F495696

General Info

Members Datasets Scaffolds Average Seq Length
1785 649 3567 408

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2932082852|2932088224
Length 479
Sequence GYQSFYHIKILNSNFVITLVGISRCPILRLHARWPHITYNLMVLLTIFFCIVLLVLLVSLVKINPFIAFLIVSIIAGLLLGIPINKVTASVQKGMGDILGQLLIIICLGAMLGKLVAVSGAAQKIAGVLVAAVGEKYIQWALVAAGFIIGIPLFYGIGFVLMVPLIFSVVYKYKLPAVYIGLPMLASLSVTHGFLPPHPSPSALVALFHANMATTFIYGLMIAIPAIILAGPVFAQFLKKIPSEPLATFRAEELPAEKLPGAFNSFFTALLPVLLLMLTAFFPYLNIQDPGVAKFITFLGDPSIVMLIALMVATYTLGVKQGKSMGQLAGNFTDAVKDVALILLIIAGSGAFKEVLTASGVSSQIAAQLQSFNLPPLLLGWVIAAIIRVSLGSATVAGLTAAGIVAPLVLQNHINPNLMVLSIGAGSLAFSHVNDSGFWLYKEYFNLSIKDTIKSWSLMETLVSVIGLAGVTVINLFIK

Samples

Sample ID Description Type Environment
1 2010549000 Rice roots microbial communities from plants at IRRI, Los Banos, Philippines - endophytes Metagenome Endosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
8 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
9 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
10 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
11 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
12 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
13 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
14 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
15 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
16 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
17 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
18 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
19 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
20 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
21 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
22 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
23 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
24 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
25 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
26 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
27 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
28 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
29 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
30 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
31 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
32 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
33 3300005272 Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 Metagenome Rhizosphere
34 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
35 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
36 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
37 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
38 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
39 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
40 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
41 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
42 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
43 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
44 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
45 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
46 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
47 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
48 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
49 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
50 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
51 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
52 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
53 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
54 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
55 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
56 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
57 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
58 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
59 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
60 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
61 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
62 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
63 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
64 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
65 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
66 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
67 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
68 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
69 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
70 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
71 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
72 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
73 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
74 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
75 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
76 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
77 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
78 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
79 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
80 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
81 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
82 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
83 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
84 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
85 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
86 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
