria	2259
946	Ga0495607_0073720	3300046501	Bacteria	1896
947	Ga0495607_0099526	3300046501	Bacteria	1559
948	Ga0495607_0117212	3300046501	Bacteria	1403
949	Ga0495583_0018804	3300046506	Bacteria	3626
950	Ga0495583_0021265	3300046506	Bacteria	3342
951	Ga0495583_0024995	3300046506	Bacteria	2991
952	Ga0495583_0028527	3300046506	Bacteria	2742
953	Ga0495583_0034276	3300046506	Bacteria	2433
954	Ga0495583_0053399	3300046506	Bacteria	1834
955	Ga0495583_0083878	3300046506	Bacteria	1381
956	Ga0495606_0004950	3300046507	Bacteria	13005
957	Ga0495606_0008316	3300046507	Bacteria	9045
958	Ga0495606_0021464	3300046507	Bacteria	4729
959	Ga0495606_0025613	3300046507	Bacteria	4220
960	Ga0495606_0036586	3300046507	Bacteria	3341
961	Ga0495606_0051628	3300046507	Bacteria	2681
962	Ga0495606_0067722	3300046507	Bacteria	2259
963	Ga0495606_0071930	3300046507	Bacteria	2175
964	Ga0495606_0146951	3300046507	Bacteria	1387
965	Ga0495608_0162800	3300046511	Bacteria	1418
966	Ga0495610_0004852	3300046512	Bacteria	9782
967	Ga0495610_0023130	3300046512	Bacteria	3385
968	Ga0495610_0025046	3300046512	Bacteria	3211
969	Ga0495610_0034354	3300046512	Bacteria	2612
970	Ga0495610_0045744	3300046512	Bacteria	2164
971	Ga0495616_0002064	3300046513	Bacteria	13495
972	Ga0495616_0010258	3300046513	Bacteria	5429
973	Ga0495616_0018249	3300046513	Bacteria	3854
974	Ga0495616_0038139	3300046513	Bacteria	2468
975	Ga0495616_0057492	3300046513	Bacteria	1917
976	Ga0495616_0061435	3300046513	Bacteria	1842
977	Ga0495620_0013582	3300046515	Bacteria	4165
978	Ga0495620_0019141	3300046515	Bacteria	3374
979	Ga0495620_0029780	3300046515	Bacteria	2522
980	Ga0495630_0083442	3300046517	Bacteria	2412
981	Ga0495631_0003311	3300046518	Bacteria	8860
982	Ga0495631_0006697	3300046518	Bacteria	5919
983	Ga0495631_0016236	3300046518	Bacteria	3554
984	Ga0495632_0014317	3300046519	Bacteria	4490
985	Ga0495632_0034155	3300046519	Bacteria	2605
986	Ga0495632_0036777	3300046519	Bacteria	2488
987	Ga0495632_0047812	3300046519	Bacteria	2120
988	Ga0495632_0052882	3300046519	Bacteria	1995
989	Ga0495632_0081407	3300046519	Bacteria	1544
990	Ga0495637_0001495	3300046520	Bacteria	13703
991	Ga0495637_0012561	3300046520	Bacteria	4046
992	Ga0495637_0016665	3300046520	Bacteria	3433
993	Ga0495637_0022274	3300046520	Bacteria	2891
994	Ga0495637_0023314	3300046520	Bacteria	2815
995	Ga0495637_0031551	3300046520	Bacteria	2342
996	Ga0495637_0039038	3300046520	Bacteria	2052
997	Ga0495637_0072443	3300046520	Bacteria	1387
998	Ga0495643_0032050	3300046522	Bacteria	2920
999	Ga0495643_0037125	3300046522	Bacteria	2674
1000	Ga0495643_0060483	3300046522	Bacteria	2010
1001	Ga0495643_0079608	3300046522	Bacteria	1708
1002	Ga0495644_0037645	3300046523	Bacteria	1825
1003	Ga0495648_0000274	3300046524	Bacteria	57965
1004	Ga0495648_0001541	3300046524	Bacteria	22515
1005	Ga0495648_0006414	3300046524	Bacteria	9604
1006	Ga0495648_0012181	3300046524	Bacteria	6429
1007	Ga0495648_0016062	3300046524	Bacteria	5405
1008	Ga0495648_0023973	3300046524	Bacteria	4166
1009	Ga0495648_0030090	3300046524	Bacteria	3596
1010	Ga0495648_0031607	3300046524	Bacteria	3483
1011	Ga0495648_0046737	3300046524	Bacteria	2680
1012	Ga0495648_0047997	3300046524	Bacteria	2632
1013	Ga0495648_0053072	3300046524	Bacteria	2458
1014	Ga0495648_0054797	3300046524	Bacteria	2407
1015	Ga0495663_0015746	3300046525	Bacteria	2133
1016	Ga0495666_0050817	3300046526	Bacteria	1992
1017	Ga0495642_0002842	3300046528	Bacteria	6910
1018	Ga0495642_0004228	3300046528	Bacteria	5590
1019	Ga0495642_0011523	3300046528	Bacteria	3398
1020	Ga0495642_0015934	3300046528	Bacteria	2926
1021	Ga0495642_0019757	3300046528	Bacteria	2640
1022	Ga0495642_0023678	3300046528	Bacteria	2425
1023	Ga0495652_0050172	3300046529	Bacteria	3569
1024	Ga0495654_0013072	3300046530	Bacteria	4446
1025	Ga0495654_0014527	3300046530	Bacteria	4190
1026	Ga0495654_0022792	3300046530	Bacteria	3247
1027	Ga0495654_0028076	3300046530	Bacteria	2879
1028	Ga0495654_0036253	3300046530	Bacteria	2480
1029	Ga0495654_0036527	3300046530	Bacteria	2468
1030	Ga0495654_0038506	3300046530	Bacteria	2390
1031	Ga0495654_0040898	3300046530	Bacteria	2307
1032	Ga0495654_0052619	3300046530	Bacteria	1981
1033	Ga0495654_0063601	3300046530	Bacteria	1766
1034	Ga0495654_0084069	3300046530	Bacteria	1487
1035	Ga0495654_0097376	3300046530	Bacteria	1358
1036	Ga0495665_0001906	3300046531	Bacteria	11248
1037	Ga0495665_0112556	3300046531	Bacteria	1427
1038	Ga0495586_0079153	3300046535	Bacteria	1804
1039	Ga0495609_0006819	3300046538	Bacteria	5773
1040	Ga0495609_0031484	3300046538	Bacteria	2410
1041	Ga0495609_0032935	3300046538	Bacteria	2352
1042	Ga0495609_0039141	3300046538	Bacteria	2135
1043	Ga0495597_0000477	3300046542	Bacteria	33829
1044	Ga0495597_0001172	3300046542	Bacteria	19661
1045	Ga0495597_0005204	3300046542	Bacteria	6922
1046	Ga0495597_0015990	3300046542	Bacteria	3547
1047	Ga0495597_0019402	3300046542	Bacteria	3182
1048	Ga0495597_0031645	3300046542	Bacteria	2405
1049	Ga0495597_0038142	3300046542	Bacteria	2155
1050	Ga0495597_0039801	3300046542	Bacteria	2103
1051	Ga0495597_0053963	3300046542	Bacteria	1766
1052	Ga0495597_0095733	3300046542	Bacteria	1256
1053	Ga0495645_0002166	3300046543	Bacteria	13340
1054	Ga0495645_0105897	3300046543	Bacteria	1995
1055	Ga0495622_0012351	3300046557	Bacteria	3952
1056	Ga0495622_0032432	3300046557	Bacteria	2439
1057	Ga0495622_0042600	3300046557	Bacteria	2110
1058	Ga0495622_0092611	3300046557	Bacteria	1388
1059	Ga0495633_0018782	3300046558	Bacteria	3504
1060	Ga0495633_0019960	3300046558	Bacteria	3380
1061	Ga0495633_0074594	3300046558	Bacteria	1581
1062	Ga0495667_0106370	3300046559	Bacteria	1813
1063	Ga0495656_0000221	3300046615	Bacteria	20331
1064	Ga0495656_0012748	3300046615	Bacteria	3110
1065	Ga0495656_0023037	3300046615	Bacteria	2446
1066	Ga0495668_0017235	3300046616	Bacteria	4192
1067	Ga0495668_0035550	3300046616	Bacteria	2792
1068	Ga0495668_0054775	3300046616	Bacteria	2203
1069	Ga0495668_0067312	3300046616	Bacteria	1970
1070	Ga0495634_0028485	3300046642	Bacteria	3876
1071	Ga0495611_0004389	3300046648	Bacteria	6108
1072	Ga0495611_0043506	3300046648	Bacteria	2008
1073	Ga0495625_0000197	3300046660	Bacteria	95865
1074	Ga0495625_0007062	3300046660	Bacteria	9868
1075	Ga0495625_0014742	3300046660	Bacteria	6222
1076	Ga0495625_0021990	3300046660	Bacteria	4897
1077	Ga0495625_0032446	3300046660	Bacteria	3870
1078	Ga0495625_0043510	3300046660	Bacteria	3256
1079	Ga0495625_0073312	3300046660	Bacteria	2400
1080	Ga0495625_0125699	3300046660	Bacteria	1741
1081	Ga0495625_0149239	3300046660	Bacteria	1572
1082	Ga0495635_0011014	3300046663	Bacteria	6338
1083	Ga0495635_0026960	3300046663	Bacteria	3997
1084	Ga0495635_0030513	3300046663	Bacteria	3746
1085	Ga0495659_0000040	3300046664	Bacteria	59388
1086	Ga0495659_0025721	3300046664	Bacteria	2016
1087	Ga0495661_0000348	3300046665	Bacteria	50388
1088	Ga0495661_0007080	3300046665	Bacteria	7834
1089	Ga0495661_0009327	3300046665	Bacteria	6737
1090	Ga0495661_0034500	3300046665	Bacteria	3183
1091	Ga0495661_0079320	3300046665	Bacteria	1897
1092	Ga0495661_0098562	3300046665	Bacteria	1649
1093	Ga0495588_0022541	3300046674	Bacteria	3113
1094	Ga0495588_0029999	3300046674	Bacteria	2731
1095	Ga0495588_0063300	3300046674	Bacteria	1918
1096	Ga0495623_0024842	3300046679	Bacteria	3859
1097	Ga0495623_0041129	3300046679	Bacteria	2950
1098	Ga0495646_0090837	3300046680	Bacteria	1763
1099	Ga0495669_0041078	3300046684	Bacteria	2052
1100	Ga0495613_0006465	3300046689	Bacteria	8763
1101	Ga0495613_0047629	3300046689	Bacteria	3166
1102	Ga0495624_0010903	3300046690	Bacteria	6265
1103	Ga0495670_0015225	3300046691	Bacteria	3781
1104	Ga0495670_0019138	3300046691	Bacteria	3374
1105	Ga0495670_0021409	3300046691	Bacteria	3188
1106	Ga0495671_0013014	3300046692	Bacteria	4524
1107	Ga0495671_0027762	3300046692	Bacteria	2919
1108	Ga0495671_0039701	3300046692	Bacteria	2375
1109	Ga0495671_0040390	3300046692	Bacteria	2352
1110	Ga0495671_0054844	3300046692	Bacteria	1975
1111	Ga0495671_0058621	3300046692	Bacteria	1904
1112	Ga0495671_0059730	3300046692	Bacteria	1883
1113	Ga0495671_0095599	3300046692	Bacteria	1453
1114	Ga0495649_0000571	3300046694	Bacteria	31125
1115	Ga0495649_0009534	3300046694	Bacteria	5760
1116	Ga0495649_0018434	3300046694	Bacteria	3927
1117	Ga0495649_0023723	3300046694	Bacteria	3426
1118	Ga0495649_0048384	3300046694	Bacteria	2310
1119	Ga0495649_0070961	3300046694	Bacteria	1867
1120	Ga0495649_0071009	3300046694	Bacteria	1866
1121	Ga0495649_0119615	3300046694	Bacteria	1393
1122	Ga0495589_0014806	3300046794	Bacteria	4011
1123	Ga0495589_0034929	3300046794	Bacteria	2521
1124	Ga0495589_0041163	3300046794	Bacteria	2306
1125	Ga0495589_0089205	3300046794	Bacteria	1497
1126	Ga0495589_0100169	3300046794	Bacteria	1402
1127	Ga0495600_0034578	3300046809	Bacteria	3281
1128	Ga0495600_0043455	3300046809	Bacteria	2930
1129	Ga0495600_0051406	3300046809	Bacteria	2690
1130	Ga0495600_0151359	3300046809	Bacteria	1502
1131	Ga0495600_0212463	3300046809	Bacteria	1239
1132	Ga0495660_0000852	3300046810	Bacteria	22522
1133	Ga0495660_0017765	3300046810	Bacteria	4091
1134	Ga0495660_0024102	3300046810	Bacteria	3467
1135	Ga0495660_0025621	3300046810	Bacteria	3348
1136	Ga0495660_0033046	3300046810	Bacteria	2903
1137	Ga0495660_0042675	3300046810	Bacteria	2505
1138	Ga0495660_0045590	3300046810	Bacteria	2406
1139	Ga0495660_0049378	3300046810	Bacteria	2297
1140	Ga0495660_0051607	3300046810	Bacteria	2237
1141	Ga0495660_0077262	3300046810	Bacteria	1752
1142	Ga0495660_0084517	3300046810	Bacteria	1659
1143	Ga0495660_0102574	3300046810	Bacteria	1470
1144	Ga0495660_0104948	3300046810	Bacteria	1449
1145	Ga0495660_0111350	3300046810	Bacteria	1396
1146	Ga0495660_0132777	3300046810	Bacteria	1247
1147	Ga0495581_0026016	3300047315	Bacteria	3394
1148	Ga0495581_0039125	3300047315	Bacteria	2745
1149	Ga0495581_0056157	3300047315	Bacteria	2273
1150	Ga0495581_0056419	3300047315	Bacteria	2267
1151	Ga0495581_0062217	3300047315	Bacteria	2156
1152	Ga0495581_0189128	3300047315	Bacteria	1204
1153	Ga0495604_0031057	3300047317	Bacteria	4239
1154	Ga0495604_0069025	3300047317	Bacteria	2680
1155	Ga0495674_0003165	3300047319	Bacteria	15977
1156	Ga0495674_0231885	3300047319	Bacteria	1523
1157	Ga0495672_0000136	3300047320	Bacteria	108633
1158	Ga0495672_0028549	3300047320	Bacteria	3528
1159	Ga0495672_0029929	3300047320	Bacteria	3422
1160	Ga0495672_0030524	3300047320	Bacteria	3379
1161	Ga0495672_0031290	3300047320	Bacteria	3323
1162	Ga0495672_0043880	3300047320	Bacteria	2685
1163	Ga0495672_0051294	3300047320	Bacteria	2430
1164	Ga0495672_0057028	3300047320	Bacteria	2269
1165	Ga0495676_0010324	3300047321	Bacteria	8473
1166	Ga0495676_0041144	3300047321	Bacteria	3806
1167	Ga0495676_0055931	3300047321	Bacteria	3124
1168	Ga0495680_0008487	3300047322	Bacteria	9332
1169	Ga0495680_0071799	3300047322	Bacteria	2634
1170	Ga0495680_0073605	3300047322	Bacteria	2596
1171	Ga0495680_0095059	3300047322	Bacteria	2228
1172	Ga0495680_0123845	3300047322	Bacteria	1906
1173	Ga0495683_0014433	3300047323	Bacteria	4115
1174	Ga0495683_0019660	3300047323	Bacteria	3484
1175	Ga0495683_0064884	3300047323	Bacteria	1802
1176	Ga0495687_003317	3300047443	Bacteria	11802
1177	Ga0495687_011357	3300047443	Bacteria	4798
1178	Ga0495687_015066	3300047443	Bacteria	3945
1179	Ga0495687_016835	3300047443	Bacteria	3666
1180	Ga0495675_0034380	3300047444	Bacteria	3236
