F495696
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1785 | 649 | 3567 | 408 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|2932082852|2932088224 |
| Length | 479 |
| Sequence | GYQSFYHIKILNSNFVITLVGISRCPILRLHARWPHITYNLMVLLTIFFCIVLLVLLVSLVKINPFIAFLIVSIIAGLLLGIPINKVTASVQKGMGDILGQLLIIICLGAMLGKLVAVSGAAQKIAGVLVAAVGEKYIQWALVAAGFIIGIPLFYGIGFVLMVPLIFSVVYKYKLPAVYIGLPMLASLSVTHGFLPPHPSPSALVALFHANMATTFIYGLMIAIPAIILAGPVFAQFLKKIPSEPLATFRAEELPAEKLPGAFNSFFTALLPVLLLMLTAFFPYLNIQDPGVAKFITFLGDPSIVMLIALMVATYTLGVKQGKSMGQLAGNFTDAVKDVALILLIIAGSGAFKEVLTASGVSSQIAAQLQSFNLPPLLLGWVIAAIIRVSLGSATVAGLTAAGIVAPLVLQNHINPNLMVLSIGAGSLAFSHVNDSGFWLYKEYFNLSIKDTIKSWSLMETLVSVIGLAGVTVINLFIK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2010549000 | Rice roots microbial communities from plants at IRRI, Los Banos, Philippines - endophytes | Metagenome | Endosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 4 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 5 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 6 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 7 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 8 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 9 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 10 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 11 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 12 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 13 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 14 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 15 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 16 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 17 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 18 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 19 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 20 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 21 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 22 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 23 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 24 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 25 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 26 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 27 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 28 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 29 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 30 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 31 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 32 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 33 | 3300005272 | Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 | Metagenome | Rhizosphere |
| 34 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 35 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 36 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 37 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 41 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 44 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 46 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 48 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 50 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 66 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 67 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 68 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 69 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 70 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 71 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 76 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 78 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 79 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 80 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 82 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 83 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 84 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 85 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 86 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 87 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 88 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 89 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 90 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 91 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 92 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 93 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 94 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 95 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 96 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 97 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 99 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 100 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 101 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 102 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 103 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 105 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 106 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 107 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 136 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 140 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 141 | 3300015679 | Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.4_F08 | Metagenome | Unclassified |
| 142 | 3300015680 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.2_H03 | Metagenome | Rhizosphere |
| 143 | 3300015682 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 | Metagenome | Rhizosphere |
| 144 | 3300015684 | Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.2_F02 | Metagenome | Unclassified |
| 145 | 3300015685 | Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 | Metagenome | Unclassified |
| 146 | 3300015687 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 | Metagenome | Rhizosphere |
| 147 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 149 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 150 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 151 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 152 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 153 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 154 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 155 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 156 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 157 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 158 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 159 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 160 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 161 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 162 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 163 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 164 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 165 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 166 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 167 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 168 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 169 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 170 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 171 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 172 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 173 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 174 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 175 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 234 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 236 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 237 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 241 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 242 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 243 | 3300030083 | Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JPPOOL-T1 | Metagenome | Unclassified |
| 244 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 245 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 246 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 247 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 248 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 249 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 250 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 251 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 252 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 253 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 254 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 255 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 256 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 257 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 258 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 259 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 260 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 261 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 262 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 263 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 264 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 265 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 266 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 267 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 268 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 269 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 270 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 271 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 272 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 273 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 274 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 275 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 276 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 277 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 278 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 279 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 280 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 281 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 282 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 283 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 284 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 285 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 286 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 287 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 288 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 289 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 290 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 291 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 292 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 293 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 294 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 295 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 296 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 297 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 298 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 299 | 3300044669 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2E | Metagenome | Unclassified |
| 300 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 301 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 302 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 303 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 304 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 305 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 306 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 307 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 308 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 309 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 310 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 311 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 312 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 313 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 314 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 366 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 367 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 368 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 369 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 370 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 371 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 372 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 373 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 374 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 375 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 376 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 377 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 378 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 379 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 380 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 381 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 382 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 383 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 384 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 385 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 386 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 387 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 388 | 3300049133 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 389 | 3300049134 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 390 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 393 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 394 | 3300049550 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 395 | 3300049552 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 396 | 3300049556 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 397 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 398 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 399 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 400 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 401 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 402 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 403 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 404 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 405 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 406 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 407 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 408 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 409 | 3300049650 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought | Metagenome | Rhizosphere |
| 410 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 411 | 3300049670 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought | Metagenome | Rhizosphere |
| 412 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 413 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 414 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 415 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 416 | 3300049761 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control | Metagenome | Rhizosphere |
| 417 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 418 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 419 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 420 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 421 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 422 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 423 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 424 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 425 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 426 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 427 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 428 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 429 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 430 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 431 | 3300053106 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 endosphere | Metagenome | Endosphere |
| 432 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 433 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 434 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 435 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 436 | 3300053126 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere | Metagenome | Endosphere |
| 437 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 438 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 439 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 440 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 441 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 442 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 443 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 444 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 445 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 446 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 447 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 448 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 449 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 450 | 3300053726 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 endosphere | Metagenome | Endosphere |
| 451 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 452 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 453 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 454 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 455 | 2932082852 | Mucilaginibacter sp. 3215 | Isolate | Rhizosphere |
| 456 | 2506520007 | Serratia plymuthica AS9 | Isolate | Rhizosphere |
| 457 | 2506520008 | Serratia plymuthica AS12 | Isolate | Unclassified |
| 458 | 2508501071 | Serratia proteamaculans S4 | Isolate | Rhizosphere |
| 459 | 2510917020 | Caulobacter sp. AP07 | Isolate | Rhizosphere |
| 460 | 2511231025 | Pantoea sp. YR343 | Isolate | Rhizosphere |
| 461 | 2511231035 | Pantoea sp. GM01 | Isolate | Rhizosphere |
| 462 | 2547132181 | Kosakonia sacchari SP1 | Isolate | Stem |
| 463 | 2547132416 | Enterobacter sp. MR1 | Isolate | Rhizoplane |
| 464 | 2561511199 | Enterobacter sp. R4-368 | Isolate | Nodule |
| 465 | 2582581280 | Caulobacter henricii CF287 | Isolate | Rhizosphere |
| 466 | 2582581293 | Caulobacter henricii YR570 | Isolate | Rhizosphere |
| 467 | 2585427687 | Pedobacter borealis DSM 19626 | Isolate | Rhizosphere |
| 468 | 2599185169 | Klebsiella quasipneumoniae NFPP35 | Isolate | Rhizoplane |
| 469 | 2599185184 | Mucilaginibacter sp. NFR10 | Isolate | Rhizoplane |
| 470 | 2599185299 | Pantoea ananatis NFR11 | Isolate | Rhizoplane |
| 471 | 2599185353 | Staphylococcus sp. NFPP34 | Isolate | Rhizoplane |
| 472 | 2600254943 | Staphylococcus pasteuri NFIX07 | Isolate | Rhizoplane |
| 473 | 2600255254 | Klebsiella quasipneumoniae NFIX15 | Isolate | Rhizoplane |
| 474 | 2600255255 | Klebsiella quasipneumoniae NFIX23 | Isolate | Rhizoplane |
| 475 | 2600255256 | Enterobacter sp. NFIX08 | Isolate | Rhizoplane |
| 476 | 2600255257 | Enterobacter sp. NFIX03 | Isolate | Rhizoplane |
| 477 | 2600255280 | Klebsiella quasipneumoniae NFIX42 | Isolate | Rhizoplane |
| 478 | 2600255281 | Klebsiella quasipneumoniae NFIX43 | Isolate | Rhizoplane |
| 479 | 2600255287 | Klebsiella quasipneumoniae NFIX11 | Isolate | Rhizoplane |
| 480 | 2600255288 | Klebsiella quasipneumoniae NFIX14 | Isolate | Rhizoplane |
| 481 | 2600255289 | Klebsiella quasipneumoniae NFIX16 | Isolate | Rhizoplane |
| 482 | 2600255290 | Klebsiella quasipneumoniae NFIX17 | Isolate | Rhizoplane |
| 483 | 2600255291 | Klebsiella quasipneumoniae NFIX19 | Isolate | Rhizoplane |
| 484 | 2600255298 | Klebsiella quasipneumoniae NFIX21 | Isolate | Rhizoplane |
| 485 | 2600255299 | Klebsiella quasipneumoniae NFIX22 | Isolate | Rhizoplane |
| 486 | 2600255300 | Klebsiella quasipneumoniae NFIX30 | Isolate | Rhizoplane |
| 487 | 2600255301 | Klebsiella quasipneumoniae NFIX33 | Isolate | Rhizoplane |
| 488 | 2600255302 | Klebsiella quasipneumoniae NFIX35 | Isolate | Rhizoplane |
| 489 | 2600255303 | Klebsiella quasipneumoniae NFIX36 | Isolate | Rhizoplane |
| 490 | 2600255304 | Klebsiella quasipneumoniae NFIX37 | Isolate | Rhizoplane |
| 491 | 2600255305 | Klebsiella quasipneumoniae NFIX41 | Isolate | Rhizoplane |
| 492 | 2600255306 | Klebsiella quasipneumoniae NFIX44 | Isolate | Rhizoplane |
| 493 | 2600255307 | Klebsiella quasipneumoniae NFIX56 | Isolate | Rhizoplane |
| 494 | 2600255309 | Klebsiella sp. NFIX53 | Isolate | Rhizoplane |
| 495 | 2600255310 | Enterobacter sp. NFIX06 | Isolate | Rhizoplane |
| 496 | 2600255311 | Enterobacter sp. NFIX04 | Isolate | Rhizoplane |
| 497 | 2600255392 | Klebsiella quasipneumoniae NFIX54 | Isolate | Rhizoplane |
| 498 | 2602042046 | Enterobacter sp. NFIX09 | Isolate | Rhizoplane |
| 499 | 2602042047 | Enterobacter sp. NFIX59 | Isolate | Rhizoplane |
| 500 | 2602042052 | Klebsiella quasipneumoniae NFIX18 | Isolate | Rhizoplane |
| 501 | 2602042053 | Klebsiella quasipneumoniae NFIX12 | Isolate | Rhizoplane |
| 502 | 2602042066 | Enterobacter sp. NFIX45 | Isolate | Rhizoplane |
| 503 | 2602042067 | Enterobacter sp. NFIX58 | Isolate | Rhizoplane |
| 504 | 2602042103 | Klebsiella quasipneumoniae NFIX29 | Isolate | Rhizoplane |
| 505 | 2602042104 | Klebsiella quasipneumoniae NFIX26 | Isolate | Rhizoplane |
| 506 | 2602042105 | Klebsiella quasipneumoniae NFIX25 | Isolate | Rhizoplane |
| 507 | 2602042106 | Klebsiella quasipneumoniae NFIX13 | Isolate | Rhizoplane |
| 508 | 2602042109 | Klebsiella aerogenes NFIX39 | Isolate | Rhizoplane |
| 509 | 2602042110 | Klebsiella quasipneumoniae NFIX40 | Isolate | Rhizoplane |
| 510 | 2602042111 | Klebsiella quasipneumoniae NFIX20 | Isolate | Rhizoplane |
| 511 | 2603880178 | Klebsiella quasipneumoniae NFIX34 | Isolate | Rhizoplane |
| 512 | 2603880184 | Klebsiella quasipneumoniae NFIX27 | Isolate | Rhizoplane |
| 513 | 2603880202 | Klebsiella quasipneumoniae NFIX38 | Isolate | Rhizoplane |
| 514 | 2603880211 | Klebsiella quasipneumoniae NFIX24 | Isolate | Rhizoplane |
| 515 | 2608642108 | Pantoea agglomerans NFPP29 | Isolate | Rhizoplane |
| 516 | 2609459761 | Enterobacter sp. NFR05 | Isolate | Rhizoplane |
| 517 | 2636415599 | Klebsiella variicola DX120E | Isolate | Unclassified |
| 518 | 2643221556 | Massilia sp. Root1485 | Isolate | Unclassified |
| 519 | 2643221600 | Flavobacterium sp. Root186 | Isolate | Unclassified |
| 520 | 2643221667 | Flavobacterium sp. Root420 | Isolate | Unclassified |
| 521 | 2643221684 | Massilia sp. Root133 | Isolate | Unclassified |
| 522 | 2643221716 | Flavobacterium sp. Root901 | Isolate | Unclassified |
| 523 | 2643221725 | Flavobacterium sp. Root935 | Isolate | Unclassified |
| 524 | 2648501693 | Pantoea ananatis B1-9 | Isolate | Rhizosphere |
| 525 | 2654587920 | Serratia plymuthica HRO-C48 | Isolate | Rhizosphere |
| 526 | 2667528172 | Enterobacteriaceae bacterium NFIX31 | Isolate | Rhizoplane |
| 527 | 2675903046 | Klebsiella quasipneumoniae NFIX52 | Isolate | Rhizoplane |
| 528 | 2681812866 | Enterobacter asburiae NFIX55 | Isolate | Rhizoplane |
| 529 | 2681812869 | Enterobacter ludwigii NFPP41 | Isolate | Rhizoplane |
| 530 | 2684622997 | Pantoea ananatis NFIX48 | Isolate | Rhizoplane |
| 531 | 2687453601 | Serratia plymuthica 3Rp8 | Isolate | Unclassified |
| 532 | 2706794495 | Dickeya zeae ZJU1202 | Isolate | Unclassified |
| 533 | 2721755487 | Sphingobacterium sp. B29 | Isolate | Rhizosphere |
| 534 | 2738541276 | Cellvibrio sp. YR554 | Isolate | Unclassified |
| 535 | 2738541278 | Niastella sp. CF465 | Isolate | Unclassified |
| 536 | 2738541279 | Flavobacterium sp. GV069 | Isolate | Unclassified |
| 537 | 2738541283 | Pedobacter sp. OK701 | Isolate | Unclassified |
| 538 | 2738541285 | Flavobacterium sp. GV030 | Isolate | Unclassified |
| 539 | 2738541302 | Pedobacter sp. CF074 | Isolate | Unclassified |
| 540 | 2738543007 | Flavobacterium sp. GV063 | Isolate | Unclassified |
| 541 | 2739367651 | Pedobacter sp. OK291 | Isolate | Unclassified |
| 542 | 2739367656 | Pedobacter sp. CF523 | Isolate | Unclassified |
| 543 | 2739367663 | Pedobacter sp. YR510 | Isolate | Unclassified |
| 544 | 2739367857 | Flavobacterium sp. GV029 | Isolate | Unclassified |
| 545 | 2739367858 | Flavobacterium sp. GV028 | Isolate | Unclassified |
| 546 | 2751185917 | Enterobacter sp. HK169 | Isolate | Unclassified |
| 547 | 2765235842 | Enterobacter ludwigii AA4 | Isolate | Unclassified |
| 548 | 2772190666 | Serratia surfactantfaciens YD25 | Isolate | Unclassified |
| 549 | 2775507074 | Klebsiella sp. D5A | Isolate | Unclassified |
| 550 | 2791355010 | Kosakonia pseudosacchari NN143 | Isolate | Unclassified |
| 551 | 2791355275 | Enterobacter sp. Sa187 | Isolate | Unclassified |
| 552 | 2802428842 | Flavobacterium sp. S87F.05.LMB.W.Kidney.N | Isolate | Unclassified |
| 553 | 2806310673 | Serratia quinivorans NCTC 13189 | Isolate | Rhizosphere |
| 554 | 2808606414 | Pantoea sp. SJZ147 | Isolate | Rhizosphere |
| 555 | 2811995292 | Kosakonia oryzae Ola 51 | Isolate | Unclassified |