87 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
88 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
89 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
90 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
91 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
92 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
93 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
94 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
95 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
96 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
97 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
98 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
99 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
100 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
101 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
102 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
103 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
104 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
105 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
106 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
107 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
108 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
109 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
110 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
111 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
112 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
113 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
114 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
115 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
116 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
117 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
118 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
119 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
120 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
121 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
122 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
123 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
124 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
125 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
126 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
127 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
128 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
129 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
130 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
131 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
132 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
133 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
134 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
135 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
136 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
137 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
138 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
139 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
140 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
141 3300015679 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.4_F08 Metagenome Unclassified
142 3300015680 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.2_H03 Metagenome Rhizosphere
143 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
144 3300015684 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.2_F02 Metagenome Unclassified
145 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
146 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
147 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
148 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
149 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
150 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
151 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
152 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
153 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
154 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
155 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
156 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
157 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
158 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
159 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
160 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
161 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
162 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
163 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
164 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
165 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
166 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
167 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
168 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
169 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
170 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
171 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
172 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
173 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
174 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
175 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
231 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
234 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
235 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
236 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
237 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
239 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
240 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
241 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
242 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
243 3300030083 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JPPOOL-T1 Metagenome Unclassified
244 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
245 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
246 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
247 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
248 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
249 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
250 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
251 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
252 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
253 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
254 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
255 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
256 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
257 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
258 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
259 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
260 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
261 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
262 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
263 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
264 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
265 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
266 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
267 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
268 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
269 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
270 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
271 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
272 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
273 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
274 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
275 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
276 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
277 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
278 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
279 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
280 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
281 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
282 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
283 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
284 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
285 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
286 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
287 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
288 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
289 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
290 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
291 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
292 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
293 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
294 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
295 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
296 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
297 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
298 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
299 3300044669 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2E Metagenome Unclassified
300 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
301 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
302 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
303 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
304 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
305 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
306 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
307 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
308 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
309 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
310 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
311 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
312 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
313 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
314 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
315 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
316 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
317 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
318 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
319 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
320 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
321 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
322 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
323 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
324 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
325 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
326 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
327 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
328 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