1181	Ga0495675_0139309	3300047444	Bacteria	1504
1182	Ga0495677_0012467	3300047445	Bacteria	3100
1183	Ga0495679_008826	3300047446	Bacteria	4069
1184	Ga0495679_012135	3300047446	Bacteria	3292
1185	Ga0495679_019635	3300047446	Bacteria	2369
1186	Ga0495679_030992	3300047446	Bacteria	1730
1187	Ga0495685_003555	3300047447	Bacteria	4983
1188	Ga0495673_0000470	3300047469	Bacteria	43772
1189	Ga0495673_0003288	3300047469	Bacteria	10729
1190	Ga0495673_0003698	3300047469	Bacteria	9956
1191	Ga0495673_0004242	3300047469	Bacteria	9047
1192	Ga0495673_0007229	3300047469	Bacteria	6416
1193	Ga0495673_0013100	3300047469	Bacteria	4367
1194	Ga0495673_0013139	3300047469	Bacteria	4360
1195	Ga0495673_0014605	3300047469	Bacteria	4079
1196	Ga0495673_0015571	3300047469	Bacteria	3914
1197	Ga0495673_0019237	3300047469	Bacteria	3424
1198	Ga0495673_0027436	3300047469	Bacteria	2710
1199	Ga0495673_0030250	3300047469	Bacteria	2545
1200	Ga0495673_0030694	3300047469	Bacteria	2522
1201	Ga0495673_0070805	3300047469	Bacteria	1467
1202	Ga0495673_0079593	3300047469	Bacteria	1360
1203	Ga0495681_0007528	3300047470	Bacteria	6938
1204	Ga0495681_0008957	3300047470	Bacteria	6213
1205	Ga0495681_0011782	3300047470	Bacteria	5177
1206	Ga0495681_0015638	3300047470	Bacteria	4286
1207	Ga0495681_0019441	3300047470	Bacteria	3709
1208	Ga0495681_0020884	3300047470	Bacteria	3541
1209	Ga0495681_0030089	3300047470	Bacteria	2770
1210	Ga0495681_0044945	3300047470	Bacteria	2118
1211	Ga0495681_0060150	3300047470	Bacteria	1753
1212	Ga0495684_0010235	3300047471	Bacteria	7254
1213	Ga0495684_0057634	3300047471	Bacteria	2960
1214	Ga0495684_0066398	3300047471	Bacteria	2743
1215	Ga0495686_0001077	3300047472	Bacteria	32501
1216	Ga0495686_0003271	3300047472	Bacteria	14174
1217	Ga0495686_0005700	3300047472	Bacteria	9732
1218	Ga0495686_0023849	3300047472	Bacteria	4026
1219	Ga0495686_0030077	3300047472	Bacteria	3529
1220	Ga0495686_0034795	3300047472	Bacteria	3241
1221	Ga0495686_0053249	3300047472	Bacteria	2536
1222	Ga0495686_0124775	3300047472	Bacteria	1531
1223	Ga0495686_0143086	3300047472	Bacteria	1410
1224	Ga0495593_0067661	3300047673	Bacteria	1859
1225	Ga0495602_0060466	3300048088	Bacteria	3300
1226	Ga0495602_0148492	3300048088	Bacteria	1846
1227	Ga0495602_0226987	3300048088	Bacteria	1405
1228	Ga0495614_0000477	3300048089	Bacteria	16487
1229	Ga0495614_0017584	3300048089	Bacteria	3106
1230	Ga0495626_0002989	3300048091	Bacteria	11207
1231	Ga0495626_0004591	3300048091	Bacteria	8420
1232	Ga0495626_0005932	3300048091	Bacteria	7030
1233	Ga0495626_0005986	3300048091	Bacteria	6999
1234	Ga0495626_0014079	3300048091	Bacteria	4136
1235	Ga0495626_0016898	3300048091	Bacteria	3696
1236	Ga0495626_0018282	3300048091	Bacteria	3523
1237	Ga0495626_0032805	3300048091	Bacteria	2491
1238	Ga0496100_0071260	3300048903	Bacteria	2320
1239	Ga0496101_0003964	3300048904	Bacteria	9261
1240	Ga0496102_0001247	3300048905	Bacteria	22962
1241	Ga0496102_0006177	3300048905	Bacteria	10212
1242	Ga0496102_0008207	3300048905	Bacteria	8938
1243	Ga0496102_0010101	3300048905	Bacteria	8120
1244	Ga0496102_0014650	3300048905	Bacteria	6816
1245	Ga0496102_0112072	3300048905	Bacteria	2544
1246	Ga0496102_0149378	3300048905	Bacteria	2195
1247	Ga0496103_0003305	3300048906	Bacteria	9861
1248	Ga0496103_0009348	3300048906	Bacteria	5807
1249	Ga0496103_0080536	3300048906	Bacteria	2048
1250	Ga0496104_0004823	3300048907	Bacteria	11755
1251	Ga0496104_0038354	3300048907	Bacteria	4483
1252	Ga0496104_0052579	3300048907	Bacteria	3848
1253	Ga0496104_0302236	3300048907	Bacteria	1512
1254	Ga0496105_0002650	3300048908	Bacteria	13031
1255	Ga0496105_0060437	3300048908	Bacteria	3127
1256	Ga0496105_0149548	3300048908	Bacteria	1920
1257	Ga0496105_0152803	3300048908	Bacteria	1897
1258	Ga0496106_0004823	3300048909	Bacteria	9980
1259	Ga0496107_0050128	3300048910	Bacteria	3009
1260	Ga0496108_0087016	3300048911	Bacteria	2653
1261	Ga0496110_0176537	3300048913	Bacteria	1939
1262	Ga0496110_0191882	3300048913	Bacteria	1855
1263	Ga0496112_0005803	3300048915	Bacteria	10741
1264	Ga0496112_0177893	3300048915	Bacteria	2092
1265	Ga0496113_0011897	3300048916	Bacteria	5832
1266	Ga0496115_0130884	3300048918	Bacteria	2068
1267	Ga0496116_0000943	3300048919	Bacteria	35796
1268	Ga0496116_0009275	3300048919	Bacteria	8413
1269	Ga0496116_0011789	3300048919	Bacteria	7196
1270	Ga0496116_0015154	3300048919	Bacteria	6111
1271	Ga0496116_0078289	3300048919	Bacteria	2062
1272	Ga0496116_0135175	3300048919	Bacteria	1398
1273	Ga0496117_0007953	3300048920	Bacteria	10185
1274	Ga0496117_0017503	3300048920	Bacteria	5983
1275	Ga0496117_0021965	3300048920	Bacteria	5137
1276	Ga0496117_0095479	3300048920	Bacteria	1900
1277	Ga0496117_0164845	3300048920	Bacteria	1293
1278	Ga0496118_0004899	3300048921	Bacteria	15562
1279	Ga0496118_0008847	3300048921	Bacteria	10302
1280	Ga0496118_0047119	3300048921	Bacteria	3345
1281	Ga0496118_0077011	3300048921	Bacteria	2367
1282	Ga0496118_0092538	3300048921	Bacteria	2075
1283	Ga0496118_0137542	3300048921	Bacteria	1556
1284	Ga0496119_0001823	3300048922	Bacteria	24690
1285	Ga0496119_0008519	3300048922	Bacteria	8992
1286	Ga0496119_0065325	3300048922	Bacteria	2155
1287	Ga0496120_0000042	3300048923	Bacteria	197055
1288	Ga0496120_0016914	3300048923	Bacteria	4748
1289	Ga0496120_0026078	3300048923	Bacteria	3616
1290	Ga0496121_0004935	3300048924	Bacteria	17501
1291	Ga0496121_0013475	3300048924	Bacteria	8778
1292	Ga0496121_0017904	3300048924	Bacteria	7188
1293	Ga0496121_0032738	3300048924	Bacteria	4719
1294	Ga0496121_0060163	3300048924	Bacteria	3126
1295	Ga0496122_0000224	3300048925	Bacteria	126514
1296	Ga0496122_0001311	3300048925	Bacteria	40819
1297	Ga0496122_0108992	3300048925	Bacteria	1824
1298	Ga0496123_0000187	3300048926	Bacteria	125396
1299	Ga0496123_0002525	3300048926	Bacteria	22460
1300	Ga0496123_0075482	3300048926	Bacteria	2080
1301	Ga0496123_0077598	3300048926	Bacteria	2039
1302	Ga0496124_0005554	3300048927	Bacteria	14125
1303	Ga0496124_0006344	3300048927	Bacteria	12910
1304	Ga0496124_0027632	3300048927	Bacteria	5088
1305	Ga0496124_0039679	3300048927	Bacteria	4078
1306	Ga0496124_0040365	3300048927	Bacteria	4037
1307	Ga0496124_0049974	3300048927	Bacteria	3565
1308	Ga0496124_0053110	3300048927	Bacteria	3438
1309	Ga0496124_0123921	3300048927	Bacteria	2061
1310	Ga0496125_0001129	3300048928	Bacteria	40763
1311	Ga0496125_0014244	3300048928	Bacteria	7751
1312	Ga0496125_0021482	3300048928	Bacteria	6020
1313	Ga0496125_0021884	3300048928	Bacteria	5950
1314	Ga0496125_0026943	3300048928	Bacteria	5220
1315	Ga0496125_0162468	3300048928	Bacteria	1514
1316	Ga0496125_0162616	3300048928	Bacteria	1513
1317	Ga0496125_0186634	3300048928	Bacteria	1374
1318	Ga0496126_0001122	3300048929	Bacteria	44809
1319	Ga0496126_0050559	3300048929	Bacteria	3787
1320	Ga0496126_0058456	3300048929	Bacteria	3476
1321	Ga0496126_0069637	3300048929	Bacteria	3137
1322	Ga0496126_0083261	3300048929	Bacteria	2824
1323	Ga0495678_000734	3300049459	Bacteria	29779
1324	Ga0495678_000892	3300049459	Bacteria	26497
1325	Ga0495678_015103	3300049459	Bacteria	3565
1326	Ga0495678_016346	3300049459	Bacteria	3395
1327	Ga0495678_017940	3300049459	Bacteria	3193
1328	Ga0495678_036984	3300049459	Bacteria	1987
1329	Ga0495678_041186	3300049459	Bacteria	1850
1330	Ga0495678_044098	3300049459	Bacteria	1766
1331	Ga0495678_062713	3300049459	Bacteria	1390
1332	Ga0495682_0010986	3300049460	Bacteria	3490
1333	Ga0495682_0020007	3300049460	Bacteria	2514
1334	Ga0501290_002178	3300049513	Bacteria	2548
1335	Ga0501294_000001	3300049517	Bacteria	34855
1336	Ga0501300_000191	3300049523	Bacteria	9279
1337	Ga0501033_0201174	3300049570	Bacteria	1423
1338	Ga0501034_0000379	3300049571	Bacteria	75837
1339	Ga0501034_0001044	3300049571	Bacteria	39462
1340	Ga0501034_0002761	3300049571	Bacteria	20617
1341	Ga0501034_0100667	3300049571	Bacteria	2884
1342	Ga0501034_0208567	3300049571	Bacteria	1910
1343	Ga0501037_0044681	3300049573	Bacteria	3253
1344	Ga0501039_0011293	3300049575	Bacteria	6802
1345	Ga0501039_0084867	3300049575	Bacteria	2467
1346	Ga0501039_0288979	3300049575	Bacteria	1289
1347	Ga0501042_0026545	3300049578	Bacteria	4069
1348	Ga0501043_0024290	3300049579	Bacteria	4757
1349	Ga0501047_0009469	3300049581	Bacteria	9203
1350	Ga0501047_0009540	3300049581	Bacteria	9173
1351	Ga0501069_0000672	3300049585	Bacteria	15878
1352	Ga0501069_0077776	3300049585	Bacteria	1865
1353	Ga0501070_0076424	3300049586	Bacteria	2772
1354	Ga0501071_0005154	3300049587	Bacteria	8372
1355	Ga0501071_0082388	3300049587	Bacteria	2356
1356	Ga0501072_0085548	3300049588	Bacteria	2501
1357	Ga0501075_0037644	3300049591	Bacteria	3615
1358	Ga0501076_0086908	3300049592	Bacteria	2513
1359	Ga0501206_000314	3300049653	Bacteria	5691
1360	Ga0501235_014775	3300049669	Bacteria	1721
1361	Ga0501225_0003896	3300049705	Bacteria	4470
1362	Ga0501225_0006737	3300049705	Bacteria	3348
1363	Ga0501079_0227591	3300049741	Bacteria	1457
1364	Ga0501080_0001619	3300049742	Bacteria	19144
1365	Ga0501080_0002448	3300049742	Bacteria	16233
1366	Ga0501080_0161824	3300049742	Bacteria	2067
1367	Ga0501083_0010630	3300049744	Bacteria	6479
1368	Ga0501241_005788	3300049758	Bacteria	2294
1369	Ga0501262_000056	3300049759	Bacteria	13717
1370	Ga0501280_008718	3300049776	Bacteria	1412
1371	Ga0501282_000001	3300049778	Bacteria	101349
1372	Ga0501044_0025399	3300049823	Bacteria	6279
1373	nmdc:mga03683_11778_c1	3300050489	Bacteria	3178
1374	nmdc:mga03683_18817_c1	3300050489	Bacteria	2631
1375	nmdc:mga03683_24512_c1	3300050489	Bacteria	2361
1376	nmdc:mga03683_2543_c1	3300050489	Bacteria	5688
1377	nmdc:mga03683_68793_c1	3300050489	Bacteria	1509
1378	nmdc:mga03n38_41052_c1	3300050490	Bacteria	2014
1379	nmdc:mga03n38_54511_c1	3300050490	Bacteria	1797
1380	nmdc:mga03n38_93965_c1	3300050490	Bacteria	1433
1381	nmdc:mga0yw44_110686_c1	3300050492	Bacteria	1759
1382	nmdc:mga0yw44_20037_c1	3300050492	Bacteria	3703
1383	nmdc:mga0yw44_331_c2	3300050492	Bacteria	16251
1384	nmdc:mga0yw44_37630_c1	3300050492	Bacteria	2858
1385	nmdc:mga0yw44_878_c1	3300050492	Bacteria	11320
1386	nmdc:mga0k408_119369_c1	3300050493	Bacteria	1561
1387	nmdc:mga0k408_3816_c1	3300050493	Bacteria	7989
1388	nmdc:mga0k408_42121_c1	3300050493	Bacteria	2630
1389	nmdc:mga0k408_53806_c1	3300050493	Bacteria	2333
1390	nmdc:mga0k408_95516_c1	3300050493	Bacteria	1749
1391	nmdc:mga06z11_5469_c1	3300050494	Bacteria	5099
1392	nmdc:mga04h51_10138_c1	3300050495	Bacteria	2579
1393	nmdc:mga07m45_21074_c1	3300050496	Bacteria	3546
1394	nmdc:mga07m45_26200_c1	3300050496	Bacteria	3204
1395	nmdc:mga07m45_5154_c1	3300050496	Bacteria	6478
1396	nmdc:mga07m45_59483_c1	3300050496	Bacteria	2162
1397	nmdc:mga07m45_65075_c1	3300050496	Bacteria	2070
1398	nmdc:mga07m45_8090_c1	3300050496	Bacteria	5392
1399	nmdc:mga07m45_81849_c1	3300050496	Bacteria	1844
1400	nmdc:mga07m45_83260_c1	3300050496	Bacteria	1828
1401	nmdc:mga07m45_872_c1	3300050496	Bacteria	13146
1402	nmdc:mga07m45_93182_c1	3300050496	Bacteria	1727
1403	nmdc:mga06r32_231803_c1	3300050510	Bacteria	1834
1404	nmdc:mga08y16_11899_c1	3300050511	Bacteria	9139
1405	nmdc:mga08y16_245227_c1	3300050511	Bacteria	1851
1406	nmdc:mga0n895_280_c1	3300050512	Bacteria	33650
1407	nmdc:mga0rr50_179908_c1	3300050513	Bacteria	1728
1408	nmdc:mga0rr50_350_c1	3300050513	Bacteria	25198
1409	nmdc:mga08x19_210498_c1	3300050514	Bacteria	1334
1410	nmdc:mga0a205_1570_c1	3300050515	Bacteria	19575