| 556 | 2814123068 | Kosakonia radicincitans GXGL-4A | Isolate | Rhizosphere |
| 557 | 2818991437 | Pedobacter terrae 518 | Isolate | Unclassified |
| 558 | 2818991460 | Chitinophaga polysaccharea 1209 | Isolate | Unclassified |
| 559 | 2821136567 | Chitinophaga sancti 1232 | Isolate | Unclassified |
| 560 | 2823373977 | Enterobacter ludwigii NCR3 | Isolate | Rhizosphere |
| 561 | 2842711865 | Duganella sp. R-73148 | Isolate | Unclassified |
| 562 | 2842722452 | Pedobacter sp. R-72249 | Isolate | Unclassified |
| 563 | 2842903701 | Olivibacter sp. R-72191 | Isolate | Unclassified |
| 564 | 2842909656 | Pedobacter sp. R-72393 | Isolate | Unclassified |
| 565 | 2844425489 | Enterobacter cloacae SBP-8 | Isolate | Rhizosphere |
| 566 | 2844528606 | Pantoea sp. R-72498 v. 2 | Isolate | Unclassified |
| 567 | 2847797336 | Pantoea ananatis NN08200 | Isolate | Unclassified |
| 568 | 2849281842 | Pedobacter sp. AK013 | Isolate | Rhizosphere |
| 569 | 2852623160 | Mucilaginibacter sp. AK015 | Isolate | Rhizosphere |
| 570 | 2854601825 | Dickeya dianthicola SS70 | Isolate | Stem Tuber |
| 571 | 2855195626 | Pectobacterium atrosepticum SS26 | Isolate | Stem Tuber |
| 572 | 2857558681 | Duganella sp. R-74565 | Isolate | Unclassified |
| 573 | 2857564685 | Duganella sp. R-74599 | Isolate | Unclassified |
| 574 | 2857618242 | Flavobacterium sp. R-74482 | Isolate | Unclassified |
| 575 | 2857627736 | Pedobacter sp. R-74587 | Isolate | Unclassified |
| 576 | 2865014394 | Pantoea sp. R-71966 | Isolate | Unclassified |
| 577 | 2869551831 | Serratia inhibens PRI-2C | Isolate | Rhizosphere |
| 578 | 2871282230 | Pectobacterium parmentieri SS90 | Isolate | Stem Tuber |
| 579 | 2876601092 | Pantoea endophytica 596 | Isolate | Unclassified |
| 580 | 2881359912 | Flavobacterium ustbae T13 | Isolate | Rhizosphere |
| 581 | 2881609920 | Pantoea sp. ARC607 | Isolate | Rhizosphere |
| 582 | 2883068021 | Chitinophaga rhizosphaerae T16R-86 | Isolate | Rhizosphere |
| 583 | 2884086401 | Kluyvera sp. PO2S7 | Isolate | Rhizosphere |
| 584 | 2884634485 | Algoriphagus kandeliae XY-J91 | Isolate | Unclassified |
| 585 | 2884791551 | Chitinophaga oryzae 1310 | Isolate | Unclassified |
| 586 | 2884933994 | Mucilaginibacter sp. 14171R-50 | Isolate | Rhizosphere |
| 587 | 2888366609 | Serratia sp. NGAS9 | Isolate | Rhizosphere |
| 588 | 2896109856 | Chitinophaga sp. SYP-B3965 | Isolate | Rhizosphere |
| 589 | 2896317667 | Sphingobacterium sp. SGR-19 | Isolate | Rhizosphere |
| 590 | 2904424332 | Duganella sp. 1411 | Isolate | Rhizosphere |
| 591 | 2904445276 | Pedobacter terrae 1734 | Isolate | Rhizosphere |
| 592 | 2904467357 | Chitinophaga sancti 3198 | Isolate | Unclassified |
| 593 | 2904504865 | Serratia marcescens 1822 | Isolate | Unclassified |
| 594 | 2904513164 | Klebsiella variicola 1431 | Isolate | Rhizosphere |
| 595 | 2904780799 | Sphingobacterium sp. 1304 | Isolate | Rhizosphere |
| 596 | 2910245624 | Adhaeribacter radiodurans KUDC8001 | Isolate | Rhizosphere |
| 597 | 2911138879 | Spirosoma sp. KUDC1026 | Isolate | Rhizosphere |
| 598 | 2914759650 | Rhizosphaericola mali | Isolate | Rhizosphere |
| 599 | 2919177583 | Sphingobacterium sp. 2149 | Isolate | Rhizosphere |
| 600 | 2919191525 | Flavobacterium sp. 2755 | Isolate | Rhizosphere |
| 601 | 2919437846 | Mucilaginibacter pocheonensis 3262 | Isolate | Rhizosphere |
| 602 | 2919683626 | Flavobacterium piscis 4129 | Isolate | Unclassified |
| 603 | 2919692658 | Algoriphagus sp. 4150 | Isolate | Rhizosphere |
| 604 | 2923634449 | Enterobacter kobei SLBN-76 | Isolate | Rhizosphere |
| 605 | 2927833300 | Enterobacter sp. SLBN-59 | Isolate | Rhizosphere |
| 606 | 2928078545 | Mucilaginibacter rubeus 1215 | Isolate | Unclassified |
| 607 | 2928147474 | Mucilaginibacter rubeus 2025 | Isolate | Unclassified |
| 608 | 2928519762 | Leuconostoc citreum 1377 | Isolate | Rhizosphere |
| 609 | 2929150217 | Flavobacterium sp. R-74510 Hybrid assembly | Isolate | Unclassified |
| 610 | 2929177148 | Chitinophaga sp. R-72269 Hybrid assembly | Isolate | Unclassified |
| 611 | 2929239360 | Chitinophaga sp. R-73072 Hybrid assembly | Isolate | Unclassified |
| 612 | 2929921140 | Chitinophaga sp. R-72609 Hybrid assembly | Isolate | Unclassified |
| 613 | 2932406140 | Serratia sp. 2723 | Isolate | Rhizosphere |
| 614 | 2935625433 | Kosakonia sp. 1610 | Isolate | Rhizosphere |
| 615 | 2937539931 | Pantoea sp. LS15 | Isolate | Unclassified |
| 616 | 2937967321 | Serratia sp. YC16 | Isolate | Unclassified |
| 617 | 2939573065 | Citrobacter sp. 506 | Isolate | Rhizosphere |
| 618 | 2939577877 | Serratia sp. 509 | Isolate | Rhizosphere |
| 619 | 2939602548 | Pantoea dispersa 1175 | Isolate | Rhizosphere |
| 620 | 2939617950 | Kosakonia cowanii 2056 | Isolate | Rhizosphere |
| 621 | 2945874760 | Phytobacter diazotrophicus UAEU22 | Isolate | Rhizosphere |
| 622 | 2945951305 | Pantoea agglomerans W2I1 | Isolate | Rhizosphere |
| 623 | 2945977869 | Chitinophaga sp. W2I13 | Isolate | Rhizosphere |
| 624 | 2945997725 | Pedobacter sp. W3I1 | Isolate | Rhizosphere |
| 625 | 2946013367 | Chitinophaga sp. W3I9 | Isolate | Rhizosphere |
| 626 | 2954016120 | Flavobacterium sp. W4I14 | Isolate | Rhizosphere |
| 627 | 2969079654 | Klebsiella variicola E57-7 | Isolate | Unclassified |
| 628 | 2974310843 | Enterobacter sp. SORGH_AS 287 | Isolate | Unclassified |
| 629 | 2974435778 | Kosakonia cowanii SORGH_AS 304 | Isolate | Unclassified |
| 630 | 2978975091 | Pantoea anthophila SORGH_AS 797 | Isolate | Unclassified |
| 631 | 2984494565 | Pantoea ananatis SORGH_AS197 | Isolate | Aerial Root |
| 632 | 2984559226 | Klebsiella variicola SORGH_AS834 | Isolate | Aerial Root |
| 633 | 2984595703 | Klebsiella variicola SORGH_AS1070 | Isolate | Aerial Root |
| 634 | 2990261002 | Pantoea ananatis SORGH_AS213 | Isolate | Aerial Root |
| 635 | 640753048 | Serratia proteamaculans 568 | Isolate | Endosphere |
| 636 | 8003151029 | Chitinophaga sp. GbtcB8 | Isolate | Unclassified |
| 637 | 8004592986 | Serratia sp. S119 | Isolate | Unclassified |
| 638 | 8007371054 | Clostridium sp. YIM B02515 | Isolate | Unclassified |
| 639 | 8015394850 | Serratia sp. PGPR-27 | Isolate | Rhizosphere |
| 640 | 8016733728 | Pantoea sp. SORGH_AS 659 | Isolate | Unclassified |
| 641 | 8018221730 | Enterobacter sp. CM29 | Isolate | Unclassified |
| 642 | 8018405270 | Enterobacter sp. 198 | Isolate | Rhizosphere |
| 643 | 8019499862 | Kluyvera sp. 1366 | Isolate | Rhizosphere |
| 644 | 8019504834 | Atlantibacter hermannii 1903 | Isolate | Rhizosphere |
| 645 | 8047673197 | Telluria mixta LMG 11547 | Isolate | Rhizosphere |
| 646 | 8054307821 | Flavobacterium soyae SCIV07 | Isolate | Rhizosphere |
| 647 | 8055588893 | Parapedobacter lycopersici KACC 18788 | Isolate | Rhizosphere |
| 648 | 8055592153 | Flavobacterium panacis DCY106 | Isolate | Rhizosphere |
| 649 | 8056440228 | Flavobacterium hibisci THG-HG1.4 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 88.01 |
| Metatranscriptomes | 0.39 |
| Isolates | 11.6 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.22 |
| Bulb | 0 |
| Endosphere | 7.62 |
| Nodule | 1.34 |
| Rhizoplane | 4.15 |
| Rhizosphere | 71.99 |
| Stem | 0.06 |
| Stem Tuber | 0.17 |
| Unclassified | 3.08 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | RicEn_C3870 | 2010549000 | Bacteria | 1571 |
| 2 | SwRhRL2b_contig_631140 | 2162886007 | Bacteria | 2668 |
| 3 | MBSR1b_contig_5928364 | 2162886012 | Bacteria | 2176 |
| 4 | JGI24740J21852_10003107 | 3300001979 | Bacteria | 7325 |
| 5 | JGI24740J21852_10012470 | 3300001979 | Bacteria | 3201 |
| 6 | JGI24737J22298_10031040 | 3300001990 | Bacteria | 1670 |
| 7 | JGI24735J21928_10000028 | 3300002067 | Bacteria | 83192 |
| 8 | JGI24735J21928_10005158 | 3300002067 | Bacteria | 4349 |
| 9 | JGI24735J21928_10008798 | 3300002067 | Bacteria | 3257 |
| 10 | JGI24735J21928_10019190 | 3300002067 | Bacteria | 2103 |
| 11 | JGI24738J21930_10003820 | 3300002075 | Bacteria | 3763 |
| 12 | JGI25162J39368_1000047 | 3300002737 | Viruses | 167507 |
| 13 | JGI25162J39368_1000183 | 3300002737 | Bacteria | 67086 |
| 14 | JGI25162J39368_1000496 | 3300002737 | Bacteria | 29876 |
| 15 | JGI25154J39366_1000080 | 3300002738 | Bacteria | 89374 |
| 16 | JGI25152J39213_1000513 | 3300002773 | Bacteria | 21560 |
| 17 | JGI25150J39212_1000008 | 3300002774 | Bacteria | 253098 |
| 18 | JGI25151J46595_10000014 | 3300003187 | Bacteria | 253098 |
| 19 | JGI25151J46595_10000887 | 3300003187 | Bacteria | 23572 |
| 20 | JGI25151J46595_10002451 | 3300003187 | Bacteria | 11134 |
| 21 | JGI25151J46595_10005962 | 3300003187 | Bacteria | 6209 |
| 22 | JGI25165J46597_1000043 | 3300003214 | Bacteria | 264515 |
| 23 | JGI25165J46597_1000802 | 3300003214 | Bacteria | 23746 |
| 24 | JGI25153J46596_10000020 | 3300003215 | Bacteria | 252978 |
| 25 | JGI25153J46596_10002621 | 3300003215 | Bacteria | 10289 |
| 26 | rootH1_10000810 | 3300003316 | Bacteria | 14027 |
| 27 | rootH1_10002962 | 3300003316 | Bacteria | 28463 |
| 28 | rootH1_10036744 | 3300003316 | Bacteria | 7438 |
| 29 | rootH1_10055138 | 3300003316 | Bacteria | 12061 |
| 30 | rootH2_10000230 | 3300003320 | Bacteria | 58157 |
| 31 | rootH2_10003679 | 3300003320 | Bacteria | 27278 |
| 32 | rootH2_10011814 | 3300003320 | Bacteria | 7172 |
| 33 | rootH2_10013605 | 3300003320 | Bacteria | 52813 |
| 34 | rootH2_10024296 | 3300003320 | Bacteria | 9925 |
| 35 | rootH2_10051442 | 3300003320 | Bacteria | 9098 |
| 36 | rootH2_10056661 | 3300003320 | Bacteria | 4153 |
| 37 | rootH2_10071853 | 3300003320 | Bacteria | 2648 |
| 38 | rootH2_10118897 | 3300003320 | Bacteria | 5944 |
| 39 | rootH2_10123222 | 3300003320 | Bacteria | 2334 |
| 40 | rootH2_10141248 | 3300003320 | Bacteria | 5566 |
| 41 | rootH2_10161859 | 3300003320 | Bacteria | 1622 |
| 42 | rootL2_10027207 | 3300003322 | Bacteria | 1957 |
| 43 | rootL2_10054875 | 3300003322 | Unclassified | 3038 |
| 44 | rootL2_10067288 | 3300003322 | Bacteria | 5234 |
| 45 | rootL2_10070945 | 3300003322 | Bacteria | 5850 |
| 46 | rootL2_10127765 | 3300003322 | Bacteria | 6430 |
| 47 | rootL2_10154743 | 3300003322 | Bacteria | 3057 |
| 48 | rootL2_10200472 | 3300003322 | Bacteria | 5412 |
| 49 | rootH1_10000727 | 3300003316 | Bacteria | 46114 |
| 50 | rootH1_10000727 | 3300003323 | Bacteria | 5388 |
| 51 | rootH1_10003785 | 3300003323 | Bacteria | 131157 |
| 52 | rootH1_10018881 | 3300003323 | Bacteria | 66058 |
| 53 | rootH1_10034687 | 3300003323 | Bacteria | 4802 |
| 54 | rootH1_10040702 | 3300003323 | Bacteria | 5264 |
| 55 | rootH1_10047799 | 3300003323 | Bacteria | 17409 |
| 56 | rootH1_10051913 | 3300003323 | Bacteria | 15080 |
| 57 | rootH1_10060101 | 3300003323 | Bacteria | 3840 |
| 58 | rootH1_10104912 | 3300003323 | Bacteria | 6713 |
| 59 | rootH1_10109702 | 3300003323 | Bacteria | 4605 |
| 60 | rootH1_10119890 | 3300003323 | Bacteria | 1483 |
| 61 | rootH1_10178156 | 3300003323 | Bacteria | 4609 |
| 62 | rootH1_10198885 | 3300003323 | Bacteria | 2889 |
| 63 | rootH1_10228699 | 3300003323 | Bacteria | 4590 |
| 64 | rootH1_10367847 | 3300003323 | Bacteria | 2971 |
| 65 | JGI25160J50197_1001583 | 3300003354 | Bacteria | 11221 |
| 66 | JGI25160J50197_1001791 | 3300003354 | Bacteria | 10388 |
| 67 | Ga0006562J51391_1029369 | 3300003578 | Bacteria | 1830 |
| 68 | Ga0055532_1000238 | 3300003758 | Bacteria | 40402 |
| 69 | Ga0055525_1000028 | 3300003759 | Bacteria | 331683 |
| 70 | Ga0055542_1007574 | 3300003762 | Bacteria | 2194 |
| 71 | Ga0055526_1000131 | 3300003771 | Bacteria | 66529 |
| 72 | Ga0055537_1000100 | 3300003773 | Bacteria | 64929 |
| 73 | Ga0055536_1000036 | 3300003781 | Bacteria | 141730 |
| 74 | Ga0055536_1005098 | 3300003781 | Bacteria | 6514 |
| 75 | Ga0055534_1000085 | 3300003784 | Bacteria | 72934 |
| 76 | Ga0055528_1000458 | 3300003790 | Bacteria | 32517 |
| 77 | Ga0055530_10001821 | 3300003791 | Bacteria | 14730 |
| 78 | Ga0055531_10000015 | 3300003794 | Bacteria | 182104 |
| 79 | Ga0055531_10000132 | 3300003794 | Bacteria | 85251 |
| 80 | Ga0058692_1000146 | 3300003856 | Bacteria | 44864 |
| 81 | Ga0058692_1000443 | 3300003856 | Bacteria | 18845 |
| 82 | Ga0058692_1001071 | 3300003856 | Bacteria | 10687 |
| 83 | Ga0065165_1004837 | 3300005262 | Bacteria | 8009 |
| 84 | Ga0065165_1015046 | 3300005262 | Bacteria | 2968 |
| 85 | Ga0065703_1018789 | 3300005272 | Bacteria | 7950 |
| 86 | Ga0065714_10003442 | 3300005288 | Bacteria | 8456 |
| 87 | Ga0065714_10005093 | 3300005288 | Bacteria | 4170 |
| 88 | Ga0065714_10064423 | 3300005288 | Bacteria | 257266 |
| 89 | Ga0065704_10000577 | 3300005289 | Bacteria | 18026 |
| 90 | Ga0065704_10071197 | 3300005289 | Bacteria | 12576 |
| 91 | Ga0065704_10071631 | 3300005289 | Bacteria | 10443 |
| 92 | Ga0065704_10101511 | 3300005289 | Bacteria | 2235 |
| 93 | Ga0065715_10012402 | 3300005293 | Bacteria | 3201 |
| 94 | Ga0065715_10134393 | 3300005293 | Bacteria | 1956 |
| 95 | Ga0070658_10000014 | 3300005327 | Bacteria | 244978 |
| 96 | Ga0070658_10000721 | 3300005327 | Bacteria | 28601 |
| 97 | Ga0070658_10038243 | 3300005327 | Bacteria | 3870 |
| 98 | Ga0070658_10043816 | 3300005327 | Bacteria | 3615 |
| 99 | Ga0070658_10079035 | 3300005327 | Bacteria | 2701 |
| 100 | Ga0070658_10226872 | 3300005327 | Bacteria | 1581 |
| 101 | Ga0070676_10000207 | 3300005328 | Bacteria | 25090 |
| 102 | Ga0070676_10000487 | 3300005328 | Bacteria | 18936 |
| 103 | Ga0070676_10003430 | 3300005328 | Bacteria | 8260 |
| 104 | Ga0070676_10009602 | 3300005328 | Bacteria | 5227 |
| 105 | Ga0070676_10064499 | 3300005328 | Unclassified | 2184 |
| 106 | Ga0070683_100000859 | 3300005329 | Bacteria | 22458 |
| 107 | Ga0070683_100002782 | 3300005329 | Bacteria | 13982 |
| 108 | Ga0070683_100014746 | 3300005329 | Bacteria | 6846 |
| 109 | Ga0070683_100034878 | 3300005329 | Bacteria | 4598 |
| 110 | Ga0070690_100008784 | 3300005330 | Bacteria | 5833 |
| 111 | Ga0070690_100009170 | 3300005330 | Bacteria | 5725 |
| 112 | Ga0070690_100139300 | 3300005330 | Bacteria | 1646 |
| 113 | Ga0070670_100026107 | 3300005331 | Bacteria | 5028 |
| 114 | Ga0070670_100046396 | 3300005331 | Bacteria | 3736 |
| 115 | Ga0070670_100211792 | 3300005331 | Bacteria | 1685 |
| 116 | Ga0070677_10002635 | 3300005333 | Bacteria | 5739 |
| 117 | Ga0068869_100000107 | 3300005334 | Bacteria | 39252 |
| 118 | Ga0068869_100013547 | 3300005334 | Bacteria | 5427 |
| 119 | Ga0068869_100124699 | 3300005334 | Bacteria | 1974 |
| 120 | Ga0070666_10000432 | 3300005335 | Bacteria | 25632 |
| 121 | Ga0070666_10001827 | 3300005335 | Bacteria | 12978 |
| 122 | Ga0070666_10001999 | 3300005335 | Bacteria | 12408 |
| 123 | Ga0070666_10041185 | 3300005335 | Unclassified | 3085 |
| 124 | Ga0070680_100000224 | 3300005336 | Bacteria | 37398 |
| 125 | Ga0070680_100001771 | 3300005336 | Bacteria | 15858 |
| 126 | Ga0070680_100019931 | 3300005336 | Bacteria | 5317 |
| 127 | Ga0070682_100000299 | 3300005337 | Bacteria | 34539 |
| 128 | Ga0070682_100012301 | 3300005337 | Bacteria | 4904 |
| 129 | Ga0070682_100038149 | 3300005337 | Bacteria | 2945 |
| 130 | Ga0068868_100000256 | 3300005338 | Bacteria | 36252 |
| 131 | Ga0068868_100010309 | 3300005338 | Bacteria | 6760 |
| 132 | Ga0068868_100011101 | 3300005338 | Bacteria | 6552 |
| 133 | Ga0068868_100014519 | 3300005338 | Bacteria | 5806 |
| 134 | Ga0070660_100006203 | 3300005339 | Bacteria | 8274 |
| 135 | Ga0070660_100014661 | 3300005339 | Bacteria | 5654 |
| 136 | Ga0070660_100020365 | 3300005339 | Bacteria | 4874 |
| 137 | Ga0070660_100201502 | 3300005339 | Bacteria | 1614 |
| 138 | Ga0070660_100212195 | 3300005339 | Bacteria | 1572 |
| 139 | Ga0070689_100192319 | 3300005340 | Bacteria | 1662 |
| 140 | Ga0070689_100200100 | 3300005340 | Bacteria | 1631 |
| 141 | Ga0070691_10006501 | 3300005341 | Bacteria | 5346 |
| 142 | Ga0070661_100006405 | 3300005344 | Bacteria | 8118 |
| 143 | Ga0070661_100025950 | 3300005344 | Bacteria | 4211 |
| 144 | Ga0070661_100040837 | 3300005344 | Bacteria | 3385 |
| 145 | Ga0070668_100001216 | 3300005347 | Bacteria | 18285 |
| 146 | Ga0070668_100030597 | 3300005347 | Bacteria | 4093 |
| 147 | Ga0070668_100033130 | 3300005347 | Bacteria | 3933 |
| 148 | Ga0070669_100006366 | 3300005353 | Bacteria | 8505 |
| 149 | Ga0070669_100041267 | 3300005353 | Unclassified | 3356 |
| 150 | Ga0070669_100177786 | 3300005353 | Unclassified | 1663 |
| 151 | Ga0070675_100011184 | 3300005354 | Bacteria | 7022 |
| 152 | Ga0070675_100014343 | 3300005354 | Bacteria | 6247 |
| 153 | Ga0070675_100050928 | 3300005354 | Bacteria | 3401 |
| 154 | Ga0070675_100064757 | 3300005354 | Unclassified | 3022 |
| 155 | Ga0070675_100078505 | 3300005354 | Bacteria | 2749 |
| 156 | Ga0070675_100189705 | 3300005354 | Bacteria | 1780 |
| 157 | Ga0070671_100001192 | 3300005355 | Bacteria | 19490 |
| 158 | Ga0070671_100001920 | 3300005355 | Bacteria | 15924 |
| 159 | Ga0070671_100004338 | 3300005355 | Bacteria | 11224 |
| 160 | Ga0070671_100005999 | 3300005355 | Bacteria | 9683 |
| 161 | Ga0070671_100052400 | 3300005355 | Bacteria | 3393 |
| 162 | Ga0070673_100000003 | 3300005364 | Bacteria | 216759 |
| 163 | Ga0070673_100001023 | 3300005364 | Bacteria | 15833 |
| 164 | Ga0070673_100011904 | 3300005364 | Bacteria | 5958 |
| 165 | Ga0070673_100015606 | 3300005364 | Bacteria | 5342 |
| 166 | Ga0070673_100034082 | 3300005364 | Unclassified | 3849 |
| 167 | Ga0070673_100048651 | 3300005364 | Bacteria | 3307 |
| 168 | Ga0070673_100069354 | 3300005364 | Bacteria | 2825 |
| 169 | Ga0070673_100105555 | 3300005364 | Unclassified | 2327 |
| 170 | Ga0070673_100134895 | 3300005364 | Bacteria | 2076 |
| 171 | Ga0070673_100169830 | 3300005364 | Bacteria | 1861 |
| 172 | Ga0070659_100003851 | 3300005366 | Bacteria | 10692 |
| 173 | Ga0070659_100027076 | 3300005366 | Bacteria | 4414 |
| 174 | Ga0070659_100031677 | 3300005366 | Bacteria | 4096 |
| 175 | Ga0070659_100038542 | 3300005366 | Bacteria | 3728 |
| 176 | Ga0070659_100078286 | 3300005366 | Bacteria | 2637 |
| 177 | Ga0070667_100001236 | 3300005367 | Bacteria | 23182 |
| 178 | Ga0070667_100006686 | 3300005367 | Bacteria | 9582 |
| 179 | Ga0070667_100012516 | 3300005367 | Bacteria | 7017 |
| 180 | Ga0070667_100013081 | 3300005367 | Bacteria | 6858 |
| 181 | Ga0070667_100025739 | 3300005367 | Bacteria | 4893 |
| 182 | Ga0070667_100108343 | 3300005367 | Unclassified | 2407 |
| 183 | Ga0070667_100119262 | 3300005367 | Bacteria | 2294 |
| 184 | Ga0070667_100145081 | 3300005367 | Unclassified | 2081 |
| 185 | Ga0070713_100135064 | 3300005436 | Bacteria | 2179 |
| 186 | Ga0070701_10077846 | 3300005438 | Bacteria | 1788 |
| 187 | Ga0070705_100011663 | 3300005440 | Bacteria | 4442 |
| 188 | Ga0070663_100035123 | 3300005455 | Bacteria | 3476 |
| 189 | Ga0070663_100052494 | 3300005455 | Bacteria | 2907 |
| 190 | Ga0070663_100059222 | 3300005455 | Bacteria | 2752 |
| 191 | Ga0070678_100005233 | 3300005456 | Bacteria | 7469 |
| 192 | Ga0070678_100013040 | 3300005456 | Bacteria | 5194 |
| 193 | Ga0070678_100168349 | 3300005456 | Bacteria | 1782 |
| 194 | Ga0070662_100000054 | 3300005457 | Bacteria | 60719 |
| 195 | Ga0070662_100005103 | 3300005457 | Bacteria | 8368 |
| 196 | Ga0070662_100008858 | 3300005457 | Bacteria | 6558 |
| 197 | Ga0070662_100111484 | 3300005457 | Bacteria | 2084 |
| 198 | Ga0070681_10042628 | 3300005458 | Bacteria | 4547 |
| 199 | Ga0070681_10051241 | 3300005458 | Bacteria | 4117 |
| 200 | Ga0070681_10094627 | 3300005458 | Bacteria | 2936 |
| 201 | Ga0070681_10260774 | 3300005458 | Bacteria | 1645 |
| 202 | Ga0068867_100000001 | 3300005459 | Bacteria | 427563 |
| 203 | Ga0068867_100004058 | 3300005459 | Bacteria | 10306 |
| 204 | Ga0068867_100018608 | 3300005459 | Bacteria | 4939 |
| 205 | Ga0068867_100067089 | 3300005459 | Bacteria | 2674 |
| 206 | Ga0068867_100072714 | 3300005459 | Bacteria | 2574 |
| 207 | Ga0068867_100101963 | 3300005459 | Bacteria | 2193 |
| 208 | Ga0068867_100179390 | 3300005459 | Bacteria | 1683 |
| 209 | Ga0070698_100093392 | 3300005471 | Bacteria | 2988 |
| 210 | Ga0070679_100000665 | 3300005530 | Bacteria | 29299 |
| 211 | Ga0070679_100009081 | 3300005530 | Bacteria | 9380 |
| 212 | Ga0070679_100012347 | 3300005530 | Bacteria | 8159 |
| 213 | Ga0070679_100089788 | 3300005530 | Bacteria | 3060 |
| 214 | Ga0070684_100000589 | 3300005535 | Bacteria | 25054 |
| 215 | Ga0070684_100024374 | 3300005535 | Bacteria | 5075 |
| 216 | Ga0070684_100045096 | 3300005535 | Bacteria | 3817 |
| 217 | Ga0070684_100149241 | 3300005535 | Bacteria | 2117 |
| 218 | Ga0068853_100002572 | 3300005539 | Bacteria | 13639 |
| 219 | Ga0068853_100003164 | 3300005539 | Bacteria | 12586 |
| 220 | Ga0068853_100004462 | 3300005539 | Bacteria | 10850 |
| 221 | Ga0068853_100010823 | 3300005539 | Bacteria | 7388 |
| 222 | Ga0068853_100016379 | 3300005539 | Bacteria | 6100 |
| 223 | Ga0068853_100023944 | 3300005539 | Bacteria | 5117 |
| 224 | Ga0070672_100002671 | 3300005543 | Bacteria | 11403 |
| 225 | Ga0070672_100034008 | 3300005543 | Bacteria | 3865 |
| 226 | Ga0070672_100036903 | 3300005543 | Bacteria | 3727 |
| 227 | Ga0070672_100054755 | 3300005543 | Bacteria | 3124 |
| 228 | Ga0070672_100102111 | 3300005543 | Bacteria | 2327 |
| 229 | Ga0070672_100110094 | 3300005543 | Bacteria | 2244 |
| 230 | Ga0070672_100220239 | 3300005543 | Unclassified | 1592 |
| 231 | Ga0070696_100063722 | 3300005546 | Bacteria | 2582 |
| 232 | Ga0070693_100121931 | 3300005547 | Unclassified | 1618 |
| 233 | Ga0070665_100000001 | 3300005548 | Bacteria | 1083363 |
| 234 | Ga0070665_100000010 | 3300005548 | Bacteria | 529545 |
| 235 | Ga0070665_100000117 | 3300005548 | Bacteria | 149831 |
| 236 | Ga0070665_100000858 | 3300005548 | Bacteria | 39506 |
| 237 | Ga0070665_100001604 | 3300005548 | Bacteria | 26025 |
| 238 | Ga0070665_100008265 | 3300005548 | Bacteria | 10522 |
| 239 | Ga0070665_100049509 | 3300005548 | Bacteria | 4215 |
| 240 | Ga0068855_100000033 | 3300005563 | Bacteria | 167299 |
| 241 | Ga0068855_100000097 | 3300005563 | Bacteria | 106474 |
| 242 | Ga0068855_100000189 | 3300005563 | Bacteria | 79227 |
| 243 | Ga0068855_100000361 | 3300005563 | Bacteria | 56312 |
| 244 | Ga0068855_100001432 | 3300005563 | Bacteria | 29672 |
| 245 | Ga0068855_100010449 | 3300005563 | Bacteria | 11198 |
| 246 | Ga0068855_100014725 | 3300005563 | Bacteria | 9423 |
| 247 | Ga0068855_100021645 | 3300005563 | Bacteria | 7713 |
| 248 | Ga0068855_100030000 | 3300005563 | Bacteria | 6504 |
| 249 | Ga0068855_100088290 | 3300005563 | Bacteria | 3582 |
| 250 | Ga0068855_100109855 | 3300005563 | Bacteria | 3166 |
| 251 | Ga0068855_100129080 | 3300005563 | Bacteria | 2888 |
| 252 | Ga0068855_100155285 | 3300005563 | Bacteria | 2600 |
| 253 | Ga0070664_100001763 | 3300005564 | Bacteria | 17340 |
| 254 | Ga0070664_100108257 | 3300005564 | Bacteria | 2423 |
| 255 | Ga0070664_100145204 | 3300005564 | Bacteria | 2092 |
| 256 | Ga0070664_100161703 | 3300005564 | Unclassified | 1981 |
| 257 | Ga0070664_100238375 | 3300005564 | Unclassified | 1632 |
| 258 | Ga0070664_100295202 | 3300005564 | Bacteria | 1463 |
| 259 | Ga0068857_100000006 | 3300005577 | Bacteria | 168660 |
| 260 | Ga0068857_100000416 | 3300005577 | Bacteria | 30150 |
| 261 | Ga0068857_100001995 | 3300005577 | Bacteria | 16541 |
| 262 | Ga0068857_100072849 | 3300005577 | Bacteria | 3061 |
| 263 | Ga0068857_100092526 | 3300005577 | Bacteria | 2707 |
| 264 | Ga0068857_100166601 | 3300005577 | Unclassified | 2001 |
| 265 | Ga0068854_100001137 | 3300005578 | Bacteria | 15981 |
| 266 | Ga0068854_100012640 | 3300005578 | Bacteria | 5532 |
| 267 | Ga0068854_100030425 | 3300005578 | Unclassified | 3745 |
| 268 | Ga0068854_100046999 | 3300005578 | Bacteria | 3075 |
| 269 | Ga0068854_100074559 | 3300005578 | Bacteria | 2489 |
| 270 | Ga0068854_100212741 | 3300005578 | Bacteria | 1526 |
| 271 | Ga0068856_100001524 | 3300005614 | Bacteria | 24300 |
| 272 | Ga0068856_100006605 | 3300005614 | Bacteria | 11365 |
| 273 | Ga0068856_100019317 | 3300005614 | Bacteria | 6615 |
| 274 | Ga0068856_100033216 | 3300005614 | Bacteria | 5052 |
| 275 | Ga0068856_100044125 | 3300005614 | Bacteria | 4387 |
| 276 | Ga0068856_100049707 | 3300005614 | Bacteria | 4133 |
| 277 | Ga0068856_100076063 | 3300005614 | Bacteria | 3326 |
| 278 | Ga0070702_100018818 | 3300005615 | Bacteria | 3590 |
| 279 | Ga0068852_100001789 | 3300005616 | Bacteria | 14595 |
| 280 | Ga0068852_100012306 | 3300005616 | Bacteria | 6490 |
| 281 | Ga0068852_100029381 | 3300005616 | Bacteria | 4516 |
| 282 | Ga0068852_100124015 | 3300005616 | Bacteria | 2369 |
| 283 | Ga0068852_100148764 | 3300005616 | Bacteria | 2175 |
| 284 | Ga0068852_100197264 | 3300005616 | Bacteria | 1903 |
| 285 | Ga0068859_100000242 | 3300005617 | Bacteria | 53646 |
| 286 | Ga0068859_100000397 | 3300005617 | Bacteria | 43279 |
| 287 | Ga0068859_100007103 | 3300005617 | Bacteria | 11366 |
| 288 | Ga0068859_100016634 | 3300005617 | Bacteria | 7384 |
| 289 | Ga0068859_100020210 | 3300005617 | Bacteria | 6685 |
| 290 | Ga0068859_100050940 | 3300005617 | Bacteria | 4161 |
| 291 | Ga0068864_100007085 | 3300005618 | Bacteria | 9205 |
| 292 | Ga0068864_100024122 | 3300005618 | Bacteria | 5114 |