329 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
330 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
331 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
332 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
333 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
334 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
335 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
336 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
337 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
338 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
339 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
340 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
341 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
342 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
343 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
344 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
345 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
346 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
347 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
348 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
349 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
350 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
351 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
352 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
353 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
354 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
355 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
356 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
357 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
358 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
359 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
360 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
361 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
362 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
363 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
364 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
365 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
366 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
367 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
368 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
369 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
370 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
371 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
372 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
373 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
374 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
375 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
376 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
377 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
378 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
379 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
380 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
381 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
382 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
383 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
384 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
385 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
386 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
387 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
388 3300049133 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
389 3300049134 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
390 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
391 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
392 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
393 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
394 3300049550 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
395 3300049552 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
396 3300049556 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
397 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
398 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
399 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
400 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
401 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
402 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
403 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
404 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
405 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
406 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
407 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
408 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
409 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
410 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
411 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
412 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
413 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
414 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
415 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
416 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
417 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
418 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
419 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
420 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
421 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
422 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
423 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
424 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
425 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
426 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
427 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
428 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
429 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
430 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
431 3300053106 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 endosphere Metagenome Endosphere
432 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
433 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
434 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
435 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
436 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
437 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
438 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
439 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
440 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
441 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
442 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
443 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
444 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
445 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
446 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
447 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
448 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
449 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
450 3300053726 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 endosphere Metagenome Endosphere
451 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
452 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
453 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
454 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
455 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
456 2506520007 Serratia plymuthica AS9 Isolate Rhizosphere
457 2506520008 Serratia plymuthica AS12 Isolate Unclassified
458 2508501071 Serratia proteamaculans S4 Isolate Rhizosphere
459 2510917020 Caulobacter sp. AP07 Isolate Rhizosphere
460 2511231025 Pantoea sp. YR343 Isolate Rhizosphere
461 2511231035 Pantoea sp. GM01 Isolate Rhizosphere
462 2547132181 Kosakonia sacchari SP1 Isolate Stem
463 2547132416 Enterobacter sp. MR1 Isolate Rhizoplane
464 2561511199 Enterobacter sp. R4-368 Isolate Nodule
465 2582581280 Caulobacter henricii CF287 Isolate Rhizosphere
466 2582581293 Caulobacter henricii YR570 Isolate Rhizosphere
467 2585427687 Pedobacter borealis DSM 19626 Isolate Rhizosphere
468 2599185169 Klebsiella quasipneumoniae NFPP35 Isolate Rhizoplane
469 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
470 2599185299 Pantoea ananatis NFR11 Isolate Rhizoplane
471 2599185353 Staphylococcus sp. NFPP34 Isolate Rhizoplane
472 2600254943 Staphylococcus pasteuri NFIX07 Isolate Rhizoplane
473 2600255254 Klebsiella quasipneumoniae NFIX15 Isolate Rhizoplane
474 2600255255 Klebsiella quasipneumoniae NFIX23 Isolate Rhizoplane
475 2600255256 Enterobacter sp. NFIX08 Isolate Rhizoplane
476 2600255257 Enterobacter sp. NFIX03 Isolate Rhizoplane
477 2600255280 Klebsiella quasipneumoniae NFIX42 Isolate Rhizoplane
478 2600255281 Klebsiella quasipneumoniae NFIX43 Isolate Rhizoplane
479 2600255287 Klebsiella quasipneumoniae NFIX11 Isolate Rhizoplane
480 2600255288 Klebsiella quasipneumoniae NFIX14 Isolate Rhizoplane
481 2600255289 Klebsiella quasipneumoniae NFIX16 Isolate Rhizoplane
482 2600255290 Klebsiella quasipneumoniae NFIX17 Isolate Rhizoplane
483 2600255291 Klebsiella quasipneumoniae NFIX19 Isolate Rhizoplane
484 2600255298 Klebsiella quasipneumoniae NFIX21 Isolate Rhizoplane
485 2600255299 Klebsiella quasipneumoniae NFIX22 Isolate Rhizoplane
486 2600255300 Klebsiella quasipneumoniae NFIX30 Isolate Rhizoplane
487 2600255301 Klebsiella quasipneumoniae NFIX33 Isolate Rhizoplane
488 2600255302 Klebsiella quasipneumoniae NFIX35 Isolate Rhizoplane
489 2600255303 Klebsiella quasipneumoniae NFIX36 Isolate Rhizoplane
490 2600255304 Klebsiella quasipneumoniae NFIX37 Isolate Rhizoplane
491 2600255305 Klebsiella quasipneumoniae NFIX41 Isolate Rhizoplane
492 2600255306 Klebsiella quasipneumoniae NFIX44 Isolate Rhizoplane
493 2600255307 Klebsiella quasipneumoniae NFIX56 Isolate Rhizoplane
494 2600255309 Klebsiella sp. NFIX53 Isolate Rhizoplane
495 2600255310 Enterobacter sp. NFIX06 Isolate Rhizoplane
496 2600255311 Enterobacter sp. NFIX04 Isolate Rhizoplane
497 2600255392 Klebsiella quasipneumoniae NFIX54 Isolate Rhizoplane
498 2602042046 Enterobacter sp. NFIX09 Isolate Rhizoplane
499 2602042047 Enterobacter sp. NFIX59 Isolate Rhizoplane
500 2602042052 Klebsiella quasipneumoniae NFIX18 Isolate Rhizoplane
501 2602042053 Klebsiella quasipneumoniae NFIX12 Isolate Rhizoplane
502 2602042066 Enterobacter sp. NFIX45 Isolate Rhizoplane
503 2602042067 Enterobacter sp. NFIX58 Isolate Rhizoplane
504 2602042103 Klebsiella quasipneumoniae NFIX29 Isolate Rhizoplane
505 2602042104 Klebsiella quasipneumoniae NFIX26 Isolate Rhizoplane
506 2602042105 Klebsiella quasipneumoniae NFIX25 Isolate Rhizoplane
507 2602042106 Klebsiella quasipneumoniae NFIX13 Isolate Rhizoplane