1411	nmdc:mga0sz30_28123_c1	3300050516	Bacteria	2312
1412	nmdc:mga0sz30_34691_c1	3300050516	Bacteria	2102
1413	nmdc:mga0sz30_492_c1	3300050516	Bacteria	14711
1414	nmdc:mga0sz30_7096_c1	3300050516	Bacteria	4190
1415	Ga0495601_0005164	3300053077	Bacteria	7588
1416	Ga0495601_0057403	3300053077	Bacteria	2466
1417	Ga0495601_0071296	3300053077	Bacteria	2219
1418	Ga0500578_0000597	3300053086	Bacteria	43685
1419	Ga0500578_0089362	3300053086	Bacteria	1955
1420	Ga0500578_0097222	3300053086	Bacteria	1866
1421	Ga0500643_000040	3300053087	Bacteria	168108
1422	Ga0500646_0015646	3300053090	Bacteria	1977
1423	Ga0500583_0037307	3300053092	Bacteria	2182
1424	Ga0500583_0052934	3300053092	Bacteria	1890
1425	Ga0500641_0001787	3300053096	Bacteria	7614
1426	Ga0500641_0017906	3300053096	Bacteria	2657
1427	Ga0500654_050727	3300053099	Bacteria	2237
1428	Ga0500555_005318	3300053103	Bacteria	3652
1429	Ga0500556_0000150	3300053104	Bacteria	57930
1430	Ga0500556_0032001	3300053104	Bacteria	1794
1431	Ga0500562_001784	3300053108	Bacteria	5380
1432	Ga0500562_002430	3300053108	Bacteria	4674
1433	Ga0500569_002375	3300053109	Bacteria	3695
1434	Ga0500572_005648	3300053111	Bacteria	2843
1435	Ga0500594_0000535	3300053118	Bacteria	8241
1436	Ga0500595_012649	3300053119	Bacteria	3256
1437	Ga0500595_013850	3300053119	Bacteria	3078
1438	Ga0500652_003456	3300053131	Bacteria	4791
1439	Ga0500658_0005366	3300053134	Bacteria	4770
1440	Ga0500561_0001399	3300053137	Bacteria	3927
1441	Ga0500564_000387	3300053138	Bacteria	12569
1442	Ga0500568_0004905	3300053139	Bacteria	7044
1443	Ga0500568_0011540	3300053139	Bacteria	4091
1444	Ga0500577_0030551	3300053142	Bacteria	1877
1445	Ga0500600_0024394	3300053149	Bacteria	3603
1446	Ga0500604_0000093	3300053151	Bacteria	28700
1447	Ga0500616_0016933	3300053153	Bacteria	4138
1448	Ga0500622_0003196	3300053156	Bacteria	11161
1449	Ga0500622_0006152	3300053156	Bacteria	7040
1450	Ga0500633_0003384	3300053160	Bacteria	3470
1451	Ga0500634_0016794	3300053161	Bacteria	3911
1452	Ga0500634_0021049	3300053161	Bacteria	3529
1453	Ga0500645_000100	3300053730	Bacteria	68299
1454	Ga0500645_001458	3300053730	Bacteria	11931
1455	Ga0500645_006225	3300053730	Bacteria	4283
1456	Ga0500656_001303	3300053732	Bacteria	2126
1457	Ga0500552_001657	3300053733	Bacteria	2126
1458	Ga0500587_000973	3300053739	Bacteria	3854
1459	Ga0501082_0009073	3300060353	Bacteria	8579
1460	Ga0466962_0001580	3300061719	Bacteria	10655
1461	Ga0466962_0005899	3300061719	Bacteria	5885
1462	Ga0530510_0181580	3300061734	Bacteria	1561
1463	2508541121	2508501009	Bacteria	7784016
1464	2509154290	2508501128	Bacteria	8613869
1465	2511245776	2511231002	Bacteria	5042903
1466	2511257289	2511231004	Bacteria	6669789
1467	2511266924	2511231006	Bacteria	6794709
1468	2511267349	2511231006	Bacteria	6794709
1469	2511272915	2511231007	Bacteria	6306603
1470	2511278956	2511231008	Bacteria	6624100
1471	2511291227	2511231010	Bacteria	6373152
1472	2511293764	2511231011	Bacteria	6149768
1473	2511300525	2511231012	Bacteria	6738011
1474	2511315498	2511231014	Bacteria	6462302
1475	2511320331	2511231015	Bacteria	6598026
1476	2511323560	2511231016	Bacteria	6704427
1477	2511330717	2511231017	Bacteria	6503007
1478	2511336795	2511231018	Bacteria	6436256
1479	2511342573	2511231019	Bacteria	6520662
1480	2511348117	2511231020	Bacteria	6115223
1481	2511357038	2511231021	Bacteria	7302637
1482	2511363215	2511231022	Bacteria	6719296
1483	2511368309	2511231023	Bacteria	6808468
1484	2511414952	2511231031	Bacteria	6558529
1485	2511826800	2511231156	Bacteria	6845832
1486	2512324394	2512047018	Bacteria	6663241
1487	2548499292	2547132374	Bacteria	5530232
1488	2548697355	2547132424	Bacteria	8348532
1489	2554817284	2554235132	Bacteria	6772433
1490	2555672003	2554235341	Bacteria	6867980
1491	2583794499	2582580891	Bacteria	6800976
1492	2585149561	2582581279	Bacteria	4980720
1493	2587919883	2585428106	Bacteria	5179711
1494	2597860084	2597489887	Bacteria	6666321
1495	2597862099	2597489888	Bacteria	6179543
1496	2599353832	2599185160	Bacteria	6844013
1497	2599360490	2599185161	Bacteria	6960462
1498	2599366812	2599185162	Bacteria	6957254
1499	2599373601	2599185163	Bacteria	6995158
1500	2599378940	2599185164	Bacteria	6841688
1501	2599386082	2599185165	Bacteria	6843250
1502	2599392460	2599185166	Bacteria	6959206
1503	2599404226	2599185168	Bacteria	6997636
1504	2599460666	2599185181	Bacteria	6844519
1505	2599470212	2599185182	Bacteria	6883168
1506	2599482923	2599185185	Bacteria	6652270
1507	2599489687	2599185186	Bacteria	6831633
1508	2599502845	2599185188	Bacteria	6164180
1509	2599508014	2599185189	Bacteria	5862825
1510	2599510967	2599185190	Bacteria	6285678
1511	2599615126	2599185212	Bacteria	6765997
1512	2599771322	2599185248	Bacteria	6696816
1513	2599803372	2599185257	Bacteria	6492581
1514	2599879433	2599185288	Bacteria	6666191
1515	2599888735	2599185289	Bacteria	6778765
1516	2599890341	2599185290	Bacteria	6289611
1517	2599900744	2599185291	Bacteria	6775623
1518	2599930127	2599185300	Bacteria	6062622
1519	2599945348	2599185302	Bacteria	5954930
1520	2599947931	2599185303	Bacteria	6512725
1521	2599955620	2599185304	Bacteria	5951361
1522	2599960988	2599185305	Bacteria	6748700
1523	2599969443	2599185306	Bacteria	6637356
1524	2599980874	2599185308	Bacteria	6621546
1525	2599985830	2599185309	Bacteria	5969593
1526	2599990627	2599185310	Bacteria	6014457
1527	2599996384	2599185311	Bacteria	6354990
1528	2600001987	2599185312	Bacteria	5912071
1529	2600005716	2599185313	Bacteria	6658188
1530	2600014750	2599185314	Bacteria	6621749
1531	2600020638	2599185315	Bacteria	6771107
1532	2600027170	2599185316	Bacteria	6320029
1533	2600027867	2599185317	Bacteria	6435722
1534	2600033414	2599185318	Bacteria	6961590
1535	2600049332	2599185320	Bacteria	5963263
1536	2600055171	2599185321	Bacteria	6764560
1537	2600061597	2599185322	Bacteria	6763055
1538	2600064214	2599185323	Bacteria	6688755
1539	2600071094	2599185324	Bacteria	6590677
1540	2600080604	2599185325	Bacteria	6324919
1541	2600213280	2599185356	Bacteria	6843884
1542	2600357034	2600254930	Bacteria	6431253
1543	2600365355	2600254931	Bacteria	6734225
1544	2600443513	2600254954	Bacteria	5100516
1545	2601625917	2600255283	Bacteria	6061572
1546	2601690697	2600255296	Bacteria	5784754
1547	2601773447	2600255313	Bacteria	6842543
1548	2601799695	2600255318	Bacteria	6383414
1549	2602009033	2600255389	Bacteria	5275336
1550	2606074120	2603880185	Bacteria	6379190
1551	2606126235	2603880199	Bacteria	6377649
1552	2608382928	2606217733	Bacteria	6360972
1553	2624482665	2623620443	Bacteria	6427864
1554	2624490270	2623620446	Bacteria	6500345
1555	2643731952	2643221541	Bacteria	5498788
1556	2643842015	2643221565	Bacteria	6216018
1557	2643866125	2643221570	Bacteria	5103772
1558	2643955425	2643221589	Bacteria	6250934
1559	2643994115	2643221596	Bacteria	5006805
1560	2644023777	2643221602	Bacteria	6249926
1561	2644033156	2643221604	Bacteria	5014917
1562	2644041721	2643221606	Bacteria	5588032
1563	2644057651	2643221609	Bacteria	6756331
1564	2644072262	2643221611	Bacteria	6820941
1565	2644161003	2643221628	Bacteria	5745828
1566	2644185880	2643221633	Bacteria	6733554
1567	2644223488	2643221640	Bacteria	5258820
1568	2644237230	2643221642	Bacteria	5357871
1569	2644255010	2643221645	Bacteria	7207331
1570	2644285812	2643221650	Bacteria	7029547
1571	2644292939	2643221652	Bacteria	5140275
1572	2644328197	2643221658	Bacteria	6064537
1573	2644359200	2643221664	Bacteria	7272945
1574	2644394636	2643221671	Bacteria	5496681
1575	2644469585	2643221683	Bacteria	5749203
1576	2644623784	2643221713	Bacteria	6554480
1577	2644631475	2643221714	Bacteria	9015452
1578	2644647955	2643221717	Bacteria	5676132
1579	2652543785	2651869719	Bacteria	6047974
1580	2671093027	2667528170	Bacteria	6786960
1581	2671096411	2667528171	Bacteria	6900659
1582	2671125653	2667528176	Bacteria	6724917
1583	2671771059	2671180172	Bacteria	6495783
1584	2671840256	2671180195	Bacteria	9757215
1585	2677898652	2675903420	Bacteria	6247433
1586	2678265173	2675903515	Bacteria	6580491
1587	2715752007	2713897148	Bacteria	5883533
1588	2715755363	2713897149	Bacteria	6506249
1589	2718635877	2718217725	Bacteria	5758958
1590	2723246990	2721755607	Bacteria	5841722
1591	2738738367	2738541280	Bacteria	6630198
1592	2738808891	2738541294	Bacteria	6925949
1593	2738842819	2738541300	Bacteria	6675882
1594	2738896251	2738541309	Bacteria	6926455
1595	2739196484	2738543004	Bacteria	6381073
1596	2739241925	2738543012	Bacteria	7115078
1597	2739251636	2738543013	Bacteria	5618633
1598	2739257458	2738543015	Bacteria	6750701
1599	2739273566	2738543018	Bacteria	6718814
1600	2739314469	2738543025	Bacteria	6600348
1601	2739342610	2738543030	Bacteria	6719714
1602	2739603677	2739367653	Bacteria	2780952
1603	2743739618	2740892503	Bacteria	6855563
1604	2744954099	2744054611	Bacteria	5611514
1605	2745005630	2744054620	Bacteria	6551379
1606	2772641521	2772190715	Bacteria	6959372
1607	2774122081	2773857670	Bacteria	6407454
1608	2774133546	2773857673	Bacteria	6513460
1609	2774858412	2773857922	Bacteria	9757215
1610	2776259538	2775506901	Bacteria	9631051
1611	2784262567	2784132063	Bacteria	6262788
1612	2784314326	2784132072	Bacteria	6596533
1613	2784471052	2784132109	Bacteria	3141763
1614	2792462166	2791355048	Bacteria	5832535
1615	2793076490
1616	2794595523	2791355520	Bacteria	5948615
1617	2808855810	2808606361	Bacteria	6136259
1618	2808874920	2808606365	Bacteria	4301966
1619	2808921982	2808606376	Bacteria	6248667
1620	2808933366	2808606377	Bacteria	6646337
1621	2808935891	2808606378	Bacteria	6177535
1622	2808942301	2808606379	Bacteria	5022697
1623	2808944103	2808606380	Bacteria	6248705
1624	2808955452	2808606381	Bacteria	6646461
1625	2808959672	2808606382	Bacteria	6841132
1626	2808964317	2808606383	Bacteria	6138645
1627	2808975026	2808606385	Bacteria	6711065
1628	2808991335	2808606388	Bacteria	6706662
1629	2808999205	2808606389	Bacteria	6138126
1630	2809218571	2808606445	Bacteria	6057339
1631	2812368563	2811994881	Bacteria	6298475
1632	2816470773	2816332133	Bacteria	7249298
1633	2816511757	2816332139	Bacteria	9138787
1634	2817510206	2816332305	Bacteria	2697803
1635	2819654232	2818991456	Bacteria	6123676
1636	2819701504	2818991464	Bacteria	6907494
1637	2823425123	2823421272	Bacteria	5372474
1638	2824672921	2824671348	Bacteria	8369588
1639	2824689435	2824687955	Bacteria	8360029
1640	2824705347	2824704595	Bacteria	9667483
1641	2824755512	2824753945	Bacteria	9787441
1642	2824763796	2824763712	Bacteria	9792355
1643	2825655934	2825651385	Bacteria	6715909
1644	2834028789	2834028612	Bacteria	6354979
1645	2842137210	2842134933	Bacteria	5847019
1646	2842680418	2842677519	Bacteria	5615038
1647	2842682469	2842677519	Bacteria	5615038
1648	2842830101	2842826826	Bacteria	5974129
1649	2842837520	2842832357	Bacteria	5959113
1650	2842838901	2842837860	Bacteria	6066181
1651	2842845304	2842843487	Bacteria	6004777
1652	2842856336	2842854478	Bacteria	6143501
1653	2843746074	2843744320	Bacteria	5659202
1654	2844666169	2844665904	Bacteria	6817974
1655	2847935653	2847930680	Bacteria	9342022
1656	2849561674	2849560528	Bacteria	5393480
1657	2851156755	2851153111	Bacteria	5542585
1658	2852615724	2852612431	Bacteria	6885235
1659	2852660590	2852657418	Bacteria	6472974
1660	2852670692	2852667396	Bacteria	6885555
1661	2855672093	2855670206	Bacteria	7120389