| 293 | Ga0068864_100035435 | 3300005618 | Bacteria | 4248 |
| 294 | Ga0068864_100047564 | 3300005618 | Bacteria | 3685 |
| 295 | Ga0068866_10006104 | 3300005718 | Bacteria | 5013 |
| 296 | Ga0068866_10070976 | 3300005718 | Bacteria | 1840 |
| 297 | Ga0068866_10085686 | 3300005718 | Unclassified | 1703 |
| 298 | Ga0068861_100010485 | 3300005719 | Bacteria | 6432 |
| 299 | Ga0068861_100016454 | 3300005719 | Bacteria | 5234 |
| 300 | Ga0068851_10003183 | 3300005834 | Bacteria | 7276 |
| 301 | Ga0068851_10006949 | 3300005834 | Bacteria | 5188 |
| 302 | Ga0068870_10001223 | 3300005840 | Bacteria | 10330 |
| 303 | Ga0068870_10005043 | 3300005840 | Bacteria | 5736 |
| 304 | Ga0068870_10034383 | 3300005840 | Bacteria | 2593 |
| 305 | Ga0068870_10097862 | 3300005840 | Bacteria | 1652 |
| 306 | Ga0068863_100003280 | 3300005841 | Bacteria | 15977 |
| 307 | Ga0068863_100006910 | 3300005841 | Bacteria | 11121 |
| 308 | Ga0068863_100042965 | 3300005841 | Bacteria | 4293 |
| 309 | Ga0068858_100001416 | 3300005842 | Bacteria | 24652 |
| 310 | Ga0068858_100014158 | 3300005842 | Bacteria | 7521 |
| 311 | Ga0068858_100028195 | 3300005842 | Bacteria | 5217 |
| 312 | Ga0068858_100094303 | 3300005842 | Unclassified | 2788 |
| 313 | Ga0068858_100122525 | 3300005842 | Bacteria | 2433 |
| 314 | Ga0068858_100182600 | 3300005842 | Bacteria | 1981 |
| 315 | Ga0068858_100265941 | 3300005842 | Bacteria | 1631 |
| 316 | Ga0068858_100364055 | 3300005842 | Bacteria | 1386 |
| 317 | Ga0068860_100000046 | 3300005843 | Bacteria | 214800 |
| 318 | Ga0068860_100000700 | 3300005843 | Bacteria | 38538 |
| 319 | Ga0068860_100001914 | 3300005843 | Bacteria | 22094 |
| 320 | Ga0068860_100005835 | 3300005843 | Bacteria | 12393 |
| 321 | Ga0068860_100014886 | 3300005843 | Bacteria | 7605 |
| 322 | Ga0068860_100016701 | 3300005843 | Bacteria | 7158 |
| 323 | Ga0068860_100029570 | 3300005843 | Bacteria | 5272 |
| 324 | Ga0068860_100111058 | 3300005843 | Bacteria | 2620 |
| 325 | Ga0068860_100139901 | 3300005843 | Bacteria | 2326 |
| 326 | Ga0068860_100208693 | 3300005843 | Bacteria | 1894 |
| 327 | Ga0068862_100045022 | 3300005844 | Bacteria | 3764 |
| 328 | Ga0068862_100113984 | 3300005844 | Bacteria | 2376 |
| 329 | Ga0068862_100219741 | 3300005844 | Bacteria | 1720 |
| 330 | Ga0081455_10006925 | 3300005937 | Bacteria | 12058 |
| 331 | Ga0081539_10000337 | 3300005985 | Bacteria | 103868 |
| 332 | Ga0075364_10000169 | 3300006051 | Bacteria | 29011 |
| 333 | Ga0075364_10001466 | 3300006051 | Bacteria | 12834 |
| 334 | Ga0075364_10011431 | 3300006051 | Bacteria | 5394 |
| 335 | Ga0075364_10033181 | 3300006051 | Bacteria | 3322 |
| 336 | Ga0075367_10027430 | 3300006178 | Bacteria | 3240 |
| 337 | Ga0075366_10000898 | 3300006195 | Bacteria | 14398 |
| 338 | Ga0075366_10009323 | 3300006195 | Bacteria | 5481 |
| 339 | Ga0075366_10033260 | 3300006195 | Unclassified | 3037 |
| 340 | Ga0097621_100000247 | 3300006237 | Bacteria | 36324 |
| 341 | Ga0097621_100000277 | 3300006237 | Bacteria | 34682 |
| 342 | Ga0097621_100002714 | 3300006237 | Bacteria | 12118 |
| 343 | Ga0097621_100005494 | 3300006237 | Bacteria | 8928 |
| 344 | Ga0097621_100008121 | 3300006237 | Bacteria | 7545 |
| 345 | Ga0097621_100008900 | 3300006237 | Bacteria | 7256 |
| 346 | Ga0097621_100046710 | 3300006237 | Bacteria | 3505 |
| 347 | Ga0097621_100136578 | 3300006237 | Bacteria | 2092 |
| 348 | Ga0068871_100000455 | 3300006358 | Bacteria | 28102 |
| 349 | Ga0068871_100001185 | 3300006358 | Bacteria | 17461 |
| 350 | Ga0068871_100003771 | 3300006358 | Bacteria | 10436 |
| 351 | Ga0068871_100015222 | 3300006358 | Bacteria | 5752 |
| 352 | Ga0068871_100038211 | 3300006358 | Bacteria | 3832 |
| 353 | Ga0068871_100039603 | 3300006358 | Bacteria | 3771 |
| 354 | Ga0068871_100045918 | 3300006358 | Bacteria | 3517 |
| 355 | Ga0075428_100031435 | 3300006844 | Bacteria | 5868 |
| 356 | Ga0075428_100161497 | 3300006844 | Bacteria | 2432 |
| 357 | Ga0075431_100047295 | 3300006847 | Bacteria | 4435 |
| 358 | Ga0075429_100125763 | 3300006880 | Bacteria | 2242 |
| 359 | Ga0068865_100000011 | 3300006881 | Bacteria | 154581 |
| 360 | Ga0068865_100000076 | 3300006881 | Bacteria | 51732 |
| 361 | Ga0068865_100001877 | 3300006881 | Bacteria | 12358 |
| 362 | Ga0068865_100002323 | 3300006881 | Bacteria | 11209 |
| 363 | Ga0097620_100000242 | 3300006931 | Bacteria | 53646 |
| 364 | Ga0097620_100000397 | 3300006931 | Bacteria | 43279 |
| 365 | Ga0097620_100007103 | 3300006931 | Bacteria | 11366 |
| 366 | Ga0097620_100016633 | 3300006931 | Bacteria | 7384 |
| 367 | Ga0097620_100020209 | 3300006931 | Bacteria | 6685 |
| 368 | Ga0097620_100050942 | 3300006931 | Bacteria | 4161 |
| 369 | Ga0099824_1008363 | 3300006942 | Bacteria | 13260 |
| 370 | Ga0079104_1000078 | 3300006946 | Bacteria | 141909 |
| 371 | Ga0079104_1000117 | 3300006946 | Bacteria | 114089 |
| 372 | Ga0079104_1000227 | 3300006946 | Bacteria | 76897 |
| 373 | Ga0079104_1000305 | 3300006946 | Bacteria | 62224 |
| 374 | Ga0079104_1000836 | 3300006946 | Bacteria | 25615 |
| 375 | Ga0079104_1005557 | 3300006946 | Bacteria | 5007 |
| 376 | Ga0079104_1011258 | 3300006946 | Bacteria | 2887 |
| 377 | Ga0079104_1017478 | 3300006946 | Bacteria | 2060 |
| 378 | Ga0079104_1020654 | 3300006946 | Bacteria | 1809 |
| 379 | Ga0099826_10001062 | 3300006948 | Bacteria | 15560 |
| 380 | Ga0105251_10000230 | 3300009011 | Bacteria | 56255 |
| 381 | Ga0105251_10000233 | 3300009011 | Bacteria | 55865 |
| 382 | Ga0105251_10000760 | 3300009011 | Bacteria | 29421 |
| 383 | Ga0105251_10004261 | 3300009011 | Bacteria | 9854 |
| 384 | Ga0105251_10004664 | 3300009011 | Bacteria | 9224 |
| 385 | Ga0105251_10007521 | 3300009011 | Bacteria | 6698 |
| 386 | Ga0105251_10007546 | 3300009011 | Bacteria | 6679 |
| 387 | Ga0105251_10053167 | 3300009011 | Bacteria | 1926 |
| 388 | Ga0105244_10000017 | 3300009036 | Bacteria | 253386 |
| 389 | Ga0105244_10000046 | 3300009036 | Bacteria | 143184 |
| 390 | Ga0105244_10000266 | 3300009036 | Bacteria | 52668 |
| 391 | Ga0105244_10001361 | 3300009036 | Bacteria | 19852 |
| 392 | Ga0105244_10003529 | 3300009036 | Bacteria | 11115 |
| 393 | Ga0105244_10013249 | 3300009036 | Bacteria | 4829 |
| 394 | Ga0105244_10014481 | 3300009036 | Bacteria | 4557 |
| 395 | Ga0105244_10021608 | 3300009036 | Bacteria | 3557 |
| 396 | Ga0105244_10025737 | 3300009036 | Bacteria | 3193 |
| 397 | Ga0105244_10036739 | 3300009036 | Bacteria | 2564 |
| 398 | Ga0105250_10000012 | 3300009092 | Bacteria | 274899 |
| 399 | Ga0105250_10000185 | 3300009092 | Bacteria | 53998 |
| 400 | Ga0105250_10004683 | 3300009092 | Bacteria | 6247 |
| 401 | Ga0105250_10008198 | 3300009092 | Bacteria | 4448 |
| 402 | Ga0105250_10023274 | 3300009092 | Bacteria | 2496 |
| 403 | Ga0105250_10043000 | 3300009092 | Bacteria | 1811 |
| 404 | Ga0105240_10000074 | 3300009093 | Bacteria | 199611 |
| 405 | Ga0105240_10000103 | 3300009093 | Bacteria | 172981 |
| 406 | Ga0105240_10003631 | 3300009093 | Bacteria | 23897 |
| 407 | Ga0105240_10003829 | 3300009093 | Bacteria | 23261 |
| 408 | Ga0105240_10005745 | 3300009093 | Bacteria | 18403 |
| 409 | Ga0105240_10011123 | 3300009093 | Bacteria | 12576 |
| 410 | Ga0105240_10015220 | 3300009093 | Bacteria | 10466 |
| 411 | Ga0105240_10016636 | 3300009093 | Bacteria | 9947 |
| 412 | Ga0105240_10027109 | 3300009093 | Bacteria | 7507 |
| 413 | Ga0105240_10032969 | 3300009093 | Bacteria | 6698 |
| 414 | Ga0105240_10089262 | 3300009093 | Bacteria | 3770 |
| 415 | Ga0105240_10101346 | 3300009093 | Bacteria | 3502 |
| 416 | Ga0105240_10126435 | 3300009093 | Bacteria | 3071 |
| 417 | Ga0105240_10147389 | 3300009093 | Unclassified | 2807 |
| 418 | Ga0111539_10002966 | 3300009094 | Bacteria | 22505 |
| 419 | Ga0111539_10119193 | 3300009094 | Bacteria | 3093 |
| 420 | Ga0111539_10120129 | 3300009094 | Bacteria | 3079 |
| 421 | Ga0111539_10325540 | 3300009094 | Bacteria | 1789 |
| 422 | Ga0105245_10011909 | 3300009098 | Bacteria | 7563 |
| 423 | Ga0105245_10048769 | 3300009098 | Bacteria | 3789 |
| 424 | Ga0105245_10231648 | 3300009098 | Bacteria | 1787 |
| 425 | Ga0105247_10000238 | 3300009101 | Bacteria | 51733 |
| 426 | Ga0105247_10000319 | 3300009101 | Bacteria | 43234 |
| 427 | Ga0105247_10003524 | 3300009101 | Bacteria | 10175 |
| 428 | Ga0105247_10020148 | 3300009101 | Unclassified | 4009 |
| 429 | Ga0114129_10011363 | 3300009147 | Bacteria | 12683 |
| 430 | Ga0105243_10000012 | 3300009148 | Bacteria | 300885 |
| 431 | Ga0105243_10000241 | 3300009148 | Bacteria | 62487 |
| 432 | Ga0105243_10000260 | 3300009148 | Bacteria | 60060 |
| 433 | Ga0105243_10090305 | 3300009148 | Bacteria | 2520 |
| 434 | Ga0105241_10000013 | 3300009174 | Bacteria | 172249 |
| 435 | Ga0105241_10000293 | 3300009174 | Bacteria | 37284 |
| 436 | Ga0105241_10000530 | 3300009174 | Bacteria | 28739 |
| 437 | Ga0105241_10002996 | 3300009174 | Bacteria | 12616 |
| 438 | Ga0105241_10003032 | 3300009174 | Bacteria | 12548 |
| 439 | Ga0105241_10003168 | 3300009174 | Bacteria | 12246 |
| 440 | Ga0105241_10015322 | 3300009174 | Bacteria | 5615 |
| 441 | Ga0105241_10038983 | 3300009174 | Bacteria | 3583 |
| 442 | Ga0105241_10068084 | 3300009174 | Bacteria | 2757 |
| 443 | Ga0105241_10260364 | 3300009174 | Unclassified | 1474 |
| 444 | Ga0105242_10011381 | 3300009176 | Bacteria | 6839 |
| 445 | Ga0105242_10016371 | 3300009176 | Bacteria | 5762 |
| 446 | Ga0105242_10024565 | 3300009176 | Bacteria | 4760 |
| 447 | Ga0105242_10095194 | 3300009176 | Bacteria | 2513 |
| 448 | Ga0105242_10096669 | 3300009176 | Bacteria | 2496 |
| 449 | Ga0105248_10007416 | 3300009177 | Bacteria | 12034 |
| 450 | Ga0105248_10126228 | 3300009177 | Bacteria | 2886 |
| 451 | Ga0105248_10314189 | 3300009177 | Bacteria | 1765 |
| 452 | Ga0105237_10001686 | 3300009545 | Bacteria | 28604 |
| 453 | Ga0105237_10002542 | 3300009545 | Bacteria | 22567 |
| 454 | Ga0105237_10003907 | 3300009545 | Bacteria | 17471 |
| 455 | Ga0105237_10011277 | 3300009545 | Bacteria | 9457 |
| 456 | Ga0105237_10011674 | 3300009545 | Bacteria | 9296 |
| 457 | Ga0105237_10025166 | 3300009545 | Bacteria | 6089 |
| 458 | Ga0105237_10041982 | 3300009545 | Bacteria | 4612 |
| 459 | Ga0105237_10045228 | 3300009545 | Bacteria | 4431 |
| 460 | Ga0105237_10078754 | 3300009545 | Bacteria | 3285 |
| 461 | Ga0105237_10133804 | 3300009545 | Bacteria | 2474 |
| 462 | Ga0105237_10134113 | 3300009545 | Bacteria | 2471 |
| 463 | Ga0105237_10174882 | 3300009545 | Bacteria | 2147 |
| 464 | Ga0105237_10180224 | 3300009545 | Bacteria | 2113 |
| 465 | Ga0105238_10006037 | 3300009551 | Bacteria | 12010 |
| 466 | Ga0105238_10034131 | 3300009551 | Bacteria | 5177 |
| 467 | Ga0105238_10046342 | 3300009551 | Bacteria | 4388 |
| 468 | Ga0105238_10071739 | 3300009551 | Bacteria | 3461 |
| 469 | Ga0105238_10122480 | 3300009551 | Bacteria | 2580 |
| 470 | Ga0105238_10202318 | 3300009551 | Bacteria | 1962 |
| 471 | Ga0105238_10286743 | 3300009551 | Bacteria | 1628 |
| 472 | Ga0105249_10011396 | 3300009553 | Bacteria | 7808 |
| 473 | Ga0105249_10018519 | 3300009553 | Bacteria | 6199 |
| 474 | Ga0105249_10044257 | 3300009553 | Bacteria | 4048 |
| 475 | Ga0105249_10054601 | 3300009553 | Unclassified | 3654 |
| 476 | Ga0105249_10074907 | 3300009553 | Bacteria | 3134 |
| 477 | Ga0105239_10000048 | 3300010375 | Bacteria | 177855 |
| 478 | Ga0105239_10000280 | 3300010375 | Bacteria | 75222 |
| 479 | Ga0105239_10000696 | 3300010375 | Bacteria | 47844 |
| 480 | Ga0105239_10001111 | 3300010375 | Bacteria | 37117 |
| 481 | Ga0105239_10002752 | 3300010375 | Bacteria | 22079 |
| 482 | Ga0105239_10009182 | 3300010375 | Bacteria | 11181 |
| 483 | Ga0105239_10038267 | 3300010375 | Bacteria | 5256 |
| 484 | Ga0105239_10053015 | 3300010375 | Bacteria | 4449 |
| 485 | Ga0105239_10058061 | 3300010375 | Bacteria | 4245 |
| 486 | Ga0105239_10058623 | 3300010375 | Bacteria | 4225 |
| 487 | Ga0105239_10071665 | 3300010375 | Bacteria | 3807 |
| 488 | Ga0105239_10076795 | 3300010375 | Bacteria | 3674 |
| 489 | Ga0105239_10087369 | 3300010375 | Bacteria | 3437 |
| 490 | Ga0105239_10094302 | 3300010375 | Bacteria | 3306 |
| 491 | Ga0105239_10144933 | 3300010375 | Bacteria | 2648 |
| 492 | Ga0105239_10224516 | 3300010375 | Bacteria | 2107 |
| 493 | Ga0105246_10001408 | 3300011119 | Bacteria | 14231 |
| 494 | Ga0105246_10007124 | 3300011119 | Bacteria | 6845 |
| 495 | Ga0105246_10007306 | 3300011119 | Bacteria | 6769 |
| 496 | Ga0105246_10025668 | 3300011119 | Bacteria | 3842 |
| 497 | Ga0157373_10000127 | 3300013100 | Bacteria | 59397 |
| 498 | Ga0157373_10001089 | 3300013100 | Bacteria | 20928 |
| 499 | Ga0157373_10012333 | 3300013100 | Bacteria | 6284 |
| 500 | Ga0157373_10019294 | 3300013100 | Bacteria | 4966 |
| 501 | Ga0157373_10022692 | 3300013100 | Bacteria | 4553 |
| 502 | Ga0157373_10042824 | 3300013100 | Bacteria | 3235 |
| 503 | Ga0157373_10087577 | 3300013100 | Bacteria | 2194 |
| 504 | Ga0157373_10089796 | 3300013100 | Bacteria | 2164 |
| 505 | Ga0157373_10155386 | 3300013100 | Bacteria | 1609 |
| 506 | Ga0157371_10000003 | 3300013102 | Bacteria | 543317 |
| 507 | Ga0157371_10000172 | 3300013102 | Bacteria | 94447 |
| 508 | Ga0157371_10000868 | 3300013102 | Bacteria | 34292 |
| 509 | Ga0157371_10001625 | 3300013102 | Bacteria | 22997 |
| 510 | Ga0157371_10002111 | 3300013102 | Bacteria | 19371 |
| 511 | Ga0157371_10002204 | 3300013102 | Bacteria | 18888 |
| 512 | Ga0157371_10003848 | 3300013102 | Bacteria | 13399 |
| 513 | Ga0157371_10005778 | 3300013102 | Bacteria | 10362 |
| 514 | Ga0157371_10011682 | 3300013102 | Bacteria | 6749 |
| 515 | Ga0157371_10014562 | 3300013102 | Bacteria | 5930 |
| 516 | Ga0157371_10025296 | 3300013102 | Bacteria | 4328 |
| 517 | Ga0157371_10037827 | 3300013102 | Bacteria | 3453 |
| 518 | Ga0157371_10041007 | 3300013102 | Bacteria | 3305 |
| 519 | Ga0157371_10047958 | 3300013102 | Bacteria | 3037 |
| 520 | Ga0157371_10049923 | 3300013102 | Bacteria | 2972 |
| 521 | Ga0157371_10081240 | 3300013102 | Bacteria | 2295 |
| 522 | Ga0157371_10117413 | 3300013102 | Unclassified | 1891 |
| 523 | Ga0157370_10000181 | 3300013104 | Bacteria | 79297 |
| 524 | Ga0157370_10000313 | 3300013104 | Bacteria | 60838 |
| 525 | Ga0157370_10000326 | 3300013104 | Bacteria | 59716 |
| 526 | Ga0157370_10000822 | 3300013104 | Bacteria | 39237 |
| 527 | Ga0157370_10002652 | 3300013104 | Bacteria | 21482 |
| 528 | Ga0157370_10003924 | 3300013104 | Bacteria | 17317 |
| 529 | Ga0157370_10005338 | 3300013104 | Bacteria | 14435 |
| 530 | Ga0157370_10012037 | 3300013104 | Bacteria | 9005 |
| 531 | Ga0157370_10015635 | 3300013104 | Bacteria | 7707 |
| 532 | Ga0157370_10067402 | 3300013104 | Bacteria | 3383 |
| 533 | Ga0157370_10152496 | 3300013104 | Bacteria | 2150 |
| 534 | Ga0157369_10000002 | 3300013105 | Bacteria | 524510 |
| 535 | Ga0157369_10000007 | 3300013105 | Bacteria | 402562 |
| 536 | Ga0157369_10005374 | 3300013105 | Bacteria | 14914 |
| 537 | Ga0157369_10006651 | 3300013105 | Bacteria | 13357 |
| 538 | Ga0157369_10014086 | 3300013105 | Bacteria | 9037 |
| 539 | Ga0157369_10040373 | 3300013105 | Bacteria | 5094 |
| 540 | Ga0157369_10055159 | 3300013105 | Bacteria | 4290 |
| 541 | Ga0157369_10057285 | 3300013105 | Bacteria | 4204 |
| 542 | Ga0157369_10069413 | 3300013105 | Bacteria | 3786 |
| 543 | Ga0157369_10072059 | 3300013105 | Bacteria | 3708 |
| 544 | Ga0157374_10000001 | 3300013296 | Bacteria | 1077351 |
| 545 | Ga0157374_10000379 | 3300013296 | Bacteria | 40932 |
| 546 | Ga0157374_10001320 | 3300013296 | Bacteria | 21133 |
| 547 | Ga0157374_10001718 | 3300013296 | Bacteria | 18383 |
| 548 | Ga0157374_10002276 | 3300013296 | Bacteria | 16148 |
| 549 | Ga0157374_10022966 | 3300013296 | Bacteria | 5570 |
| 550 | Ga0157374_10050560 | 3300013296 | Bacteria | 3864 |
| 551 | Ga0157374_10066312 | 3300013296 | Bacteria | 3393 |
| 552 | Ga0157378_10001147 | 3300013297 | Bacteria | 24056 |
| 553 | Ga0157378_10002967 | 3300013297 | Bacteria | 15089 |
| 554 | Ga0157378_10076603 | 3300013297 | Bacteria | 3014 |
| 555 | Ga0157378_10137223 | 3300013297 | Bacteria | 2268 |
| 556 | Ga0157378_10162506 | 3300013297 | Bacteria | 2089 |
| 557 | Ga0163162_10000063 | 3300013306 | Bacteria | 104222 |
| 558 | Ga0163162_10000369 | 3300013306 | Bacteria | 40837 |
| 559 | Ga0163162_10001851 | 3300013306 | Bacteria | 19914 |
| 560 | Ga0163162_10001857 | 3300013306 | Bacteria | 19899 |
| 561 | Ga0163162_10003949 | 3300013306 | Bacteria | 14225 |
| 562 | Ga0163162_10005520 | 3300013306 | Bacteria | 12225 |
| 563 | Ga0163162_10005992 | 3300013306 | Bacteria | 11773 |
| 564 | Ga0163162_10008396 | 3300013306 | Bacteria | 10073 |
| 565 | Ga0163162_10037133 | 3300013306 | Unclassified | 4859 |
| 566 | Ga0163162_10052107 | 3300013306 | Bacteria | 4109 |
| 567 | Ga0163162_10124759 | 3300013306 | Unclassified | 2680 |
| 568 | Ga0163162_10163657 | 3300013306 | Bacteria | 2348 |
| 569 | Ga0163162_10173443 | 3300013306 | Bacteria | 2281 |
| 570 | Ga0157372_10000026 | 3300013307 | Bacteria | 195407 |
| 571 | Ga0157372_10000177 | 3300013307 | Bacteria | 70496 |
| 572 | Ga0157372_10000459 | 3300013307 | Bacteria | 44769 |
| 573 | Ga0157372_10000921 | 3300013307 | Bacteria | 32008 |
| 574 | Ga0157372_10004228 | 3300013307 | Bacteria | 15351 |
| 575 | Ga0157372_10008214 | 3300013307 | Bacteria | 11093 |
| 576 | Ga0157372_10025866 | 3300013307 | Bacteria | 6383 |
| 577 | Ga0157372_10040371 | 3300013307 | Bacteria | 5154 |
| 578 | Ga0157372_10040920 | 3300013307 | Bacteria | 5122 |
| 579 | Ga0157372_10052776 | 3300013307 | Bacteria | 4528 |
| 580 | Ga0157372_10053382 | 3300013307 | Bacteria | 4505 |
| 581 | Ga0157372_10067478 | 3300013307 | Bacteria | 4019 |
| 582 | Ga0157372_10121606 | 3300013307 | Bacteria | 2999 |
| 583 | Ga0157372_10189242 | 3300013307 | Bacteria | 2383 |
| 584 | Ga0157372_10201868 | 3300013307 | Bacteria | 2303 |
| 585 | Ga0157372_10202805 | 3300013307 | Bacteria | 2298 |
| 586 | Ga0157372_10302542 | 3300013307 | Bacteria | 1860 |
| 587 | Ga0157372_10330229 | 3300013307 | Bacteria | 1776 |
| 588 | Ga0157372_10352794 | 3300013307 | Bacteria | 1714 |
| 589 | Ga0157375_10000166 | 3300013308 | Bacteria | 61836 |
| 590 | Ga0157375_10002575 | 3300013308 | Bacteria | 15751 |
| 591 | Ga0157375_10005010 | 3300013308 | Bacteria | 11509 |
| 592 | Ga0157375_10015162 | 3300013308 | Bacteria | 6894 |
| 593 | Ga0157375_10047011 | 3300013308 | Bacteria | 4211 |
| 594 | Ga0157375_10172336 | 3300013308 | Bacteria | 2312 |
| 595 | Ga0157375_10241765 | 3300013308 | Bacteria | 1965 |
| 596 | Ga0163163_10003388 | 3300014325 | Bacteria | 13533 |
| 597 | Ga0163163_10057315 | 3300014325 | Bacteria | 3852 |
| 598 | Ga0163163_10220469 | 3300014325 | Bacteria | 1945 |
| 599 | Ga0157380_10018712 | 3300014326 | Bacteria | 5148 |
| 600 | Ga0157380_10028028 | 3300014326 | Bacteria | 4290 |
| 601 | Ga0157380_10036404 | 3300014326 | Bacteria | 3807 |
| 602 | Ga0182008_10000004 | 3300014497 | Bacteria | 436804 |
| 603 | Ga0182008_10001429 | 3300014497 | Bacteria | 16012 |
| 604 | Ga0182008_10008294 | 3300014497 | Bacteria | 5677 |
| 605 | Ga0157377_10002998 | 3300014745 | Bacteria | 7564 |
| 606 | Ga0157377_10004515 | 3300014745 | Bacteria | 6422 |
| 607 | Ga0157377_10006587 | 3300014745 | Bacteria | 5548 |
| 608 | Ga0157377_10010180 | 3300014745 | Bacteria | 4642 |
| 609 | Ga0157379_10011459 | 3300014968 | Bacteria | 7738 |
| 610 | Ga0157379_10037998 | 3300014968 | Bacteria | 4295 |
| 611 | Ga0157376_10000176 | 3300014969 | Bacteria | 44034 |
| 612 | Ga0157376_10000721 | 3300014969 | Bacteria | 21396 |
| 613 | Ga0157376_10001531 | 3300014969 | Bacteria | 15244 |
| 614 | Ga0157376_10004624 | 3300014969 | Bacteria | 9589 |
| 615 | Ga0157376_10007428 | 3300014969 | Bacteria | 7824 |
| 616 | Ga0157376_10110414 | 3300014969 | Bacteria | 2419 |
| 617 | Ga0157376_10125471 | 3300014969 | Bacteria | 2282 |
| 618 | Ga0157376_10125954 | 3300014969 | Bacteria | 2278 |
| 619 | Ga0157376_10228357 | 3300014969 | Bacteria | 1728 |
| 620 | Ga0182006_1000009 | 3300015261 | Bacteria | 438243 |
| 621 | Ga0182006_1000130 | 3300015261 | Bacteria | 80841 |
| 622 | Ga0182006_1000180 | 3300015261 | Bacteria | 66625 |
| 623 | Ga0182006_1001603 | 3300015261 | Bacteria | 13391 |
| 624 | Ga0182006_1002117 | 3300015261 | Bacteria | 11070 |
| 625 | Ga0182006_1005424 | 3300015261 | Bacteria | 6087 |
| 626 | Ga0182006_1015934 | 3300015261 | Bacteria | 3213 |
| 627 | Ga0182007_10000001 | 3300015262 | Bacteria | 1127301 |
| 628 | Ga0182007_10000007 | 3300015262 | Bacteria | 376596 |
| 629 | Ga0183366_1005 | 3300015679 | Bacteria | 163284 |
| 630 | Ga0183370_1005 | 3300015680 | Bacteria | 163284 |
| 631 | Ga0183373_1001 | 3300015682 | Bacteria | 1410374 |
| 632 | Ga0183365_10004 | 3300015684 | Bacteria | 333304 |
| 633 | Ga0183369_1016 | 3300015685 | Bacteria | 163284 |
| 634 | Ga0183368_1009 | 3300015687 | Bacteria | 163284 |
| 635 | Ga0163161_10000019 | 3300017792 | Bacteria | 216758 |
| 636 | Ga0163161_10000028 | 3300017792 | Bacteria | 197151 |
| 637 | Ga0163161_10000045 | 3300017792 | Bacteria | 130284 |
| 638 | Ga0163161_10000376 | 3300017792 | Bacteria | 37317 |
| 639 | Ga0163161_10000496 | 3300017792 | Bacteria | 32389 |
| 640 | Ga0163161_10002301 | 3300017792 | Bacteria | 13703 |
| 641 | Ga0163161_10002434 | 3300017792 | Bacteria | 13304 |
| 642 | Ga0163161_10004909 | 3300017792 | Bacteria | 9307 |
| 643 | Ga0163161_10154616 | 3300017792 | Bacteria | 1745 |
| 644 | Ga0163161_10182786 | 3300017792 | Bacteria | 1609 |
| 645 | Ga0213876_10000039 | 3300021384 | Bacteria | 173104 |
| 646 | Ga0209436_102822 | 3300025208 | Bacteria | 4934 |
| 647 | Ga0209436_103845 | 3300025208 | Bacteria | 3841 |
| 648 | Ga0209147_100010 | 3300025229 | Bacteria | 741391 |
| 649 | Ga0209563_100011 | 3300025230 | Bacteria | 1187808 |
| 650 | Ga0207427_100125 | 3300025231 | Bacteria | 96142 |
| 651 | Ga0209437_100008 | 3300025233 | Bacteria | 921142 |
| 652 | Ga0209437_100089 | 3300025233 | Bacteria | 250476 |
| 653 | Ga0209258_100075 | 3300025242 | Bacteria | 270751 |
| 654 | Ga0207425_1000007 | 3300025245 | Bacteria | 777411 |
| 655 | Ga0209646_1000091 | 3300025246 | Bacteria | 188727 |
| 656 | Ga0209026_1000497 | 3300025250 | Bacteria | 28577 |
| 657 | Ga0209677_101431 | 3300025253 | Bacteria | 10313 |
| 658 | Ga0209148_1000085 | 3300025254 | Bacteria | 265193 |
| 659 | Ga0209148_1000117 | 3300025254 | Bacteria | 188938 |
| 660 | Ga0209148_1000600 | 3300025254 | Bacteria | 32520 |
| 661 | Ga0209148_1003709 | 3300025254 | Bacteria | 4041 |
| 662 | Ga0209129_1000006 | 3300025258 | Bacteria | 777761 |
| 663 | Ga0209129_1000021 | 3300025258 | Bacteria | 445018 |
| 664 | Ga0209233_1000024 | 3300025261 | Bacteria | 695418 |
| 665 | Ga0209233_1000079 | 3300025261 | Bacteria | 346944 |
| 666 | Ga0209565_1000082 | 3300025263 | Bacteria | 154452 |
| 667 | Ga0209455_1000259 | 3300025272 | Bacteria | 61221 |
| 668 | Ga0209455_1002019 | 3300025272 | Bacteria | 8298 |
| 669 | Ga0209673_1000422 | 3300025273 | Bacteria | 73685 |
| 670 | Ga0209130_1000320 | 3300025284 | Bacteria | 56333 |
| 671 | Ga0209675_1000176 | 3300025291 | Bacteria | 73644 |
| 672 | Ga0209676_1000008 | 3300025292 | Bacteria | 991778 |
| 673 | Ga0209676_1000204 | 3300025292 | Bacteria | 132896 |
| 674 | Ga0209025_1000043 | 3300025294 | Bacteria | 350458 |
| 675 | Ga0209025_1000089 | 3300025294 | Bacteria | 254130 |
| 676 | Ga0209025_1000999 | 3300025294 | Bacteria | 41918 |
| 677 | Ga0209025_1003105 | 3300025294 | Bacteria | 16286 |
| 678 | Ga0209025_1007368 | 3300025294 | Bacteria | 8230 |
| 679 | Ga0209025_1009924 | 3300025294 | Bacteria | 6543 |
| 680 | Ga0209564_1000438 | 3300025295 | Bacteria | 71794 |
| 681 | Ga0209758_1000016 | 3300025297 | Bacteria | 778557 |
| 682 | Ga0209758_1023838 | 3300025297 | Bacteria | 2750 |
| 683 | Ga0209050_1000180 | 3300025298 | Bacteria | 142987 |
| 684 | Ga0209256_1000323 | 3300025299 | Bacteria | 82313 |
| 685 | Ga0207426_1000032 | 3300025302 | Bacteria | 457997 |
| 686 | Ga0207426_1000057 | 3300025302 | Bacteria | 369548 |
| 687 | Ga0207426_1000251 | 3300025302 | Bacteria | 117462 |
| 688 | Ga0209257_1000004 | 3300025304 | Bacteria | 1678347 |
| 689 | Ga0209257_1000005 | 3300025304 | Bacteria | 1592528 |
| 690 | Ga0207656_10014318 | 3300025321 | Bacteria | 3053 |
| 691 | Ga0207656_10026978 | 3300025321 | Bacteria | 2346 |
| 692 | Ga0207696_1000040 | 3300025711 | Bacteria | 318695 |
| 693 | Ga0207696_1000068 | 3300025711 | Bacteria | 228017 |
| 694 | Ga0207696_1000245 | 3300025711 | Bacteria | 73998 |
| 695 | Ga0207696_1000525 | 3300025711 | Bacteria | 31632 |
| 696 | Ga0207696_1005540 | 3300025711 | Bacteria | 5222 |
| 697 | Ga0207696_1021957 | 3300025711 | Bacteria | 2036 |
| 698 | Ga0207655_1000023 | 3300025728 | Bacteria | 467070 |
| 699 | Ga0207655_1000034 | 3300025728 | Bacteria | 364737 |
| 700 | Ga0207655_1000053 | 3300025728 | Bacteria | 284129 |
| 701 | Ga0207655_1000082 | 3300025728 | Bacteria | 213760 |
| 702 | Ga0207655_1000106 | 3300025728 | Bacteria | 181416 |
| 703 | Ga0207655_1000264 | 3300025728 | Bacteria | 82670 |
| 704 | Ga0207655_1001062 | 3300025728 | Bacteria | 27373 |