508 2602042109 Klebsiella aerogenes NFIX39 Isolate Rhizoplane
509 2602042110 Klebsiella quasipneumoniae NFIX40 Isolate Rhizoplane
510 2602042111 Klebsiella quasipneumoniae NFIX20 Isolate Rhizoplane
511 2603880178 Klebsiella quasipneumoniae NFIX34 Isolate Rhizoplane
512 2603880184 Klebsiella quasipneumoniae NFIX27 Isolate Rhizoplane
513 2603880202 Klebsiella quasipneumoniae NFIX38 Isolate Rhizoplane
514 2603880211 Klebsiella quasipneumoniae NFIX24 Isolate Rhizoplane
515 2608642108 Pantoea agglomerans NFPP29 Isolate Rhizoplane
516 2609459761 Enterobacter sp. NFR05 Isolate Rhizoplane
517 2636415599 Klebsiella variicola DX120E Isolate Unclassified
518 2643221556 Massilia sp. Root1485 Isolate Unclassified
519 2643221600 Flavobacterium sp. Root186 Isolate Unclassified
520 2643221667 Flavobacterium sp. Root420 Isolate Unclassified
521 2643221684 Massilia sp. Root133 Isolate Unclassified
522 2643221716 Flavobacterium sp. Root901 Isolate Unclassified
523 2643221725 Flavobacterium sp. Root935 Isolate Unclassified
524 2648501693 Pantoea ananatis B1-9 Isolate Rhizosphere
525 2654587920 Serratia plymuthica HRO-C48 Isolate Rhizosphere
526 2667528172 Enterobacteriaceae bacterium NFIX31 Isolate Rhizoplane
527 2675903046 Klebsiella quasipneumoniae NFIX52 Isolate Rhizoplane
528 2681812866 Enterobacter asburiae NFIX55 Isolate Rhizoplane
529 2681812869 Enterobacter ludwigii NFPP41 Isolate Rhizoplane
530 2684622997 Pantoea ananatis NFIX48 Isolate Rhizoplane
531 2687453601 Serratia plymuthica 3Rp8 Isolate Unclassified
532 2706794495 Dickeya zeae ZJU1202 Isolate Unclassified
533 2721755487 Sphingobacterium sp. B29 Isolate Rhizosphere
534 2738541276 Cellvibrio sp. YR554 Isolate Unclassified
535 2738541278 Niastella sp. CF465 Isolate Unclassified
536 2738541279 Flavobacterium sp. GV069 Isolate Unclassified
537 2738541283 Pedobacter sp. OK701 Isolate Unclassified
538 2738541285 Flavobacterium sp. GV030 Isolate Unclassified
539 2738541302 Pedobacter sp. CF074 Isolate Unclassified
540 2738543007 Flavobacterium sp. GV063 Isolate Unclassified
541 2739367651 Pedobacter sp. OK291 Isolate Unclassified
542 2739367656 Pedobacter sp. CF523 Isolate Unclassified
543 2739367663 Pedobacter sp. YR510 Isolate Unclassified
544 2739367857 Flavobacterium sp. GV029 Isolate Unclassified
545 2739367858 Flavobacterium sp. GV028 Isolate Unclassified
546 2751185917 Enterobacter sp. HK169 Isolate Unclassified
547 2765235842 Enterobacter ludwigii AA4 Isolate Unclassified
548 2772190666 Serratia surfactantfaciens YD25 Isolate Unclassified
549 2775507074 Klebsiella sp. D5A Isolate Unclassified
550 2791355010 Kosakonia pseudosacchari NN143 Isolate Unclassified
551 2791355275 Enterobacter sp. Sa187 Isolate Unclassified
552 2802428842 Flavobacterium sp. S87F.05.LMB.W.Kidney.N Isolate Unclassified
553 2806310673 Serratia quinivorans NCTC 13189 Isolate Rhizosphere
554 2808606414 Pantoea sp. SJZ147 Isolate Rhizosphere
555 2811995292 Kosakonia oryzae Ola 51 Isolate Unclassified
556 2814123068 Kosakonia radicincitans GXGL-4A Isolate Rhizosphere
557 2818991437 Pedobacter terrae 518 Isolate Unclassified
558 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
559 2821136567 Chitinophaga sancti 1232 Isolate Unclassified
560 2823373977 Enterobacter ludwigii NCR3 Isolate Rhizosphere
561 2842711865 Duganella sp. R-73148 Isolate Unclassified
562 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
563 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
564 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
565 2844425489 Enterobacter cloacae SBP-8 Isolate Rhizosphere
566 2844528606 Pantoea sp. R-72498 v. 2 Isolate Unclassified
567 2847797336 Pantoea ananatis NN08200 Isolate Unclassified
568 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
569 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
570 2854601825 Dickeya dianthicola SS70 Isolate Stem Tuber
571 2855195626 Pectobacterium atrosepticum SS26 Isolate Stem Tuber
572 2857558681 Duganella sp. R-74565 Isolate Unclassified
573 2857564685 Duganella sp. R-74599 Isolate Unclassified
574 2857618242 Flavobacterium sp. R-74482 Isolate Unclassified
575 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
576 2865014394 Pantoea sp. R-71966 Isolate Unclassified
577 2869551831 Serratia inhibens PRI-2C Isolate Rhizosphere
578 2871282230 Pectobacterium parmentieri SS90 Isolate Stem Tuber
579 2876601092 Pantoea endophytica 596 Isolate Unclassified
580 2881359912 Flavobacterium ustbae T13 Isolate Rhizosphere
581 2881609920 Pantoea sp. ARC607 Isolate Rhizosphere
582 2883068021 Chitinophaga rhizosphaerae T16R-86 Isolate Rhizosphere
583 2884086401 Kluyvera sp. PO2S7 Isolate Rhizosphere
584 2884634485 Algoriphagus kandeliae XY-J91 Isolate Unclassified
585 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
586 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
587 2888366609 Serratia sp. NGAS9 Isolate Rhizosphere
588 2896109856 Chitinophaga sp. SYP-B3965 Isolate Rhizosphere
589 2896317667 Sphingobacterium sp. SGR-19 Isolate Rhizosphere
590 2904424332 Duganella sp. 1411 Isolate Rhizosphere
591 2904445276 Pedobacter terrae 1734 Isolate Rhizosphere
592 2904467357 Chitinophaga sancti 3198 Isolate Unclassified
593 2904504865 Serratia marcescens 1822 Isolate Unclassified
594 2904513164 Klebsiella variicola 1431 Isolate Rhizosphere
595 2904780799 Sphingobacterium sp. 1304 Isolate Rhizosphere
596 2910245624 Adhaeribacter radiodurans KUDC8001 Isolate Rhizosphere