1662	2855682864	2855676851	Bacteria	7063653
1663	2857294674	2857288857	Bacteria	7189066
1664	2857505865	2857504554	Bacteria	5369913
1665	2857728166	2857727296	Bacteria	2745552
1666	2858854342	2858848962	Bacteria	6963058
1667	2858888398	2858882152	Bacteria	7230291
1668	2858891704	2858888857	Bacteria	7060307
1669	2858899157	2858895516	Bacteria	7378898
1670	2860344534	2860339153	Bacteria	6846989
1671	2860868824	2860867994	Bacteria	5645326
1672	2862513857	2862507626	Bacteria	9425308
1673	2867304125	2867302475	Bacteria	7087181
1674	2867313460	2867312974	Bacteria	7058875
1675	2867322719	2867319477	Bacteria	7069771
1676	2869054918	2869048445	Bacteria	6875584
1677	2869066597	2869061728	Bacteria	7112407
1678	2869072949	2869068681	Bacteria	7205615
1679	2878034595	2878029506	Bacteria	6418441
1680	2880235242	2880230671	Bacteria	6140320
1681	2880493917	2880489317	Bacteria	7096270
1682	2880498424	2880495981	Bacteria	7340502
1683	2881673405	2881665667	Bacteria	8175609
1684	2885194260	2885192300	Bacteria	5882526
1685	2885412063	2885409591	Bacteria	9235467
1686	2898330778	2898329390	Bacteria	5168154
1687	2904455522	2904449895	Bacteria	6927402
1688	2904461639	2904456579	Bacteria	6819253
1689	2904462133	2904456579	Bacteria	6819253
1690	2904521615	2904518522	Bacteria	6068986
1691	2904552976	2904550169	Bacteria	6221258
1692	2904698543	2904690495	Bacteria	9412302
1693	2904716530	2904711408	Bacteria	9771557
1694	2908762446	2908756301	Bacteria	8864324
1695	2913041779	2913036834	Bacteria	6704877
1696	2916702836	2916699645	Bacteria	3568996
1697	2917075876	2917070673	Bacteria	6868303
1698	2919069586	2919063839	Bacteria	6302690
1699	2919388663	2919385768	Bacteria	5897293
1700	2919447276	2919446982	Bacteria	3994487
1701	2919459646	2919456309	Bacteria	6586567
1702	2919464659	2919462493	Bacteria	5817112
1703	2919487450	2919481497	Bacteria	6907839
1704	2919490016	2919487758	Bacteria	5929766
1705	2919501840	2919501602	Bacteria	5286340
1706	2919703766	2919697872	Bacteria	6553725
1707	2919704876	2919704043	Bacteria	5560311
1708	2919719795	2919713450	Bacteria	7431245
1709	2919720268	2919713450	Bacteria	7431245
1710	2923158704	2923153595	Bacteria	6870622
1711	2923522621	2923519811	Bacteria	6298479
1712	2923590424	2923586266	Bacteria	6565975
1713	2926063513	2926063275	Bacteria	5285848
1714	2928532030	2928531327	Bacteria	5101314
1715	2929149097	2929144301	Bacteria	6622272
1716	2929212679	2929212328	Bacteria	7708288
1717	2929220462	2929219909	Bacteria	6984360
1718	2929227014	2929226422	Bacteria	7248583
1719	2929526710	2929520902	Bacteria	6765052
1720	2931373480	2931369376	Bacteria	6847892
1721	2931397304	2931396565	Bacteria	7251677
1722	2935356862	2935353572	Unclassified	6955622
1723	2935678648	2935675223	Bacteria	9928132
1724	2935687861	2935684952	Bacteria	9590419
1725	2935714881	2935713505	Bacteria	9608509
1726	2935726554	2935722832	Bacteria	9608746
1727	2935733699	2935732158	Bacteria	9706831
1728	2935743078	2935741537	Bacteria	9707219
1729	2935754883	2935750917	Bacteria	9590372
1730	2939636954	2939636861	Bacteria	6297853
1731	2940559740	2940556831	Bacteria	9590747
1732	2945929769	2945928738	Bacteria	6053221
1733	2945947911	2945945610	Bacteria	5951079
1734	2945950272	2945945610	Bacteria	5951079
1735	2945966019	2945961074	Bacteria	7342064
1736	2945975074	2945972063	Bacteria	6086495
1737	2969309391	2969304461	Bacteria	6601805
1738	2974289250	2974289157	Bacteria	6080362
1739	2984287465	2984286254	Bacteria	6702062
1740	2984570038	2984568884	Bacteria	3884413
1741	2988730700	2988728565	Bacteria	6124362
1742	2990714180	2990710928	Bacteria	5002431
1743	2998144652	2998139840	Bacteria	6073514
1744	3007396766	3007395558	Bacteria	6755444
1745	3007398335	3007395558	Bacteria	6755444
1746	3007516416	3007511990	Bacteria	6481491
1747	3007615658	3007614139	Bacteria	6053559
1748	3007622775	3007619802	Bacteria	6411688
1749	3007858365	3007855910	Bacteria	5637581
1750	3007866119	3007861166	Bacteria	6045338
1751	3007867560	3007866637	Bacteria	5899198
1752	637322419	637000220	Bacteria	7074893
1753	8002783916	8002775197	Bacteria	10728764
1754	8002789688	8002784119	Bacteria	9788632
1755	8003835212	8003830390	Bacteria	6541657
1756	8003871321	8003870546	Bacteria	7396674
1757	8006987614	8006984368	Bacteria	9651211
1758	8011354864	8011350971	Bacteria	6158957
1759	8015692790	8015687852	Bacteria	6613826
1760	8019619231	8019619141	Bacteria	9218857
1761	8019633888	8019629233	Bacteria	8687553
1762	8019773660	8019769354	Bacteria	6924660
1763	8019782059	8019775933	Bacteria	6858656
1764	8029996227	8029995093	Bacteria	5990776
1765	8034963096	8034962539	Bacteria	4884839
1766	8054352773	8054347763	Bacteria	5901107
1767	8054504403	8054503363	Bacteria	6101651
1768	8054710129	8054704163	Bacteria	7247792
1769	8054731124	8054727385	Bacteria	7558670
1770	8054735262	8054734606	Bacteria	6947278
1771	8055776024	8055770955	Bacteria	6827675
1772	8055818832	8055817908	Bacteria	6609162
1773	8056130894	8056125926	Bacteria	6228218
1774	8056132723	8056131705	Bacteria	6107031
1775	8056144289	8056143049	Bacteria	6307666
1776	8056155673	8056155041	Bacteria	6486948
1777	8056161425	8056161164	Bacteria	6106669
1778	8056171904	8056166840	Bacteria	5820959
1779	8056172585	8056172158	Bacteria	6133900
1780	8056179784	8056177738	Bacteria	6748268
1781	8056574915	8056569372	Bacteria	5997322
1782	8056692469	8056689827	Bacteria	6712655
1783	8056972170	8056967851	Bacteria	9038162
1784	8057804908	8057798959	Bacteria	6713499
1785	Ga0395905_0000106
1786	SwRhRL2b_contig_3359380
1787	SwRhRL2b_contig_451342
1788	JGI24739J22299_10027560
1789	JGI24738J21930_10013006
1790	JGI25155J39150_1000002
1791	JGI25156J39149_1000003
1792	JGI25162J39368_1000194
1793	JGI25162J39368_1000671
1794	JGI25154J39366_1000009
1795	JGI25157J39369_1000002
1796	JGI25163J39215_1000690
1797	JGI25163J39215_1001497
1798	JGI25164J39214_1000160
1799	JGI25164J39214_1000417
1800	JGI25150J39212_1004255
1801	JGI25150J39212_1005462
1802	JGI25159J45721_1001036
1803	JGI25159J45721_1012731
1804	JGI25151J46595_10009599
1805	JGI25165J46597_1000290
1806	JGI25165J46597_1000470
1807	JGI25165J46597_1000770
1808	JGI25153J46596_10037698
1809	rootH2_10012126
1810	rootH1_10147960
1811	JGI25160J50197_1000305
1812	JGI25161J50226_1000018
1813	Ga0055538_1000036
1814	Ga0055539_1000047
1815	Ga0055533_1000058
1816	Ga0055532_1000087
1817	Ga0055525_1000209
1818	Ga0055535_1003122
1819	Ga0055537_1000127
1820	Ga0055536_1002216
1821	Ga0055536_1004611
1822	Ga0055536_1004659
1823	Ga0055536_1004690
1824	Ga0055534_1000340
1825	Ga0055534_1005703
1826	Ga0055528_1001503
1827	Ga0055530_10001779
1828	Ga0055530_10004594
1829	Ga0055530_10005180
1830	Ga0055540_1001314
1831	Ga0055540_1002441
1832	Ga0055540_1003847
1833	Ga0055540_1005246
1834	Ga0055540_1009711
1835	Ga0055531_10000348
1836	Ga0055531_10001138
1837	Ga0055541_1000034
1838	Ga0055543_1000418
1839	Ga0065165_1002126
1840	Ga0065714_10004456
1841	Ga0065714_10013374
1842	Ga0065714_10028410
1843	Ga0065714_10068674
1844	Ga0065714_10068918
1845	Ga0065714_10078586
1846	Ga0065714_10078707
1847	Ga0065714_10085116
1848	Ga0065704_10001910
1849	Ga0065704_10005418
1850	Ga0065712_10011733
1851	Ga0065712_10073972
1852	Ga0065715_10092771
1853	Ga0065707_10015660
1854	Ga0070658_10147124
1855	Ga0070658_10156080
1856	Ga0070676_10001154
1857	Ga0070676_10072377
1858	Ga0070683_100024533
1859	Ga0070683_100080286
1860	Ga0070670_100102289
1861	Ga0068869_100009902
1862	Ga0070680_100113882
1863	Ga0070682_100053087
1864	Ga0068868_100016222
1865	Ga0068868_100061632
1866	Ga0070660_100013873
1867	Ga0070661_100018565
1868	Ga0070661_100059704
1869	Ga0070692_10000512
1870	Ga0070668_100009698
1871	Ga0070669_100024903
1872	Ga0070675_100260801
1873	Ga0070671_100041590
1874	Ga0070673_100020456
1875	Ga0070659_100173768
1876	Ga0070659_100210719
1877	Ga0070667_100020196
1878	Ga0070709_10162048
1879	Ga0070714_100059826
1880	Ga0070714_100313253
1881	Ga0070711_100051889
1882	Ga0070705_100017433
1883	Ga0070700_100033850
1884	Ga0070694_100001309
1885	Ga0070708_100395296
1886	Ga0070663_100032125
1887	Ga0070663_100038070
1888	Ga0070662_100007601
1889	Ga0070662_100063517
1890	Ga0070681_10000400
1891	Ga0068867_100032250
1892	Ga0070685_10147476
1893	Ga0070706_100030535
1894	Ga0070706_100054161
1895	Ga0070698_100001061
1896	Ga0070698_100002279
1897	Ga0070698_100123942
1898	Ga0070699_100008172
1899	Ga0070699_100341163
1900	Ga0070697_100346371
1901	Ga0068853_100043783
1902	Ga0068853_100152766
1903	Ga0070665_100023785
1904	Ga0070665_100027573
1905	Ga0070665_100102347
1906	Ga0070665_100130171
1907	Ga0070704_100159796
1908	Ga0068855_100036615
1909	Ga0068855_100053696
1910	Ga0068855_100090213
1911	Ga0068855_100104660
1912	Ga0068855_100113368
1913	Ga0068855_100127821
1914	Ga0068855_100269037
1915	Ga0070664_100023382
1916	Ga0068854_100003802
1917	Ga0068856_100032092
1918	Ga0068856_100093249
1919	Ga0068856_100195683
1920	Ga0068856_100359627
1921	Ga0068852_100032842
1922	Ga0068852_100038545
1923	Ga0068859_100055102
1924	Ga0068864_100018695
1925	Ga0068861_100005124
1926	Ga0068861_100084712
1927	Ga0068861_100150464
1928	Ga0068863_100188142
1929	Ga0068858_100015717
1930	Ga0068858_100082134
1931	Ga0068860_100001000
1932	Ga0068860_100003227
1933	Ga0068860_100039138
1934	Ga0068860_100245381
1935	Ga0068862_100008139
1936	Ga0068862_100070727
1937	Ga0068862_100164663
1938	Ga0081455_10000535
1939	Ga0081455_10002583
1940	Ga0081455_10003074
1941	Ga0081455_10006365
1942	Ga0081455_10076181
1943	Ga0081538_10000336
1944	Ga0081538_10104838
1945	Ga0081540_1005124
1946	Ga0081540_1016510
1947	Ga0081540_1018707
1948	Ga0081539_10000322
1949	Ga0081539_10001500
1950	Ga0081539_10010735
1951	Ga0081539_10055915
1952	Ga0075365_10001038
1953	Ga0075365_10002515
1954	Ga0075365_10147569
1955	Ga0075365_10151217
1956	Ga0075365_10153319
1957	Ga0075368_10028500
1958	Ga0075363_100063220
1959	Ga0075363_100064246
1960	Ga0075363_100072682
1961	Ga0075364_10056443
1962	Ga0075364_10099254
1963	Ga0075432_10000475
1964	Ga0075432_10001254
1965	Ga0075432_10004055
1966	Ga0075432_10009780
1967	Ga0075432_10019754
1968	Ga0075362_10003219
1969	Ga0075362_10009581
1970	Ga0075362_10024455
1971	Ga0075362_10081741
1972	Ga0075367_10001008
1973	Ga0075367_10114691
1974	Ga0075369_10000014
1975	Ga0075369_10013629
1976	Ga0075369_10019212
1977	Ga0075369_10020019
1978	Ga0075369_10067738
1979	Ga0075366_10007780
1980	Ga0075366_10022363
1981	Ga0075366_10030145
1982	Ga0075366_10031183
1983	Ga0075366_10034453
1984	Ga0075366_10078636
1985	Ga0075366_10078687
1986	Ga0097621_100321685
1987	Ga0075370_10000325
1988	Ga0075370_10003407
1989	Ga0075370_10004598
1990	Ga0075370_10006184
1991	Ga0075370_10034028
1992	Ga0075370_10041253
1993	Ga0075370_10124616
1994	Ga0075428_100092590
1995	Ga0075434_100000910
1996	Ga0075434_100337786
1997	Ga0075429_100202575
1998	Ga0075436_100001623
1999	Ga0075436_100061626
2000	Ga0075436_100112691
2001	Ga0097620_100055105
2002	Ga0079104_1000259
2003	Ga0079104_1001901
2004	Ga0079104_1012883
2005	Ga0099826_10005506
2006	Ga0075435_100003979
2007	Ga0075435_100145488
2008	Ga0099794_10000175
2009	Ga0099794_10004144
2010	Ga0099795_10001474
2011	Ga0099795_10003195
2012	Ga0099795_10010610
2013	Ga0105251_10000030
2014	Ga0105251_10000152
2015	Ga0105251_10024552
2016	Ga0105251_10032369
2017	Ga0105251_10041514
2018	Ga0105251_10065625
2019	Ga0105251_10071251
2020	Ga0105244_10002080
2021	Ga0105244_10017319