| 705 | Ga0207655_1002562 | 3300025728 | Bacteria | 14546 |
| 706 | Ga0207655_1003694 | 3300025728 | Bacteria | 11272 |
| 707 | Ga0207655_1005115 | 3300025728 | Bacteria | 9042 |
| 708 | Ga0207713_1000017 | 3300025735 | Bacteria | 394495 |
| 709 | Ga0207713_1000044 | 3300025735 | Bacteria | 238074 |
| 710 | Ga0207713_1000053 | 3300025735 | Bacteria | 222068 |
| 711 | Ga0207713_1000062 | 3300025735 | Bacteria | 208832 |
| 712 | Ga0207713_1000066 | 3300025735 | Bacteria | 195645 |
| 713 | Ga0207713_1006048 | 3300025735 | Bacteria | 7463 |
| 714 | Ga0207713_1006491 | 3300025735 | Bacteria | 7113 |
| 715 | Ga0207713_1007033 | 3300025735 | Bacteria | 6741 |
| 716 | Ga0207713_1013766 | 3300025735 | Bacteria | 4242 |
| 717 | Ga0207713_1061774 | 3300025735 | Bacteria | 1424 |
| 718 | Ga0207682_10003471 | 3300025893 | Bacteria | 6833 |
| 719 | Ga0207642_10021917 | 3300025899 | Bacteria | 2524 |
| 720 | Ga0207642_10032843 | 3300025899 | Bacteria | 2190 |
| 721 | Ga0207642_10068285 | 3300025899 | Bacteria | 1681 |
| 722 | Ga0207710_10000104 | 3300025900 | Bacteria | 107245 |
| 723 | Ga0207710_10000693 | 3300025900 | Bacteria | 18877 |
| 724 | Ga0207710_10016084 | 3300025900 | Bacteria | 3164 |
| 725 | Ga0207680_10000268 | 3300025903 | Bacteria | 24842 |
| 726 | Ga0207647_10000046 | 3300025904 | Bacteria | 90148 |
| 727 | Ga0207647_10001200 | 3300025904 | Bacteria | 19960 |
| 728 | Ga0207647_10027349 | 3300025904 | Bacteria | 3718 |
| 729 | Ga0207647_10058493 | 3300025904 | Bacteria | 2360 |
| 730 | Ga0207645_10000088 | 3300025907 | Bacteria | 65894 |
| 731 | Ga0207645_10000542 | 3300025907 | Bacteria | 31431 |
| 732 | Ga0207645_10001902 | 3300025907 | Bacteria | 16850 |
| 733 | Ga0207645_10025938 | 3300025907 | Bacteria | 3790 |
| 734 | Ga0207645_10075539 | 3300025907 | Unclassified | 2157 |
| 735 | Ga0207643_10006182 | 3300025908 | Bacteria | 6408 |
| 736 | Ga0207643_10039172 | 3300025908 | Unclassified | 2666 |
| 737 | Ga0207643_10060148 | 3300025908 | Bacteria | 2168 |
| 738 | Ga0207643_10061613 | 3300025908 | Bacteria | 2143 |
| 739 | Ga0207643_10095996 | 3300025908 | Bacteria | 1733 |
| 740 | Ga0207705_10000076 | 3300025909 | Bacteria | 122975 |
| 741 | Ga0207705_10000107 | 3300025909 | Bacteria | 94984 |
| 742 | Ga0207705_10010608 | 3300025909 | Bacteria | 6695 |
| 743 | Ga0207705_10012996 | 3300025909 | Bacteria | 6009 |
| 744 | Ga0207705_10041503 | 3300025909 | Bacteria | 3301 |
| 745 | Ga0207654_10000016 | 3300025911 | Bacteria | 211550 |
| 746 | Ga0207654_10000738 | 3300025911 | Bacteria | 18178 |
| 747 | Ga0207654_10000743 | 3300025911 | Bacteria | 18094 |
| 748 | Ga0207654_10002549 | 3300025911 | Bacteria | 9245 |
| 749 | Ga0207654_10013839 | 3300025911 | Bacteria | 4156 |
| 750 | Ga0207654_10018530 | 3300025911 | Bacteria | 3654 |
| 751 | Ga0207654_10029628 | 3300025911 | Bacteria | 2999 |
| 752 | Ga0207707_10000487 | 3300025912 | Bacteria | 41080 |
| 753 | Ga0207707_10012617 | 3300025912 | Bacteria | 7342 |
| 754 | Ga0207707_10099580 | 3300025912 | Bacteria | 2540 |
| 755 | Ga0207707_10154843 | 3300025912 | Bacteria | 2004 |
| 756 | Ga0207695_10000019 | 3300025913 | Bacteria | 732137 |
| 757 | Ga0207695_10000282 | 3300025913 | Bacteria | 126242 |
| 758 | Ga0207695_10002490 | 3300025913 | Bacteria | 27118 |
| 759 | Ga0207695_10004745 | 3300025913 | Bacteria | 18394 |
| 760 | Ga0207695_10010448 | 3300025913 | Bacteria | 11353 |
| 761 | Ga0207695_10015766 | 3300025913 | Bacteria | 8881 |
| 762 | Ga0207695_10020921 | 3300025913 | Bacteria | 7477 |
| 763 | Ga0207695_10023840 | 3300025913 | Bacteria | 6907 |
| 764 | Ga0207695_10045195 | 3300025913 | Bacteria | 4677 |
| 765 | Ga0207695_10063197 | 3300025913 | Bacteria | 3817 |
| 766 | Ga0207695_10084084 | 3300025913 | Bacteria | 3213 |
| 767 | Ga0207671_10000572 | 3300025914 | Bacteria | 49400 |
| 768 | Ga0207671_10003026 | 3300025914 | Bacteria | 17227 |
| 769 | Ga0207671_10003229 | 3300025914 | Bacteria | 16398 |
| 770 | Ga0207671_10019811 | 3300025914 | Bacteria | 5136 |
| 771 | Ga0207671_10030327 | 3300025914 | Bacteria | 4033 |
| 772 | Ga0207671_10035305 | 3300025914 | Bacteria | 3712 |
| 773 | Ga0207671_10058291 | 3300025914 | Bacteria | 2863 |
| 774 | Ga0207671_10113039 | 3300025914 | Bacteria | 2068 |
| 775 | Ga0207660_10002080 | 3300025917 | Bacteria | 13256 |
| 776 | Ga0207660_10008225 | 3300025917 | Bacteria | 6751 |
| 777 | Ga0207660_10040547 | 3300025917 | Bacteria | 3261 |
| 778 | Ga0207660_10050798 | 3300025917 | Bacteria | 2946 |
| 779 | Ga0207662_10025868 | 3300025918 | Bacteria | 3382 |
| 780 | Ga0207657_10011508 | 3300025919 | Bacteria | 8783 |
| 781 | Ga0207657_10018840 | 3300025919 | Bacteria | 6572 |
| 782 | Ga0207657_10023001 | 3300025919 | Bacteria | 5814 |
| 783 | Ga0207657_10030460 | 3300025919 | Bacteria | 4897 |
| 784 | Ga0207657_10084456 | 3300025919 | Bacteria | 2661 |
| 785 | Ga0207657_10091159 | 3300025919 | Bacteria | 2542 |
| 786 | Ga0207657_10166850 | 3300025919 | Bacteria | 1785 |
| 787 | Ga0207657_10225106 | 3300025919 | Bacteria | 1501 |
| 788 | Ga0207649_10004270 | 3300025920 | Bacteria | 7777 |
| 789 | Ga0207652_10000055 | 3300025921 | Bacteria | 115420 |
| 790 | Ga0207652_10000103 | 3300025921 | Bacteria | 91988 |
| 791 | Ga0207652_10003723 | 3300025921 | Bacteria | 12514 |
| 792 | Ga0207652_10052292 | 3300025921 | Bacteria | 3505 |
| 793 | Ga0207652_10070422 | 3300025921 | Bacteria | 3037 |
| 794 | Ga0207652_10152500 | 3300025921 | Unclassified | 2069 |
| 795 | Ga0207681_10005187 | 3300025923 | Bacteria | 8002 |
| 796 | Ga0207681_10010237 | 3300025923 | Bacteria | 5742 |
| 797 | Ga0207681_10149448 | 3300025923 | Unclassified | 1749 |
| 798 | Ga0207694_10002468 | 3300025924 | Bacteria | 15055 |
| 799 | Ga0207694_10007215 | 3300025924 | Bacteria | 8439 |
| 800 | Ga0207694_10048422 | 3300025924 | Bacteria | 3289 |
| 801 | Ga0207650_10057853 | 3300025925 | Bacteria | 2885 |
| 802 | Ga0207650_10252522 | 3300025925 | Bacteria | 1428 |
| 803 | Ga0207659_10005711 | 3300025926 | Bacteria | 7574 |
| 804 | Ga0207659_10027151 | 3300025926 | Bacteria | 3872 |
| 805 | Ga0207659_10107651 | 3300025926 | Bacteria | 2113 |
| 806 | Ga0207659_10125849 | 3300025926 | Bacteria | 1971 |
| 807 | Ga0207687_10026062 | 3300025927 | Bacteria | 3914 |
| 808 | Ga0207687_10035758 | 3300025927 | Bacteria | 3380 |
| 809 | Ga0207700_10127297 | 3300025928 | Bacteria | 2074 |
| 810 | Ga0207644_10011358 | 3300025931 | Bacteria | 5891 |
| 811 | Ga0207690_10013651 | 3300025932 | Bacteria | 4886 |
| 812 | Ga0207690_10018497 | 3300025932 | Bacteria | 4274 |
| 813 | Ga0207690_10059178 | 3300025932 | Bacteria | 2595 |
| 814 | Ga0207690_10079861 | 3300025932 | Bacteria | 2281 |
| 815 | Ga0207690_10178767 | 3300025932 | Bacteria | 1596 |
| 816 | Ga0207706_10000115 | 3300025933 | Bacteria | 86484 |
| 817 | Ga0207706_10014773 | 3300025933 | Bacteria | 7069 |
| 818 | Ga0207706_10019052 | 3300025933 | Bacteria | 6173 |
| 819 | Ga0207706_10028637 | 3300025933 | Bacteria | 4974 |
| 820 | Ga0207706_10036150 | 3300025933 | Bacteria | 4388 |
| 821 | Ga0207706_10069027 | 3300025933 | Bacteria | 3108 |
| 822 | Ga0207706_10134591 | 3300025933 | Bacteria | 2174 |
| 823 | Ga0207686_10005472 | 3300025934 | Bacteria | 6815 |
| 824 | Ga0207709_10000006 | 3300025935 | Bacteria | 800946 |
| 825 | Ga0207709_10000119 | 3300025935 | Bacteria | 121452 |
| 826 | Ga0207709_10004334 | 3300025935 | Bacteria | 8210 |
| 827 | Ga0207670_10062107 | 3300025936 | Bacteria | 2552 |
| 828 | Ga0207669_10055806 | 3300025937 | Bacteria | 2394 |
| 829 | Ga0207704_10000001 | 3300025938 | Bacteria | 716296 |
| 830 | Ga0207704_10004504 | 3300025938 | Bacteria | 6369 |
| 831 | Ga0207704_10008805 | 3300025938 | Bacteria | 4846 |
| 832 | Ga0207691_10000293 | 3300025940 | Bacteria | 49545 |
| 833 | Ga0207691_10008395 | 3300025940 | Bacteria | 9925 |
| 834 | Ga0207691_10030637 | 3300025940 | Bacteria | 5025 |
| 835 | Ga0207691_10042120 | 3300025940 | Bacteria | 4210 |
| 836 | Ga0207691_10151393 | 3300025940 | Bacteria | 2039 |
| 837 | Ga0207691_10153826 | 3300025940 | Bacteria | 2021 |
| 838 | Ga0207711_10020817 | 3300025941 | Bacteria | 5474 |
| 839 | Ga0207711_10168828 | 3300025941 | Bacteria | 1984 |
| 840 | Ga0207689_10001830 | 3300025942 | Bacteria | 20104 |
| 841 | Ga0207689_10002330 | 3300025942 | Bacteria | 17781 |
| 842 | Ga0207689_10006044 | 3300025942 | Bacteria | 10703 |
| 843 | Ga0207689_10014794 | 3300025942 | Bacteria | 6623 |
| 844 | Ga0207689_10033869 | 3300025942 | Bacteria | 4243 |
| 845 | Ga0207689_10047061 | 3300025942 | Unclassified | 3563 |
| 846 | Ga0207661_10001626 | 3300025944 | Bacteria | 15292 |
| 847 | Ga0207661_10002021 | 3300025944 | Bacteria | 13987 |
| 848 | Ga0207661_10056983 | 3300025944 | Bacteria | 3140 |
| 849 | Ga0207679_10001158 | 3300025945 | Bacteria | 16816 |
| 850 | Ga0207679_10049597 | 3300025945 | Bacteria | 3064 |
| 851 | Ga0207679_10106915 | 3300025945 | Bacteria | 2200 |
| 852 | Ga0207667_10000046 | 3300025949 | Bacteria | 245420 |
| 853 | Ga0207667_10000135 | 3300025949 | Bacteria | 111565 |
| 854 | Ga0207667_10000190 | 3300025949 | Bacteria | 90197 |
| 855 | Ga0207667_10000391 | 3300025949 | Bacteria | 59208 |
| 856 | Ga0207667_10001258 | 3300025949 | Bacteria | 31777 |
| 857 | Ga0207667_10003647 | 3300025949 | Bacteria | 18980 |
| 858 | Ga0207667_10004453 | 3300025949 | Bacteria | 17151 |
| 859 | Ga0207667_10015326 | 3300025949 | Bacteria | 8715 |
| 860 | Ga0207667_10044880 | 3300025949 | Bacteria | 4682 |
| 861 | Ga0207667_10058074 | 3300025949 | Bacteria | 4060 |
| 862 | Ga0207667_10073823 | 3300025949 | Bacteria | 3544 |
| 863 | Ga0207667_10097647 | 3300025949 | Bacteria | 3032 |
| 864 | Ga0207667_10212267 | 3300025949 | Bacteria | 1984 |
| 865 | Ga0207667_10228621 | 3300025949 | Bacteria | 1905 |
| 866 | Ga0207651_10000002 | 3300025960 | Bacteria | 427663 |
| 867 | Ga0207651_10002459 | 3300025960 | Bacteria | 8847 |
| 868 | Ga0207651_10054310 | 3300025960 | Bacteria | 2744 |
| 869 | Ga0207651_10071052 | 3300025960 | Bacteria | 2465 |
| 870 | Ga0207651_10072948 | 3300025960 | Bacteria | 2439 |
| 871 | Ga0207651_10080997 | 3300025960 | Bacteria | 2339 |
| 872 | Ga0207651_10127472 | 3300025960 | Bacteria | 1942 |
| 873 | Ga0207712_10017200 | 3300025961 | Bacteria | 4692 |
| 874 | Ga0207712_10018615 | 3300025961 | Bacteria | 4526 |
| 875 | Ga0207712_10023530 | 3300025961 | Bacteria | 4067 |
| 876 | Ga0207712_10024170 | 3300025961 | Bacteria | 4020 |
| 877 | Ga0207668_10001840 | 3300025972 | Bacteria | 12381 |
| 878 | Ga0207668_10013298 | 3300025972 | Bacteria | 5063 |
| 879 | Ga0207668_10062151 | 3300025972 | Bacteria | 2629 |
| 880 | Ga0207640_10000710 | 3300025981 | Bacteria | 19310 |
| 881 | Ga0207640_10022246 | 3300025981 | Bacteria | 3791 |
| 882 | Ga0207640_10228886 | 3300025981 | Bacteria | 1429 |
| 883 | Ga0207658_10001199 | 3300025986 | Bacteria | 20672 |
| 884 | Ga0207658_10006063 | 3300025986 | Bacteria | 8256 |
| 885 | Ga0207658_10007214 | 3300025986 | Bacteria | 7577 |
| 886 | Ga0207658_10008446 | 3300025986 | Bacteria | 7009 |
| 887 | Ga0207658_10166523 | 3300025986 | Bacteria | 1811 |
| 888 | Ga0207677_10000042 | 3300026023 | Bacteria | 110706 |
| 889 | Ga0207677_10005877 | 3300026023 | Bacteria | 6676 |
| 890 | Ga0207677_10013999 | 3300026023 | Bacteria | 4668 |
| 891 | Ga0207677_10052863 | 3300026023 | Unclassified | 2762 |
| 892 | Ga0207677_10058186 | 3300026023 | Bacteria | 2659 |
| 893 | Ga0207703_10000495 | 3300026035 | Bacteria | 40916 |
| 894 | Ga0207703_10003145 | 3300026035 | Bacteria | 13927 |
| 895 | Ga0207703_10006159 | 3300026035 | Bacteria | 9602 |
| 896 | Ga0207703_10153412 | 3300026035 | Bacteria | 2011 |
| 897 | Ga0207639_10001961 | 3300026041 | Bacteria | 13824 |
| 898 | Ga0207639_10002864 | 3300026041 | Bacteria | 11589 |
| 899 | Ga0207639_10016353 | 3300026041 | Bacteria | 5247 |
| 900 | Ga0207639_10018367 | 3300026041 | Bacteria | 4968 |
| 901 | Ga0207639_10065102 | 3300026041 | Bacteria | 2829 |
| 902 | Ga0207639_10077694 | 3300026041 | Bacteria | 2618 |
| 903 | Ga0207639_10119487 | 3300026041 | Bacteria | 2163 |
| 904 | Ga0207678_10039235 | 3300026067 | Bacteria | 4110 |
| 905 | Ga0207678_10072591 | 3300026067 | Bacteria | 2949 |
| 906 | Ga0207702_10000165 | 3300026078 | Bacteria | 79066 |
| 907 | Ga0207702_10010109 | 3300026078 | Bacteria | 7906 |
| 908 | Ga0207702_10017996 | 3300026078 | Bacteria | 5849 |
| 909 | Ga0207702_10030948 | 3300026078 | Bacteria | 4460 |
| 910 | Ga0207702_10034461 | 3300026078 | Bacteria | 4233 |
| 911 | Ga0207641_10000053 | 3300026088 | Bacteria | 173468 |
| 912 | Ga0207641_10000734 | 3300026088 | Bacteria | 35187 |
| 913 | Ga0207641_10005551 | 3300026088 | Bacteria | 10750 |
| 914 | Ga0207641_10018211 | 3300026088 | Bacteria | 5757 |
| 915 | Ga0207641_10018628 | 3300026088 | Bacteria | 5691 |
| 916 | Ga0207648_10000001 | 3300026089 | Bacteria | 427499 |
| 917 | Ga0207648_10003474 | 3300026089 | Bacteria | 16523 |
| 918 | Ga0207648_10005517 | 3300026089 | Bacteria | 12755 |
| 919 | Ga0207648_10020072 | 3300026089 | Bacteria | 6028 |
| 920 | Ga0207648_10021881 | 3300026089 | Bacteria | 5745 |
| 921 | Ga0207648_10079790 | 3300026089 | Bacteria | 2855 |
| 922 | Ga0207648_10090555 | 3300026089 | Bacteria | 2673 |
| 923 | Ga0207648_10136337 | 3300026089 | Bacteria | 2162 |
| 924 | Ga0207676_10057538 | 3300026095 | Bacteria | 3062 |
| 925 | Ga0207676_10103841 | 3300026095 | Bacteria | 2362 |
| 926 | Ga0207674_10000018 | 3300026116 | Bacteria | 167809 |
| 927 | Ga0207674_10000672 | 3300026116 | Bacteria | 44419 |
| 928 | Ga0207674_10002568 | 3300026116 | Bacteria | 22867 |
| 929 | Ga0207674_10011114 | 3300026116 | Bacteria | 10125 |
| 930 | Ga0207674_10015732 | 3300026116 | Bacteria | 8300 |
| 931 | Ga0207674_10028279 | 3300026116 | Bacteria | 5918 |
| 932 | Ga0207674_10057821 | 3300026116 | Bacteria | 3931 |
| 933 | Ga0207674_10116814 | 3300026116 | Bacteria | 2639 |
| 934 | Ga0207675_100005554 | 3300026118 | Bacteria | 12068 |
| 935 | Ga0207675_100017826 | 3300026118 | Bacteria | 6625 |
| 936 | Ga0207675_100119454 | 3300026118 | Bacteria | 2493 |
| 937 | Ga0207683_10011668 | 3300026121 | Bacteria | 7500 |
| 938 | Ga0207683_10021472 | 3300026121 | Bacteria | 5528 |
| 939 | Ga0207683_10067406 | 3300026121 | Bacteria | 3157 |
| 940 | Ga0207683_10108019 | 3300026121 | Bacteria | 2490 |
| 941 | Ga0207683_10155591 | 3300026121 | Unclassified | 2064 |
| 942 | Ga0207698_10001560 | 3300026142 | Bacteria | 13354 |
| 943 | Ga0207698_10007731 | 3300026142 | Bacteria | 6746 |
| 944 | Ga0207698_10025890 | 3300026142 | Bacteria | 4142 |
| 945 | Ga0207698_10134973 | 3300026142 | Bacteria | 2116 |
| 946 | Ga0209281_1000031 | 3300027111 | Bacteria | 422772 |
| 947 | Ga0209281_1000065 | 3300027111 | Bacteria | 285579 |
| 948 | Ga0209281_1000088 | 3300027111 | Bacteria | 245908 |
| 949 | Ga0209281_1000107 | 3300027111 | Bacteria | 218397 |
| 950 | Ga0209281_1000112 | 3300027111 | Bacteria | 213847 |
| 951 | Ga0209281_1000162 | 3300027111 | Bacteria | 159535 |
| 952 | Ga0209281_1000327 | 3300027111 | Bacteria | 82960 |
| 953 | Ga0209281_1000606 | 3300027111 | Bacteria | 40572 |
| 954 | Ga0209281_1000649 | 3300027111 | Bacteria | 37518 |
| 955 | Ga0209281_1001280 | 3300027111 | Bacteria | 16155 |
| 956 | Ga0209281_1010279 | 3300027111 | Bacteria | 2151 |
| 957 | Ga0209371_1000010 | 3300027312 | Bacteria | 922021 |
| 958 | Ga0209371_1000027 | 3300027312 | Bacteria | 448853 |
| 959 | Ga0209371_1000029 | 3300027312 | Bacteria | 424797 |
| 960 | Ga0209371_1000092 | 3300027312 | Bacteria | 171648 |
| 961 | Ga0209371_1000146 | 3300027312 | Bacteria | 115378 |
| 962 | Ga0209371_1000266 | 3300027312 | Bacteria | 61272 |
| 963 | Ga0209371_1000270 | 3300027312 | Bacteria | 60585 |
| 964 | Ga0209371_1004055 | 3300027312 | Bacteria | 6619 |
| 965 | Ga0209371_1009262 | 3300027312 | Bacteria | 3146 |
| 966 | Ga0209371_1014847 | 3300027312 | Bacteria | 2118 |
| 967 | Ga0209489_109199 | 3300027361 | Bacteria | 12544 |
| 968 | Ga0207428_10079113 | 3300027907 | Bacteria | 2571 |
| 969 | Ga0268266_10000032 | 3300028379 | Bacteria | 395079 |
| 970 | Ga0268266_10000049 | 3300028379 | Bacteria | 307763 |
| 971 | Ga0268266_10000079 | 3300028379 | Bacteria | 213545 |
| 972 | Ga0268266_10004031 | 3300028379 | Bacteria | 14202 |
| 973 | Ga0268266_10095689 | 3300028379 | Bacteria | 2608 |
| 974 | Ga0268266_10100658 | 3300028379 | Bacteria | 2546 |
| 975 | Ga0268265_10018409 | 3300028380 | Unclassified | 4840 |
| 976 | Ga0268265_10136426 | 3300028380 | Bacteria | 2048 |
| 977 | Ga0268265_10164881 | 3300028380 | Bacteria | 1887 |
| 978 | Ga0268264_10000041 | 3300028381 | Bacteria | 372501 |
| 979 | Ga0268264_10000176 | 3300028381 | Bacteria | 136166 |
| 980 | Ga0268264_10004390 | 3300028381 | Bacteria | 12032 |
| 981 | Ga0268264_10007057 | 3300028381 | Bacteria | 9416 |
| 982 | Ga0268264_10011611 | 3300028381 | Bacteria | 7267 |
| 983 | Ga0268264_10017902 | 3300028381 | Bacteria | 5797 |
| 984 | Ga0268264_10019208 | 3300028381 | Bacteria | 5585 |
| 985 | Ga0268264_10022094 | 3300028381 | Bacteria | 5192 |
| 986 | Ga0268264_10125354 | 3300028381 | Bacteria | 2269 |
| 987 | Ga0268264_10193439 | 3300028381 | Bacteria | 1856 |
| 988 | Ga0307517_10000429 | 3300028786 | Bacteria | 72171 |
| 989 | Ga0307517_10001171 | 3300028786 | Bacteria | 44114 |
| 990 | Ga0307517_10002048 | 3300028786 | Bacteria | 32795 |
| 991 | Ga0307515_10000061 | 3300028794 | Bacteria | 251841 |
| 992 | Ga0307515_10001027 | 3300028794 | Bacteria | 63746 |
| 993 | Ga0307515_10001574 | 3300028794 | Bacteria | 50970 |
| 994 | Ga0307515_10015963 | 3300028794 | Bacteria | 13791 |
| 995 | Ga0265338_10025958 | 3300028800 | Bacteria | 5924 |
| 996 | Ga0265338_10094575 | 3300028800 | Bacteria | 2458 |
| 997 | Ga0237817_10010 | 3300030083 | Bacteria | 78285 |
| 998 | Ga0268256_1000022 | 3300030500 | Bacteria | 531115 |
| 999 | Ga0268256_1000032 | 3300030500 | Bacteria | 424603 |
| 1000 | Ga0268256_1000045 | 3300030500 | Bacteria | 330053 |
| 1001 | Ga0268256_1000082 | 3300030500 | Bacteria | 171648 |
| 1002 | Ga0268256_1000117 | 3300030500 | Bacteria | 115176 |
| 1003 | Ga0268256_1000248 | 3300030500 | Bacteria | 56898 |
| 1004 | Ga0268256_1003628 | 3300030500 | Bacteria | 6861 |
| 1005 | Ga0268256_1003783 | 3300030500 | Bacteria | 6620 |
| 1006 | Ga0268256_1005563 | 3300030500 | Bacteria | 4915 |
| 1007 | Ga0268256_1005828 | 3300030500 | Bacteria | 4736 |
| 1008 | Ga0307511_10001833 | 3300030521 | Bacteria | 22329 |
| 1009 | Ga0307511_10035570 | 3300030521 | Bacteria | 4346 |
| 1010 | Ga0316176_1186872 | 3300030732 | Bacteria | 4413 |
| 1011 | Ga0316181_1204273 | 3300030744 | Bacteria | 12316 |
| 1012 | Ga0265332_10018318 | 3300031238 | Bacteria | 3090 |
| 1013 | Ga0265327_10000051 | 3300031251 | Bacteria | 257963 |
| 1014 | Ga0265327_10023081 | 3300031251 | Bacteria | 3696 |
| 1015 | Ga0265327_10102392 | 3300031251 | Unclassified | 1380 |
| 1016 | Ga0265316_10006677 | 3300031344 | Bacteria | 10991 |
| 1017 | Ga0265316_10137960 | 3300031344 | Unclassified | 1834 |
| 1018 | Ga0307513_10005109 | 3300031456 | Bacteria | 17369 |
| 1019 | Ga0307513_10017431 | 3300031456 | Bacteria | 8612 |
| 1020 | Ga0307513_10060749 | 3300031456 | Bacteria | 4005 |
| 1021 | Ga0307513_10177668 | 3300031456 | Unclassified | 1996 |
| 1022 | Ga0307513_10179938 | 3300031456 | Bacteria | 1979 |
| 1023 | Ga0307513_10242293 | 3300031456 | Bacteria | 1607 |
| 1024 | Ga0307513_10263851 | 3300031456 | Bacteria | 1510 |
| 1025 | Ga0307509_10000019 | 3300031507 | Bacteria | 256151 |
| 1026 | Ga0307509_10085073 | 3300031507 | Bacteria | 3256 |
| 1027 | Ga0307509_10093472 | 3300031507 | Bacteria | 3069 |
| 1028 | Ga0307509_10095342 | 3300031507 | Bacteria | 3031 |
| 1029 | Ga0307509_10192126 | 3300031507 | Bacteria | 1891 |
| 1030 | Ga0307408_100000005 | 3300031548 | Bacteria | 529098 |
| 1031 | Ga0307408_100072036 | 3300031548 | Unclassified | 2557 |
| 1032 | Ga0307508_10002356 | 3300031616 | Bacteria | 19994 |
| 1033 | Ga0307514_10035615 | 3300031649 | Bacteria | 3961 |
| 1034 | Ga0316575_10008091 | 3300031665 | Bacteria | 3822 |
| 1035 | Ga0265314_10011967 | 3300031711 | Bacteria | 7115 |
| 1036 | Ga0307516_10001571 | 3300031730 | Bacteria | 31452 |
| 1037 | Ga0307516_10019622 | 3300031730 | Bacteria | 6999 |
| 1038 | Ga0307405_10000003 | 3300031731 | Bacteria | 569064 |
| 1039 | Ga0307405_10000019 | 3300031731 | Bacteria | 167960 |
| 1040 | Ga0307413_10000959 | 3300031824 | Bacteria | 10337 |
| 1041 | Ga0307413_10001519 | 3300031824 | Bacteria | 8893 |
| 1042 | Ga0307413_10050336 | 3300031824 | Bacteria | 2503 |
| 1043 | Ga0307518_10012267 | 3300031838 | Bacteria | 6128 |
| 1044 | Ga0307407_10000019 | 3300031903 | Bacteria | 129701 |
| 1045 | Ga0307407_10000021 | 3300031903 | Bacteria | 122064 |
| 1046 | Ga0307407_10088738 | 3300031903 | Bacteria | 1890 |
| 1047 | Ga0307412_10055732 | 3300031911 | Unclassified | 2631 |
| 1048 | Ga0307409_100027918 | 3300031995 | Bacteria | 4010 |
| 1049 | Ga0307409_100179525 | 3300031995 | Unclassified | 1873 |
| 1050 | Ga0307416_100000043 | 3300032002 | Bacteria | 130035 |
| 1051 | Ga0307416_100000232 | 3300032002 | Bacteria | 29680 |
| 1052 | Ga0307416_100000252 | 3300032002 | Bacteria | 28542 |
| 1053 | Ga0307416_100001520 | 3300032002 | Bacteria | 12660 |
| 1054 | Ga0307414_10000053 | 3300032004 | Bacteria | 121338 |
| 1055 | Ga0307414_10002363 | 3300032004 | Bacteria | 9864 |
| 1056 | Ga0307414_10004482 | 3300032004 | Bacteria | 7587 |
| 1057 | Ga0307414_10005497 | 3300032004 | Bacteria | 6984 |
| 1058 | Ga0307414_10006818 | 3300032004 | Bacteria | 6388 |
| 1059 | Ga0307414_10032784 | 3300032004 | Bacteria | 3425 |
| 1060 | Ga0307411_10000006 | 3300032005 | Bacteria | 382357 |
| 1061 | Ga0307411_10000009 | 3300032005 | Bacteria | 319906 |
| 1062 | Ga0307415_100009832 | 3300032126 | Bacteria | 5388 |
| 1063 | Ga0307415_100165412 | 3300032126 | Bacteria | 1719 |
| 1064 | Ga0307507_10000510 | 3300033179 | Bacteria | 81853 |
| 1065 | Ga0307510_10000002 | 3300033180 | Bacteria | 801565 |
| 1066 | Ga0307510_10020428 | 3300033180 | Bacteria | 7735 |
| 1067 | Ga0307510_10020871 | 3300033180 | Bacteria | 7646 |
| 1068 | Ga0373936_0012250 | 3300035113 | Bacteria | 3260 |
| 1069 | Ga0373936_0012969 | 3300035113 | Bacteria | 3177 |
| 1070 | Ga0373937_0057048 | 3300036401 | Bacteria | 3587 |
| 1071 | Ga0373937_0140797 | 3300036401 | Unclassified | 2257 |
| 1072 | Ga0395899_0000002 | 3300037312 | Bacteria | 1324310 |
| 1073 | Ga0395899_0000055 | 3300037312 | Bacteria | 220579 |
| 1074 | Ga0395899_0001560 | 3300037312 | Bacteria | 19297 |
| 1075 | Ga0395899_0001714 | 3300037312 | Bacteria | 18241 |
| 1076 | Ga0395899_0007754 | 3300037312 | Bacteria | 8277 |
| 1077 | Ga0395899_0014865 | 3300037312 | Bacteria | 5942 |
| 1078 | Ga0395899_0020675 | 3300037312 | Bacteria | 4990 |
| 1079 | Ga0395899_0047617 | 3300037312 | Bacteria | 3191 |
| 1080 | Ga0395900_0000285 | 3300037418 | Bacteria | 75772 |
| 1081 | Ga0395900_0000322 | 3300037418 | Bacteria | 70864 |
| 1082 | Ga0395900_0001027 | 3300037418 | Bacteria | 35806 |
| 1083 | Ga0395900_0003451 | 3300037418 | Bacteria | 17088 |
| 1084 | Ga0395900_0004551 | 3300037418 | Bacteria | 14660 |
| 1085 | Ga0395900_0005771 | 3300037418 | Bacteria | 12934 |
| 1086 | Ga0395900_0035403 | 3300037418 | Bacteria | 5142 |
| 1087 | Ga0395900_0067592 | 3300037418 | Bacteria | 3672 |
| 1088 | Ga0395900_0102015 | 3300037418 | Bacteria | 2947 |
| 1089 | Ga0395900_0118787 | 3300037418 | Bacteria | 2713 |
| 1090 | Ga0395900_0176938 | 3300037418 | Bacteria | 2170 |
| 1091 | Ga0395900_0255098 | 3300037418 | Bacteria | 1753 |
| 1092 | Ga0395898_0001240 | 3300037466 | Bacteria | 38058 |
| 1093 | Ga0395898_0038993 | 3300037466 | Bacteria | 4705 |
| 1094 | Ga0395898_0048311 | 3300037466 | Bacteria | 4174 |
| 1095 | Ga0395898_0058344 | 3300037466 | Unclassified | 3757 |
| 1096 | Ga0395898_0081995 | 3300037466 | Bacteria | 3110 |
| 1097 | Ga0395898_0083914 | 3300037466 | Bacteria | 3070 |
| 1098 | Ga0395905_0000070 | 3300037471 | Bacteria | 175662 |
| 1099 | Ga0395905_0000716 | 3300037471 | Bacteria | 43859 |
| 1100 | Ga0395905_0017759 | 3300037471 | Bacteria | 6756 |
| 1101 | Ga0395905_0021327 | 3300037471 | Bacteria | 6128 |
| 1102 | Ga0395905_0061121 | 3300037471 | Unclassified | 3523 |
| 1103 | Ga0395901_0000332 | 3300038443 | Bacteria | 57814 |
| 1104 | Ga0395901_0003481 | 3300038443 | Bacteria | 15860 |
| 1105 | Ga0395901_0009872 | 3300038443 | Bacteria | 9675 |
| 1106 | Ga0395901_0017512 | 3300038443 | Bacteria | 7313 |
| 1107 | Ga0395901_0061345 | 3300038443 | Bacteria | 3912 |
| 1108 | Ga0395901_0208062 | 3300038443 | Bacteria | 2048 |
| 1109 | Ga0395901_0218072 | 3300038443 | Bacteria | 1994 |
| 1110 | Ga0395901_0236184 | 3300038443 | Bacteria | 1908 |
| 1111 | Ga0395901_0304788 | 3300038443 | Bacteria | 1651 |
| 1112 | Ga0436365_0171687 | 3300039437 | Bacteria | 172237 |
| 1113 | Ga0436361_0059626 | 3300039447 | Bacteria | 8081 |
| 1114 | Ga0439438_000001 | 3300041405 | Bacteria | 1263568 |
| 1115 | Ga0439438_002410 | 3300041405 | Bacteria | 7969 |