597 2911138879 Spirosoma sp. KUDC1026 Isolate Rhizosphere
598 2914759650 Rhizosphaericola mali Isolate Rhizosphere
599 2919177583 Sphingobacterium sp. 2149 Isolate Rhizosphere
600 2919191525 Flavobacterium sp. 2755 Isolate Rhizosphere
601 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
602 2919683626 Flavobacterium piscis 4129 Isolate Unclassified
603 2919692658 Algoriphagus sp. 4150 Isolate Rhizosphere
604 2923634449 Enterobacter kobei SLBN-76 Isolate Rhizosphere
605 2927833300 Enterobacter sp. SLBN-59 Isolate Rhizosphere
606 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
607 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
608 2928519762 Leuconostoc citreum 1377 Isolate Rhizosphere
609 2929150217 Flavobacterium sp. R-74510 Hybrid assembly Isolate Unclassified
610 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
611 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
612 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
613 2932406140 Serratia sp. 2723 Isolate Rhizosphere
614 2935625433 Kosakonia sp. 1610 Isolate Rhizosphere
615 2937539931 Pantoea sp. LS15 Isolate Unclassified
616 2937967321 Serratia sp. YC16 Isolate Unclassified
617 2939573065 Citrobacter sp. 506 Isolate Rhizosphere
618 2939577877 Serratia sp. 509 Isolate Rhizosphere
619 2939602548 Pantoea dispersa 1175 Isolate Rhizosphere
620 2939617950 Kosakonia cowanii 2056 Isolate Rhizosphere
621 2945874760 Phytobacter diazotrophicus UAEU22 Isolate Rhizosphere
622 2945951305 Pantoea agglomerans W2I1 Isolate Rhizosphere
623 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
624 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
625 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere
626 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
627 2969079654 Klebsiella variicola E57-7 Isolate Unclassified
628 2974310843 Enterobacter sp. SORGH_AS 287 Isolate Unclassified
629 2974435778 Kosakonia cowanii SORGH_AS 304 Isolate Unclassified
630 2978975091 Pantoea anthophila SORGH_AS 797 Isolate Unclassified
631 2984494565 Pantoea ananatis SORGH_AS197 Isolate Aerial Root
632 2984559226 Klebsiella variicola SORGH_AS834 Isolate Aerial Root
633 2984595703 Klebsiella variicola SORGH_AS1070 Isolate Aerial Root
634 2990261002 Pantoea ananatis SORGH_AS213 Isolate Aerial Root
635 640753048 Serratia proteamaculans 568 Isolate Endosphere
636 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified
637 8004592986 Serratia sp. S119 Isolate Unclassified
638 8007371054 Clostridium sp. YIM B02515 Isolate Unclassified
639 8015394850 Serratia sp. PGPR-27 Isolate Rhizosphere
640 8016733728 Pantoea sp. SORGH_AS 659 Isolate Unclassified
641 8018221730 Enterobacter sp. CM29 Isolate Unclassified
642 8018405270 Enterobacter sp. 198 Isolate Rhizosphere
643 8019499862 Kluyvera sp. 1366 Isolate Rhizosphere
644 8019504834 Atlantibacter hermannii 1903 Isolate Rhizosphere
645 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere
646 8054307821 Flavobacterium soyae SCIV07 Isolate Rhizosphere
647 8055588893 Parapedobacter lycopersici KACC 18788 Isolate Rhizosphere
648 8055592153 Flavobacterium panacis DCY106 Isolate Rhizosphere
649 8056440228 Flavobacterium hibisci THG-HG1.4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 88.01
Metatranscriptomes 0.39
Isolates 11.6

Biome Distribution

Category Percentage (%)
Aerial Root 0.22
Bulb 0
Endosphere 7.62
Nodule 1.34
Rhizoplane 4.15
Rhizosphere 71.99
Stem 0.06
Stem Tuber 0.17
Unclassified 3.08

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 RicEn_C3870 2010549000 Bacteria 1571
2 SwRhRL2b_contig_631140 2162886007 Bacteria 2668
3 MBSR1b_contig_5928364 2162886012 Bacteria 2176
4 JGI24740J21852_10003107 3300001979 Bacteria 7325
5 JGI24740J21852_10012470 3300001979 Bacteria 3201
6 JGI24737J22298_10031040 3300001990 Bacteria 1670
7 JGI24735J21928_10000028 3300002067 Bacteria 83192
8 JGI24735J21928_10005158 3300002067 Bacteria 4349
9 JGI24735J21928_10008798 3300002067 Bacteria 3257
10 JGI24735J21928_10019190 3300002067 Bacteria 2103
11 JGI24738J21930_10003820 3300002075 Bacteria 3763
12 JGI25162J39368_1000047 3300002737 Viruses 167507
13 JGI25162J39368_1000183 3300002737 Bacteria 67086
14 JGI25162J39368_1000496 3300002737 Bacteria 29876
15 JGI25154J39366_1000080 3300002738 Bacteria 89374
16 JGI25152J39213_1000513 3300002773 Bacteria 21560
17 JGI25150J39212_1000008 3300002774 Bacteria 253098
18 JGI25151J46595_10000014 3300003187 Bacteria 253098
19 JGI25151J46595_10000887 3300003187 Bacteria 23572
20 JGI25151J46595_10002451 3300003187 Bacteria 11134
21 JGI25151J46595_10005962 3300003187 Bacteria 6209
22 JGI25165J46597_1000043 3300003214 Bacteria 264515
23 JGI25165J46597_1000802 3300003214 Bacteria 23746
24 JGI25153J46596_10000020 3300003215 Bacteria 252978
25 JGI25153J46596_10002621 3300003215 Bacteria 10289
26 rootH1_10000810 3300003316 Bacteria 14027
27 rootH1_10002962 3300003316 Bacteria 28463
28 rootH1_10036744 3300003316 Bacteria 7438
29 rootH1_10055138 3300003316 Bacteria 12061
30 rootH2_10000230 3300003320 Bacteria 58157
31 rootH2_10003679 3300003320 Bacteria 27278
32 rootH2_10011814 3300003320 Bacteria 7172
33 rootH2_10013605 3300003320 Bacteria 52813
34 rootH2_10024296 3300003320 Bacteria 9925
35 rootH2_10051442 3300003320 Bacteria 9098
36 rootH2_10056661 3300003320 Bacteria 4153
37 rootH2_10071853 3300003320 Bacteria 2648
38 rootH2_10118897 3300003320 Bacteria 5944
39 rootH2_10123222 3300003320 Bacteria 2334