2022	Ga0105244_10031407
2023	Ga0105244_10061539
2024	Ga0105244_10067547
2025	Ga0105244_10088231
2026	Ga0105244_10094234
2027	Ga0105250_10003748
2028	Ga0105250_10003832
2029	Ga0105250_10021069
2030	Ga0105250_10023281
2031	Ga0105250_10046896
2032	Ga0105240_10043773
2033	Ga0105240_10046877
2034	Ga0105240_10197731
2035	Ga0111539_10000980
2036	Ga0111539_10144775
2037	Ga0111539_10293622
2038	Ga0105245_10027202
2039	Ga0105245_10098259
2040	Ga0105245_10166475
2041	Ga0105247_10000503
2042	Ga0105247_10001684
2043	Ga0105243_10000655
2044	Ga0105243_10009254
2045	Ga0105243_10012936
2046	Ga0105243_10041601
2047	Ga0105243_10109570
2048	Ga0105241_10037920
2049	Ga0105241_10054340
2050	Ga0105241_10061580
2051	Ga0105241_10063731
2052	Ga0105242_10000361
2053	Ga0105248_10044791
2054	Ga0105248_10120457
2055	Ga0105237_10000304
2056	Ga0105237_10034592
2057	Ga0105237_10046264
2058	Ga0105238_10042238
2059	Ga0105238_10065111
2060	Ga0105249_10013528
2061	Ga0105249_10025312
2062	Ga0105249_10025451
2063	Ga0105249_10035390
2064	Ga0105249_10183864
2065	Ga0099796_10000071
2066	Ga0099796_10005817
2067	Ga0105239_10011662
2068	Ga0105239_10028219
2069	Ga0105239_10037516
2070	Ga0105239_10051508
2071	Ga0105239_10058071
2072	Ga0105239_10483861
2073	Ga0105246_10006848
2074	Ga0105246_10019968
2075	Ga0105246_10031877
2076	Ga0105246_10035944
2077	Ga0105246_10059559
2078	Ga0105246_10098707
2079	Ga0157345_1000313
2080	Ga0157373_10013085
2081	Ga0157373_10017472
2082	Ga0157373_10053162
2083	Ga0157373_10055121
2084	Ga0157373_10059368
2085	Ga0157373_10069451
2086	Ga0157373_10073727
2087	Ga0157373_10074182
2088	Ga0157373_10077737
2089	Ga0157373_10077887
2090	Ga0157373_10093958
2091	Ga0157371_10010968
2092	Ga0157371_10013341
2093	Ga0157371_10031628
2094	Ga0157370_10021210
2095	Ga0157370_10046488
2096	Ga0157370_10088370
2097	Ga0157370_10140117
2098	Ga0157370_10344520
2099	Ga0157369_10046843
2100	Ga0157369_10071871
2101	Ga0157369_10091976
2102	Ga0157369_10191438
2103	Ga0157378_10017744
2104	Ga0157378_10018043
2105	Ga0163162_10027887
2106	Ga0163162_10057535
2107	Ga0163162_10071260
2108	Ga0163162_10105479
2109	Ga0157372_10074657
2110	Ga0157375_10051881
2111	Ga0157375_10157882
2112	Ga0157375_10161590
2113	Ga0157375_10198054
2114	Ga0157375_10465470
2115	Ga0163163_10074657
2116	Ga0157380_10009376
2117	Ga0182008_10000118
2118	Ga0182008_10004546
2119	Ga0182008_10012781
2120	Ga0182008_10013518
2121	Ga0182008_10015320
2122	Ga0182008_10015537
2123	Ga0182008_10041546
2124	Ga0182008_10048088
2125	Ga0182008_10122169
2126	Ga0157379_10207440
2127	Ga0157376_10003956
2128	Ga0157376_10242683
2129	Ga0182006_1004584
2130	Ga0182006_1005243
2131	Ga0182006_1008050
2132	Ga0182006_1009122
2133	Ga0182006_1015792
2134	Ga0182006_1071688
2135	Ga0182007_10006325
2136	Ga0182005_1008720
2137	Ga0182005_1012383
2138	Ga0182005_1013939
2139	Ga0183362_10009
2140	Ga0163161_10004717
2141	Ga0163161_10005146
2142	Ga0163161_10018973
2143	Ga0163161_10079763
2144	Ga0163161_10084671
2145	Ga0163161_10101313
2146	Ga0163161_10123266
2147	Ga0163161_10129480
2148	Ga0163161_10135634
2149	Ga0213872_10000052
2150	Ga0213872_10000094
2151	Ga0213872_10000146
2152	Ga0213872_10000918
2153	Ga0213872_10009810
2154	Ga0213872_10083774
2155	Ga0213876_10096573
2156	Ga0224712_10005870
2157	Ga0209435_100001
2158	Ga0209760_100085
2159	Ga0209760_100408
2160	Ga0209784_100050
2161	Ga0209566_100063
2162	Ga0209674_100084
2163	Ga0209147_100083
2164	Ga0209563_100084
2165	Ga0209563_100623
2166	Ga0207427_100007
2167	Ga0207427_100038
2168	Ga0209437_100006
2169	Ga0209437_100009
2170	Ga0209258_100113
2171	Ga0207425_1004215
2172	Ga0209646_1000001
2173	Ga0209646_1000302
2174	Ga0209026_1000003
2175	Ga0209677_100047
2176	Ga0209759_1000001
2177	Ga0209759_1004130
2178	Ga0209233_1000059
2179	Ga0209233_1000074
2180	Ga0209233_1000155
2181	Ga0209565_1000070
2182	Ga0209565_1000418
2183	Ga0209673_1000234
2184	Ga0209673_1014753
2185	Ga0209130_1000050
2186	Ga0209130_1002622
2187	Ga0209675_1000069
2188	Ga0209675_1000643
2189	Ga0209675_1004382
2190	Ga0209675_1005889
2191	Ga0209676_1000006
2192	Ga0209676_1000010
2193	Ga0209676_1000376
2194	Ga0209676_1001281
2195	Ga0209676_1002525
2196	Ga0209676_1002985
2197	Ga0209676_1006892
2198	Ga0209676_1008984
2199	Ga0209676_1009706
2200	Ga0209676_1033370
2201	Ga0209025_1000113
2202	Ga0209025_1001851
2203	Ga0209025_1041557
2204	Ga0209025_1049694
2205	Ga0209050_1000019
2206	Ga0209050_1000027
2207	Ga0209050_1000494
2208	Ga0209050_1002573
2209	Ga0209050_1007216
2210	Ga0209050_1014545
2211	Ga0209256_1002634
2212	Ga0207426_1000071
2213	Ga0207426_1015277
2214	Ga0209051_1000102
2215	Ga0209051_1000356
2216	Ga0209051_1000367
2217	Ga0209051_1000383
2218	Ga0209051_1000506
2219	Ga0209051_1000975
2220	Ga0209051_1008938
2221	Ga0209051_1011394
2222	Ga0209257_1000012
2223	Ga0209257_1000357
2224	Ga0209257_1006431
2225	Ga0209257_1008166
2226	Ga0207696_1000052
2227	Ga0207696_1000054
2228	Ga0207696_1000213
2229	Ga0207696_1003518
2230	Ga0207696_1006973
2231	Ga0207696_1016721
2232	Ga0207696_1025093
2233	Ga0207655_1003610
2234	Ga0207655_1003693
2235	Ga0207655_1007731
2236	Ga0207655_1014269
2237	Ga0207655_1021841
2238	Ga0207655_1028430
2239	Ga0207655_1028973
2240	Ga0207655_1030543
2241	Ga0207655_1037648
2242	Ga0207713_1000013
2243	Ga0207713_1010035
2244	Ga0207713_1011872
2245	Ga0207713_1025915
2246	Ga0207713_1029894
2247	Ga0207713_1030331
2248	Ga0207653_10004328
2249	Ga0207692_10006623
2250	Ga0207710_10000929
2251	Ga0207688_10003465
2252	Ga0207680_10064388
2253	Ga0207647_10006579
2254	Ga0207647_10099355
2255	Ga0207647_10148515
2256	Ga0207645_10056064
2257	Ga0207645_10076737
2258	Ga0207684_10098803
2259	Ga0207684_10139138
2260	Ga0207654_10017811
2261	Ga0207654_10111953
2262	Ga0207707_10052071
2263	Ga0207671_10000295
2264	Ga0207671_10021914
2265	Ga0207671_10157044
2266	Ga0207693_10068379
2267	Ga0207663_10102138
2268	Ga0207657_10020579
2269	Ga0207657_10080794
2270	Ga0207657_10258386
2271	Ga0207649_10020234
2272	Ga0207649_10026837
2273	Ga0207652_10060219
2274	Ga0207681_10117514
2275	Ga0207681_10138791
2276	Ga0207694_10012539
2277	Ga0207694_10015367
2278	Ga0207694_10067030
2279	Ga0207650_10000575
2280	Ga0207700_10020622
2281	Ga0207664_10024049
2282	Ga0207664_10215329
2283	Ga0207644_10098875
2284	Ga0207690_10100236
2285	Ga0207706_10013343
2286	Ga0207706_10018193
2287	Ga0207706_10027670
2288	Ga0207686_10000422
2289	Ga0207709_10000224
2290	Ga0207709_10000259
2291	Ga0207709_10002095
2292	Ga0207709_10052206
2293	Ga0207709_10070423
2294	Ga0207709_10089043
2295	Ga0207669_10068168
2296	Ga0207665_10036669
2297	Ga0207711_10074730
2298	Ga0207711_10104954
2299	Ga0207689_10008566
2300	Ga0207667_10039611
2301	Ga0207667_10048683
2302	Ga0207667_10056651
2303	Ga0207667_10118152
2304	Ga0207667_10142833
2305	Ga0207651_10123234
2306	Ga0207712_10000615
2307	Ga0207712_10103052
2308	Ga0207712_10221159
2309	Ga0207668_10012628
2310	Ga0207640_10049644
2311	Ga0207658_10165783
2312	Ga0207658_10263303
2313	Ga0207677_10010989
2314	Ga0207703_10005208
2315	Ga0207703_10071366
2316	Ga0207639_10148435
2317	Ga0207639_10149851
2318	Ga0207678_10002939
2319	Ga0207678_10036589
2320	Ga0207678_10090542
2321	Ga0207708_10055402
2322	Ga0207708_10109741
2323	Ga0207641_10013381
2324	Ga0207648_10007662
2325	Ga0207648_10135581
2326	Ga0207676_10049626
2327	Ga0207674_10077343
2328	Ga0207674_10167153
2329	Ga0207674_10403555
2330	Ga0207675_100007150
2331	Ga0207675_100062183
2332	Ga0207675_100089155
2333	Ga0207675_100310072
2334	Ga0207683_10004481
2335	Ga0207683_10019750
2336	Ga0207683_10033130
2337	Ga0207683_10047584
2338	Ga0207698_10028300
2339	Ga0207698_10335607
2340	Ga0209281_1000015
2341	Ga0209281_1000228
2342	Ga0209281_1007083
2343	Ga0209981_1002891
2344	Ga0209179_1002693
2345	Ga0209179_1002990
2346	Ga0209282_1000561
2347	Ga0209588_1001992
2348	Ga0209588_1005473
2349	Ga0209588_1012327
2350	Ga0209813_10024784
2351	Ga0207428_10000407
2352	Ga0207428_10046285
2353	Ga0207428_10094763
2354	Ga0207428_10097940
2355	Ga0268266_10016663
2356	Ga0268266_10016765
2357	Ga0268266_10043060
2358	Ga0268266_10083205
2359	Ga0268265_10185946
2360	Ga0268264_10000860
2361	Ga0268264_10009372
2362	Ga0268264_10017159
2363	Ga0268264_10041558
2364	Ga0265334_10031233
2365	Ga0307515_10000651
2366	Ga0307515_10021511
2367	Ga0307515_10077307
2368	Ga0307511_10000022
2369	Ga0307511_10000355
2370	Ga0307511_10081071
2371	Ga0307511_10170050
2372	Ga0316177_1002614
2373	Ga0316177_1165457
2374	Ga0316176_1145635
2375	Ga0314311_1019612
2376	Ga0314311_1084958
2377	Ga0316178_1061339
2378	Ga0316183_1093439
2379	Ga0316183_1162789
2380	Ga0316183_1174315
2381	Ga0316181_1090505
2382	Ga0265330_10000116
2383	Ga0265332_10000003
2384	Ga0265332_10000012
2385	Ga0265332_10000033
2386	Ga0265325_10007177
2387	Ga0265340_10056000
2388	Ga0265331_10000006
2389	Ga0265327_10000001
2390	Ga0265327_10000049
2391	Ga0265327_10000798
2392	Ga0265327_10044922
2393	Ga0307513_10000014
2394	Ga0307513_10000019
2395	Ga0307513_10012715
2396	Ga0307513_10019068
2397	Ga0307513_10147427
2398	Ga0307513_10148518
2399	Ga0307513_10176591
2400	Ga0307509_10071671
2401	Ga0307509_10179427
2402	Ga0307408_100000020
2403	Ga0307408_100011048
2404	Ga0307408_100024832
2405	Ga0307408_100035977
2406	Ga0307408_100044323
2407	Ga0307408_100075697
2408	Ga0307408_100080766
2409	Ga0307408_100150165
2410	Ga0307408_100278762
2411	Ga0307408_100295096
2412	Ga0307508_10112483
2413	Ga0307514_10001125
2414	Ga0307514_10008781
2415	Ga0307514_10106507
2416	Ga0316575_10000138
2417	Ga0316575_10029883
2418	Ga0316579_10025936
2419	Ga0316579_10027749
2420	Ga0316579_10030600
2421	Ga0265314_10000029
2422	Ga0265314_10005268
2423	Ga0265314_10024671
2424	Ga0265314_10034512
2425	Ga0316576_10000111
2426	Ga0316576_10004205
2427	Ga0316576_10037777
2428	Ga0316576_10090890
2429	Ga0316576_10161610
2430	Ga0316578_10002226
2431	Ga0316578_10033864
2432	Ga0316578_10077036
2433	Ga0307516_10006735
2434	Ga0307516_10043969
2435	Ga0307405_10002086
2436	Ga0307405_10004473
2437	Ga0307405_10015127
2438	Ga0307405_10032537
2439	Ga0307405_10077115
2440	Ga0316577_10062893
2441	Ga0316577_10074258
2442	Ga0307413_10004156
2443	Ga0307413_10057078
2444	Ga0307518_10131298
2445	Ga0307410_10001553
2446	Ga0307406_10000178
2447	Ga0307406_10000505
2448	Ga0307406_10008832
2449	Ga0307406_10248885
2450	Ga0307407_10003421
2451	Ga0307407_10062192
2452	Ga0307407_10094250
2453	Ga0307412_10002073
2454	Ga0307412_10031473
2455	Ga0307412_10054709
2456	Ga0307412_10061526
2457	Ga0307412_10072118
2458	Ga0307412_10086868
2459	Ga0307412_10100552
2460	Ga0307409_100000015
2461	Ga0307409_100035588
2462	Ga0307409_100047441
2463	Ga0307416_100000138
2464	Ga0307414_10037379
2465	Ga0307414_10120348
2466	Ga0307414_10146213
2467	Ga0307411_10042190
2468	Ga0307411_10123617
2469	Ga0307415_100001768
2470	Ga0307415_100048368
2471	Ga0316583_10005041
2472	Ga0316583_10033410
2473	Ga0316583_10045324
2474	Ga0316580_10007364
2475	Ga0316593_10015135
2476	Ga0307507_10000090
2477	Ga0307510_10000009
2478	Ga0307510_10016374
2479	Ga0307510_10030629
2480	Ga0316592_1009497
2481	Ga0316586_1004284
2482	Ga0316586_1007462
2483	Ga0316587_1004502
2484	Ga0316587_1016477
2485	Ga0316596_1010863
2486	Ga0316596_1020885
2487	Ga0373944_0003538
2488	Ga0373936_0018269
2489	Ga0373945_0000855
2490	Ga0373954_0042059
2491	Ga0373943_0002078
2492	Ga0373946_0004768
2493	Ga0373942_0004061
2494	Ga0316574_0003852
2495	Ga0316574_0006709