| 1116 | Ga0439438_002877 | 3300041405 | Bacteria | 7159 |
| 1117 | Ga0439439_0030538 | 3300041406 | Bacteria | 1370 |
| 1118 | Ga0439447_000193 | 3300041407 | Bacteria | 21766 |
| 1119 | Ga0439447_000563 | 3300041407 | Bacteria | 13807 |
| 1120 | Ga0451791_1638987 | 3300041451 | Bacteria | 2124 |
| 1121 | Ga0451800_0868019 | 3300041459 | Bacteria | 2285 |
| 1122 | Ga0451807_2607721 | 3300041486 | Bacteria | 3505 |
| 1123 | Ga0451837_0156886 | 3300041494 | Bacteria | 1202 |
| 1124 | Ga0439442_014730 | 3300042002 | Unclassified | 1610 |
| 1125 | Ga0439448_0003051 | 3300042005 | Bacteria | 4601 |
| 1126 | Ga0439448_0008130 | 3300042005 | Bacteria | 3063 |
| 1127 | Ga0439448_0025228 | 3300042005 | Bacteria | 1863 |
| 1128 | Ga0439432_002021 | 3300042006 | Bacteria | 7680 |
| 1129 | Ga0439432_010316 | 3300042006 | Bacteria | 3239 |
| 1130 | Ga0439449_0002186 | 3300042007 | Bacteria | 7688 |
| 1131 | Ga0439449_0028771 | 3300042007 | Bacteria | 2071 |
| 1132 | Ga0439452_000010 | 3300042010 | Bacteria | 459139 |
| 1133 | Ga0439452_000012 | 3300042010 | Bacteria | 412478 |
| 1134 | Ga0439452_000039 | 3300042010 | Bacteria | 145243 |
| 1135 | Ga0439452_003330 | 3300042010 | Bacteria | 5652 |
| 1136 | Ga0439455_0001320 | 3300042012 | Bacteria | 4085 |
| 1137 | Ga0439457_007044 | 3300042014 | Bacteria | 2713 |
| 1138 | Ga0439457_007246 | 3300042014 | Bacteria | 2670 |
| 1139 | Ga0439458_0000056 | 3300042157 | Bacteria | 19343 |
| 1140 | Ga0439458_0000106 | 3300042157 | Bacteria | 16619 |
| 1141 | Ga0439464_0003228 | 3300042439 | Bacteria | 4103 |
| 1142 | Ga0451577_0000660 | 3300042876 | Bacteria | 54407 |
| 1143 | Ga0451577_0022846 | 3300042876 | Bacteria | 5709 |
| 1144 | Ga0451577_0026427 | 3300042876 | Bacteria | 5259 |
| 1145 | Ga0451577_0063292 | 3300042876 | Bacteria | 3299 |
| 1146 | Ga0451577_0163772 | 3300042876 | Bacteria | 2003 |
| 1147 | Ga0451577_0195649 | 3300042876 | Unclassified | 1825 |
| 1148 | Ga0451577_0290746 | 3300042876 | Bacteria | 1481 |
| 1149 | Ga0466969_0011304 | 3300044656 | Bacteria | 4727 |
| 1150 | Ga0466969_0017683 | 3300044656 | Bacteria | 3720 |
| 1151 | Ga0466969_0073274 | 3300044656 | Bacteria | 1643 |
| 1152 | Ga0466972_0000008 | 3300044658 | Bacteria | 264518 |
| 1153 | Ga0466972_0000032 | 3300044658 | Bacteria | 159445 |
| 1154 | Ga0466972_0000099 | 3300044658 | Bacteria | 76709 |
| 1155 | Ga0466972_0008359 | 3300044658 | Bacteria | 5188 |
| 1156 | Ga0466972_0032304 | 3300044658 | Bacteria | 2571 |
| 1157 | Ga0466981_0000033 | 3300044669 | Bacteria | 64864 |
| 1158 | Ga0453683_0000135 | 3300044673 | Bacteria | 107930 |
| 1159 | Ga0453683_0026343 | 3300044673 | Bacteria | 3692 |
| 1160 | Ga0453683_0100006 | 3300044673 | Bacteria | 1820 |
| 1161 | Ga0453683_0107530 | 3300044673 | Bacteria | 1753 |
| 1162 | Ga0466966_0000157 | 3300044684 | Bacteria | 44093 |
| 1163 | Ga0466966_0000222 | 3300044684 | Bacteria | 38030 |
| 1164 | Ga0466966_0002934 | 3300044684 | Bacteria | 11237 |
| 1165 | Ga0466966_0008700 | 3300044684 | Bacteria | 6719 |
| 1166 | Ga0466966_0076017 | 3300044684 | Bacteria | 2097 |
| 1167 | Ga0466961_0000565 | 3300044693 | Bacteria | 23538 |
| 1168 | Ga0466961_0010853 | 3300044693 | Bacteria | 5817 |
| 1169 | Ga0466961_0027192 | 3300044693 | Bacteria | 3678 |
| 1170 | Ga0466964_0006766 | 3300044706 | Bacteria | 4273 |
| 1171 | Ga0466964_0007857 | 3300044706 | Bacteria | 3994 |
| 1172 | Ga0453684_0000553 | 3300044712 | Bacteria | 141396 |
| 1173 | Ga0453684_0001244 | 3300044712 | Bacteria | 77266 |
| 1174 | Ga0453684_0003919 | 3300044712 | Bacteria | 32695 |
| 1175 | Ga0453684_0009187 | 3300044712 | Bacteria | 17377 |
| 1176 | Ga0453684_0011435 | 3300044712 | Bacteria | 14889 |
| 1177 | Ga0453684_0027373 | 3300044712 | Bacteria | 8179 |
| 1178 | Ga0453684_0049262 | 3300044712 | Bacteria | 5558 |
| 1179 | Ga0453684_0072712 | 3300044712 | Bacteria | 4339 |
| 1180 | Ga0453684_0084391 | 3300044712 | Bacteria | 3950 |
| 1181 | Ga0453684_0325186 | 3300044712 | Bacteria | 1740 |
| 1182 | Ga0466971_0002102 | 3300044719 | Bacteria | 8444 |
| 1183 | Ga0466971_0002161 | 3300044719 | Bacteria | 8316 |
| 1184 | Ga0466968_0005875 | 3300044735 | Bacteria | 4606 |
| 1185 | Ga0466970_0008939 | 3300044765 | Bacteria | 5052 |
| 1186 | Ga0466970_0031607 | 3300044765 | Bacteria | 2796 |
| 1187 | Ga0466970_0037259 | 3300044765 | Bacteria | 2577 |
| 1188 | Ga0466957_0000013 | 3300044842 | Bacteria | 71310 |
| 1189 | Ga0466957_0004749 | 3300044842 | Bacteria | 7609 |
| 1190 | Ga0466957_0006610 | 3300044842 | Bacteria | 6557 |
| 1191 | Ga0466957_0030457 | 3300044842 | Bacteria | 3222 |
| 1192 | Ga0466960_0031512 | 3300044901 | Bacteria | 2448 |
| 1193 | Ga0466960_0076825 | 3300044901 | Bacteria | 1673 |
| 1194 | Ga0466959_0001636 | 3300045049 | Bacteria | 13844 |
| 1195 | Ga0466959_0005022 | 3300045049 | Bacteria | 8985 |
| 1196 | Ga0466959_0010903 | 3300045049 | Bacteria | 6516 |
| 1197 | Ga0466959_0019618 | 3300045049 | Bacteria | 4972 |
| 1198 | Ga0466959_0027743 | 3300045049 | Bacteria | 4199 |
| 1199 | Ga0451576_0000112 | 3300045051 | Bacteria | 209574 |
| 1200 | Ga0451576_0001577 | 3300045051 | Bacteria | 38299 |
| 1201 | Ga0451576_0056604 | 3300045051 | Bacteria | 4100 |
| 1202 | Ga0451576_0058884 | 3300045051 | Bacteria | 4012 |
| 1203 | Ga0451576_0209097 | 3300045051 | Bacteria | 2038 |
| 1204 | Ga0466958_0001403 | 3300045836 | Bacteria | 11395 |
| 1205 | Ga0466958_0002680 | 3300045836 | Bacteria | 9016 |
| 1206 | Ga0466967_0027952 | 3300045976 | Bacteria | 4700 |
| 1207 | Ga0466967_0038134 | 3300045976 | Bacteria | 4119 |
| 1208 | Ga0495627_000181 | 3300046453 | Bacteria | 71127 |
| 1209 | Ga0495627_002499 | 3300046453 | Bacteria | 8778 |
| 1210 | Ga0495592_0162110 | 3300046454 | Bacteria | 1538 |
| 1211 | Ga0495590_0007233 | 3300046457 | Bacteria | 4292 |
| 1212 | Ga0495591_000029 | 3300046458 | Bacteria | 179657 |
| 1213 | Ga0495591_000094 | 3300046458 | Bacteria | 101106 |
| 1214 | Ga0495591_006502 | 3300046458 | Bacteria | 5160 |
| 1215 | Ga0495638_0003576 | 3300046460 | Bacteria | 12171 |
| 1216 | Ga0495638_0014448 | 3300046460 | Bacteria | 5335 |
| 1217 | Ga0495638_0041297 | 3300046460 | Bacteria | 2919 |
| 1218 | Ga0495638_0105728 | 3300046460 | Bacteria | 1677 |
| 1219 | Ga0495638_0112814 | 3300046460 | Bacteria | 1613 |
| 1220 | Ga0495651_0057753 | 3300046462 | Bacteria | 2979 |
| 1221 | Ga0495650_0000033 | 3300046471 | Bacteria | 412188 |
| 1222 | Ga0495650_0000103 | 3300046471 | Bacteria | 210023 |
| 1223 | Ga0495650_0000167 | 3300046471 | Bacteria | 145804 |
| 1224 | Ga0495650_0000189 | 3300046471 | Bacteria | 133931 |
| 1225 | Ga0495650_0000519 | 3300046471 | Bacteria | 57139 |
| 1226 | Ga0495582_0058936 | 3300046473 | Bacteria | 2118 |
| 1227 | Ga0495605_0000055 | 3300046474 | Bacteria | 157514 |
| 1228 | Ga0495605_0000068 | 3300046474 | Bacteria | 137743 |
| 1229 | Ga0495605_0055374 | 3300046474 | Bacteria | 1916 |
| 1230 | Ga0495584_0000576 | 3300046491 | Bacteria | 24776 |
| 1231 | Ga0495584_0001279 | 3300046491 | Bacteria | 15309 |
| 1232 | Ga0495584_0023801 | 3300046491 | Bacteria | 3104 |
| 1233 | Ga0495585_0000018 | 3300046492 | Bacteria | 162473 |
| 1234 | Ga0495585_0001568 | 3300046492 | Bacteria | 17756 |
| 1235 | Ga0495596_0003492 | 3300046500 | Bacteria | 7934 |
| 1236 | Ga0495596_0006128 | 3300046500 | Bacteria | 5585 |
| 1237 | Ga0495607_0001005 | 3300046501 | Bacteria | 25961 |
| 1238 | Ga0495607_0003503 | 3300046501 | Bacteria | 11999 |
| 1239 | Ga0495607_0006487 | 3300046501 | Bacteria | 8227 |
| 1240 | Ga0495606_0000008 | 3300046507 | Bacteria | 321373 |
| 1241 | Ga0495606_0000419 | 3300046507 | Bacteria | 71128 |
| 1242 | Ga0495606_0000619 | 3300046507 | Bacteria | 55941 |
| 1243 | Ga0495606_0001898 | 3300046507 | Bacteria | 26072 |
| 1244 | Ga0495606_0004447 | 3300046507 | Bacteria | 14002 |
| 1245 | Ga0495606_0014229 | 3300046507 | Bacteria | 6224 |
| 1246 | Ga0495606_0020180 | 3300046507 | Bacteria | 4925 |
| 1247 | Ga0495606_0028183 | 3300046507 | Bacteria | 3966 |
| 1248 | Ga0495606_0037911 | 3300046507 | Bacteria | 3268 |
| 1249 | Ga0495610_0000148 | 3300046512 | Bacteria | 77303 |
| 1250 | Ga0495610_0000266 | 3300046512 | Bacteria | 54387 |
| 1251 | Ga0495610_0001323 | 3300046512 | Bacteria | 21995 |
| 1252 | Ga0495610_0004181 | 3300046512 | Bacteria | 10786 |
| 1253 | Ga0495610_0007362 | 3300046512 | Bacteria | 7348 |
| 1254 | Ga0495610_0022376 | 3300046512 | Bacteria | 3459 |
| 1255 | Ga0495616_0002554 | 3300046513 | Bacteria | 12011 |
| 1256 | Ga0495616_0004107 | 3300046513 | Bacteria | 9231 |
| 1257 | Ga0495616_0015961 | 3300046513 | Bacteria | 4164 |
| 1258 | Ga0495616_0023858 | 3300046513 | Bacteria | 3287 |
| 1259 | Ga0495616_0049087 | 3300046513 | Bacteria | 2117 |
| 1260 | Ga0495618_0019272 | 3300046514 | Bacteria | 4196 |
| 1261 | Ga0495630_0041133 | 3300046517 | Bacteria | 3452 |
| 1262 | Ga0495630_0154644 | 3300046517 | Bacteria | 1746 |
| 1263 | Ga0495630_0207858 | 3300046517 | Bacteria | 1494 |
| 1264 | Ga0495637_0032499 | 3300046520 | Bacteria | 2298 |
| 1265 | Ga0495637_0065569 | 3300046520 | Bacteria | 1478 |
| 1266 | Ga0495644_0016290 | 3300046523 | Unclassified | 2845 |
| 1267 | Ga0495644_0044795 | 3300046523 | Bacteria | 1664 |
| 1268 | Ga0495648_0002776 | 3300046524 | Bacteria | 15794 |
| 1269 | Ga0495648_0003058 | 3300046524 | Bacteria | 14968 |
| 1270 | Ga0495648_0004838 | 3300046524 | Bacteria | 11366 |
| 1271 | Ga0495642_0044151 | 3300046528 | Bacteria | 1819 |
| 1272 | Ga0495654_0000078 | 3300046530 | Bacteria | 110443 |
| 1273 | Ga0495654_0000572 | 3300046530 | Bacteria | 29558 |
| 1274 | Ga0495654_0000616 | 3300046530 | Bacteria | 28330 |
| 1275 | Ga0495654_0026535 | 3300046530 | Bacteria | 2977 |
| 1276 | Ga0495609_0000038 | 3300046538 | Bacteria | 182264 |
| 1277 | Ga0495609_0000190 | 3300046538 | Bacteria | 61573 |
| 1278 | Ga0495609_0000254 | 3300046538 | Bacteria | 50695 |
| 1279 | Ga0495609_0001935 | 3300046538 | Bacteria | 13177 |
| 1280 | Ga0495609_0025233 | 3300046538 | Bacteria | 2726 |
| 1281 | Ga0495622_0000053 | 3300046557 | Bacteria | 102938 |
| 1282 | Ga0495633_0000022 | 3300046558 | Bacteria | 226582 |
| 1283 | Ga0495633_0000177 | 3300046558 | Bacteria | 82953 |
| 1284 | Ga0495668_0000009 | 3300046616 | Bacteria | 492623 |
| 1285 | Ga0495668_0001086 | 3300046616 | Bacteria | 28354 |
| 1286 | Ga0495668_0001824 | 3300046616 | Bacteria | 19303 |
| 1287 | Ga0495668_0003068 | 3300046616 | Bacteria | 12940 |
| 1288 | Ga0495668_0010689 | 3300046616 | Bacteria | 5545 |
| 1289 | Ga0495625_0000017 | 3300046660 | Bacteria | 299728 |
| 1290 | Ga0495625_0000375 | 3300046660 | Bacteria | 68361 |
| 1291 | Ga0495625_0000785 | 3300046660 | Bacteria | 44141 |
| 1292 | Ga0495625_0001098 | 3300046660 | Bacteria | 35115 |
| 1293 | Ga0495625_0007459 | 3300046660 | Bacteria | 9513 |
| 1294 | Ga0495625_0013468 | 3300046660 | Bacteria | 6571 |
| 1295 | Ga0495625_0029100 | 3300046660 | Bacteria | 4135 |
| 1296 | Ga0495625_0042106 | 3300046660 | Bacteria | 3321 |
| 1297 | Ga0495635_0099339 | 3300046663 | Bacteria | 1989 |
| 1298 | Ga0495659_0001483 | 3300046664 | Bacteria | 7958 |
| 1299 | Ga0495661_0000070 | 3300046665 | Bacteria | 124795 |
| 1300 | Ga0495661_0000400 | 3300046665 | Bacteria | 46177 |
| 1301 | Ga0495661_0000838 | 3300046665 | Bacteria | 28709 |
| 1302 | Ga0495661_0002871 | 3300046665 | Bacteria | 13037 |
| 1303 | Ga0495661_0043170 | 3300046665 | Bacteria | 2773 |
| 1304 | Ga0495661_0131899 | 3300046665 | Bacteria | 1368 |
| 1305 | Ga0495588_0000172 | 3300046674 | Bacteria | 81934 |
| 1306 | Ga0495658_0032269 | 3300046683 | Bacteria | 2859 |
| 1307 | Ga0495658_0033214 | 3300046683 | Bacteria | 2824 |
| 1308 | Ga0495669_0005794 | 3300046684 | Bacteria | 5151 |
| 1309 | Ga0495613_0063067 | 3300046689 | Bacteria | 2712 |
| 1310 | Ga0495671_0003259 | 3300046692 | Bacteria | 10072 |
| 1311 | Ga0495649_0000008 | 3300046694 | Bacteria | 483706 |
| 1312 | Ga0495649_0001447 | 3300046694 | Bacteria | 17893 |
| 1313 | Ga0495649_0012203 | 3300046694 | Bacteria | 5009 |
| 1314 | Ga0495649_0044924 | 3300046694 | Bacteria | 2411 |
| 1315 | Ga0495589_0000010 | 3300046794 | Bacteria | 250407 |
| 1316 | Ga0495589_0000126 | 3300046794 | Bacteria | 70547 |
| 1317 | Ga0495589_0000211 | 3300046794 | Bacteria | 49487 |
| 1318 | Ga0495589_0008358 | 3300046794 | Bacteria | 5409 |
| 1319 | Ga0495660_0000011 | 3300046810 | Bacteria | 361397 |
| 1320 | Ga0495660_0000047 | 3300046810 | Bacteria | 149291 |
| 1321 | Ga0495674_0035314 | 3300047319 | Unclassified | 4512 |
| 1322 | Ga0495672_0000004 | 3300047320 | Bacteria | 631810 |
| 1323 | Ga0495672_0000392 | 3300047320 | Bacteria | 53737 |
| 1324 | Ga0495672_0001319 | 3300047320 | Bacteria | 24677 |
| 1325 | Ga0495672_0042879 | 3300047320 | Bacteria | 2725 |
| 1326 | Ga0495672_0043010 | 3300047320 | Bacteria | 2719 |
| 1327 | Ga0495680_0062162 | 3300047322 | Bacteria | 2872 |
| 1328 | Ga0495683_0009241 | 3300047323 | Bacteria | 5253 |
| 1329 | Ga0495683_0033417 | 3300047323 | Bacteria | 2617 |
| 1330 | Ga0495687_000001 | 3300047443 | Bacteria | 1215582 |
| 1331 | Ga0495687_000071 | 3300047443 | Bacteria | 159096 |
| 1332 | Ga0495687_000363 | 3300047443 | Bacteria | 56664 |
| 1333 | Ga0495687_003106 | 3300047443 | Bacteria | 12423 |
| 1334 | Ga0495687_004707 | 3300047443 | Bacteria | 9058 |
| 1335 | Ga0495675_0084072 | 3300047444 | Bacteria | 2003 |
| 1336 | Ga0495677_0000016 | 3300047445 | Bacteria | 126981 |
| 1337 | Ga0495677_0003062 | 3300047445 | Bacteria | 6500 |
| 1338 | Ga0495677_0012949 | 3300047445 | Bacteria | 3037 |
| 1339 | Ga0495673_0000023 | 3300047469 | Bacteria | 539904 |
| 1340 | Ga0495673_0000079 | 3300047469 | Bacteria | 202569 |
| 1341 | Ga0495681_0011881 | 3300047470 | Bacteria | 5148 |
| 1342 | Ga0495686_0001966 | 3300047472 | Bacteria | 20417 |
| 1343 | Ga0495686_0035024 | 3300047472 | Bacteria | 3230 |
| 1344 | Ga0495602_0082369 | 3300048088 | Bacteria | 2701 |
| 1345 | Ga0495626_0000042 | 3300048091 | Bacteria | 169058 |
| 1346 | Ga0495626_0000533 | 3300048091 | Bacteria | 37890 |
| 1347 | Ga0496100_0032077 | 3300048903 | Unclassified | 3272 |
| 1348 | Ga0496101_0000029 | 3300048904 | Bacteria | 198515 |
| 1349 | Ga0496101_0030747 | 3300048904 | Bacteria | 3769 |
| 1350 | Ga0496102_0001288 | 3300048905 | Bacteria | 22599 |
| 1351 | Ga0496102_0076783 | 3300048905 | Bacteria | 3073 |
| 1352 | Ga0496103_0154689 | 3300048906 | Bacteria | 1469 |
| 1353 | Ga0496104_0000098 | 3300048907 | Bacteria | 84601 |
| 1354 | Ga0496104_0108208 | 3300048907 | Bacteria | 2664 |
| 1355 | Ga0496105_0020177 | 3300048908 | Bacteria | 5382 |
| 1356 | Ga0496106_0016890 | 3300048909 | Bacteria | 5401 |
| 1357 | Ga0496106_0186055 | 3300048909 | Unclassified | 1650 |
| 1358 | Ga0496107_0002047 | 3300048910 | Bacteria | 12887 |
| 1359 | Ga0496109_0019183 | 3300048912 | Bacteria | 6023 |
| 1360 | Ga0496111_0153113 | 3300048914 | Bacteria | 1711 |
| 1361 | Ga0496113_0022284 | 3300048916 | Bacteria | 4478 |
| 1362 | Ga0496115_0109466 | 3300048918 | Bacteria | 2269 |
| 1363 | Ga0496116_0000075 | 3300048919 | Bacteria | 231674 |
| 1364 | Ga0496116_0000077 | 3300048919 | Bacteria | 227959 |
| 1365 | Ga0496116_0006079 | 3300048919 | Bacteria | 11043 |
| 1366 | Ga0496116_0028515 | 3300048919 | Bacteria | 4042 |
| 1367 | Ga0496116_0032177 | 3300048919 | Bacteria | 3742 |
| 1368 | Ga0496116_0035909 | 3300048919 | Bacteria | 3476 |
| 1369 | Ga0496116_0041821 | 3300048919 | Bacteria | 3140 |
| 1370 | Ga0496116_0041883 | 3300048919 | Bacteria | 3137 |
| 1371 | Ga0496117_0000054 | 3300048920 | Bacteria | 278013 |
| 1372 | Ga0496117_0000593 | 3300048920 | Bacteria | 59578 |
| 1373 | Ga0496117_0000635 | 3300048920 | Bacteria | 56535 |
| 1374 | Ga0496117_0002611 | 3300048920 | Bacteria | 22395 |
| 1375 | Ga0496117_0006228 | 3300048920 | Bacteria | 12166 |
| 1376 | Ga0496117_0025066 | 3300048920 | Bacteria | 4698 |
| 1377 | Ga0496117_0051088 | 3300048920 | Bacteria | 2926 |
| 1378 | Ga0496117_0129807 | 3300048920 | Bacteria | 1530 |
| 1379 | Ga0496118_0000045 | 3300048921 | Bacteria | 275165 |
| 1380 | Ga0496118_0006469 | 3300048921 | Bacteria | 12865 |
| 1381 | Ga0496118_0008371 | 3300048921 | Bacteria | 10697 |
| 1382 | Ga0496118_0032272 | 3300048921 | Bacteria | 4319 |
| 1383 | Ga0496118_0033182 | 3300048921 | Bacteria | 4241 |
| 1384 | Ga0496118_0040958 | 3300048921 | Bacteria | 3675 |
| 1385 | Ga0496118_0057976 | 3300048921 | Bacteria | 2898 |
| 1386 | Ga0496118_0067077 | 3300048921 | Bacteria | 2615 |
| 1387 | Ga0496118_0084529 | 3300048921 | Bacteria | 2213 |
| 1388 | Ga0496118_0086752 | 3300048921 | Bacteria | 2174 |
| 1389 | Ga0496119_0000023 | 3300048922 | Bacteria | 259882 |
| 1390 | Ga0496119_0001077 | 3300048922 | Bacteria | 34526 |
| 1391 | Ga0496119_0001451 | 3300048922 | Bacteria | 28525 |
| 1392 | Ga0496119_0001653 | 3300048922 | Bacteria | 26225 |
| 1393 | Ga0496119_0002580 | 3300048922 | Bacteria | 19700 |
| 1394 | Ga0496119_0009788 | 3300048922 | Bacteria | 8155 |
| 1395 | Ga0496119_0015944 | 3300048922 | Bacteria | 5749 |
| 1396 | Ga0496119_0022542 | 3300048922 | Bacteria | 4502 |
| 1397 | Ga0496119_0024430 | 3300048922 | Bacteria | 4251 |
| 1398 | Ga0496119_0041172 | 3300048922 | Bacteria | 2945 |
| 1399 | Ga0496119_0049672 | 3300048922 | Bacteria | 2591 |
| 1400 | Ga0496120_0000112 | 3300048923 | Bacteria | 136735 |
| 1401 | Ga0496120_0000139 | 3300048923 | Bacteria | 120489 |
| 1402 | Ga0496120_0000177 | 3300048923 | Bacteria | 108260 |
| 1403 | Ga0496120_0000407 | 3300048923 | Bacteria | 69144 |
| 1404 | Ga0496120_0007202 | 3300048923 | Bacteria | 8326 |
| 1405 | Ga0496120_0009875 | 3300048923 | Bacteria | 6723 |
| 1406 | Ga0496120_0018341 | 3300048923 | Bacteria | 4514 |
| 1407 | Ga0496120_0022093 | 3300048923 | Bacteria | 4006 |
| 1408 | Ga0496120_0035790 | 3300048923 | Bacteria | 2961 |
| 1409 | Ga0496120_0039461 | 3300048923 | Bacteria | 2785 |
| 1410 | Ga0496121_0000010 | 3300048924 | Bacteria | 793488 |
| 1411 | Ga0496121_0002021 | 3300048924 | Bacteria | 32182 |
| 1412 | Ga0496121_0005398 | 3300048924 | Bacteria | 16413 |
| 1413 | Ga0496121_0013963 | 3300048924 | Bacteria | 8579 |
| 1414 | Ga0496121_0034633 | 3300048924 | Bacteria | 4542 |
| 1415 | Ga0496121_0054576 | 3300048924 | Bacteria | 3336 |
| 1416 | Ga0496121_0074282 | 3300048924 | Bacteria | 2720 |
| 1417 | Ga0496121_0119078 | 3300048924 | Bacteria | 1997 |
| 1418 | Ga0496121_0136441 | 3300048924 | Bacteria | 1827 |
| 1419 | Ga0496122_0000108 | 3300048925 | Bacteria | 191029 |
| 1420 | Ga0496122_0000348 | 3300048925 | Bacteria | 99830 |
| 1421 | Ga0496122_0000771 | 3300048925 | Bacteria | 61695 |
| 1422 | Ga0496122_0001079 | 3300048925 | Bacteria | 47351 |
| 1423 | Ga0496122_0003177 | 3300048925 | Bacteria | 21905 |
| 1424 | Ga0496122_0005356 | 3300048925 | Bacteria | 15325 |
| 1425 | Ga0496122_0018906 | 3300048925 | Bacteria | 6328 |
| 1426 | Ga0496122_0020291 | 3300048925 | Bacteria | 6014 |
| 1427 | Ga0496122_0025156 | 3300048925 | Bacteria | 5181 |
| 1428 | Ga0496122_0026213 | 3300048925 | Bacteria | 5033 |
| 1429 | Ga0496122_0042259 | 3300048925 | Bacteria | 3588 |
| 1430 | Ga0496122_0043681 | 3300048925 | Bacteria | 3507 |
| 1431 | Ga0496122_0070880 | 3300048925 | Bacteria | 2486 |
| 1432 | Ga0496123_0000065 | 3300048926 | Bacteria | 211758 |
| 1433 | Ga0496123_0000424 | 3300048926 | Bacteria | 76245 |
| 1434 | Ga0496123_0000781 | 3300048926 | Bacteria | 51428 |
| 1435 | Ga0496123_0002969 | 3300048926 | Bacteria | 19747 |
| 1436 | Ga0496123_0005408 | 3300048926 | Bacteria | 12865 |
| 1437 | Ga0496123_0008601 | 3300048926 | Bacteria | 9343 |
| 1438 | Ga0496123_0009042 | 3300048926 | Bacteria | 9030 |
| 1439 | Ga0496123_0011737 | 3300048926 | Bacteria | 7553 |
| 1440 | Ga0496123_0012625 | 3300048926 | Bacteria | 7179 |
| 1441 | Ga0496123_0015732 | 3300048926 | Bacteria | 6188 |
| 1442 | Ga0496123_0079081 | 3300048926 | Bacteria | 2011 |
| 1443 | Ga0496124_0000100 | 3300048927 | Bacteria | 181404 |
| 1444 | Ga0496124_0001570 | 3300048927 | Bacteria | 33020 |
| 1445 | Ga0496124_0005306 | 3300048927 | Bacteria | 14562 |
| 1446 | Ga0496124_0005767 | 3300048927 | Bacteria | 13782 |
| 1447 | Ga0496124_0005834 | 3300048927 | Bacteria | 13666 |
| 1448 | Ga0496124_0007587 | 3300048927 | Bacteria | 11503 |
| 1449 | Ga0496124_0022824 | 3300048927 | Bacteria | 5729 |
| 1450 | Ga0496124_0025452 | 3300048927 | Bacteria | 5359 |
| 1451 | Ga0496125_0000070 | 3300048928 | Bacteria | 245793 |
| 1452 | Ga0496125_0000104 | 3300048928 | Bacteria | 201270 |
| 1453 | Ga0496125_0000509 | 3300048928 | Bacteria | 67449 |
| 1454 | Ga0496125_0003423 | 3300048928 | Bacteria | 19252 |
| 1455 | Ga0496125_0009046 | 3300048928 | Bacteria | 10312 |
| 1456 | Ga0496125_0016571 | 3300048928 | Bacteria | 7069 |
| 1457 | Ga0496125_0019538 | 3300048928 | Bacteria | 6385 |
| 1458 | Ga0496125_0117900 | 3300048928 | Bacteria | 1902 |
| 1459 | Ga0496125_0181345 | 3300048928 | Bacteria | 1402 |
| 1460 | Ga0496126_0001489 | 3300048929 | Bacteria | 36334 |
| 1461 | Ga0496126_0001777 | 3300048929 | Bacteria | 31874 |
| 1462 | Ga0496126_0040747 | 3300048929 | Bacteria | 4304 |
| 1463 | Ga0496126_0044023 | 3300048929 | Bacteria | 4113 |
| 1464 | Ga0496126_0049927 | 3300048929 | Bacteria | 3816 |
| 1465 | Ga0496126_0087468 | 3300048929 | Bacteria | 2745 |
| 1466 | Ga0501344_00526 | 3300049133 | Bacteria | 1617 |
| 1467 | Ga0501345_00240 | 3300049134 | Bacteria | 1676 |
| 1468 | Ga0495678_000415 | 3300049459 | Bacteria | 43047 |
| 1469 | Ga0495678_006121 | 3300049459 | Bacteria | 6463 |
| 1470 | Ga0495682_0000004 | 3300049460 | Bacteria | 378337 |
| 1471 | Ga0495682_0043443 | 3300049460 | Bacteria | 1646 |
| 1472 | Ga0501300_002577 | 3300049523 | Bacteria | 2717 |
| 1473 | Ga0501315_000769 | 3300049531 | Bacteria | 2411 |
| 1474 | Ga0501334_00617 | 3300049550 | Bacteria | 1706 |
| 1475 | Ga0501336_000088 | 3300049552 | Bacteria | 3212 |
| 1476 | Ga0501340_000804 | 3300049556 | Bacteria | 1529 |
| 1477 | Ga0501032_0003830 | 3300049569 | Bacteria | 11429 |
| 1478 | Ga0501032_0066866 | 3300049569 | Unclassified | 2402 |
| 1479 | Ga0501033_0032638 | 3300049570 | Bacteria | 3911 |
| 1480 | Ga0501034_0026227 | 3300049571 | Bacteria | 5935 |
| 1481 | Ga0501034_0035363 | 3300049571 | Bacteria | 5065 |
| 1482 | Ga0501034_0103328 | 3300049571 | Bacteria | 2843 |
| 1483 | Ga0501036_0127085 | 3300049572 | Unclassified | 2153 |
| 1484 | Ga0501037_0014870 | 3300049573 | Bacteria | 5726 |
| 1485 | Ga0501037_0024855 | 3300049573 | Bacteria | 4429 |
| 1486 | Ga0501038_0112597 | 3300049574 | Bacteria | 2253 |
| 1487 | Ga0501043_0068988 | 3300049579 | Unclassified | 2777 |
| 1488 | Ga0501043_0147839 | 3300049579 | Unclassified | 1839 |
| 1489 | Ga0501047_0011115 | 3300049581 | Bacteria | 8520 |
| 1490 | Ga0501047_0013626 | 3300049581 | Bacteria | 7714 |
| 1491 | Ga0501047_0015992 | 3300049581 | Bacteria | 7154 |
| 1492 | Ga0501047_0032071 | 3300049581 | Bacteria | 5070 |
| 1493 | Ga0501047_0046535 | 3300049581 | Bacteria | 4193 |
| 1494 | Ga0501047_0112786 | 3300049581 | Bacteria | 2601 |
| 1495 | Ga0501069_0028606 | 3300049585 | Bacteria | 3057 |
| 1496 | Ga0501070_0116525 | 3300049586 | Bacteria | 2206 |
| 1497 | Ga0501071_0012334 | 3300049587 | Bacteria | 5795 |
| 1498 | Ga0501074_0004546 | 3300049590 | Bacteria | 9930 |
| 1499 | Ga0501199_001224 | 3300049650 | Bacteria | 2310 |
| 1500 | Ga0501217_008773 | 3300049661 | Bacteria | 2190 |
| 1501 | Ga0501236_000080 | 3300049670 | Bacteria | 8714 |
| 1502 | Ga0501249_000030 | 3300049679 | Bacteria | 80958 |
| 1503 | Ga0501257_021605 | 3300049686 | Unclassified | 1519 |
| 1504 | Ga0501245_002382 | 3300049708 | Bacteria | 2510 |
| 1505 | Ga0501241_009726 | 3300049758 | Bacteria | 1750 |
| 1506 | Ga0501264_000029 | 3300049761 | Bacteria | 22049 |
| 1507 | Ga0501266_000008 | 3300049763 | Bacteria | 241629 |
| 1508 | Ga0501266_000013 | 3300049763 | Bacteria | 183849 |
| 1509 | Ga0501035_0000359 | 3300049822 | Bacteria | 52585 |
| 1510 | Ga0501035_0033273 | 3300049822 | Bacteria | 4688 |
| 1511 | Ga0501035_0075798 | 3300049822 | Bacteria | 2975 |
| 1512 | Ga0501044_0005351 | 3300049823 | Bacteria | 14267 |
| 1513 | Ga0501044_0017177 | 3300049823 | Bacteria | 7763 |
| 1514 | Ga0501044_0020067 | 3300049823 | Bacteria | 7136 |
| 1515 | Ga0501044_0391186 | 3300049823 | Unclassified | 1304 |
| 1516 | nmdc:mga00v17_196_c1 | 3300050491 | Bacteria | 36286 |
| 1517 | nmdc:mga00v17_23251_c1 | 3300050491 | Bacteria | 3584 |
| 1518 | nmdc:mga00v17_4576_c1 | 3300050491 | Bacteria | 7211 |
| 1519 | nmdc:mga0k408_1724_c1 | 3300050493 | Bacteria | 11736 |
| 1520 | nmdc:mga0k408_66023_c1 | 3300050493 | Bacteria | 2107 |
| 1521 | nmdc:mga06z11_8598_c1 | 3300050494 | Bacteria | 4267 |
| 1522 | nmdc:mga09592_100881_c1 | 3300050508 | Bacteria | 2472 |
| 1523 | nmdc:mga08y16_334798_c1 | 3300050511 | Bacteria | 1556 |
| 1524 | nmdc:mga08y16_62681_c1 | 3300050511 | Bacteria | 3883 |
| 1525 | nmdc:mga08y16_65537_c1 | 3300050511 | Bacteria | 3792 |
| 1526 | Ga0495619_0116661 | 3300053085 | Bacteria | 1828 |
| 1527 | Ga0500578_0000001 | 3300053086 | Bacteria | 317120 |
| 1528 | Ga0500578_0000065 | 3300053086 | Bacteria | 117032 |
| 1529 | Ga0500578_0021415 | 3300053086 | Bacteria | 4154 |
| 1530 | Ga0500644_0000078 | 3300053088 | Bacteria | 59447 |
| 1531 | Ga0500646_0001488 | 3300053090 | Bacteria | 6161 |
| 1532 | Ga0500583_0000013 | 3300053092 | Bacteria | 150087 |
| 1533 | Ga0500583_0000083 | 3300053092 | Bacteria | 53982 |
| 1534 | Ga0500583_0001261 | 3300053092 | Bacteria | 7225 |
| 1535 | Ga0500583_0051084 | 3300053092 | Bacteria | 1920 |
| 1536 | Ga0500641_0000012 | 3300053096 | Bacteria | 164908 |
| 1537 | Ga0500558_074059 | 3300053106 | Bacteria | 1399 |
| 1538 | Ga0500562_000003 | 3300053108 | Bacteria | 293779 |
| 1539 | Ga0500569_000269 | 3300053109 | Bacteria | 8190 |
| 1540 | Ga0500608_000802 | 3300053122 | Bacteria | 11412 |
| 1541 | Ga0500608_009290 | 3300053122 | Bacteria | 4168 |
| 1542 | Ga0500618_000290 | 3300053125 | Bacteria | 38288 |
| 1543 | Ga0500621_000001 | 3300053126 | Bacteria | 1049698 |
| 1544 | Ga0500658_0000005 | 3300053134 | Bacteria | 369268 |
| 1545 | Ga0500658_0000043 | 3300053134 | Bacteria | 73664 |
| 1546 | Ga0500658_0003731 | 3300053134 | Bacteria | 5738 |
| 1547 | Ga0500559_0000112 | 3300053136 | Bacteria | 63817 |
| 1548 | Ga0500559_0011531 | 3300053136 | Bacteria | 3775 |
| 1549 | Ga0500559_0014817 | 3300053136 | Bacteria | 3294 |
| 1550 | Ga0500568_0007556 | 3300053139 | Bacteria | 5319 |
| 1551 | Ga0500577_0002288 | 3300053142 | Bacteria | 4883 |
| 1552 | Ga0500586_000866 | 3300053145 | Bacteria | 6263 |
| 1553 | Ga0500588_0002345 | 3300053146 | Bacteria | 3832 |
| 1554 | Ga0500588_0007061 | 3300053146 | Bacteria | 2576 |
| 1555 | Ga0500616_0000075 | 3300053153 | Bacteria | 221455 |
| 1556 | Ga0500616_0036958 | 3300053153 | Bacteria | 2646 |
| 1557 | Ga0500622_0000066 | 3300053156 | Bacteria | 124842 |
| 1558 | Ga0500622_0000475 | 3300053156 | Bacteria | 37778 |
| 1559 | Ga0500622_0000546 | 3300053156 | Bacteria | 34660 |
| 1560 | Ga0500622_0000677 | 3300053156 | Bacteria | 30106 |
| 1561 | Ga0500622_0001523 | 3300053156 | Bacteria | 18373 |
| 1562 | Ga0500622_0002438 | 3300053156 | Bacteria | 13428 |
| 1563 | Ga0500622_0005953 | 3300053156 | Bacteria | 7182 |
| 1564 | Ga0500622_0021019 | 3300053156 | Bacteria | 3464 |
| 1565 | Ga0500622_0094691 | 3300053156 | Bacteria | 1477 |
| 1566 | Ga0500624_000479 | 3300053157 | Bacteria | 11822 |
| 1567 | Ga0500627_0089310 | 3300053158 | Bacteria | 1379 |
| 1568 | Ga0500633_0005708 | 3300053160 | Bacteria | 2984 |
| 1569 | Ga0500636_0017902 | 3300053177 | Bacteria | 4188 |
| 1570 | Ga0500637_0018077 | 3300053178 | Bacteria | 3782 |
| 1571 | Ga0500637_0031875 | 3300053178 | Bacteria | 2937 |
| 1572 | Ga0500584_001081 | 3300053726 | Bacteria | 8990 |
| 1573 | Ga0500611_000094 | 3300053727 | Bacteria | 25623 |
| 1574 | Ga0500645_020539 | 3300053730 | Bacteria | 2047 |
| 1575 | Ga0500661_010982 | 3300055283 | Bacteria | 1643 |
| 1576 | Ga0466962_0006890 | 3300061719 | Bacteria | 5449 |
| 1577 | Ga0466962_0007818 | 3300061719 | Bacteria | 5126 |
| 1578 | 2932088224 | 2932082852 | Bacteria | 6563563 |
| 1579 | 2506580849 | 2506520007 | Bacteria | 5442880 |
| 1580 | 2506585988 | 2506520008 | Bacteria | 5443009 |
| 1581 | 2508854656 | 2508501071 | Bacteria | 5454741 |
| 1582 | 2511125239 | 2510917020 | Bacteria | 5657507 |
| 1583 | 2511379307 | 2511231025 | Bacteria | 5324661 |
| 1584 | 2511436175 | 2511231035 | Bacteria | 5341610 |
| 1585 | 2547698305 | 2547132181 | Bacteria | 4945084 |
| 1586 | 2548648108 | 2547132416 | Bacteria | 4633861 |
| 1587 | 2562464823 | 2561511199 | Bacteria | 5155034 |
| 1588 | 2585152119 | 2582581280 | Bacteria | 5994497 |
| 1589 | 2585194397 | 2582581293 | Bacteria | 5907401 |
| 1590 | 2586208182 | 2585427687 | Bacteria | 5544917 |
| 1591 | 2599411825 | 2599185169 | Bacteria | 5441380 |
| 1592 | 2599480972 | 2599185184 | Bacteria | 6430550 |
| 1593 | 2599927203 | 2599185299 | Bacteria | 4854625 |
| 1594 | 2600198675 | 2599185353 | Bacteria | 2219443 |
| 1595 | 2600401392 | 2600254943 | Bacteria | 2613887 |
| 1596 | 2601524502 | 2600255254 | Bacteria | 5281859 |
| 1597 | 2601529656 | 2600255255 | Bacteria | 5282785 |
| 1598 | 2601534694 | 2600255256 | Bacteria | 5597742 |
| 1599 | 2601539279 | 2600255257 | Bacteria | 5597196 |
| 1600 | 2601616490 | 2600255280 | Bacteria | 5292309 |
| 1601 | 2601621212 | 2600255281 | Bacteria | 5288753 |
| 1602 | 2601646191 | 2600255287 | Bacteria | 5210468 |
| 1603 | 2601649609 | 2600255288 | Bacteria | 5282738 |
| 1604 | 2601654536 | 2600255289 | Bacteria | 5281907 |
| 1605 | 2601660190 | 2600255290 | Bacteria | 5282218 |
| 1606 | 2601664305 | 2600255291 | Bacteria | 5217298 |
| 1607 | 2601699121 | 2600255298 | Bacteria | 5215185 |
| 1608 | 2601702530 | 2600255299 | Bacteria | 5218662 |
| 1609 | 2601707280 | 2600255300 | Bacteria | 5287774 |
| 1610 | 2601712301 | 2600255301 | Bacteria | 5280532 |
| 1611 | 2601717797 | 2600255302 | Bacteria | 5288235 |
| 1612 | 2601723033 | 2600255303 | Bacteria | 5219315 |
| 1613 | 2601727725 | 2600255304 | Bacteria | 5283973 |
| 1614 | 2601732742 | 2600255305 | Bacteria | 5282329 |
| 1615 | 2601737489 | 2600255306 | Bacteria | 5281613 |
| 1616 | 2601741908 | 2600255307 | Bacteria | 5439064 |
| 1617 | 2601752806 | 2600255309 | Bacteria | 5431045 |
| 1618 | 2601757628 | 2600255310 | Bacteria | 5600903 |
| 1619 | 2601763987 | 2600255311 | Bacteria | 5598766 |
| 1620 | 2602021768 | 2600255392 | Bacteria | 5437392 |
| 1621 | 2603640335 | 2602042046 | Bacteria | 5483348 |
| 1622 | 2603645984 | 2602042047 | Bacteria | 4697674 |
| 1623 | 2603662469 | 2602042052 | Bacteria | 5215873 |
| 1624 | 2603667365 | 2602042053 | Bacteria | 5214361 |
| 1625 | 2603701762 | 2602042066 | Bacteria | 4423871 |
| 1626 | 2603706421 | 2602042067 | Bacteria | 4863713 |
| 1627 | 2603840151 | 2602042103 | Bacteria | 5284714 |
| 1628 | 2603845228 | 2602042104 | Bacteria | 5281639 |
| 1629 | 2603850301 | 2602042105 | Bacteria | 5282303 |
| 1630 | 2603855369 | 2602042106 | Bacteria | 5282744 |
| 1631 | 2603868365 | 2602042109 | Bacteria | 5152801 |
| 1632 | 2603873183 | 2602042110 | Bacteria | 5283285 |
| 1633 | 2603878176 | 2602042111 | Bacteria | 5212080 |
| 1634 | 2606050130 | 2603880178 | Bacteria | 5283018 |
| 1635 | 2606071794 | 2603880184 | Bacteria | 5217896 |
| 1636 | 2606147813 | 2603880202 | Bacteria | 5284684 |
| 1637 | 2606178252 | 2603880211 | Bacteria | 5284226 |
| 1638 | 2608668621 | 2608642108 | Bacteria | 4104624 |
| 1639 | 2609911247 | 2609459761 | Bacteria | 5513740 |
| 1640 | 2637222953 | 2636415599 | Bacteria | 5718434 |
| 1641 | 2643801201 | 2643221556 | Bacteria | 7251154 |
| 1642 | 2644008708 | 2643221600 | Bacteria | 5530138 |
| 1643 | 2644012756 | 2643221600 | Bacteria | 5530138 |
| 1644 | 2644370447 | 2643221667 | Bacteria | 5627472 |
| 1645 | 2644471807 | 2643221684 | Bacteria | 7145183 |
| 1646 | 2644641775 | 2643221716 | Bacteria | 4986332 |
| 1647 | 2644682108 | 2643221725 | Bacteria | 5087956 |
| 1648 | 2650897646 | 2648501693 | Bacteria | 5069560 |
| 1649 | 2656276689 | 2654587920 | Bacteria | 5475511 |
| 1650 | 2671105268 | 2667528172 | Bacteria | 5170840 |
| 1651 | 2676408767 | 2675903046 | Bacteria | 5451247 |
| 1652 | 2681998904 | 2681812866 | Bacteria | 4552357 |
| 1653 | 2682009644 | 2681812869 | Bacteria | 5014465 |
| 1654 | 2686352542 | 2684622997 | Bacteria | 4624240 |
| 1655 | 2689447405 | 2687453601 | Bacteria | 5546041 |
| 1656 | 2707100922 | 2706794495 | Bacteria | 4536932 |
| 1657 | 2722729328 | 2721755487 | Bacteria | 6357185 |
| 1658 | 2738713891 | 2738541276 | Bacteria | 4690596 |
| 1659 | 2738731680 | 2738541278 | Bacteria | 9755573 |
| 1660 | 2738735539 | 2738541279 | Bacteria | 6149495 |
| 1661 | 2738756502 | 2738541283 | Bacteria | 7222293 |
| 1662 | 2738768116 | 2738541285 | Bacteria | 6150075 |
| 1663 | 2738855270 | 2738541302 | Bacteria | 5944758 |
| 1664 | 2739217121 | 2738543007 | Bacteria | 6149845 |
| 1665 | 2739589307 | 2739367651 | Bacteria | 6359826 |
| 1666 | 2739617702 | 2739367656 | Bacteria | 5152243 |
| 1667 | 2739648453 | 2739367663 | Bacteria | 5040914 |
| 1668 | 2740001760 | 2739367857 | Bacteria | 5433684 |
| 1669 | 2740003712 | 2739367857 | Bacteria | 5433684 |
| 1670 | 2740006576 | 2739367858 | Bacteria | 5432813 |
| 1671 | 2740008529 | 2739367858 | Bacteria | 5432813 |
| 1672 | 2753857927 | 2751185917 | Bacteria | 4551186 |
| 1673 | 2765591058 | 2765235842 | Bacteria | 4799256 |
| 1674 | 2772441213 | 2772190666 | Bacteria | 5117644 |
| 1675 | 2777021292 | 2775507074 | Bacteria | 5532402 |
| 1676 | 2792311203 | 2791355010 | Bacteria | 4864581 |
| 1677 | 2793403654 | 2791355275 | Bacteria | 4429597 |
| 1678 | 2802655062 | 2802428842 | Bacteria | 4926114 |
| 1679 | 2807180286 | 2806310673 | Bacteria | 4801221 |
| 1680 | 2809124742 | 2808606414 | Bacteria | 4917181 |
| 1681 | 2813726581 | 2811995292 | Bacteria | 5303342 |
| 1682 | 2814693953 | 2814123068 | Bacteria | 5687681 |
| 1683 | 2819546719 | 2818991437 | Bacteria | 5805520 |
| 1684 | 2819548959 | 2818991437 | Bacteria | 5805520 |
| 1685 | 2819677715 | 2818991460 | Bacteria | 7595395 |
| 1686 | 2821141812 | 2821136567 | Bacteria | 8080116 |
| 1687 | 2823378178 | 2823373977 | Bacteria | 4779415 |
| 1688 | 2842715397 | 2842711865 | Bacteria | 7155354 |
| 1689 | 2842723825 | 2842722452 | Bacteria | 6263924 |
| 1690 | 2842725467 | 2842722452 | Bacteria | 6263924 |
| 1691 | 2842908894 | 2842903701 | Bacteria | 6986368 |
| 1692 | 2842910337 | 2842909656 | Bacteria | 6185908 |
| 1693 | 2842912746 | 2842909656 | Bacteria | 6185908 |
| 1694 | 2844429430 | 2844425489 | Bacteria | 4854065 |
| 1695 | 2844532101 | 2844528606 | Bacteria | 4733806 |
| 1696 | 2847800780 | 2847797336 | Bacteria | 5176640 |
| 1697 | 2849282034 | 2849281842 | Bacteria | 6065644 |
| 1698 | 2852625838 | 2852623160 | Bacteria | 4376875 |
| 1699 | 2854603326 | 2854601825 | Bacteria | 4797592 |
| 1700 | 2855195947 | 2855195626 | Bacteria | 4927512 |
| 1701 | 2857559223 | 2857558681 | Bacteria | 6617694 |
| 1702 | 2857567031 | 2857564685 | Bacteria | 6290584 |
| 1703 | 2857620826 | 2857618242 | Bacteria | 5635925 |
| 1704 | 2857622380 | 2857618242 | Bacteria | 5635925 |
| 1705 | 2857631743 | 2857627736 | Bacteria | 5625397 |
| 1706 | 2865017802 | 2865014394 | Bacteria | 4764573 |
| 1707 | 2869556838 | 2869551831 | Bacteria | 5474685 |
| 1708 | 2871286344 | 2871282230 | Bacteria | 4917173 |
| 1709 | 2876602791 | 2876601092 | Bacteria | 5114497 |
| 1710 | 2881361078 | 2881359912 | Bacteria | 4935907 |
| 1711 | 2881614088 | 2881609920 | Bacteria | 4405319 |
| 1712 | 2883072422 | 2883068021 | Bacteria | 6192739 |
| 1713 | 2884086821 | 2884086401 | Bacteria | 5005459 |
| 1714 | 2884637941 | 2884634485 | Bacteria | 3928637 |
| 1715 | 2884794559 | 2884791551 | Bacteria | 8511252 |
| 1716 | 2884797658 | 2884791551 | Bacteria | 8511252 |
| 1717 | 2884935634 | 2884933994 | Bacteria | 4535041 |
| 1718 | 2888371337 | 2888366609 | Bacteria | 5155009 |
| 1719 | 2896114998 | 2896109856 | Bacteria | 7140722 |
| 1720 | 2896318303 | 2896317667 | Bacteria | 4606601 |
| 1721 | 2904425866 | 2904424332 | Bacteria | 7633521 |
| 1722 | 2904445327 | 2904445276 | Bacteria | 5310396 |
| 1723 | 2904446890 | 2904445276 | Bacteria | 5310396 |
| 1724 | 2904469773 | 2904467357 | Bacteria | 8057758 |
| 1725 | 2904508258 | 2904504865 | Bacteria | 5152820 |
| 1726 | 2904517953 | 2904513164 | Bacteria | 5476410 |
| 1727 | 2904780994 | 2904780799 | Bacteria | 5840761 |
| 1728 | 2910248856 | 2910245624 | Bacteria | 6935613 |
| 1729 | 2911141532 | 2911138879 | Bacteria | 5811561 |
| 1730 | 2914763139 | 2914759650 | Bacteria | 4701441 |
| 1731 | 2919180542 | 2919177583 | Bacteria | 5641607 |
| 1732 | 2919194710 | 2919191525 | Bacteria | 5765973 |
| 1733 | 2919195084 | 2919191525 | Bacteria | 5765973 |
| 1734 | 2919442701 | 2919437846 | Bacteria | 6199444 |
| 1735 | 2919686630 | 2919683626 | Bacteria | 5534354 |
| 1736 | 2919693833 | 2919692658 | Bacteria | 5943958 |
| 1737 | 2923636967 | 2923634449 | Bacteria | 4753480 |
| 1738 | 2927836603 | 2927833300 | Bacteria | 4923934 |
| 1739 | 2928080884 | 2928078545 | Bacteria | 6534839 |
| 1740 | 2928150209 | 2928147474 | Bacteria | 6512076 |
| 1741 | 2928521664 | 2928519762 | Bacteria | 1953908 |
| 1742 | 2929150922 | 2929150217 | Bacteria | 5462483 |
| 1743 | 2929183293 | 2929177148 | Bacteria | 7883697 |
| 1744 | 2929245409 | 2929239360 | Bacteria | 7745570 |
| 1745 | 2929926121 | 2929921140 | Bacteria | 8649150 |
| 1746 | 2932409353 | 2932406140 | Bacteria | 5134491 |
| 1747 | 2935628814 | 2935625433 | Bacteria | 5042964 |
| 1748 | 2937540172 | 2937539931 | Bacteria | 4639830 |
| 1749 | 2937968881 | 2937967321 | Bacteria | 5094075 |
| 1750 | 2939576739 | 2939573065 | Bacteria | 4926053 |
| 1751 | 2939581142 | 2939577877 | Bacteria | 5132791 |
| 1752 | 2939602955 | 2939602548 | Bacteria | 4950493 |
| 1753 | 2939620708 | 2939617950 | Bacteria | 4820956 |
| 1754 | 2945875623 | 2945874760 | Bacteria | 5527237 |
| 1755 | 2945953877 | 2945951305 | Bacteria | 4918162 |
| 1756 | 2945979253 | 2945977869 | Bacteria | 7777518 |
| 1757 | 2945999751 | 2945997725 | Bacteria | 6404843 |
| 1758 | 2946002447 | 2945997725 | Bacteria | 6404843 |
| 1759 | 2946014876 | 2946013367 | Bacteria | 7766675 |
| 1760 | 2954017567 | 2954016120 | Bacteria | 6446024 |
| 1761 | 2954019333 | 2954016120 | Bacteria | 6446024 |
| 1762 | 2969079980 | 2969079654 | Bacteria | 5439582 |
| 1763 | 2974314709 | 2974310843 | Bacteria | 4947816 |
| 1764 | 2974440493 | 2974435778 | Bacteria | 4876478 |
| 1765 | 2978976368 | 2978975091 | Bacteria | 4704313 |
| 1766 | 2984495760 | 2984494565 | Bacteria | 5000175 |
| 1767 | 2984562434 | 2984559226 | Bacteria | 5683096 |
| 1768 | 2984600492 | 2984595703 | Bacteria | 5682994 |
| 1769 | 2990265447 | 2990261002 | Bacteria | 4919493 |
| 1770 | 640940217 | 640753048 | Bacteria | 5495657 |
| 1771 | 8003151862 | 8003151029 | Bacteria | 8187759 |
| 1772 | 8004593997 | 8004592986 | Bacteria | 5122074 |
| 1773 | 8007371409 | 8007371054 | Bacteria | 4849201 |
| 1774 | 8015395176 | 8015394850 | Bacteria | 5064660 |
| 1775 | 8016736785 | 8016733728 | Bacteria | 5274317 |
| 1776 | 8018222442 | 8018221730 | Bacteria | 4616064 |
| 1777 | 8018408926 | 8018405270 | Bacteria | 4978981 |
| 1778 | 8019502018 | 8019499862 | Bacteria | 5169538 |
| 1779 | 8019507336 | 8019504834 | Bacteria | 4819156 |
| 1780 | 8047675401 | 8047673197 | Bacteria | 7395230 |
| 1781 | 8054307940 | 8054307821 | Bacteria | 5212224 |
| 1782 | 8055590297 | 8055588893 | Bacteria | 3619545 |
| 1783 | 8055597190 | 8055592153 | Bacteria | 5961247 |
| 1784 | 8056442408 | 8056440228 | Bacteria | 4946504 |
| 1785 | RicEn_C3870 | |||
| 1786 | SwRhRL2b_contig_631140 | |||
| 1787 | MBSR1b_contig_5928364 | |||
| 1788 | JGI24740J21852_10003107 | |||
| 1789 | JGI24740J21852_10012470 | |||
| 1790 | JGI24737J22298_10031040 | |||
| 1791 | JGI24735J21928_10000028 | |||
| 1792 | JGI24735J21928_10005158 | |||
| 1793 | JGI24735J21928_10008798 | |||
| 1794 | JGI24735J21928_10019190 | |||
| 1795 | JGI24738J21930_10003820 | |||
| 1796 | JGI25162J39368_1000047 | |||
| 1797 | JGI25162J39368_1000183 | |||
| 1798 | JGI25162J39368_1000496 | |||
| 1799 | JGI25154J39366_1000080 | |||
| 1800 | JGI25152J39213_1000513 | |||
| 1801 | JGI25150J39212_1000008 | |||
| 1802 | JGI25151J46595_10000014 | |||
| 1803 | JGI25151J46595_10000887 | |||
| 1804 | JGI25151J46595_10002451 | |||
| 1805 | JGI25151J46595_10005962 | |||
| 1806 | JGI25165J46597_1000043 | |||
| 1807 | JGI25165J46597_1000802 | |||
| 1808 | JGI25153J46596_10000020 | |||
| 1809 | JGI25153J46596_10002621 | |||
| 1810 | rootH1_10000810 | |||
| 1811 | rootH1_10002962 | |||
| 1812 | rootH1_10036744 | |||
| 1813 | rootH1_10055138 | |||
| 1814 | rootH2_10000230 | |||
| 1815 | rootH2_10003679 | |||
| 1816 | rootH2_10011814 | |||
| 1817 | rootH2_10013605 | |||
| 1818 | rootH2_10024296 | |||
| 1819 | rootH2_10051442 | |||
| 1820 | rootH2_10056661 | |||
| 1821 | rootH2_10071853 | |||
| 1822 | rootH2_10118897 | |||
| 1823 | rootH2_10123222 | |||
| 1824 | rootH2_10141248 | |||
| 1825 | rootH2_10161859 | |||
| 1826 | rootL2_10027207 | |||
| 1827 | rootL2_10054875 | |||
| 1828 | rootL2_10067288 | |||
| 1829 | rootL2_10070945 | |||
| 1830 | rootL2_10127765 | |||
| 1831 | rootL2_10154743 | |||
| 1832 | rootL2_10200472 | |||
| 1833 | rootH1_10000727 | |||
| 1834 | rootH1_10003785 | |||
| 1835 | rootH1_10018881 | |||
| 1836 | rootH1_10034687 | |||
| 1837 | rootH1_10040702 | |||
| 1838 | rootH1_10047799 | |||
| 1839 | rootH1_10051913 | |||
| 1840 | rootH1_10060101 | |||
| 1841 | rootH1_10104912 | |||
| 1842 | rootH1_10109702 | |||
| 1843 | rootH1_10119890 | |||
| 1844 | rootH1_10178156 | |||
| 1845 | rootH1_10198885 | |||
| 1846 | rootH1_10228699 | |||
| 1847 | rootH1_10367847 | |||
| 1848 | JGI25160J50197_1001583 | |||
| 1849 | JGI25160J50197_1001791 | |||
| 1850 | Ga0006562J51391_1029369 | |||
| 1851 | Ga0055532_1000238 | |||
| 1852 | Ga0055525_1000028 | |||
| 1853 | Ga0055542_1007574 | |||
| 1854 | Ga0055526_1000131 | |||
| 1855 | Ga0055537_1000100 | |||
| 1856 | Ga0055536_1000036 | |||
| 1857 | Ga0055536_1005098 | |||
| 1858 | Ga0055534_1000085 | |||
| 1859 | Ga0055528_1000458 | |||
| 1860 | Ga0055530_10001821 | |||
| 1861 | Ga0055531_10000015 | |||
| 1862 | Ga0055531_10000132 | |||
| 1863 | Ga0058692_1000146 | |||
| 1864 | Ga0058692_1000443 | |||
| 1865 | Ga0058692_1001071 | |||
| 1866 | Ga0065165_1004837 | |||
| 1867 | Ga0065165_1015046 | |||
| 1868 | Ga0065703_1018789 | |||
| 1869 | Ga0065714_10003442 | |||
| 1870 | Ga0065714_10005093 | |||
| 1871 | Ga0065714_10064423 | |||
| 1872 | Ga0065704_10000577 | |||
| 1873 | Ga0065704_10071197 | |||
| 1874 | Ga0065704_10071631 | |||
| 1875 | Ga0065704_10101511 | |||
| 1876 | Ga0065715_10012402 | |||
| 1877 | Ga0065715_10134393 | |||
| 1878 | Ga0070658_10000014 | |||
| 1879 | Ga0070658_10000721 | |||
| 1880 | Ga0070658_10038243 | |||
| 1881 | Ga0070658_10043816 | |||
| 1882 | Ga0070658_10079035 | |||
| 1883 | Ga0070658_10226872 | |||
| 1884 | Ga0070676_10000207 | |||
| 1885 | Ga0070676_10000487 | |||
| 1886 | Ga0070676_10003430 | |||
| 1887 | Ga0070676_10009602 | |||
| 1888 | Ga0070676_10064499 | |||
| 1889 | Ga0070683_100000859 | |||
| 1890 | Ga0070683_100002782 | |||
| 1891 | Ga0070683_100014746 | |||
| 1892 | Ga0070683_100034878 | |||
| 1893 | Ga0070690_100008784 | |||
| 1894 | Ga0070690_100009170 | |||
| 1895 | Ga0070690_100139300 | |||
| 1896 | Ga0070670_100026107 | |||
| 1897 | Ga0070670_100046396 | |||
| 1898 | Ga0070670_100211792 | |||
| 1899 | Ga0070677_10002635 | |||
| 1900 | Ga0068869_100000107 | |||
| 1901 | Ga0068869_100013547 | |||
| 1902 | Ga0068869_100124699 | |||
| 1903 | Ga0070666_10000432 | |||
| 1904 | Ga0070666_10001827 | |||
| 1905 | Ga0070666_10001999 | |||
| 1906 | Ga0070666_10041185 | |||
| 1907 | Ga0070680_100000224 | |||
| 1908 | Ga0070680_100001771 | |||
| 1909 | Ga0070680_100019931 | |||
| 1910 | Ga0070682_100000299 | |||
| 1911 | Ga0070682_100012301 | |||
| 1912 | Ga0070682_100038149 | |||
| 1913 | Ga0068868_100000256 | |||
| 1914 | Ga0068868_100010309 | |||
| 1915 | Ga0068868_100011101 | |||
| 1916 | Ga0068868_100014519 | |||
| 1917 | Ga0070660_100006203 | |||
| 1918 | Ga0070660_100014661 | |||
| 1919 | Ga0070660_100020365 | |||
| 1920 | Ga0070660_100201502 | |||
| 1921 | Ga0070660_100212195 | |||
| 1922 | Ga0070689_100192319 | |||
| 1923 | Ga0070689_100200100 | |||
| 1924 | Ga0070691_10006501 | |||
| 1925 | Ga0070661_100006405 | |||
| 1926 | Ga0070661_100025950 | |||
| 1927 | Ga0070661_100040837 | |||
| 1928 | Ga0070668_100001216 | |||
| 1929 | Ga0070668_100030597 | |||
| 1930 | Ga0070668_100033130 | |||
| 1931 | Ga0070669_100006366 | |||
| 1932 | Ga0070669_100041267 | |||
| 1933 | Ga0070669_100177786 | |||
| 1934 | Ga0070675_100011184 | |||
| 1935 | Ga0070675_100014343 | |||
| 1936 | Ga0070675_100050928 | |||
| 1937 | Ga0070675_100064757 | |||
| 1938 | Ga0070675_100078505 | |||
| 1939 | Ga0070675_100189705 | |||
| 1940 | Ga0070671_100001192 | |||
| 1941 | Ga0070671_100001920 | |||
| 1942 | Ga0070671_100004338 | |||
| 1943 | Ga0070671_100005999 | |||
| 1944 | Ga0070671_100052400 | |||
| 1945 | Ga0070673_100000003 | |||
| 1946 | Ga0070673_100001023 | |||
| 1947 | Ga0070673_100011904 | |||
| 1948 | Ga0070673_100015606 | |||
| 1949 | Ga0070673_100034082 | |||
| 1950 | Ga0070673_100048651 | |||
| 1951 | Ga0070673_100069354 | |||
| 1952 | Ga0070673_100105555 | |||
| 1953 | Ga0070673_100134895 | |||
| 1954 | Ga0070673_100169830 | |||
| 1955 | Ga0070659_100003851 | |||
| 1956 | Ga0070659_100027076 | |||
| 1957 | Ga0070659_100031677 | |||
| 1958 | Ga0070659_100038542 | |||
| 1959 | Ga0070659_100078286 | |||
| 1960 | Ga0070667_100001236 | |||
| 1961 | Ga0070667_100006686 | |||
| 1962 | Ga0070667_100012516 | |||
| 1963 | Ga0070667_100013081 | |||
| 1964 | Ga0070667_100025739 | |||
| 1965 | Ga0070667_100108343 | |||
| 1966 | Ga0070667_100119262 | |||
| 1967 | Ga0070667_100145081 | |||
| 1968 | Ga0070713_100135064 | |||
| 1969 | Ga0070701_10077846 | |||
| 1970 | Ga0070705_100011663 | |||
| 1971 | Ga0070663_100035123 | |||
| 1972 | Ga0070663_100052494 | |||
| 1973 | Ga0070663_100059222 | |||
| 1974 | Ga0070678_100005233 | |||
| 1975 | Ga0070678_100013040 | |||
| 1976 | Ga0070678_100168349 | |||
| 1977 | Ga0070662_100000054 | |||
| 1978 | Ga0070662_100005103 | |||
| 1979 | Ga0070662_100008858 | |||
| 1980 | Ga0070662_100111484 | |||
| 1981 | Ga0070681_10042628 | |||
| 1982 | Ga0070681_10051241 | |||
| 1983 | Ga0070681_10094627 | |||
| 1984 | Ga0070681_10260774 | |||
| 1985 | Ga0068867_100000001 | |||
| 1986 | Ga0068867_100004058 | |||
| 1987 | Ga0068867_100018608 | |||
| 1988 | Ga0068867_100067089 | |||
| 1989 | Ga0068867_100072714 | |||
| 1990 | Ga0068867_100101963 | |||
| 1991 | Ga0068867_100179390 | |||
| 1992 | Ga0070698_100093392 | |||
| 1993 | Ga0070679_100000665 | |||
| 1994 | Ga0070679_100009081 | |||
| 1995 | Ga0070679_100012347 | |||
| 1996 | Ga0070679_100089788 | |||
| 1997 | Ga0070684_100000589 | |||
| 1998 | Ga0070684_100024374 | |||
| 1999 | Ga0070684_100045096 | |||
| 2000 | Ga0070684_100149241 | |||
| 2001 | Ga0068853_100002572 | |||
| 2002 | Ga0068853_100003164 | |||
| 2003 | Ga0068853_100004462 | |||
| 2004 | Ga0068853_100010823 | |||
| 2005 | Ga0068853_100016379 | |||
| 2006 | Ga0068853_100023944 | |||
| 2007 | Ga0070672_100002671 | |||
| 2008 | Ga0070672_100034008 | |||
| 2009 | Ga0070672_100036903 | |||
| 2010 | Ga0070672_100054755 | |||
| 2011 | Ga0070672_100102111 | |||
| 2012 | Ga0070672_100110094 | |||
| 2013 | Ga0070672_100220239 | |||
| 2014 | Ga0070696_100063722 | |||
| 2015 | Ga0070693_100121931 | |||
| 2016 | Ga0070665_100000001 | |||
| 2017 | Ga0070665_100000010 | |||
| 2018 | Ga0070665_100000117 | |||
| 2019 | Ga0070665_100000858 | |||
| 2020 | Ga0070665_100001604 | |||
| 2021 | Ga0070665_100008265 | |||
| 2022 | Ga0070665_100049509 | |||
| 2023 | Ga0068855_100000033 | |||
| 2024 | Ga0068855_100000097 | |||
| 2025 | Ga0068855_100000189 | |||
| 2026 | Ga0068855_100000361 | |||
| 2027 | Ga0068855_100001432 | |||
| 2028 | Ga0068855_100010449 | |||
| 2029 | Ga0068855_100014725 | |||
| 2030 | Ga0068855_100021645 | |||
| 2031 | Ga0068855_100030000 | |||
| 2032 | Ga0068855_100088290 | |||
| 2033 | Ga0068855_100109855 | |||
| 2034 | Ga0068855_100129080 | |||
| 2035 | Ga0068855_100155285 | |||
| 2036 | Ga0070664_100001763 | |||
| 2037 | Ga0070664_100108257 | |||
| 2038 | Ga0070664_100145204 | |||
| 2039 | Ga0070664_100161703 | |||
| 2040 | Ga0070664_100238375 | |||
| 2041 | Ga0070664_100295202 | |||
| 2042 | Ga0068857_100000006 | |||
| 2043 | Ga0068857_100000416 | |||
| 2044 | Ga0068857_100001995 | |||
| 2045 | Ga0068857_100072849 | |||
| 2046 | Ga0068857_100092526 | |||
| 2047 | Ga0068857_100166601 | |||
| 2048 | Ga0068854_100001137 | |||
| 2049 | Ga0068854_100012640 | |||
| 2050 | Ga0068854_100030425 | |||
| 2051 | Ga0068854_100046999 | |||
| 2052 | Ga0068854_100074559 | |||
| 2053 | Ga0068854_100212741 | |||
| 2054 | Ga0068856_100001524 | |||
| 2055 | Ga0068856_100006605 | |||
| 2056 | Ga0068856_100019317 | |||
| 2057 | Ga0068856_100033216 | |||
| 2058 | Ga0068856_100044125 | |||
| 2059 | Ga0068856_100049707 | |||
| 2060 | Ga0068856_100076063 | |||
| 2061 | Ga0070702_100018818 | |||
| 2062 | Ga0068852_100001789 | |||
| 2063 | Ga0068852_100012306 | |||
| 2064 | Ga0068852_100029381 | |||
| 2065 | Ga0068852_100124015 | |||
| 2066 | Ga0068852_100148764 | |||
| 2067 | Ga0068852_100197264 | |||
| 2068 | Ga0068859_100000242 | |||
| 2069 | Ga0068859_100000397 | |||
| 2070 | Ga0068859_100007103 | |||
| 2071 | Ga0068859_100016634 | |||
| 2072 | Ga0068859_100020210 | |||
| 2073 | Ga0068859_100050940 | |||
| 2074 | Ga0068864_100007085 | |||
| 2075 | Ga0068864_100024122 | |||
| 2076 | Ga0068864_100035435 | |||
| 2077 | Ga0068864_100047564 | |||
| 2078 | Ga0068866_10006104 | |||
| 2079 | Ga0068866_10070976 | |||
| 2080 | Ga0068866_10085686 | |||
| 2081 | Ga0068861_100010485 | |||
| 2082 | Ga0068861_100016454 | |||
| 2083 | Ga0068851_10003183 | |||
| 2084 | Ga0068851_10006949 | |||
| 2085 | Ga0068870_10001223 | |||
| 2086 | Ga0068870_10005043 | |||