2496	Ga0316574_0025896
2497	Ga0316574_0077729
2498	Ga0373924_0009036
2499	Ga0373935_0016263
2500	Ga0373927_0003917
2501	Ga0373927_0149454
2502	Ga0373947_0078367
2503	Ga0373937_0013115
2504	Ga0316582_0000873
2505	Ga0316582_0016084
2506	Ga0316582_0043181
2507	Ga0316584_0008780
2508	Ga0316584_0032725
2509	Ga0316584_0099844
2510	Ga0316584_0151414
2511	Ga0373925_0003143
2512	Ga0373925_0004751
2513	Ga0395899_0012444
2514	Ga0395899_0139380
2515	Ga0395900_0007913
2516	Ga0395900_0058978
2517	Ga0395900_0245020
2518	Ga0395900_0290311
2519	Ga0395900_0324384
2520	Ga0395898_0008707
2521	Ga0395898_0041290
2522	Ga0395898_0087958
2523	Ga0395905_0000421
2524	Ga0395905_0006752
2525	Ga0395905_0074312
2526	Ga0395905_0152648
2527	Ga0436364_0049303
2528	Ga0395901_0016740
2529	Ga0395901_0120638
2530	Ga0395901_0207423
2531	Ga0400490_03855
2532	Ga0400483_017318
2533	Ga0400483_101085
2534	Ga0400483_147535
2535	Ga0400483_268849
2536	Ga0436360_1263943
2537	Ga0436361_0160207
2538	Ga0436361_0200270
2539	Ga0436361_0442101
2540	Ga0436361_0544128
2541	Ga0436361_0572917
2542	Ga0436361_1148233
2543	Ga0439436_0000138
2544	Ga0439436_0001818
2545	Ga0439438_001842
2546	Ga0439438_001948
2547	Ga0439438_002481
2548	Ga0439438_006466
2549	Ga0439438_007515
2550	Ga0439438_010612
2551	Ga0439438_012365
2552	Ga0439438_014653
2553	Ga0439438_019261
2554	Ga0439438_022238
2555	Ga0439438_022371
2556	Ga0439447_001126
2557	Ga0439447_006157
2558	Ga0439447_006722
2559	Ga0439447_017208
2560	Ga0439466_0001318
2561	Ga0439466_0001689
2562	Ga0439466_0005601
2563	Ga0439466_0007320
2564	Ga0439466_0013558
2565	Ga0439466_0013846
2566	Ga0439466_0014258
2567	Ga0439466_0030847
2568	Ga0439466_0031853
2569	Ga0451791_0140369
2570	Ga0451853_2692520
2571	Ga0451853_3310022
2572	Ga0439442_001679
2573	Ga0439442_003187
2574	Ga0439442_005695
2575	Ga0439442_007164
2576	Ga0439445_0001026
2577	Ga0439448_0056989
2578	Ga0439432_014042
2579	Ga0439432_015231
2580	Ga0439432_020579
2581	Ga0439432_050335
2582	Ga0439449_0004493
2583	Ga0439449_0004625
2584	Ga0439451_005260
2585	Ga0439452_001086
2586	Ga0439452_002005
2587	Ga0439452_005451
2588	Ga0439452_020021
2589	Ga0439456_001525
2590	Ga0439456_021075
2591	Ga0439463_003818
2592	Ga0439463_006913
2593	Ga0450911_000723
2594	Ga0450911_002416
2595	Ga0450920_003684
2596	Ga0450920_021789
2597	Ga0450922_001378
2598	Ga0450890_004121
2599	Ga0450898_008554
2600	Ga0450903_002198
2601	Ga0450903_003627
2602	Ga0450906_001427
2603	Ga0450906_002475
2604	Ga0450907_004153
2605	Ga0450907_006980
2606	Ga0450907_010887
2607	Ga0450908_000493
2608	Ga0450908_002247
2609	Ga0450908_005161
2610	Ga0450908_006674
2611	Ga0439434_0006636
2612	Ga0439434_0022258
2613	Ga0439435_0000022
2614	Ga0439435_0022174
2615	Ga0439464_0004446
2616	Ga0439464_0007291
2617	Ga0439464_0029767
2618	Ga0450918_001411
2619	Ga0451577_0187857
2620	Ga0466969_0030782
2621	Ga0453683_0012491
2622	Ga0453683_0025390
2623	Ga0453683_0034078
2624	Ga0466965_0000307
2625	Ga0466965_0008582
2626	Ga0466966_0000823
2627	Ga0466966_0113694
2628	Ga0466961_0002256
2629	Ga0466961_0007903
2630	Ga0466961_0013122
2631	Ga0466961_0020864
2632	Ga0466963_0000120
2633	Ga0466963_0113056
2634	Ga0466964_0008855
2635	Ga0453684_0155070
2636	Ga0453684_0251482
2637	Ga0466971_0000158
2638	Ga0466971_0004232
2639	Ga0466971_0047759
2640	Ga0466970_0000653
2641	Ga0466970_0032783
2642	Ga0466970_0107638
2643	Ga0466957_0000565
2644	Ga0466960_0000375
2645	Ga0466959_0003565
2646	Ga0466959_0209940
2647	Ga0451576_0000492
2648	Ga0451576_0008715
2649	Ga0451576_0342005
2650	Ga0466958_0000064
2651	Ga0466958_0059251
2652	Ga0466958_0148066
2653	Ga0466967_0000207
2654	Ga0466967_0069371
2655	Ga0495617_000419
2656	Ga0495617_010992
2657	Ga0495617_011341
2658	Ga0495617_045579
2659	Ga0495627_004232
2660	Ga0495627_009904
2661	Ga0495627_015563
2662	Ga0495627_016444
2663	Ga0495603_0001278
2664	Ga0495603_0053806
2665	Ga0495603_0087552
2666	Ga0495590_0000311
2667	Ga0495590_0002272
2668	Ga0495590_0017911
2669	Ga0495590_0023350
2670	Ga0495591_005006
2671	Ga0495591_005182
2672	Ga0495591_008931
2673	Ga0495591_016701
2674	Ga0495591_026752
2675	Ga0495629_0001057
2676	Ga0495638_0000690
2677	Ga0495638_0005968
2678	Ga0495638_0009156
2679	Ga0495638_0021865
2680	Ga0495638_0022412
2681	Ga0495638_0050623
2682	Ga0495638_0094164
2683	Ga0495638_0125659
2684	Ga0495638_0201175
2685	Ga0495641_0020992
2686	Ga0495651_0000646
2687	Ga0495651_0120592
2688	Ga0495653_0040212
2689	Ga0495653_0043497
2690	Ga0495653_0047939
2691	Ga0495653_0065228
2692	Ga0495653_0077378
2693	Ga0495650_0000254
2694	Ga0495650_0010806
2695	Ga0495650_0015050
2696	Ga0495650_0058664
2697	Ga0495650_0058849
2698	Ga0495650_0073013
2699	Ga0495605_0000152
2700	Ga0495605_0003305
2701	Ga0495605_0009172
2702	Ga0495605_0054444
2703	Ga0495605_0056403
2704	Ga0495639_0003410
2705	Ga0495662_0024046
2706	Ga0495584_0003579
2707	Ga0495584_0011393
2708	Ga0495584_0023705
2709	Ga0495584_0059484
2710	Ga0495584_0066578
2711	Ga0495584_0072515
2712	Ga0495584_0095164
2713	Ga0495584_0143288
2714	Ga0495585_0002697
2715	Ga0495585_0004014
2716	Ga0495585_0016536
2717	Ga0495585_0017338
2718	Ga0495585_0028914
2719	Ga0495585_0049782
2720	Ga0495585_0117920
2721	Ga0495594_0025112
2722	Ga0495594_0050960
2723	Ga0495594_0056704
2724	Ga0495596_0004342
2725	Ga0495607_0008226
2726	Ga0495607_0024512
2727	Ga0495607_0032477
2728	Ga0495607_0047283
2729	Ga0495607_0056231
2730	Ga0495607_0073720
2731	Ga0495607_0099526
2732	Ga0495607_0117212
2733	Ga0495583_0018804
2734	Ga0495583_0021265
2735	Ga0495583_0024995
2736	Ga0495583_0028527
2737	Ga0495583_0034276
2738	Ga0495583_0053399
2739	Ga0495583_0083878
2740	Ga0495606_0004950
2741	Ga0495606_0008316
2742	Ga0495606_0021464
2743	Ga0495606_0025613
2744	Ga0495606_0036586
2745	Ga0495606_0051628
2746	Ga0495606_0067722
2747	Ga0495606_0071930
2748	Ga0495606_0146951
2749	Ga0495608_0162800
2750	Ga0495610_0004852
2751	Ga0495610_0023130
2752	Ga0495610_0025046
2753	Ga0495610_0034354
2754	Ga0495610_0045744
2755	Ga0495616_0002064
2756	Ga0495616_0010258
2757	Ga0495616_0018249
2758	Ga0495616_0038139
2759	Ga0495616_0057492
2760	Ga0495616_0061435
2761	Ga0495620_0013582
2762	Ga0495620_0019141
2763	Ga0495620_0029780
2764	Ga0495630_0083442
2765	Ga0495631_0003311
2766	Ga0495631_0006697
2767	Ga0495631_0016236
2768	Ga0495632_0014317
2769	Ga0495632_0034155
2770	Ga0495632_0036777
2771	Ga0495632_0047812
2772	Ga0495632_0052882
2773	Ga0495632_0081407
2774	Ga0495637_0001495
2775	Ga0495637_0012561
2776	Ga0495637_0016665
2777	Ga0495637_0022274
2778	Ga0495637_0023314
2779	Ga0495637_0031551
2780	Ga0495637_0039038
2781	Ga0495637_0072443
2782	Ga0495643_0032050
2783	Ga0495643_0037125
2784	Ga0495643_0060483
2785	Ga0495643_0079608
2786	Ga0495644_0037645
2787	Ga0495648_0000274
2788	Ga0495648_0001541
2789	Ga0495648_0006414
2790	Ga0495648_0012181
2791	Ga0495648_0016062
2792	Ga0495648_0023973
2793	Ga0495648_0030090
2794	Ga0495648_0031607
2795	Ga0495648_0046737
2796	Ga0495648_0047997
2797	Ga0495648_0053072
2798	Ga0495648_0054797
2799	Ga0495663_0015746
2800	Ga0495666_0050817
2801	Ga0495642_0002842
2802	Ga0495642_0004228
2803	Ga0495642_0011523
2804	Ga0495642_0015934
2805	Ga0495642_0019757
2806	Ga0495642_0023678
2807	Ga0495652_0050172
2808	Ga0495654_0013072
2809	Ga0495654_0014527
2810	Ga0495654_0022792
2811	Ga0495654_0028076
2812	Ga0495654_0036253
2813	Ga0495654_0036527
2814	Ga0495654_0038506
2815	Ga0495654_0040898
2816	Ga0495654_0052619
2817	Ga0495654_0063601
2818	Ga0495654_0084069
2819	Ga0495654_0097376
2820	Ga0495665_0001906
2821	Ga0495665_0112556
2822	Ga0495586_0079153
2823	Ga0495609_0006819
2824	Ga0495609_0031484
2825	Ga0495609_0032935
2826	Ga0495609_0039141
2827	Ga0495597_0000477
2828	Ga0495597_0001172
2829	Ga0495597_0005204
2830	Ga0495597_0015990
2831	Ga0495597_0019402
2832	Ga0495597_0031645
2833	Ga0495597_0038142
2834	Ga0495597_0039801
2835	Ga0495597_0053963
2836	Ga0495597_0095733
2837	Ga0495645_0002166
2838	Ga0495645_0105897
2839	Ga0495622_0012351
2840	Ga0495622_0032432
2841	Ga0495622_0042600
2842	Ga0495622_0092611
2843	Ga0495633_0018782
2844	Ga0495633_0019960
2845	Ga0495633_0074594
2846	Ga0495667_0106370
2847	Ga0495656_0000221
2848	Ga0495656_0012748
2849	Ga0495656_0023037
2850	Ga0495668_0017235
2851	Ga0495668_0035550
2852	Ga0495668_0054775
2853	Ga0495668_0067312
2854	Ga0495634_0028485
2855	Ga0495611_0004389
2856	Ga0495611_0043506
2857	Ga0495625_0000197
2858	Ga0495625_0007062
2859	Ga0495625_0014742
2860	Ga0495625_0021990
2861	Ga0495625_0032446
2862	Ga0495625_0043510
2863	Ga0495625_0073312
2864	Ga0495625_0125699
2865	Ga0495625_0149239
2866	Ga0495635_0011014
2867	Ga0495635_0026960
2868	Ga0495635_0030513
2869	Ga0495659_0000040
2870	Ga0495659_0025721
2871	Ga0495661_0000348
2872	Ga0495661_0007080
2873	Ga0495661_0009327
2874	Ga0495661_0034500
2875	Ga0495661_0079320
2876	Ga0495661_0098562
2877	Ga0495588_0022541
2878	Ga0495588_0029999
2879	Ga0495588_0063300
2880	Ga0495623_0024842
2881	Ga0495623_0041129
2882	Ga0495646_0090837
2883	Ga0495669_0041078
2884	Ga0495613_0006465
2885	Ga0495613_0047629
2886	Ga0495624_0010903
2887	Ga0495670_0015225
2888	Ga0495670_0019138
2889	Ga0495670_0021409
2890	Ga0495671_0013014
2891	Ga0495671_0027762
2892	Ga0495671_0039701
2893	Ga0495671_0040390
2894	Ga0495671_0054844
2895	Ga0495671_0058621
2896	Ga0495671_0059730
2897	Ga0495671_0095599
2898	Ga0495649_0000571
2899	Ga0495649_0009534
2900	Ga0495649_0018434
2901	Ga0495649_0023723
2902	Ga0495649_0048384
2903	Ga0495649_0070961
2904	Ga0495649_0071009
2905	Ga0495649_0119615
2906	Ga0495589_0014806
2907	Ga0495589_0034929
2908	Ga0495589_0041163
2909	Ga0495589_0089205
2910	Ga0495589_0100169
2911	Ga0495600_0034578
2912	Ga0495600_0043455
2913	Ga0495600_0051406
2914	Ga0495600_0151359
2915	Ga0495600_0212463
2916	Ga0495660_0000852
2917	Ga0495660_0017765
2918	Ga0495660_0024102
2919	Ga0495660_0025621
2920	Ga0495660_0033046
2921	Ga0495660_0042675
2922	Ga0495660_0045590
2923	Ga0495660_0049378
2924	Ga0495660_0051607
2925	Ga0495660_0077262
2926	Ga0495660_0084517
2927	Ga0495660_0102574
2928	Ga0495660_0104948
2929	Ga0495660_0111350
2930	Ga0495660_0132777
2931	Ga0495581_0026016
2932	Ga0495581_0039125
2933	Ga0495581_0056157
2934	Ga0495581_0056419
2935	Ga0495581_0062217
2936	Ga0495581_0189128
2937	Ga0495604_0031057
2938	Ga0495604_0069025
2939	Ga0495674_0003165
2940	Ga0495674_0231885
2941	Ga0495672_0000136
2942	Ga0495672_0028549
2943	Ga0495672_0029929
2944	Ga0495672_0030524
2945	Ga0495672_0031290
2946	Ga0495672_0043880
2947	Ga0495672_0051294
2948	Ga0495672_0057028
2949	Ga0495676_0010324
2950	Ga0495676_0041144
2951	Ga0495676_0055931
2952	Ga0495680_0008487
2953	Ga0495680_0071799
2954	Ga0495680_0073605
2955	Ga0495680_0095059
2956	Ga0495680_0123845
2957	Ga0495683_0014433
2958	Ga0495683_0019660
2959	Ga0495683_0064884
2960	Ga0495687_003317
2961	Ga0495687_011357
2962	Ga0495687_015066
2963	Ga0495687_016835
2964	Ga0495675_0034380
2965	Ga0495675_0139309
2966	Ga0495677_0012467
2967	Ga0495679_008826
2968	Ga0495679_012135
2969	Ga0495679_019635
2970	Ga0495679_030992
2971	Ga0495685_003555
2972	Ga0495673_0000470
2973	Ga0495673_0003288
2974	Ga0495673_0003698
2975	Ga0495673_0004242
2976	Ga0495673_0007229
2977	Ga0495673_0013100
2978	Ga0495673_0013139
2979	Ga0495673_0014605
2980	Ga0495673_0015571
2981	Ga0495673_0019237
2982	Ga0495673_0027436
2983	Ga0495673_0030250
2984	Ga0495673_0030694
2985	Ga0495673_0070805
2986	Ga0495673_0079593
2987	Ga0495681_0007528
2988	Ga0495681_0008957
2989	Ga0495681_0011782
2990	Ga0495681_0015638
2991	Ga0495681_0019441
2992	Ga0495681_0020884
2993	Ga0495681_0030089
2994	Ga0495681_0044945
2995	Ga0495681_0060150
2996	Ga0495684_0010235
2997	Ga0495684_0057634
2998	Ga0495684_0066398
2999	Ga0495686_0001077
3000	Ga0495686_0003271
3001	Ga0495686_0005700
3002	Ga0495686_0023849
3003	Ga0495686_0030077
3004	Ga0495686_0034795
3005	Ga0495686_0053249
3006	Ga0495686_0124775
3007	Ga0495686_0143086
3008	Ga0495593_0067661
3009	Ga0495602_0060466
3010	Ga0495602_0148492
3011	Ga0495602_0226987
3012	Ga0495614_0000477
3013	Ga0495614_0017584
3014	Ga0495626_0002989
3015	Ga0495626_0004591
3016	Ga0495626_0005932
3017	Ga0495626_0005986
3018	Ga0495626_0014079
3019	Ga0495626_0016898
3020	Ga0495626_0018282
3021	Ga0495626_0032805
3022	Ga0496100_0071260
3023	Ga0496101_0003964
3024	Ga0496102_0001247
3025	Ga0496102_0006177
3026	Ga0496102_0008207
3027	Ga0496102_0010101
3028	Ga0496102_0014650
3029	Ga0496102_0112072
3030	Ga0496102_0149378
3031	Ga0496103_0003305
3032	Ga0496103_0009348
3033	Ga0496103_0080536
3034	Ga0496104_0004823
3035	Ga0496104_0038354
3036	Ga0496104_0052579
3037	Ga0496104_0302236
3038	Ga0496105_0002650
3039	Ga0496105_0060437
3040	Ga0496105_0149548
3041	Ga0496105_0152803
3042	Ga0496106_0004823
3043	Ga0496107_0050128
3044	Ga0496108_0087016
3045	Ga0496110_0176537
3046	Ga0496110_0191882
3047	Ga0496112_0005803
3048	Ga0496112_0177893
3049	Ga0496113_0011897
3050	Ga0496115_0130884
3051	Ga0496116_0000943
3052	Ga0496116_0009275
3053	Ga0496116_0011789
3054	Ga0496116_0015154
3055	Ga0496116_0078289
3056	Ga0496116_0135175
3057	Ga0496117_0007953
3058	Ga0496117_0017503
3059	Ga0496117_0021965
3060	Ga0496117_0095479
3061	Ga0496117_0164845
3062	Ga0496118_0004899
3063	Ga0496118_0008847
3064	Ga0496118_0047119
3065	Ga0496118_0077011
3066	Ga0496118_0092538
3067	Ga0496118_0137542
3068	Ga0496119_0001823
3069	Ga0496119_0008519
3070	Ga0496119_0065325
3071	Ga0496120_0000042
3072	Ga0496120_0016914
3073	Ga0496120_0026078
3074	Ga0496121_0004935
3075	Ga0496121_0013475
3076	Ga0496121_0017904
3077	Ga0496121_0032738
3078	Ga0496121_0060163
3079	Ga0496122_0000224
3080	Ga0496122_0001311
3081	Ga0496122_0108992
3082	Ga0496123_0000187
3083	Ga0496123_0002525
3084	Ga0496123_0075482
3085	Ga0496123_0077598
3086	Ga0496124_0005554
3087	Ga0496124_0006344
3088	Ga0496124_0027632
3089	Ga0496124_0039679
3090	Ga0496124_0040365
3091	Ga0496124_0049974
3092	Ga0496124_0053110
3093	Ga0496124_0123921
3094	Ga0496125_0001129
3095	Ga0496125_0014244
3096	Ga0496125_0021482
3097	Ga0496125_0021884
3098	Ga0496125_0026943
3099	Ga0496125_0162468
3100	Ga0496125_0162616
3101	Ga0496125_0186634
3102	Ga0496126_0001122
3103	Ga0496126_0050559
3104	Ga0496126_0058456
3105	Ga0496126_0069637
3106	Ga0496126_0083261
3107	Ga0495678_000734
3108	Ga0495678_000892
3109	Ga0495678_015103
3110	Ga0495678_016346
3111	Ga0495678_017940
3112	Ga0495678_036984
3113	Ga0495678_041186
3114	Ga0495678_044098
3115	Ga0495678_062713
3116	Ga0495682_0010986
3117	Ga0495682_0020007
3118	Ga0501290_002178
3119	Ga0501294_000001
3120	Ga0501300_000191
3121	Ga0501033_0201174
3122	Ga0501034_0000379
3123	Ga0501034_0001044
3124	Ga0501034_0002761
3125	Ga0501034_0100667
3126	Ga0501034_0208567
3127	Ga0501037_0044681
3128	Ga0501039_0011293
3129	Ga0501039_0084867
3130	Ga0501039_0288979
3131	Ga0501042_0026545
3132	Ga0501043_0024290
3133	Ga0501047_0009469
3134	Ga0501047_0009540
3135	Ga0501069_0000672
3136	Ga0501069_0077776
3137	Ga0501070_0076424
3138	Ga0501071_0005154
3139	Ga0501071_0082388
3140	Ga0501072_0085548
3141	Ga0501075_0037644
3142	Ga0501076_0086908
3143	Ga0501206_000314
3144	Ga0501235_014775
3145	Ga0501225_0003896
3146	Ga0501225_0006737
3147	Ga0501079_0227591
3148	Ga0501080_0001619
3149	Ga0501080_0002448
3150	Ga0501080_0161824
3151	Ga0501083_0010630
3152	Ga0501241_005788
3153	Ga0501262_000056
3154	Ga0501280_008718
3155	Ga0501282_000001
3156	Ga0501044_0025399
3157	nmdc:mga03683_11778_c1
3158	nmdc:mga03683_18817_c1
3159	nmdc:mga03683_24512_c1
3160	nmdc:mga03683_2543_c1
3161	nmdc:mga03683_68793_c1
3162	nmdc:mga03n38_41052_c1
3163	nmdc:mga03n38_54511_c1
3164	nmdc:mga03n38_93965_c1
3165	nmdc:mga0yw44_110686_c1
3166	nmdc:mga0yw44_20037_c1
3167	nmdc:mga0yw44_331_c2
3168	nmdc:mga0yw44_37630_c1
3169	nmdc:mga0yw44_878_c1
3170	nmdc:mga0k408_119369_c1
3171	nmdc:mga0k408_3816_c1
3172	nmdc:mga0k408_42121_c1
3173	nmdc:mga0k408_53806_c1
3174	nmdc:mga0k408_95516_c1
3175	nmdc:mga06z11_5469_c1
3176	nmdc:mga04h51_10138_c1
3177	nmdc:mga07m45_21074_c1
3178	nmdc:mga07m45_26200_c1
3179	nmdc:mga07m45_5154_c1
3180	nmdc:mga07m45_59483_c1
3181	nmdc:mga07m45_65075_c1
3182	nmdc:mga07m45_8090_c1
3183	nmdc:mga07m45_81849_c1
3184	nmdc:mga07m45_83260_c1
3185	nmdc:mga07m45_872_c1
3186	nmdc:mga07m45_93182_c1
3187	nmdc:mga06r32_231803_c1
3188	nmdc:mga08y16_11899_c1
3189	nmdc:mga08y16_245227_c1
3190	nmdc:mga0n895_280_c1
3191	nmdc:mga0rr50_179908_c1
3192	nmdc:mga0rr50_350_c1
3193	nmdc:mga08x19_210498_c1
3194	nmdc:mga0a205_1570_c1
3195	nmdc:mga0sz30_28123_c1
3196	nmdc:mga0sz30_34691_c1
3197	nmdc:mga0sz30_492_c1
3198	nmdc:mga0sz30_7096_c1
3199	Ga0495601_0005164
3200	Ga0495601_0057403
3201	Ga0495601_0071296
3202	Ga0500578_0000597
3203	Ga0500578_0089362
3204	Ga0500578_0097222
3205	Ga0500643_000040
3206	Ga0500646_0015646
3207	Ga0500583_0037307
3208	Ga0500583_0052934
3209	Ga0500641_0001787
3210	Ga0500641_0017906
3211	Ga0500654_050727
3212	Ga0500555_005318
3213	Ga0500556_0000150
3214	Ga0500556_0032001
3215	Ga0500562_001784
3216	Ga0500562_002430
3217	Ga0500569_002375
3218	Ga0500572_005648
3219	Ga0500594_0000535
3220	Ga0500595_012649
3221	Ga0500595_013850
3222	Ga0500652_003456
3223	Ga0500658_0005366
3224	Ga0500561_0001399
3225	Ga0500564_000387
3226	Ga0500568_0004905
3227	Ga0500568_0011540
3228	Ga0500577_0030551
3229	Ga0500600_0024394
3230	Ga0500604_0000093
3231	Ga0500616_0016933
3232	Ga0500622_0003196
3233	Ga0500622_0006152
3234	Ga0500633_0003384
3235	Ga0500634_0016794
3236	Ga0500634_0021049
3237	Ga0500645_000100
3238	Ga0500645_001458
3239	Ga0500645_006225
3240	Ga0500656_001303
3241	Ga0500552_001657
3242	Ga0500587_000973
3243	Ga0501082_0009073
3244	Ga0466962_0001580
3245	Ga0466962_0005899
3246	Ga0530510_0181580
3247	2508541121
3248	2509154290
3249	2511245776
3250	2511257289
3251	2511266924
3252	2511267349
3253	2511272915
3254	2511278956
3255	2511291227
3256	2511293764
3257	2511300525
3258	2511315498
3259	2511320331
3260	2511323560
3261	2511330717
3262	2511336795
3263	2511342573
3264	2511348117
3265	2511357038
3266	2511363215
3267	2511368309
3268	2511414952
3269	2511826800
3270	2512324394
3271	2548499292
3272	2548697355
3273	2554817284
3274	2555672003
3275	2583794499
3276	2585149561
3277	2587919883
3278	2597860084
3279	2597862099
3280	2599353832
3281	2599360490
3282	2599366812
3283	2599373601
3284	2599378940
3285	2599386082
3286	2599392460
3287	2599404226
3288	2599460666
3289	2599470212
3290	2599482923
3291	2599489687
3292	2599502845
3293	2599508014
3294	2599510967
3295	2599615126
3296	2599771322
3297	2599803372
3298	2599879433
3299	2599888735
3300	2599890341
3301	2599900744
3302	2599930127
3303	2599945348
3304	2599947931
3305	2599955620
3306	2599960988
3307	2599969443
3308	2599980874
3309	2599985830
3310	2599990627
3311	2599996384
3312	2600001987
3313	2600005716
3314	2600014750
3315	2600020638
3316	2600027170
3317	2600027867
3318	2600033414
3319	2600049332
3320	2600055171
3321	2600061597
3322	2600064214
3323	2600071094
3324	2600080604
3325	2600213280
3326	2600357034
3327	2600365355
3328	2600443513
3329	2601625917
3330	2601690697
3331	2601773447
3332	2601799695
3333	2602009033
3334	2606074120
3335	2606126235
3336	2608382928
3337	2624482665
3338	2624490270
3339	2643731952
3340	2643842015
3341	2643866125
3342	2643955425
3343	2643994115
3344	2644023777
3345	2644033156
3346	2644041721
3347	2644057651
3348	2644072262
3349	2644161003
3350	2644185880
3351	2644223488
3352	2644237230
3353	2644255010
3354	2644285812
3355	2644292939
3356	2644328197
3357	2644359200
3358	2644394636
3359	2644469585
3360	2644623784
3361	2644631475
3362	2644647955
3363	2652543785
3364	2671093027
3365	2671096411
3366	2671125653
3367	2671771059
3368	2671840256
3369	2677898652
3370	2678265173
3371	2715752007
3372	2715755363
3373	2718635877
3374	2723246990
3375	2738738367
3376	2738808891
3377	2738842819
3378	2738896251
3379	2739196484
3380	2739241925
3381	2739251636
3382	2739257458
3383	2739273566
3384	2739314469
3385	2739342610
3386	2739603677
3387	2743739618
3388	2744954099
3389	2745005630
3390	2772641521
3391	2774122081
3392	2774133546
3393	2774858412
3394	2776259538
3395	2784262567
3396	2784314326
3397	2784471052
3398	2792462166
3399	2793076490
3400	2794595523
3401	2808855810
3402	2808874920
3403	2808921982
3404	2808933366
3405	2808935891
3406	2808942301
3407	2808944103
3408	2808955452
3409	2808959672
3410	2808964317
3411	2808975026
3412	2808991335
3413	2808999205
3414	2809218571
3415	2812368563
3416	2816470773
3417	2816511757
3418	2817510206
3419	2819654232
3420	2819701504
3421	2823425123
3422	2824672921
3423	2824689435
3424	2824705347
3425	2824755512
3426	2824763796
3427	2825655934
3428	2834028789
3429	2842137210
3430	2842680418
3431	2842682469
3432	2842830101
3433	2842837520
3434	2842838901
3435	2842845304
3436	2842856336
3437	2843746074
3438	2844666169
3439	2847935653
3440	2849561674
3441	2851156755
3442	2852615724
3443	2852660590
3444	2852670692
3445	2855672093
3446	2855682864
3447	2857294674
3448	2857505865
3449	2857728166
3450	2858854342
3451	2858888398
3452	2858891704
3453	2858899157
3454	2860344534
3455	2860868824
3456	2862513857
3457	2867304125
3458	2867313460
3459	2867322719
3460	2869054918
3461	2869066597
3462	2869072949
3463	2878034595
3464	2880235242
3465	2880493917
3466	2880498424
3467	2881673405
3468	2885194260
3469	2885412063
3470	2898330778
3471	2904455522
3472	2904461639
3473	2904462133
3474	2904521615
3475	2904552976
3476	2904698543
3477	2904716530
3478	2908762446
3479	2913041779
3480	2916702836
3481	2917075876
3482	2919069586
3483	2919388663
3484	2919447276
3485	2919459646
3486	2919464659
3487	2919487450
3488	2919490016
3489	2919501840
3490	2919703766
3491	2919704876
3492	2919719795
3493	2919720268
3494	2923158704
3495	2923522621
3496	2923590424
3497	2926063513
3498	2928532030
3499	2929149097
3500	2929212679
3501	2929220462
3502	2929227014
3503	2929526710
3504	2931373480
3505	2931397304
3506	2935356862
3507	2935678648
3508	2935687861
3509	2935714881
3510	2935726554
3511	2935733699
3512	2935743078
3513	2935754883
3514	2939636954
3515	2940559740
3516	2945929769
3517	2945947911
3518	2945950272
3519	2945966019
3520	2945975074
3521	2969309391
3522	2974289250
3523	2984287465
3524	2984570038
3525	2988730700
3526	2990714180
3527	2998144652
3528	3007396766
3529	3007398335
3530	3007516416
3531	3007615658
3532	3007622775
3533	3007858365
3534	3007866119
3535	3007867560
3536	637322419
3537	8002783916
3538	8002789688
3539	8003835212
3540	8003871321
3541	8006987614
3542	8011354864
3543	8015692790
3544	8019619231
3545	8019633888
3546	8019773660
3547	8019782059
3548	8029996227
3549	8034963096
3550	8054352773
3551	8054504403
3552	8054710129
3553	8054731124
3554	8054735262
3555	8055776024
3556	8055818832
3557	8056130894
3558	8056132723
3559	8056144289
3560	8056155673
3561	8056161425
3562	8056171904
3563	8056172585
3564	8056179784
3565	8056574915
3566	8056692469
3567	8056972170
3568	8057804908