| 2087 | Ga0068870_10034383 | |||
| 2088 | Ga0068870_10097862 | |||
| 2089 | Ga0068863_100003280 | |||
| 2090 | Ga0068863_100006910 | |||
| 2091 | Ga0068863_100042965 | |||
| 2092 | Ga0068858_100001416 | |||
| 2093 | Ga0068858_100014158 | |||
| 2094 | Ga0068858_100028195 | |||
| 2095 | Ga0068858_100094303 | |||
| 2096 | Ga0068858_100122525 | |||
| 2097 | Ga0068858_100182600 | |||
| 2098 | Ga0068858_100265941 | |||
| 2099 | Ga0068858_100364055 | |||
| 2100 | Ga0068860_100000046 | |||
| 2101 | Ga0068860_100000700 | |||
| 2102 | Ga0068860_100001914 | |||
| 2103 | Ga0068860_100005835 | |||
| 2104 | Ga0068860_100014886 | |||
| 2105 | Ga0068860_100016701 | |||
| 2106 | Ga0068860_100029570 | |||
| 2107 | Ga0068860_100111058 | |||
| 2108 | Ga0068860_100139901 | |||
| 2109 | Ga0068860_100208693 | |||
| 2110 | Ga0068862_100045022 | |||
| 2111 | Ga0068862_100113984 | |||
| 2112 | Ga0068862_100219741 | |||
| 2113 | Ga0081455_10006925 | |||
| 2114 | Ga0081539_10000337 | |||
| 2115 | Ga0075364_10000169 | |||
| 2116 | Ga0075364_10001466 | |||
| 2117 | Ga0075364_10011431 | |||
| 2118 | Ga0075364_10033181 | |||
| 2119 | Ga0075367_10027430 | |||
| 2120 | Ga0075366_10000898 | |||
| 2121 | Ga0075366_10009323 | |||
| 2122 | Ga0075366_10033260 | |||
| 2123 | Ga0097621_100000247 | |||
| 2124 | Ga0097621_100000277 | |||
| 2125 | Ga0097621_100002714 | |||
| 2126 | Ga0097621_100005494 | |||
| 2127 | Ga0097621_100008121 | |||
| 2128 | Ga0097621_100008900 | |||
| 2129 | Ga0097621_100046710 | |||
| 2130 | Ga0097621_100136578 | |||
| 2131 | Ga0068871_100000455 | |||
| 2132 | Ga0068871_100001185 | |||
| 2133 | Ga0068871_100003771 | |||
| 2134 | Ga0068871_100015222 | |||
| 2135 | Ga0068871_100038211 | |||
| 2136 | Ga0068871_100039603 | |||
| 2137 | Ga0068871_100045918 | |||
| 2138 | Ga0075428_100031435 | |||
| 2139 | Ga0075428_100161497 | |||
| 2140 | Ga0075431_100047295 | |||
| 2141 | Ga0075429_100125763 | |||
| 2142 | Ga0068865_100000011 | |||
| 2143 | Ga0068865_100000076 | |||
| 2144 | Ga0068865_100001877 | |||
| 2145 | Ga0068865_100002323 | |||
| 2146 | Ga0097620_100000242 | |||
| 2147 | Ga0097620_100000397 | |||
| 2148 | Ga0097620_100007103 | |||
| 2149 | Ga0097620_100016633 | |||
| 2150 | Ga0097620_100020209 | |||
| 2151 | Ga0097620_100050942 | |||
| 2152 | Ga0099824_1008363 | |||
| 2153 | Ga0079104_1000078 | |||
| 2154 | Ga0079104_1000117 | |||
| 2155 | Ga0079104_1000227 | |||
| 2156 | Ga0079104_1000305 | |||
| 2157 | Ga0079104_1000836 | |||
| 2158 | Ga0079104_1005557 | |||
| 2159 | Ga0079104_1011258 | |||
| 2160 | Ga0079104_1017478 | |||
| 2161 | Ga0079104_1020654 | |||
| 2162 | Ga0099826_10001062 | |||
| 2163 | Ga0105251_10000230 | |||
| 2164 | Ga0105251_10000233 | |||
| 2165 | Ga0105251_10000760 | |||
| 2166 | Ga0105251_10004261 | |||
| 2167 | Ga0105251_10004664 | |||
| 2168 | Ga0105251_10007521 | |||
| 2169 | Ga0105251_10007546 | |||
| 2170 | Ga0105251_10053167 | |||
| 2171 | Ga0105244_10000017 | |||
| 2172 | Ga0105244_10000046 | |||
| 2173 | Ga0105244_10000266 | |||
| 2174 | Ga0105244_10001361 | |||
| 2175 | Ga0105244_10003529 | |||
| 2176 | Ga0105244_10013249 | |||
| 2177 | Ga0105244_10014481 | |||
| 2178 | Ga0105244_10021608 | |||
| 2179 | Ga0105244_10025737 | |||
| 2180 | Ga0105244_10036739 | |||
| 2181 | Ga0105250_10000012 | |||
| 2182 | Ga0105250_10000185 | |||
| 2183 | Ga0105250_10004683 | |||
| 2184 | Ga0105250_10008198 | |||
| 2185 | Ga0105250_10023274 | |||
| 2186 | Ga0105250_10043000 | |||
| 2187 | Ga0105240_10000074 | |||
| 2188 | Ga0105240_10000103 | |||
| 2189 | Ga0105240_10003631 | |||
| 2190 | Ga0105240_10003829 | |||
| 2191 | Ga0105240_10005745 | |||
| 2192 | Ga0105240_10011123 | |||
| 2193 | Ga0105240_10015220 | |||
| 2194 | Ga0105240_10016636 | |||
| 2195 | Ga0105240_10027109 | |||
| 2196 | Ga0105240_10032969 | |||
| 2197 | Ga0105240_10089262 | |||
| 2198 | Ga0105240_10101346 | |||
| 2199 | Ga0105240_10126435 | |||
| 2200 | Ga0105240_10147389 | |||
| 2201 | Ga0111539_10002966 | |||
| 2202 | Ga0111539_10119193 | |||
| 2203 | Ga0111539_10120129 | |||
| 2204 | Ga0111539_10325540 | |||
| 2205 | Ga0105245_10011909 | |||
| 2206 | Ga0105245_10048769 | |||
| 2207 | Ga0105245_10231648 | |||
| 2208 | Ga0105247_10000238 | |||
| 2209 | Ga0105247_10000319 | |||
| 2210 | Ga0105247_10003524 | |||
| 2211 | Ga0105247_10020148 | |||
| 2212 | Ga0114129_10011363 | |||
| 2213 | Ga0105243_10000012 | |||
| 2214 | Ga0105243_10000241 | |||
| 2215 | Ga0105243_10000260 | |||
| 2216 | Ga0105243_10090305 | |||
| 2217 | Ga0105241_10000013 | |||
| 2218 | Ga0105241_10000293 | |||
| 2219 | Ga0105241_10000530 | |||
| 2220 | Ga0105241_10002996 | |||
| 2221 | Ga0105241_10003032 | |||
| 2222 | Ga0105241_10003168 | |||
| 2223 | Ga0105241_10015322 | |||
| 2224 | Ga0105241_10038983 | |||
| 2225 | Ga0105241_10068084 | |||
| 2226 | Ga0105241_10260364 | |||
| 2227 | Ga0105242_10011381 | |||
| 2228 | Ga0105242_10016371 | |||
| 2229 | Ga0105242_10024565 | |||
| 2230 | Ga0105242_10095194 | |||
| 2231 | Ga0105242_10096669 | |||
| 2232 | Ga0105248_10007416 | |||
| 2233 | Ga0105248_10126228 | |||
| 2234 | Ga0105248_10314189 | |||
| 2235 | Ga0105237_10001686 | |||
| 2236 | Ga0105237_10002542 | |||
| 2237 | Ga0105237_10003907 | |||
| 2238 | Ga0105237_10011277 | |||
| 2239 | Ga0105237_10011674 | |||
| 2240 | Ga0105237_10025166 | |||
| 2241 | Ga0105237_10041982 | |||
| 2242 | Ga0105237_10045228 | |||
| 2243 | Ga0105237_10078754 | |||
| 2244 | Ga0105237_10133804 | |||
| 2245 | Ga0105237_10134113 | |||
| 2246 | Ga0105237_10174882 | |||
| 2247 | Ga0105237_10180224 | |||
| 2248 | Ga0105238_10006037 | |||
| 2249 | Ga0105238_10034131 | |||
| 2250 | Ga0105238_10046342 | |||
| 2251 | Ga0105238_10071739 | |||
| 2252 | Ga0105238_10122480 | |||
| 2253 | Ga0105238_10202318 | |||
| 2254 | Ga0105238_10286743 | |||
| 2255 | Ga0105249_10011396 | |||
| 2256 | Ga0105249_10018519 | |||
| 2257 | Ga0105249_10044257 | |||
| 2258 | Ga0105249_10054601 | |||
| 2259 | Ga0105249_10074907 | |||
| 2260 | Ga0105239_10000048 | |||
| 2261 | Ga0105239_10000280 | |||
| 2262 | Ga0105239_10000696 | |||
| 2263 | Ga0105239_10001111 | |||
| 2264 | Ga0105239_10002752 | |||
| 2265 | Ga0105239_10009182 | |||
| 2266 | Ga0105239_10038267 | |||
| 2267 | Ga0105239_10053015 | |||
| 2268 | Ga0105239_10058061 | |||
| 2269 | Ga0105239_10058623 | |||
| 2270 | Ga0105239_10071665 | |||
| 2271 | Ga0105239_10076795 | |||
| 2272 | Ga0105239_10087369 | |||
| 2273 | Ga0105239_10094302 | |||
| 2274 | Ga0105239_10144933 | |||
| 2275 | Ga0105239_10224516 | |||
| 2276 | Ga0105246_10001408 | |||
| 2277 | Ga0105246_10007124 | |||
| 2278 | Ga0105246_10007306 | |||
| 2279 | Ga0105246_10025668 | |||
| 2280 | Ga0157373_10000127 | |||
| 2281 | Ga0157373_10001089 | |||
| 2282 | Ga0157373_10012333 | |||
| 2283 | Ga0157373_10019294 | |||
| 2284 | Ga0157373_10022692 | |||
| 2285 | Ga0157373_10042824 | |||
| 2286 | Ga0157373_10087577 | |||
| 2287 | Ga0157373_10089796 | |||
| 2288 | Ga0157373_10155386 | |||
| 2289 | Ga0157371_10000003 | |||
| 2290 | Ga0157371_10000172 | |||
| 2291 | Ga0157371_10000868 | |||
| 2292 | Ga0157371_10001625 | |||
| 2293 | Ga0157371_10002111 | |||
| 2294 | Ga0157371_10002204 | |||
| 2295 | Ga0157371_10003848 | |||
| 2296 | Ga0157371_10005778 | |||
| 2297 | Ga0157371_10011682 | |||
| 2298 | Ga0157371_10014562 | |||
| 2299 | Ga0157371_10025296 | |||
| 2300 | Ga0157371_10037827 | |||
| 2301 | Ga0157371_10041007 | |||
| 2302 | Ga0157371_10047958 | |||
| 2303 | Ga0157371_10049923 | |||
| 2304 | Ga0157371_10081240 | |||
| 2305 | Ga0157371_10117413 | |||
| 2306 | Ga0157370_10000181 | |||
| 2307 | Ga0157370_10000313 | |||
| 2308 | Ga0157370_10000326 | |||
| 2309 | Ga0157370_10000822 | |||
| 2310 | Ga0157370_10002652 | |||
| 2311 | Ga0157370_10003924 | |||
| 2312 | Ga0157370_10005338 | |||
| 2313 | Ga0157370_10012037 | |||
| 2314 | Ga0157370_10015635 | |||
| 2315 | Ga0157370_10067402 | |||
| 2316 | Ga0157370_10152496 | |||
| 2317 | Ga0157369_10000002 | |||
| 2318 | Ga0157369_10000007 | |||
| 2319 | Ga0157369_10005374 | |||
| 2320 | Ga0157369_10006651 | |||
| 2321 | Ga0157369_10014086 | |||
| 2322 | Ga0157369_10040373 | |||
| 2323 | Ga0157369_10055159 | |||
| 2324 | Ga0157369_10057285 | |||
| 2325 | Ga0157369_10069413 | |||
| 2326 | Ga0157369_10072059 | |||
| 2327 | Ga0157374_10000001 | |||
| 2328 | Ga0157374_10000379 | |||
| 2329 | Ga0157374_10001320 | |||
| 2330 | Ga0157374_10001718 | |||
| 2331 | Ga0157374_10002276 | |||
| 2332 | Ga0157374_10022966 | |||
| 2333 | Ga0157374_10050560 | |||
| 2334 | Ga0157374_10066312 | |||
| 2335 | Ga0157378_10001147 | |||
| 2336 | Ga0157378_10002967 | |||
| 2337 | Ga0157378_10076603 | |||
| 2338 | Ga0157378_10137223 | |||
| 2339 | Ga0157378_10162506 | |||
| 2340 | Ga0163162_10000063 | |||
| 2341 | Ga0163162_10000369 | |||
| 2342 | Ga0163162_10001851 | |||
| 2343 | Ga0163162_10001857 | |||
| 2344 | Ga0163162_10003949 | |||
| 2345 | Ga0163162_10005520 | |||
| 2346 | Ga0163162_10005992 | |||
| 2347 | Ga0163162_10008396 | |||
| 2348 | Ga0163162_10037133 | |||
| 2349 | Ga0163162_10052107 | |||
| 2350 | Ga0163162_10124759 | |||
| 2351 | Ga0163162_10163657 | |||
| 2352 | Ga0163162_10173443 | |||
| 2353 | Ga0157372_10000026 | |||
| 2354 | Ga0157372_10000177 | |||
| 2355 | Ga0157372_10000459 | |||
| 2356 | Ga0157372_10000921 | |||
| 2357 | Ga0157372_10004228 | |||
| 2358 | Ga0157372_10008214 | |||
| 2359 | Ga0157372_10025866 | |||
| 2360 | Ga0157372_10040371 | |||
| 2361 | Ga0157372_10040920 | |||
| 2362 | Ga0157372_10052776 | |||
| 2363 | Ga0157372_10053382 | |||
| 2364 | Ga0157372_10067478 | |||
| 2365 | Ga0157372_10121606 | |||
| 2366 | Ga0157372_10189242 | |||
| 2367 | Ga0157372_10201868 | |||
| 2368 | Ga0157372_10202805 | |||
| 2369 | Ga0157372_10302542 | |||
| 2370 | Ga0157372_10330229 | |||
| 2371 | Ga0157372_10352794 | |||
| 2372 | Ga0157375_10000166 | |||
| 2373 | Ga0157375_10002575 | |||
| 2374 | Ga0157375_10005010 | |||
| 2375 | Ga0157375_10015162 | |||
| 2376 | Ga0157375_10047011 | |||
| 2377 | Ga0157375_10172336 | |||
| 2378 | Ga0157375_10241765 | |||
| 2379 | Ga0163163_10003388 | |||
| 2380 | Ga0163163_10057315 | |||
| 2381 | Ga0163163_10220469 | |||
| 2382 | Ga0157380_10018712 | |||
| 2383 | Ga0157380_10028028 | |||
| 2384 | Ga0157380_10036404 | |||
| 2385 | Ga0182008_10000004 | |||
| 2386 | Ga0182008_10001429 | |||
| 2387 | Ga0182008_10008294 | |||
| 2388 | Ga0157377_10002998 | |||
| 2389 | Ga0157377_10004515 | |||
| 2390 | Ga0157377_10006587 | |||
| 2391 | Ga0157377_10010180 | |||
| 2392 | Ga0157379_10011459 | |||
| 2393 | Ga0157379_10037998 | |||
| 2394 | Ga0157376_10000176 | |||
| 2395 | Ga0157376_10000721 | |||
| 2396 | Ga0157376_10001531 | |||
| 2397 | Ga0157376_10004624 | |||
| 2398 | Ga0157376_10007428 | |||
| 2399 | Ga0157376_10110414 | |||
| 2400 | Ga0157376_10125471 | |||
| 2401 | Ga0157376_10125954 | |||
| 2402 | Ga0157376_10228357 | |||
| 2403 | Ga0182006_1000009 | |||
| 2404 | Ga0182006_1000130 | |||
| 2405 | Ga0182006_1000180 | |||
| 2406 | Ga0182006_1001603 | |||
| 2407 | Ga0182006_1002117 | |||
| 2408 | Ga0182006_1005424 | |||
| 2409 | Ga0182006_1015934 | |||
| 2410 | Ga0182007_10000001 | |||
| 2411 | Ga0182007_10000007 | |||
| 2412 | Ga0183366_1005 | |||
| 2413 | Ga0183370_1005 | |||
| 2414 | Ga0183373_1001 | |||
| 2415 | Ga0183365_10004 | |||
| 2416 | Ga0183369_1016 | |||
| 2417 | Ga0183368_1009 | |||
| 2418 | Ga0163161_10000019 | |||
| 2419 | Ga0163161_10000028 | |||
| 2420 | Ga0163161_10000045 | |||
| 2421 | Ga0163161_10000376 | |||
| 2422 | Ga0163161_10000496 | |||
| 2423 | Ga0163161_10002301 | |||
| 2424 | Ga0163161_10002434 | |||
| 2425 | Ga0163161_10004909 | |||
| 2426 | Ga0163161_10154616 | |||
| 2427 | Ga0163161_10182786 | |||
| 2428 | Ga0213876_10000039 | |||
| 2429 | Ga0209436_102822 | |||
| 2430 | Ga0209436_103845 | |||
| 2431 | Ga0209147_100010 | |||
| 2432 | Ga0209563_100011 | |||
| 2433 | Ga0207427_100125 | |||
| 2434 | Ga0209437_100008 | |||
| 2435 | Ga0209437_100089 | |||
| 2436 | Ga0209258_100075 | |||
| 2437 | Ga0207425_1000007 | |||
| 2438 | Ga0209646_1000091 | |||
| 2439 | Ga0209026_1000497 | |||
| 2440 | Ga0209677_101431 | |||
| 2441 | Ga0209148_1000085 | |||
| 2442 | Ga0209148_1000117 | |||
| 2443 | Ga0209148_1000600 | |||
| 2444 | Ga0209148_1003709 | |||
| 2445 | Ga0209129_1000006 | |||
| 2446 | Ga0209129_1000021 | |||
| 2447 | Ga0209233_1000024 | |||
| 2448 | Ga0209233_1000079 | |||
| 2449 | Ga0209565_1000082 | |||
| 2450 | Ga0209455_1000259 | |||
| 2451 | Ga0209455_1002019 | |||
| 2452 | Ga0209673_1000422 | |||
| 2453 | Ga0209130_1000320 | |||
| 2454 | Ga0209675_1000176 | |||
| 2455 | Ga0209676_1000008 | |||
| 2456 | Ga0209676_1000204 | |||
| 2457 | Ga0209025_1000043 | |||
| 2458 | Ga0209025_1000089 | |||
| 2459 | Ga0209025_1000999 | |||
| 2460 | Ga0209025_1003105 | |||
| 2461 | Ga0209025_1007368 | |||
| 2462 | Ga0209025_1009924 | |||
| 2463 | Ga0209564_1000438 | |||
| 2464 | Ga0209758_1000016 | |||
| 2465 | Ga0209758_1023838 | |||
| 2466 | Ga0209050_1000180 | |||
| 2467 | Ga0209256_1000323 | |||
| 2468 | Ga0207426_1000032 | |||
| 2469 | Ga0207426_1000057 | |||
| 2470 | Ga0207426_1000251 | |||
| 2471 | Ga0209257_1000004 | |||
| 2472 | Ga0209257_1000005 | |||
| 2473 | Ga0207656_10014318 | |||
| 2474 | Ga0207656_10026978 | |||
| 2475 | Ga0207696_1000040 | |||
| 2476 | Ga0207696_1000068 | |||
| 2477 | Ga0207696_1000245 | |||
| 2478 | Ga0207696_1000525 | |||
| 2479 | Ga0207696_1005540 | |||
| 2480 | Ga0207696_1021957 | |||
| 2481 | Ga0207655_1000023 | |||
| 2482 | Ga0207655_1000034 | |||
| 2483 | Ga0207655_1000053 | |||
| 2484 | Ga0207655_1000082 | |||
| 2485 | Ga0207655_1000106 | |||
| 2486 | Ga0207655_1000264 | |||
| 2487 | Ga0207655_1001062 | |||
| 2488 | Ga0207655_1002562 | |||
| 2489 | Ga0207655_1003694 | |||
| 2490 | Ga0207655_1005115 | |||
| 2491 | Ga0207713_1000017 | |||
| 2492 | Ga0207713_1000044 | |||
| 2493 | Ga0207713_1000053 | |||
| 2494 | Ga0207713_1000062 | |||
| 2495 | Ga0207713_1000066 | |||
| 2496 | Ga0207713_1006048 | |||
| 2497 | Ga0207713_1006491 | |||
| 2498 | Ga0207713_1007033 | |||
| 2499 | Ga0207713_1013766 | |||
| 2500 | Ga0207713_1061774 | |||
| 2501 | Ga0207682_10003471 | |||
| 2502 | Ga0207642_10021917 | |||
| 2503 | Ga0207642_10032843 | |||
| 2504 | Ga0207642_10068285 | |||
| 2505 | Ga0207710_10000104 | |||
| 2506 | Ga0207710_10000693 | |||
| 2507 | Ga0207710_10016084 | |||
| 2508 | Ga0207680_10000268 | |||
| 2509 | Ga0207647_10000046 | |||
| 2510 | Ga0207647_10001200 | |||
| 2511 | Ga0207647_10027349 | |||
| 2512 | Ga0207647_10058493 | |||
| 2513 | Ga0207645_10000088 | |||
| 2514 | Ga0207645_10000542 | |||
| 2515 | Ga0207645_10001902 | |||
| 2516 | Ga0207645_10025938 | |||
| 2517 | Ga0207645_10075539 | |||
| 2518 | Ga0207643_10006182 | |||
| 2519 | Ga0207643_10039172 | |||
| 2520 | Ga0207643_10060148 | |||
| 2521 | Ga0207643_10061613 | |||
| 2522 | Ga0207643_10095996 | |||
| 2523 | Ga0207705_10000076 | |||
| 2524 | Ga0207705_10000107 | |||
| 2525 | Ga0207705_10010608 | |||
| 2526 | Ga0207705_10012996 | |||
| 2527 | Ga0207705_10041503 | |||
| 2528 | Ga0207654_10000016 | |||
| 2529 | Ga0207654_10000738 | |||
| 2530 | Ga0207654_10000743 | |||
| 2531 | Ga0207654_10002549 | |||
| 2532 | Ga0207654_10013839 | |||
| 2533 | Ga0207654_10018530 | |||
| 2534 | Ga0207654_10029628 | |||
| 2535 | Ga0207707_10000487 | |||
| 2536 | Ga0207707_10012617 | |||
| 2537 | Ga0207707_10099580 | |||
| 2538 | Ga0207707_10154843 | |||
| 2539 | Ga0207695_10000019 | |||
| 2540 | Ga0207695_10000282 | |||
| 2541 | Ga0207695_10002490 | |||
| 2542 | Ga0207695_10004745 | |||
| 2543 | Ga0207695_10010448 | |||
| 2544 | Ga0207695_10015766 | |||
| 2545 | Ga0207695_10020921 | |||
| 2546 | Ga0207695_10023840 | |||
| 2547 | Ga0207695_10045195 | |||
| 2548 | Ga0207695_10063197 | |||
| 2549 | Ga0207695_10084084 | |||
| 2550 | Ga0207671_10000572 | |||
| 2551 | Ga0207671_10003026 | |||
| 2552 | Ga0207671_10003229 | |||
| 2553 | Ga0207671_10019811 | |||
| 2554 | Ga0207671_10030327 | |||
| 2555 | Ga0207671_10035305 | |||
| 2556 | Ga0207671_10058291 | |||
| 2557 | Ga0207671_10113039 | |||
| 2558 | Ga0207660_10002080 | |||
| 2559 | Ga0207660_10008225 | |||
| 2560 | Ga0207660_10040547 | |||
| 2561 | Ga0207660_10050798 | |||
| 2562 | Ga0207662_10025868 | |||
| 2563 | Ga0207657_10011508 | |||
| 2564 | Ga0207657_10018840 | |||
| 2565 | Ga0207657_10023001 | |||
| 2566 | Ga0207657_10030460 | |||
| 2567 | Ga0207657_10084456 | |||
| 2568 | Ga0207657_10091159 | |||
| 2569 | Ga0207657_10166850 | |||
| 2570 | Ga0207657_10225106 | |||
| 2571 | Ga0207649_10004270 | |||
| 2572 | Ga0207652_10000055 | |||
| 2573 | Ga0207652_10000103 | |||
| 2574 | Ga0207652_10003723 | |||
| 2575 | Ga0207652_10052292 | |||
| 2576 | Ga0207652_10070422 | |||
| 2577 | Ga0207652_10152500 | |||
| 2578 | Ga0207681_10005187 | |||
| 2579 | Ga0207681_10010237 | |||
| 2580 | Ga0207681_10149448 | |||
| 2581 | Ga0207694_10002468 | |||
| 2582 | Ga0207694_10007215 | |||
| 2583 | Ga0207694_10048422 | |||
| 2584 | Ga0207650_10057853 | |||
| 2585 | Ga0207650_10252522 | |||
| 2586 | Ga0207659_10005711 | |||
| 2587 | Ga0207659_10027151 | |||
| 2588 | Ga0207659_10107651 | |||
| 2589 | Ga0207659_10125849 | |||
| 2590 | Ga0207687_10026062 | |||
| 2591 | Ga0207687_10035758 | |||
| 2592 | Ga0207700_10127297 | |||
| 2593 | Ga0207644_10011358 | |||
| 2594 | Ga0207690_10013651 | |||
| 2595 | Ga0207690_10018497 | |||
| 2596 | Ga0207690_10059178 | |||
| 2597 | Ga0207690_10079861 | |||
| 2598 | Ga0207690_10178767 | |||
| 2599 | Ga0207706_10000115 | |||
| 2600 | Ga0207706_10014773 | |||
| 2601 | Ga0207706_10019052 | |||
| 2602 | Ga0207706_10028637 | |||
| 2603 | Ga0207706_10036150 | |||
| 2604 | Ga0207706_10069027 | |||
| 2605 | Ga0207706_10134591 | |||
| 2606 | Ga0207686_10005472 | |||
| 2607 | Ga0207709_10000006 | |||
| 2608 | Ga0207709_10000119 | |||
| 2609 | Ga0207709_10004334 | |||
| 2610 | Ga0207670_10062107 | |||
| 2611 | Ga0207669_10055806 | |||
| 2612 | Ga0207704_10000001 | |||
| 2613 | Ga0207704_10004504 | |||
| 2614 | Ga0207704_10008805 | |||
| 2615 | Ga0207691_10000293 | |||
| 2616 | Ga0207691_10008395 | |||
| 2617 | Ga0207691_10030637 | |||
| 2618 | Ga0207691_10042120 | |||
| 2619 | Ga0207691_10151393 | |||
| 2620 | Ga0207691_10153826 | |||
| 2621 | Ga0207711_10020817 | |||
| 2622 | Ga0207711_10168828 | |||
| 2623 | Ga0207689_10001830 | |||
| 2624 | Ga0207689_10002330 | |||
| 2625 | Ga0207689_10006044 | |||
| 2626 | Ga0207689_10014794 | |||
| 2627 | Ga0207689_10033869 | |||
| 2628 | Ga0207689_10047061 | |||
| 2629 | Ga0207661_10001626 | |||
| 2630 | Ga0207661_10002021 | |||
| 2631 | Ga0207661_10056983 | |||
| 2632 | Ga0207679_10001158 | |||
| 2633 | Ga0207679_10049597 | |||
| 2634 | Ga0207679_10106915 | |||
| 2635 | Ga0207667_10000046 | |||
| 2636 | Ga0207667_10000135 | |||
| 2637 | Ga0207667_10000190 | |||
| 2638 | Ga0207667_10000391 | |||
| 2639 | Ga0207667_10001258 | |||
| 2640 | Ga0207667_10003647 | |||
| 2641 | Ga0207667_10004453 | |||
| 2642 | Ga0207667_10015326 | |||
| 2643 | Ga0207667_10044880 | |||
| 2644 | Ga0207667_10058074 | |||
| 2645 | Ga0207667_10073823 | |||
| 2646 | Ga0207667_10097647 | |||
| 2647 | Ga0207667_10212267 | |||
| 2648 | Ga0207667_10228621 | |||
| 2649 | Ga0207651_10000002 | |||
| 2650 | Ga0207651_10002459 | |||
| 2651 | Ga0207651_10054310 | |||
| 2652 | Ga0207651_10071052 | |||
| 2653 | Ga0207651_10072948 | |||
| 2654 | Ga0207651_10080997 | |||
| 2655 | Ga0207651_10127472 | |||
| 2656 | Ga0207712_10017200 | |||
| 2657 | Ga0207712_10018615 | |||
| 2658 | Ga0207712_10023530 | |||
| 2659 | Ga0207712_10024170 | |||
| 2660 | Ga0207668_10001840 | |||
| 2661 | Ga0207668_10013298 | |||
| 2662 | Ga0207668_10062151 | |||
| 2663 | Ga0207640_10000710 | |||
| 2664 | Ga0207640_10022246 | |||
| 2665 | Ga0207640_10228886 | |||
| 2666 | Ga0207658_10001199 | |||
| 2667 | Ga0207658_10006063 | |||
| 2668 | Ga0207658_10007214 | |||
| 2669 | Ga0207658_10008446 | |||
| 2670 | Ga0207658_10166523 | |||
| 2671 | Ga0207677_10000042 | |||
| 2672 | Ga0207677_10005877 | |||
| 2673 | Ga0207677_10013999 | |||
| 2674 | Ga0207677_10052863 | |||
| 2675 | Ga0207677_10058186 | |||
| 2676 | Ga0207703_10000495 | |||
| 2677 | Ga0207703_10003145 | |||
| 2678 | Ga0207703_10006159 | |||
| 2679 | Ga0207703_10153412 | |||
| 2680 | Ga0207639_10001961 | |||
| 2681 | Ga0207639_10002864 | |||
| 2682 | Ga0207639_10016353 | |||
| 2683 | Ga0207639_10018367 | |||
| 2684 | Ga0207639_10065102 | |||
| 2685 | Ga0207639_10077694 | |||
| 2686 | Ga0207639_10119487 | |||
| 2687 | Ga0207678_10039235 | |||
| 2688 | Ga0207678_10072591 | |||
| 2689 | Ga0207702_10000165 | |||
| 2690 | Ga0207702_10010109 | |||
| 2691 | Ga0207702_10017996 | |||
| 2692 | Ga0207702_10030948 | |||
| 2693 | Ga0207702_10034461 | |||
| 2694 | Ga0207641_10000053 | |||
| 2695 | Ga0207641_10000734 | |||
| 2696 | Ga0207641_10005551 | |||
| 2697 | Ga0207641_10018211 | |||
| 2698 | Ga0207641_10018628 | |||
| 2699 | Ga0207648_10000001 | |||
| 2700 | Ga0207648_10003474 | |||
| 2701 | Ga0207648_10005517 | |||
| 2702 | Ga0207648_10020072 | |||
| 2703 | Ga0207648_10021881 | |||
| 2704 | Ga0207648_10079790 | |||
| 2705 | Ga0207648_10090555 | |||
| 2706 | Ga0207648_10136337 | |||
| 2707 | Ga0207676_10057538 | |||
| 2708 | Ga0207676_10103841 | |||
| 2709 | Ga0207674_10000018 | |||
| 2710 | Ga0207674_10000672 | |||
| 2711 | Ga0207674_10002568 | |||
| 2712 | Ga0207674_10011114 | |||
| 2713 | Ga0207674_10015732 | |||
| 2714 | Ga0207674_10028279 | |||
| 2715 | Ga0207674_10057821 | |||
| 2716 | Ga0207674_10116814 | |||
| 2717 | Ga0207675_100005554 | |||
| 2718 | Ga0207675_100017826 | |||
| 2719 | Ga0207675_100119454 | |||
| 2720 | Ga0207683_10011668 | |||
| 2721 | Ga0207683_10021472 | |||
| 2722 | Ga0207683_10067406 | |||
| 2723 | Ga0207683_10108019 | |||
| 2724 | Ga0207683_10155591 | |||
| 2725 | Ga0207698_10001560 | |||
| 2726 | Ga0207698_10007731 | |||
| 2727 | Ga0207698_10025890 | |||
| 2728 | Ga0207698_10134973 | |||
| 2729 | Ga0209281_1000031 | |||
| 2730 | Ga0209281_1000065 | |||
| 2731 | Ga0209281_1000088 | |||
| 2732 | Ga0209281_1000107 | |||
| 2733 | Ga0209281_1000112 | |||
| 2734 | Ga0209281_1000162 | |||
| 2735 | Ga0209281_1000327 | |||
| 2736 | Ga0209281_1000606 | |||
| 2737 | Ga0209281_1000649 | |||
| 2738 | Ga0209281_1001280 | |||
| 2739 | Ga0209281_1010279 | |||
| 2740 | Ga0209371_1000010 | |||
| 2741 | Ga0209371_1000027 | |||
| 2742 | Ga0209371_1000029 | |||
| 2743 | Ga0209371_1000092 | |||
| 2744 | Ga0209371_1000146 | |||
| 2745 | Ga0209371_1000266 | |||
| 2746 | Ga0209371_1000270 | |||
| 2747 | Ga0209371_1004055 | |||
| 2748 | Ga0209371_1009262 | |||
| 2749 | Ga0209371_1014847 | |||
| 2750 | Ga0209489_109199 | |||
| 2751 | Ga0207428_10079113 | |||
| 2752 | Ga0268266_10000032 | |||
| 2753 | Ga0268266_10000049 | |||
| 2754 | Ga0268266_10000079 | |||
| 2755 | Ga0268266_10004031 | |||
| 2756 | Ga0268266_10095689 | |||
| 2757 | Ga0268266_10100658 | |||
| 2758 | Ga0268265_10018409 | |||
| 2759 | Ga0268265_10136426 | |||
| 2760 | Ga0268265_10164881 | |||
| 2761 | Ga0268264_10000041 | |||
| 2762 | Ga0268264_10000176 | |||
| 2763 | Ga0268264_10004390 | |||
| 2764 | Ga0268264_10007057 | |||
| 2765 | Ga0268264_10011611 | |||
| 2766 | Ga0268264_10017902 | |||
| 2767 | Ga0268264_10019208 | |||
| 2768 | Ga0268264_10022094 | |||
| 2769 | Ga0268264_10125354 | |||
| 2770 | Ga0268264_10193439 | |||
| 2771 | Ga0307517_10000429 | |||
| 2772 | Ga0307517_10001171 | |||
| 2773 | Ga0307517_10002048 | |||
| 2774 | Ga0307515_10000061 | |||
| 2775 | Ga0307515_10001027 | |||
| 2776 | Ga0307515_10001574 | |||
| 2777 | Ga0307515_10015963 | |||
| 2778 | Ga0265338_10025958 | |||
| 2779 | Ga0265338_10094575 | |||
| 2780 | Ga0237817_10010 | |||
| 2781 | Ga0268256_1000022 | |||
| 2782 | Ga0268256_1000032 | |||
| 2783 | Ga0268256_1000045 | |||
| 2784 | Ga0268256_1000082 | |||
| 2785 | Ga0268256_1000117 | |||
| 2786 | Ga0268256_1000248 | |||
| 2787 | Ga0268256_1003628 | |||
| 2788 | Ga0268256_1003783 | |||
| 2789 | Ga0268256_1005563 | |||
| 2790 | Ga0268256_1005828 | |||
| 2791 | Ga0307511_10001833 | |||
| 2792 | Ga0307511_10035570 | |||
| 2793 | Ga0316176_1186872 | |||
| 2794 | Ga0316181_1204273 | |||
| 2795 | Ga0265332_10018318 | |||
| 2796 | Ga0265327_10000051 | |||
| 2797 | Ga0265327_10023081 | |||
| 2798 | Ga0265327_10102392 | |||
| 2799 | Ga0265316_10006677 | |||
| 2800 | Ga0265316_10137960 | |||
| 2801 | Ga0307513_10005109 | |||
| 2802 | Ga0307513_10017431 | |||
| 2803 | Ga0307513_10060749 | |||
| 2804 | Ga0307513_10177668 | |||
| 2805 | Ga0307513_10179938 | |||
| 2806 | Ga0307513_10242293 | |||
| 2807 | Ga0307513_10263851 | |||
| 2808 | Ga0307509_10000019 | |||
| 2809 | Ga0307509_10085073 | |||
| 2810 | Ga0307509_10093472 | |||
| 2811 | Ga0307509_10095342 | |||
| 2812 | Ga0307509_10192126 | |||
| 2813 | Ga0307408_100000005 | |||
| 2814 | Ga0307408_100072036 | |||
| 2815 | Ga0307508_10002356 | |||
| 2816 | Ga0307514_10035615 | |||
| 2817 | Ga0316575_10008091 | |||
| 2818 | Ga0265314_10011967 | |||
| 2819 | Ga0307516_10001571 | |||
| 2820 | Ga0307516_10019622 | |||
| 2821 | Ga0307405_10000003 | |||
| 2822 | Ga0307405_10000019 | |||
| 2823 | Ga0307413_10000959 | |||
| 2824 | Ga0307413_10001519 | |||