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00441

Acyl-CoA_dh_1

Acyl-CoA dehydrogenase, C-terminal domain

283

432

0.99 PF02771

Acyl-CoA_dh_N

Acyl-CoA dehydrogenase, N-terminal domain

57

168

0.98 PF02770

Acyl-CoA_dh_M

Acyl-CoA dehydrogenase, middle domain

172

268

0.95 PF08028

Acyl-CoA_dh_2

Acyl-CoA dehydrogenase, C-terminal domain

298

421

0.95 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
2pg0-assembly1.cif.gz_A	crystal structure of acyl-coa dehydrogenase from geobacillus kaustophilus	0.9579	1	363
2pg0-assembly1.cif.gz_A	crystal structure of acyl-coa dehydrogenase from geobacillus kaustophilus	0.9528	1	363
1ivh-assembly1.cif.gz_B	structure of human isovaleryl-coa dehydrogenase at 2.6 angstroms resolution: structural basis for substrate specificity	0.949	1	363
5ol2-assembly2.cif.gz_F	the electron transferring flavoprotein/butyryl-coa dehydrogenase complex from clostridium difficile	0.9459	2	363
4l1f-assembly1.cif.gz_A	electron transferring flavoprotein of acidaminococcus fermentans: towards a mechanism of flavin-based electron bifurcation	0.9453	1	363

ID	Description	Score	Start	End	Superfamily
af_O33229_243_386_1.20.140.10	Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Butyryl-CoA Dehydrogenase, subunit A, domain 3	0.991	224	363	1.20.140.10
af_P28330_285_428_1.20.140.10	Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Butyryl-CoA Dehydrogenase, subunit A, domain 3	0.9893	224	363	1.20.140.10
af_A0A0R0F201_274_433_1.20.140.10	Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Butyryl-CoA Dehydrogenase, subunit A, domain 3	0.9801	220	363	1.20.140.10
af_Q9VSL9_273_416_1.20.140.10	Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Butyryl-CoA Dehydrogenase, subunit A, domain 3	0.9749	223	363	1.20.140.10
af_Q86A74_271_424_1.20.140.10	Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Butyryl-CoA Dehydrogenase, subunit A, domain 3	0.9731	224	363	1.20.140.10

ID	Description	Score	Start	End	GO Terms
AF-A0A1V4Q524-F1-model_v4	Acyl-CoA dehydrogenase	0.9946	261	363	GO:0003995 GO:0005737 GO:0033539 GO:0050660
AF-A0A848DKD1-F1-model_v4	Acyl-CoA dehydrogenase	0.9918	201	363	GO:0003995 GO:0005737 GO:0033539 GO:0050660
AF-A0A351SK13-F1-model_v4	Acyl-CoA dehydrogenase	0.9917	200	363	GO:0003995 GO:0005737 GO:0033539 GO:0050660
AF-A0A7S1CJ75-F1-model_v4	Acyl-CoA dehydrogenase/oxidase C-terminal domain-containing protein	0.9865	216	364	GO:0004466 GO:0005739 GO:0016401 GO:0019254 GO:0033539 GO:0042758 GO:0050660
AF-A0A3D3T7N8-F1-model_v4	Acyl-CoA dehydrogenase	0.9789	233	363	GO:0003995 GO:0005737 GO:0033539 GO:0050660

F495694

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF00441

Acyl-CoA_dh_1

Acyl-CoA dehydrogenase, C-terminal domain

283

432

0.99

PF02771

Acyl-CoA_dh_N

Acyl-CoA dehydrogenase, N-terminal domain

57

168

0.98

PF02770

Acyl-CoA_dh_M

Acyl-CoA dehydrogenase, middle domain

172

268

0.95

PF08028

Acyl-CoA_dh_2

Acyl-CoA dehydrogenase, C-terminal domain

298

421

0.95

Structural Annotation

Top 5 Hits

Map