| 2825 | Ga0307413_10050336 | |||
| 2826 | Ga0307518_10012267 | |||
| 2827 | Ga0307407_10000019 | |||
| 2828 | Ga0307407_10000021 | |||
| 2829 | Ga0307407_10088738 | |||
| 2830 | Ga0307412_10055732 | |||
| 2831 | Ga0307409_100027918 | |||
| 2832 | Ga0307409_100179525 | |||
| 2833 | Ga0307416_100000043 | |||
| 2834 | Ga0307416_100000232 | |||
| 2835 | Ga0307416_100000252 | |||
| 2836 | Ga0307416_100001520 | |||
| 2837 | Ga0307414_10000053 | |||
| 2838 | Ga0307414_10002363 | |||
| 2839 | Ga0307414_10004482 | |||
| 2840 | Ga0307414_10005497 | |||
| 2841 | Ga0307414_10006818 | |||
| 2842 | Ga0307414_10032784 | |||
| 2843 | Ga0307411_10000006 | |||
| 2844 | Ga0307411_10000009 | |||
| 2845 | Ga0307415_100009832 | |||
| 2846 | Ga0307415_100165412 | |||
| 2847 | Ga0307507_10000510 | |||
| 2848 | Ga0307510_10000002 | |||
| 2849 | Ga0307510_10020428 | |||
| 2850 | Ga0307510_10020871 | |||
| 2851 | Ga0373936_0012250 | |||
| 2852 | Ga0373936_0012969 | |||
| 2853 | Ga0373937_0057048 | |||
| 2854 | Ga0373937_0140797 | |||
| 2855 | Ga0395899_0000002 | |||
| 2856 | Ga0395899_0000055 | |||
| 2857 | Ga0395899_0001560 | |||
| 2858 | Ga0395899_0001714 | |||
| 2859 | Ga0395899_0007754 | |||
| 2860 | Ga0395899_0014865 | |||
| 2861 | Ga0395899_0020675 | |||
| 2862 | Ga0395899_0047617 | |||
| 2863 | Ga0395900_0000285 | |||
| 2864 | Ga0395900_0000322 | |||
| 2865 | Ga0395900_0001027 | |||
| 2866 | Ga0395900_0003451 | |||
| 2867 | Ga0395900_0004551 | |||
| 2868 | Ga0395900_0005771 | |||
| 2869 | Ga0395900_0035403 | |||
| 2870 | Ga0395900_0067592 | |||
| 2871 | Ga0395900_0102015 | |||
| 2872 | Ga0395900_0118787 | |||
| 2873 | Ga0395900_0176938 | |||
| 2874 | Ga0395900_0255098 | |||
| 2875 | Ga0395898_0001240 | |||
| 2876 | Ga0395898_0038993 | |||
| 2877 | Ga0395898_0048311 | |||
| 2878 | Ga0395898_0058344 | |||
| 2879 | Ga0395898_0081995 | |||
| 2880 | Ga0395898_0083914 | |||
| 2881 | Ga0395905_0000070 | |||
| 2882 | Ga0395905_0000716 | |||
| 2883 | Ga0395905_0017759 | |||
| 2884 | Ga0395905_0021327 | |||
| 2885 | Ga0395905_0061121 | |||
| 2886 | Ga0395901_0000332 | |||
| 2887 | Ga0395901_0003481 | |||
| 2888 | Ga0395901_0009872 | |||
| 2889 | Ga0395901_0017512 | |||
| 2890 | Ga0395901_0061345 | |||
| 2891 | Ga0395901_0208062 | |||
| 2892 | Ga0395901_0218072 | |||
| 2893 | Ga0395901_0236184 | |||
| 2894 | Ga0395901_0304788 | |||
| 2895 | Ga0436365_0171687 | |||
| 2896 | Ga0436361_0059626 | |||
| 2897 | Ga0439438_000001 | |||
| 2898 | Ga0439438_002410 | |||
| 2899 | Ga0439438_002877 | |||
| 2900 | Ga0439439_0030538 | |||
| 2901 | Ga0439447_000193 | |||
| 2902 | Ga0439447_000563 | |||
| 2903 | Ga0451791_1638987 | |||
| 2904 | Ga0451800_0868019 | |||
| 2905 | Ga0451807_2607721 | |||
| 2906 | Ga0451837_0156886 | |||
| 2907 | Ga0439442_014730 | |||
| 2908 | Ga0439448_0003051 | |||
| 2909 | Ga0439448_0008130 | |||
| 2910 | Ga0439448_0025228 | |||
| 2911 | Ga0439432_002021 | |||
| 2912 | Ga0439432_010316 | |||
| 2913 | Ga0439449_0002186 | |||
| 2914 | Ga0439449_0028771 | |||
| 2915 | Ga0439452_000010 | |||
| 2916 | Ga0439452_000012 | |||
| 2917 | Ga0439452_000039 | |||
| 2918 | Ga0439452_003330 | |||
| 2919 | Ga0439455_0001320 | |||
| 2920 | Ga0439457_007044 | |||
| 2921 | Ga0439457_007246 | |||
| 2922 | Ga0439458_0000056 | |||
| 2923 | Ga0439458_0000106 | |||
| 2924 | Ga0439464_0003228 | |||
| 2925 | Ga0451577_0000660 | |||
| 2926 | Ga0451577_0022846 | |||
| 2927 | Ga0451577_0026427 | |||
| 2928 | Ga0451577_0063292 | |||
| 2929 | Ga0451577_0163772 | |||
| 2930 | Ga0451577_0195649 | |||
| 2931 | Ga0451577_0290746 | |||
| 2932 | Ga0466969_0011304 | |||
| 2933 | Ga0466969_0017683 | |||
| 2934 | Ga0466969_0073274 | |||
| 2935 | Ga0466972_0000008 | |||
| 2936 | Ga0466972_0000032 | |||
| 2937 | Ga0466972_0000099 | |||
| 2938 | Ga0466972_0008359 | |||
| 2939 | Ga0466972_0032304 | |||
| 2940 | Ga0466981_0000033 | |||
| 2941 | Ga0453683_0000135 | |||
| 2942 | Ga0453683_0026343 | |||
| 2943 | Ga0453683_0100006 | |||
| 2944 | Ga0453683_0107530 | |||
| 2945 | Ga0466966_0000157 | |||
| 2946 | Ga0466966_0000222 | |||
| 2947 | Ga0466966_0002934 | |||
| 2948 | Ga0466966_0008700 | |||
| 2949 | Ga0466966_0076017 | |||
| 2950 | Ga0466961_0000565 | |||
| 2951 | Ga0466961_0010853 | |||
| 2952 | Ga0466961_0027192 | |||
| 2953 | Ga0466964_0006766 | |||
| 2954 | Ga0466964_0007857 | |||
| 2955 | Ga0453684_0000553 | |||
| 2956 | Ga0453684_0001244 | |||
| 2957 | Ga0453684_0003919 | |||
| 2958 | Ga0453684_0009187 | |||
| 2959 | Ga0453684_0011435 | |||
| 2960 | Ga0453684_0027373 | |||
| 2961 | Ga0453684_0049262 | |||
| 2962 | Ga0453684_0072712 | |||
| 2963 | Ga0453684_0084391 | |||
| 2964 | Ga0453684_0325186 | |||
| 2965 | Ga0466971_0002102 | |||
| 2966 | Ga0466971_0002161 | |||
| 2967 | Ga0466968_0005875 | |||
| 2968 | Ga0466970_0008939 | |||
| 2969 | Ga0466970_0031607 | |||
| 2970 | Ga0466970_0037259 | |||
| 2971 | Ga0466957_0000013 | |||
| 2972 | Ga0466957_0004749 | |||
| 2973 | Ga0466957_0006610 | |||
| 2974 | Ga0466957_0030457 | |||
| 2975 | Ga0466960_0031512 | |||
| 2976 | Ga0466960_0076825 | |||
| 2977 | Ga0466959_0001636 | |||
| 2978 | Ga0466959_0005022 | |||
| 2979 | Ga0466959_0010903 | |||
| 2980 | Ga0466959_0019618 | |||
| 2981 | Ga0466959_0027743 | |||
| 2982 | Ga0451576_0000112 | |||
| 2983 | Ga0451576_0001577 | |||
| 2984 | Ga0451576_0056604 | |||
| 2985 | Ga0451576_0058884 | |||
| 2986 | Ga0451576_0209097 | |||
| 2987 | Ga0466958_0001403 | |||
| 2988 | Ga0466958_0002680 | |||
| 2989 | Ga0466967_0027952 | |||
| 2990 | Ga0466967_0038134 | |||
| 2991 | Ga0495627_000181 | |||
| 2992 | Ga0495627_002499 | |||
| 2993 | Ga0495592_0162110 | |||
| 2994 | Ga0495590_0007233 | |||
| 2995 | Ga0495591_000029 | |||
| 2996 | Ga0495591_000094 | |||
| 2997 | Ga0495591_006502 | |||
| 2998 | Ga0495638_0003576 | |||
| 2999 | Ga0495638_0014448 | |||
| 3000 | Ga0495638_0041297 | |||
| 3001 | Ga0495638_0105728 | |||
| 3002 | Ga0495638_0112814 | |||
| 3003 | Ga0495651_0057753 | |||
| 3004 | Ga0495650_0000033 | |||
| 3005 | Ga0495650_0000103 | |||
| 3006 | Ga0495650_0000167 | |||
| 3007 | Ga0495650_0000189 | |||
| 3008 | Ga0495650_0000519 | |||
| 3009 | Ga0495582_0058936 | |||
| 3010 | Ga0495605_0000055 | |||
| 3011 | Ga0495605_0000068 | |||
| 3012 | Ga0495605_0055374 | |||
| 3013 | Ga0495584_0000576 | |||
| 3014 | Ga0495584_0001279 | |||
| 3015 | Ga0495584_0023801 | |||
| 3016 | Ga0495585_0000018 | |||
| 3017 | Ga0495585_0001568 | |||
| 3018 | Ga0495596_0003492 | |||
| 3019 | Ga0495596_0006128 | |||
| 3020 | Ga0495607_0001005 | |||
| 3021 | Ga0495607_0003503 | |||
| 3022 | Ga0495607_0006487 | |||
| 3023 | Ga0495606_0000008 | |||
| 3024 | Ga0495606_0000419 | |||
| 3025 | Ga0495606_0000619 | |||
| 3026 | Ga0495606_0001898 | |||
| 3027 | Ga0495606_0004447 | |||
| 3028 | Ga0495606_0014229 | |||
| 3029 | Ga0495606_0020180 | |||
| 3030 | Ga0495606_0028183 | |||
| 3031 | Ga0495606_0037911 | |||
| 3032 | Ga0495610_0000148 | |||
| 3033 | Ga0495610_0000266 | |||
| 3034 | Ga0495610_0001323 | |||
| 3035 | Ga0495610_0004181 | |||
| 3036 | Ga0495610_0007362 | |||
| 3037 | Ga0495610_0022376 | |||
| 3038 | Ga0495616_0002554 | |||
| 3039 | Ga0495616_0004107 | |||
| 3040 | Ga0495616_0015961 | |||
| 3041 | Ga0495616_0023858 | |||
| 3042 | Ga0495616_0049087 | |||
| 3043 | Ga0495618_0019272 | |||
| 3044 | Ga0495630_0041133 | |||
| 3045 | Ga0495630_0154644 | |||
| 3046 | Ga0495630_0207858 | |||
| 3047 | Ga0495637_0032499 | |||
| 3048 | Ga0495637_0065569 | |||
| 3049 | Ga0495644_0016290 | |||
| 3050 | Ga0495644_0044795 | |||
| 3051 | Ga0495648_0002776 | |||
| 3052 | Ga0495648_0003058 | |||
| 3053 | Ga0495648_0004838 | |||
| 3054 | Ga0495642_0044151 | |||
| 3055 | Ga0495654_0000078 | |||
| 3056 | Ga0495654_0000572 | |||
| 3057 | Ga0495654_0000616 | |||
| 3058 | Ga0495654_0026535 | |||
| 3059 | Ga0495609_0000038 | |||
| 3060 | Ga0495609_0000190 | |||
| 3061 | Ga0495609_0000254 | |||
| 3062 | Ga0495609_0001935 | |||
| 3063 | Ga0495609_0025233 | |||
| 3064 | Ga0495622_0000053 | |||
| 3065 | Ga0495633_0000022 | |||
| 3066 | Ga0495633_0000177 | |||
| 3067 | Ga0495668_0000009 | |||
| 3068 | Ga0495668_0001086 | |||
| 3069 | Ga0495668_0001824 | |||
| 3070 | Ga0495668_0003068 | |||
| 3071 | Ga0495668_0010689 | |||
| 3072 | Ga0495625_0000017 | |||
| 3073 | Ga0495625_0000375 | |||
| 3074 | Ga0495625_0000785 | |||
| 3075 | Ga0495625_0001098 | |||
| 3076 | Ga0495625_0007459 | |||
| 3077 | Ga0495625_0013468 | |||
| 3078 | Ga0495625_0029100 | |||
| 3079 | Ga0495625_0042106 | |||
| 3080 | Ga0495635_0099339 | |||
| 3081 | Ga0495659_0001483 | |||
| 3082 | Ga0495661_0000070 | |||
| 3083 | Ga0495661_0000400 | |||
| 3084 | Ga0495661_0000838 | |||
| 3085 | Ga0495661_0002871 | |||
| 3086 | Ga0495661_0043170 | |||
| 3087 | Ga0495661_0131899 | |||
| 3088 | Ga0495588_0000172 | |||
| 3089 | Ga0495658_0032269 | |||
| 3090 | Ga0495658_0033214 | |||
| 3091 | Ga0495669_0005794 | |||
| 3092 | Ga0495613_0063067 | |||
| 3093 | Ga0495671_0003259 | |||
| 3094 | Ga0495649_0000008 | |||
| 3095 | Ga0495649_0001447 | |||
| 3096 | Ga0495649_0012203 | |||
| 3097 | Ga0495649_0044924 | |||
| 3098 | Ga0495589_0000010 | |||
| 3099 | Ga0495589_0000126 | |||
| 3100 | Ga0495589_0000211 | |||
| 3101 | Ga0495589_0008358 | |||
| 3102 | Ga0495660_0000011 | |||
| 3103 | Ga0495660_0000047 | |||
| 3104 | Ga0495674_0035314 | |||
| 3105 | Ga0495672_0000004 | |||
| 3106 | Ga0495672_0000392 | |||
| 3107 | Ga0495672_0001319 | |||
| 3108 | Ga0495672_0042879 | |||
| 3109 | Ga0495672_0043010 | |||
| 3110 | Ga0495680_0062162 | |||
| 3111 | Ga0495683_0009241 | |||
| 3112 | Ga0495683_0033417 | |||
| 3113 | Ga0495687_000001 | |||
| 3114 | Ga0495687_000071 | |||
| 3115 | Ga0495687_000363 | |||
| 3116 | Ga0495687_003106 | |||
| 3117 | Ga0495687_004707 | |||
| 3118 | Ga0495675_0084072 | |||
| 3119 | Ga0495677_0000016 | |||
| 3120 | Ga0495677_0003062 | |||
| 3121 | Ga0495677_0012949 | |||
| 3122 | Ga0495673_0000023 | |||
| 3123 | Ga0495673_0000079 | |||
| 3124 | Ga0495681_0011881 | |||
| 3125 | Ga0495686_0001966 | |||
| 3126 | Ga0495686_0035024 | |||
| 3127 | Ga0495602_0082369 | |||
| 3128 | Ga0495626_0000042 | |||
| 3129 | Ga0495626_0000533 | |||
| 3130 | Ga0496100_0032077 | |||
| 3131 | Ga0496101_0000029 | |||
| 3132 | Ga0496101_0030747 | |||
| 3133 | Ga0496102_0001288 | |||
| 3134 | Ga0496102_0076783 | |||
| 3135 | Ga0496103_0154689 | |||
| 3136 | Ga0496104_0000098 | |||
| 3137 | Ga0496104_0108208 | |||
| 3138 | Ga0496105_0020177 | |||
| 3139 | Ga0496106_0016890 | |||
| 3140 | Ga0496106_0186055 | |||
| 3141 | Ga0496107_0002047 | |||
| 3142 | Ga0496109_0019183 | |||
| 3143 | Ga0496111_0153113 | |||
| 3144 | Ga0496113_0022284 | |||
| 3145 | Ga0496115_0109466 | |||
| 3146 | Ga0496116_0000075 | |||
| 3147 | Ga0496116_0000077 | |||
| 3148 | Ga0496116_0006079 | |||
| 3149 | Ga0496116_0028515 | |||
| 3150 | Ga0496116_0032177 | |||
| 3151 | Ga0496116_0035909 | |||
| 3152 | Ga0496116_0041821 | |||
| 3153 | Ga0496116_0041883 | |||
| 3154 | Ga0496117_0000054 | |||
| 3155 | Ga0496117_0000593 | |||
| 3156 | Ga0496117_0000635 | |||
| 3157 | Ga0496117_0002611 | |||
| 3158 | Ga0496117_0006228 | |||
| 3159 | Ga0496117_0025066 | |||
| 3160 | Ga0496117_0051088 | |||
| 3161 | Ga0496117_0129807 | |||
| 3162 | Ga0496118_0000045 | |||
| 3163 | Ga0496118_0006469 | |||
| 3164 | Ga0496118_0008371 | |||
| 3165 | Ga0496118_0032272 | |||
| 3166 | Ga0496118_0033182 | |||
| 3167 | Ga0496118_0040958 | |||
| 3168 | Ga0496118_0057976 | |||
| 3169 | Ga0496118_0067077 | |||
| 3170 | Ga0496118_0084529 | |||
| 3171 | Ga0496118_0086752 | |||
| 3172 | Ga0496119_0000023 | |||
| 3173 | Ga0496119_0001077 | |||
| 3174 | Ga0496119_0001451 | |||
| 3175 | Ga0496119_0001653 | |||
| 3176 | Ga0496119_0002580 | |||
| 3177 | Ga0496119_0009788 | |||
| 3178 | Ga0496119_0015944 | |||
| 3179 | Ga0496119_0022542 | |||
| 3180 | Ga0496119_0024430 | |||
| 3181 | Ga0496119_0041172 | |||
| 3182 | Ga0496119_0049672 | |||
| 3183 | Ga0496120_0000112 | |||
| 3184 | Ga0496120_0000139 | |||
| 3185 | Ga0496120_0000177 | |||
| 3186 | Ga0496120_0000407 | |||
| 3187 | Ga0496120_0007202 | |||
| 3188 | Ga0496120_0009875 | |||
| 3189 | Ga0496120_0018341 | |||
| 3190 | Ga0496120_0022093 | |||
| 3191 | Ga0496120_0035790 | |||
| 3192 | Ga0496120_0039461 | |||
| 3193 | Ga0496121_0000010 | |||
| 3194 | Ga0496121_0002021 | |||
| 3195 | Ga0496121_0005398 | |||
| 3196 | Ga0496121_0013963 | |||
| 3197 | Ga0496121_0034633 | |||
| 3198 | Ga0496121_0054576 | |||
| 3199 | Ga0496121_0074282 | |||
| 3200 | Ga0496121_0119078 | |||
| 3201 | Ga0496121_0136441 | |||
| 3202 | Ga0496122_0000108 | |||
| 3203 | Ga0496122_0000348 | |||
| 3204 | Ga0496122_0000771 | |||
| 3205 | Ga0496122_0001079 | |||
| 3206 | Ga0496122_0003177 | |||
| 3207 | Ga0496122_0005356 | |||
| 3208 | Ga0496122_0018906 | |||
| 3209 | Ga0496122_0020291 | |||
| 3210 | Ga0496122_0025156 | |||
| 3211 | Ga0496122_0026213 | |||
| 3212 | Ga0496122_0042259 | |||
| 3213 | Ga0496122_0043681 | |||
| 3214 | Ga0496122_0070880 | |||
| 3215 | Ga0496123_0000065 | |||
| 3216 | Ga0496123_0000424 | |||
| 3217 | Ga0496123_0000781 | |||
| 3218 | Ga0496123_0002969 | |||
| 3219 | Ga0496123_0005408 | |||
| 3220 | Ga0496123_0008601 | |||
| 3221 | Ga0496123_0009042 | |||
| 3222 | Ga0496123_0011737 | |||
| 3223 | Ga0496123_0012625 | |||
| 3224 | Ga0496123_0015732 | |||
| 3225 | Ga0496123_0079081 | |||
| 3226 | Ga0496124_0000100 | |||
| 3227 | Ga0496124_0001570 | |||
| 3228 | Ga0496124_0005306 | |||
| 3229 | Ga0496124_0005767 | |||
| 3230 | Ga0496124_0005834 | |||
| 3231 | Ga0496124_0007587 | |||
| 3232 | Ga0496124_0022824 | |||
| 3233 | Ga0496124_0025452 | |||
| 3234 | Ga0496125_0000070 | |||
| 3235 | Ga0496125_0000104 | |||
| 3236 | Ga0496125_0000509 | |||
| 3237 | Ga0496125_0003423 | |||
| 3238 | Ga0496125_0009046 | |||
| 3239 | Ga0496125_0016571 | |||
| 3240 | Ga0496125_0019538 | |||
| 3241 | Ga0496125_0117900 | |||
| 3242 | Ga0496125_0181345 | |||
| 3243 | Ga0496126_0001489 | |||
| 3244 | Ga0496126_0001777 | |||
| 3245 | Ga0496126_0040747 | |||
| 3246 | Ga0496126_0044023 | |||
| 3247 | Ga0496126_0049927 | |||
| 3248 | Ga0496126_0087468 | |||
| 3249 | Ga0501344_00526 | |||
| 3250 | Ga0501345_00240 | |||
| 3251 | Ga0495678_000415 | |||
| 3252 | Ga0495678_006121 | |||
| 3253 | Ga0495682_0000004 | |||
| 3254 | Ga0495682_0043443 | |||
| 3255 | Ga0501300_002577 | |||
| 3256 | Ga0501315_000769 | |||
| 3257 | Ga0501334_00617 | |||
| 3258 | Ga0501336_000088 | |||
| 3259 | Ga0501340_000804 | |||
| 3260 | Ga0501032_0003830 | |||
| 3261 | Ga0501032_0066866 | |||
| 3262 | Ga0501033_0032638 | |||
| 3263 | Ga0501034_0026227 | |||
| 3264 | Ga0501034_0035363 | |||
| 3265 | Ga0501034_0103328 | |||
| 3266 | Ga0501036_0127085 | |||
| 3267 | Ga0501037_0014870 | |||
| 3268 | Ga0501037_0024855 | |||
| 3269 | Ga0501038_0112597 | |||
| 3270 | Ga0501043_0068988 | |||
| 3271 | Ga0501043_0147839 | |||
| 3272 | Ga0501047_0011115 | |||
| 3273 | Ga0501047_0013626 | |||
| 3274 | Ga0501047_0015992 | |||
| 3275 | Ga0501047_0032071 | |||
| 3276 | Ga0501047_0046535 | |||
| 3277 | Ga0501047_0112786 | |||
| 3278 | Ga0501069_0028606 | |||
| 3279 | Ga0501070_0116525 | |||
| 3280 | Ga0501071_0012334 | |||
| 3281 | Ga0501074_0004546 | |||
| 3282 | Ga0501199_001224 | |||
| 3283 | Ga0501217_008773 | |||
| 3284 | Ga0501236_000080 | |||
| 3285 | Ga0501249_000030 | |||
| 3286 | Ga0501257_021605 | |||
| 3287 | Ga0501245_002382 | |||
| 3288 | Ga0501241_009726 | |||
| 3289 | Ga0501264_000029 | |||
| 3290 | Ga0501266_000008 | |||
| 3291 | Ga0501266_000013 | |||
| 3292 | Ga0501035_0000359 | |||
| 3293 | Ga0501035_0033273 | |||
| 3294 | Ga0501035_0075798 | |||
| 3295 | Ga0501044_0005351 | |||
| 3296 | Ga0501044_0017177 | |||
| 3297 | Ga0501044_0020067 | |||
| 3298 | Ga0501044_0391186 | |||
| 3299 | nmdc:mga00v17_196_c1 | |||
| 3300 | nmdc:mga00v17_23251_c1 | |||
| 3301 | nmdc:mga00v17_4576_c1 | |||
| 3302 | nmdc:mga0k408_1724_c1 | |||
| 3303 | nmdc:mga0k408_66023_c1 | |||
| 3304 | nmdc:mga06z11_8598_c1 | |||
| 3305 | nmdc:mga09592_100881_c1 | |||
| 3306 | nmdc:mga08y16_334798_c1 | |||
| 3307 | nmdc:mga08y16_62681_c1 | |||
| 3308 | nmdc:mga08y16_65537_c1 | |||
| 3309 | Ga0495619_0116661 | |||
| 3310 | Ga0500578_0000001 | |||
| 3311 | Ga0500578_0000065 | |||
| 3312 | Ga0500578_0021415 | |||
| 3313 | Ga0500644_0000078 | |||
| 3314 | Ga0500646_0001488 | |||
| 3315 | Ga0500583_0000013 | |||
| 3316 | Ga0500583_0000083 | |||
| 3317 | Ga0500583_0001261 | |||
| 3318 | Ga0500583_0051084 | |||
| 3319 | Ga0500641_0000012 | |||
| 3320 | Ga0500558_074059 | |||
| 3321 | Ga0500562_000003 | |||
| 3322 | Ga0500569_000269 | |||
| 3323 | Ga0500608_000802 | |||
| 3324 | Ga0500608_009290 | |||
| 3325 | Ga0500618_000290 | |||
| 3326 | Ga0500621_000001 | |||
| 3327 | Ga0500658_0000005 | |||
| 3328 | Ga0500658_0000043 | |||
| 3329 | Ga0500658_0003731 | |||
| 3330 | Ga0500559_0000112 | |||
| 3331 | Ga0500559_0011531 | |||
| 3332 | Ga0500559_0014817 | |||
| 3333 | Ga0500568_0007556 | |||
| 3334 | Ga0500577_0002288 | |||
| 3335 | Ga0500586_000866 | |||
| 3336 | Ga0500588_0002345 | |||
| 3337 | Ga0500588_0007061 | |||
| 3338 | Ga0500616_0000075 | |||
| 3339 | Ga0500616_0036958 | |||
| 3340 | Ga0500622_0000066 | |||
| 3341 | Ga0500622_0000475 | |||
| 3342 | Ga0500622_0000546 | |||
| 3343 | Ga0500622_0000677 | |||
| 3344 | Ga0500622_0001523 | |||
| 3345 | Ga0500622_0002438 | |||
| 3346 | Ga0500622_0005953 | |||
| 3347 | Ga0500622_0021019 | |||
| 3348 | Ga0500622_0094691 | |||
| 3349 | Ga0500624_000479 | |||
| 3350 | Ga0500627_0089310 | |||
| 3351 | Ga0500633_0005708 | |||
| 3352 | Ga0500636_0017902 | |||
| 3353 | Ga0500637_0018077 | |||
| 3354 | Ga0500637_0031875 | |||
| 3355 | Ga0500584_001081 | |||
| 3356 | Ga0500611_000094 | |||
| 3357 | Ga0500645_020539 | |||
| 3358 | Ga0500661_010982 | |||
| 3359 | Ga0466962_0006890 | |||
| 3360 | Ga0466962_0007818 | |||
| 3361 | 2932088224 | |||
| 3362 | 2506580849 | |||
| 3363 | 2506585988 | |||
| 3364 | 2508854656 | |||
| 3365 | 2511125239 | |||
| 3366 | 2511379307 | |||
| 3367 | 2511436175 | |||
| 3368 | 2547698305 | |||
| 3369 | 2548648108 | |||
| 3370 | 2562464823 | |||
| 3371 | 2585152119 | |||
| 3372 | 2585194397 | |||
| 3373 | 2586208182 | |||
| 3374 | 2599411825 | |||
| 3375 | 2599480972 | |||
| 3376 | 2599927203 | |||
| 3377 | 2600198675 | |||
| 3378 | 2600401392 | |||
| 3379 | 2601524502 | |||
| 3380 | 2601529656 | |||
| 3381 | 2601534694 | |||
| 3382 | 2601539279 | |||
| 3383 | 2601616490 | |||
| 3384 | 2601621212 | |||
| 3385 | 2601646191 | |||
| 3386 | 2601649609 | |||
| 3387 | 2601654536 | |||
| 3388 | 2601660190 | |||
| 3389 | 2601664305 | |||
| 3390 | 2601699121 | |||
| 3391 | 2601702530 | |||
| 3392 | 2601707280 | |||
| 3393 | 2601712301 | |||
| 3394 | 2601717797 | |||
| 3395 | 2601723033 | |||
| 3396 | 2601727725 | |||
| 3397 | 2601732742 | |||
| 3398 | 2601737489 | |||
| 3399 | 2601741908 | |||
| 3400 | 2601752806 | |||
| 3401 | 2601757628 | |||
| 3402 | 2601763987 | |||
| 3403 | 2602021768 | |||
| 3404 | 2603640335 | |||
| 3405 | 2603645984 | |||
| 3406 | 2603662469 | |||
| 3407 | 2603667365 | |||
| 3408 | 2603701762 | |||
| 3409 | 2603706421 | |||
| 3410 | 2603840151 | |||
| 3411 | 2603845228 | |||
| 3412 | 2603850301 | |||
| 3413 | 2603855369 | |||
| 3414 | 2603868365 | |||
| 3415 | 2603873183 | |||
| 3416 | 2603878176 | |||
| 3417 | 2606050130 | |||
| 3418 | 2606071794 | |||
| 3419 | 2606147813 | |||
| 3420 | 2606178252 | |||
| 3421 | 2608668621 | |||
| 3422 | 2609911247 | |||
| 3423 | 2637222953 | |||
| 3424 | 2643801201 | |||
| 3425 | 2644008708 | |||
| 3426 | 2644012756 | |||
| 3427 | 2644370447 | |||
| 3428 | 2644471807 | |||
| 3429 | 2644641775 | |||
| 3430 | 2644682108 | |||
| 3431 | 2650897646 | |||
| 3432 | 2656276689 | |||
| 3433 | 2671105268 | |||
| 3434 | 2676408767 | |||
| 3435 | 2681998904 | |||
| 3436 | 2682009644 | |||
| 3437 | 2686352542 | |||
| 3438 | 2689447405 | |||
| 3439 | 2707100922 | |||
| 3440 | 2722729328 | |||
| 3441 | 2738713891 | |||
| 3442 | 2738731680 | |||
| 3443 | 2738735539 | |||
| 3444 | 2738756502 | |||
| 3445 | 2738768116 | |||
| 3446 | 2738855270 | |||
| 3447 | 2739217121 | |||
| 3448 | 2739589307 | |||
| 3449 | 2739617702 | |||
| 3450 | 2739648453 | |||
| 3451 | 2740001760 | |||
| 3452 | 2740003712 | |||
| 3453 | 2740006576 | |||
| 3454 | 2740008529 | |||
| 3455 | 2753857927 | |||
| 3456 | 2765591058 | |||
| 3457 | 2772441213 | |||
| 3458 | 2777021292 | |||
| 3459 | 2792311203 | |||
| 3460 | 2793403654 | |||
| 3461 | 2802655062 | |||
| 3462 | 2807180286 | |||
| 3463 | 2809124742 | |||
| 3464 | 2813726581 | |||
| 3465 | 2814693953 | |||
| 3466 | 2819546719 | |||
| 3467 | 2819548959 | |||
| 3468 | 2819677715 | |||
| 3469 | 2821141812 | |||
| 3470 | 2823378178 | |||
| 3471 | 2842715397 | |||
| 3472 | 2842723825 | |||
| 3473 | 2842725467 | |||
| 3474 | 2842908894 | |||
| 3475 | 2842910337 | |||
| 3476 | 2842912746 | |||
| 3477 | 2844429430 | |||
| 3478 | 2844532101 | |||
| 3479 | 2847800780 | |||
| 3480 | 2849282034 | |||
| 3481 | 2852625838 | |||
| 3482 | 2854603326 | |||
| 3483 | 2855195947 | |||
| 3484 | 2857559223 | |||
| 3485 | 2857567031 | |||
| 3486 | 2857620826 | |||
| 3487 | 2857622380 | |||
| 3488 | 2857631743 | |||
| 3489 | 2865017802 | |||
| 3490 | 2869556838 | |||
| 3491 | 2871286344 | |||
| 3492 | 2876602791 | |||
| 3493 | 2881361078 | |||
| 3494 | 2881614088 | |||
| 3495 | 2883072422 | |||
| 3496 | 2884086821 | |||
| 3497 | 2884637941 | |||
| 3498 | 2884794559 | |||
| 3499 | 2884797658 | |||
| 3500 | 2884935634 | |||
| 3501 | 2888371337 | |||
| 3502 | 2896114998 | |||
| 3503 | 2896318303 | |||
| 3504 | 2904425866 | |||
| 3505 | 2904445327 | |||
| 3506 | 2904446890 | |||
| 3507 | 2904469773 | |||
| 3508 | 2904508258 | |||
| 3509 | 2904517953 | |||
| 3510 | 2904780994 | |||
| 3511 | 2910248856 | |||
| 3512 | 2911141532 | |||
| 3513 | 2914763139 | |||
| 3514 | 2919180542 | |||
| 3515 | 2919194710 | |||
| 3516 | 2919195084 | |||
| 3517 | 2919442701 | |||
| 3518 | 2919686630 | |||
| 3519 | 2919693833 | |||
| 3520 | 2923636967 | |||
| 3521 | 2927836603 | |||
| 3522 | 2928080884 | |||
| 3523 | 2928150209 | |||
| 3524 | 2928521664 | |||
| 3525 | 2929150922 | |||
| 3526 | 2929183293 | |||
| 3527 | 2929245409 | |||
| 3528 | 2929926121 | |||
| 3529 | 2932409353 | |||
| 3530 | 2935628814 | |||
| 3531 | 2937540172 | |||
| 3532 | 2937968881 | |||
| 3533 | 2939576739 | |||
| 3534 | 2939581142 | |||
| 3535 | 2939602955 | |||
| 3536 | 2939620708 | |||
| 3537 | 2945875623 | |||
| 3538 | 2945953877 | |||
| 3539 | 2945979253 | |||
| 3540 | 2945999751 | |||
| 3541 | 2946002447 | |||
| 3542 | 2946014876 | |||
| 3543 | 2954017567 | |||
| 3544 | 2954019333 | |||
| 3545 | 2969079980 | |||
| 3546 | 2974314709 | |||
| 3547 | 2974440493 | |||
| 3548 | 2978976368 | |||
| 3549 | 2984495760 | |||
| 3550 | 2984562434 | |||
| 3551 | 2984600492 | |||
| 3552 | 2990265447 | |||
| 3553 | 640940217 | |||
| 3554 | 8003151862 | |||
| 3555 | 8004593997 | |||
| 3556 | 8007371409 | |||
| 3557 | 8015395176 | |||
| 3558 | 8016736785 | |||
| 3559 | 8018222442 | |||
| 3560 | 8018408926 | |||
| 3561 | 8019502018 | |||
| 3562 | 8019507336 | |||
| 3563 | 8047675401 | |||
| 3564 | 8054307940 | |||
| 3565 | 8055590297 | |||
| 3566 | 8055597190 | |||
| 3567 | 8056442408 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4f35-assembly2.cif.gz_B | crystal structure of a bacterial dicarboxylate/sodium symporter | 0.642 | 8 | 360 |
| 4r0c-assembly1.cif.gz_B | crystal structure of the alcanivorax borkumensis ydah transporter reveals an unusual topology | 0.6034 | 11 | 373 |
| 6ol0-assembly2.cif.gz_B | structure of vcindy bound to malate | 0.5988 | 8 | 360 |
| 7qha-assembly1.cif.gz_B | cryo-em structure of the tripartite atp-independent periplasmic (trap) transporter siaqm from photobacterium profundum in amphipol | 0.5911 | 4 | 374 |
| 4r0c-assembly1.cif.gz_B | crystal structure of the alcanivorax borkumensis ydah transporter reveals an unusual topology | 0.5856 | 11 | 373 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_I6YCG9_3_406_1.20.1530.20 | Mainly Alpha;Up-down Bundle;Na+/H+ antiporter like fold; | 0.6106 | 10 | 375 | 1.20.1530.20 |
| af_I6YCG9_3_406_1.20.1530.20 | Mainly Alpha;Up-down Bundle;Na+/H+ antiporter like fold; | 0.5952 | 10 | 375 | 1.20.1530.20 |
| af_P0CE94_1155_1278_1.20.1420.10 | Mainly Alpha;Up-down Bundle;A middle domain of Talin 1;Talin, central domain | 0.3701 | 196 | 291 | 1.20.1420.10 |
| af_A0A0R4IIA7_1847_1972_1.20.120.230 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Alpha-catenin/vinculin-like | 0.3527 | 101 | 263 | 1.20.120.230 |
| af_A0A0R4IIA7_1847_1972_1.20.120.230 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Alpha-catenin/vinculin-like | 0.3371 | 101 | 263 | 1.20.120.230 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7X2MN99-F1-model_v4 | Gluconate transporter | 0.966 | 3 | 293 |
GO:0005886
GO:0015128 |
| AF-A0A6M1HS67-F1-model_v4 | deleted | 0.9578 | 75 | 276 |
|
| AF-A0A3S4ICG4-F1-model_v4 | deleted | 0.957 | 3 | 291 |
|
| AF-A0A5W9WTU6-F1-model_v4 | Gluconate permease | 0.9529 | 3 | 263 |
GO:0005886
GO:0015128 GO:0015568 |
| AF-A0A7Y2UEX4-F1-model_v4 | deleted | 0.9512 | 3 | 189 |
|