40 rootH2_10141248 3300003320 Bacteria 5566
41 rootH2_10161859 3300003320 Bacteria 1622
42 rootL2_10027207 3300003322 Bacteria 1957
43 rootL2_10054875 3300003322 Unclassified 3038
44 rootL2_10067288 3300003322 Bacteria 5234
45 rootL2_10070945 3300003322 Bacteria 5850
46 rootL2_10127765 3300003322 Bacteria 6430
47 rootL2_10154743 3300003322 Bacteria 3057
48 rootL2_10200472 3300003322 Bacteria 5412
49 rootH1_10000727 3300003316 Bacteria 46114
50 rootH1_10000727 3300003323 Bacteria 5388
51 rootH1_10003785 3300003323 Bacteria 131157
52 rootH1_10018881 3300003323 Bacteria 66058
53 rootH1_10034687 3300003323 Bacteria 4802
54 rootH1_10040702 3300003323 Bacteria 5264
55 rootH1_10047799 3300003323 Bacteria 17409
56 rootH1_10051913 3300003323 Bacteria 15080
57 rootH1_10060101 3300003323 Bacteria 3840
58 rootH1_10104912 3300003323 Bacteria 6713
59 rootH1_10109702 3300003323 Bacteria 4605
60 rootH1_10119890 3300003323 Bacteria 1483
61 rootH1_10178156 3300003323 Bacteria 4609
62 rootH1_10198885 3300003323 Bacteria 2889
63 rootH1_10228699 3300003323 Bacteria 4590
64 rootH1_10367847 3300003323 Bacteria 2971
65 JGI25160J50197_1001583 3300003354 Bacteria 11221
66 JGI25160J50197_1001791 3300003354 Bacteria 10388
67 Ga0006562J51391_1029369 3300003578 Bacteria 1830
68 Ga0055532_1000238 3300003758 Bacteria 40402
69 Ga0055525_1000028 3300003759 Bacteria 331683
70 Ga0055542_1007574 3300003762 Bacteria 2194
71 Ga0055526_1000131 3300003771 Bacteria 66529
72 Ga0055537_1000100 3300003773 Bacteria 64929
73 Ga0055536_1000036 3300003781 Bacteria 141730
74 Ga0055536_1005098 3300003781 Bacteria 6514
75 Ga0055534_1000085 3300003784 Bacteria 72934
76 Ga0055528_1000458 3300003790 Bacteria 32517
77 Ga0055530_10001821 3300003791 Bacteria 14730
78 Ga0055531_10000015 3300003794 Bacteria 182104
79 Ga0055531_10000132 3300003794 Bacteria 85251
80 Ga0058692_1000146 3300003856 Bacteria 44864
81 Ga0058692_1000443 3300003856 Bacteria 18845
82 Ga0058692_1001071 3300003856 Bacteria 10687
83 Ga0065165_1004837 3300005262 Bacteria 8009
84 Ga0065165_1015046 3300005262 Bacteria 2968
85 Ga0065703_1018789 3300005272 Bacteria 7950
86 Ga0065714_10003442 3300005288 Bacteria 8456
87 Ga0065714_10005093 3300005288 Bacteria 4170
88 Ga0065714_10064423 3300005288 Bacteria 257266
89 Ga0065704_10000577 3300005289 Bacteria 18026
90 Ga0065704_10071197 3300005289 Bacteria 12576
91 Ga0065704_10071631 3300005289 Bacteria 10443
92 Ga0065704_10101511 3300005289 Bacteria 2235
93 Ga0065715_10012402 3300005293 Bacteria 3201
94 Ga0065715_10134393 3300005293 Bacteria 1956
95 Ga0070658_10000014 3300005327 Bacteria 244978
96 Ga0070658_10000721 3300005327 Bacteria 28601
97 Ga0070658_10038243 3300005327 Bacteria 3870
98 Ga0070658_10043816 3300005327 Bacteria 3615
99 Ga0070658_10079035 3300005327 Bacteria 2701
100 Ga0070658_10226872 3300005327 Bacteria 1581
101 Ga0070676_10000207 3300005328 Bacteria 25090
102 Ga0070676_10000487 3300005328 Bacteria 18936
103 Ga0070676_10003430 3300005328 Bacteria 8260
104 Ga0070676_10009602 3300005328 Bacteria 5227
105 Ga0070676_10064499 3300005328 Unclassified 2184
106 Ga0070683_100000859 3300005329 Bacteria 22458
107 Ga0070683_100002782 3300005329 Bacteria 13982
108 Ga0070683_100014746 3300005329 Bacteria 6846
109 Ga0070683_100034878 3300005329 Bacteria 4598
110 Ga0070690_100008784 3300005330 Bacteria 5833
111 Ga0070690_100009170 3300005330 Bacteria 5725
112 Ga0070690_100139300 3300005330 Bacteria 1646
113 Ga0070670_100026107 3300005331 Bacteria 5028
114 Ga0070670_100046396 3300005331 Bacteria 3736
115 Ga0070670_100211792 3300005331 Bacteria 1685
116 Ga0070677_10002635 3300005333 Bacteria 5739
117 Ga0068869_100000107 3300005334 Bacteria 39252
118 Ga0068869_100013547 3300005334 Bacteria 5427
119 Ga0068869_100124699 3300005334 Bacteria 1974
120 Ga0070666_10000432 3300005335 Bacteria 25632
121 Ga0070666_10001827 3300005335 Bacteria 12978
122 Ga0070666_10001999 3300005335 Bacteria 12408
123 Ga0070666_10041185 3300005335 Unclassified 3085
124 Ga0070680_100000224 3300005336 Bacteria 37398
125 Ga0070680_100001771 3300005336 Bacteria 15858
126 Ga0070680_100019931 3300005336 Bacteria 5317
127 Ga0070682_100000299 3300005337 Bacteria 34539
128 Ga0070682_100012301 3300005337 Bacteria 4904
129 Ga0070682_100038149 3300005337 Bacteria 2945
130 Ga0068868_100000256 3300005338 Bacteria 36252
131 Ga0068868_100010309 3300005338 Bacteria 6760
132 Ga0068868_100011101 3300005338 Bacteria 6552
133 Ga0068868_100014519 3300005338 Bacteria 5806
134 Ga0070660_100006203 3300005339 Bacteria 8274
135 Ga0070660_100014661 3300005339 Bacteria 5654
136 Ga0070660_100020365 3300005339 Bacteria 4874
137 Ga0070660_100201502 3300005339 Bacteria 1614
138 Ga0070660_100212195 3300005339 Bacteria 1572
139 Ga0070689_100192319 3300005340 Bacteria 1662
140 Ga0070689_100200100 3300005340 Bacteria 1631
141 Ga0070691_10006501 3300005341 Bacteria 5346
142 Ga0070661_100006405 3300005344 Bacteria 8118
143 Ga0070661_100025950 3300005344 Bacteria 4211
144 Ga0070661_100040837 3300005344 Bacteria 3385
145 Ga0070668_100001216 3300005347 Bacteria 18285
146 Ga0070668_100030597 3300005347 Bacteria 4093
147 Ga0070668_100033130 3300005347 Bacteria 3933
148 Ga0070669_100006366 3300005353 Bacteria 8505
149 Ga0070669_100041267 3300005353 Unclassified 3356
150 Ga0070669_100177786 3300005353 Unclassified 1663
151 Ga0070675_100011184 3300005354 Bacteria 7022
152 Ga0070675_100014343 3300005354 Bacteria 6247
153 Ga0070675_100050928 3300005354 Bacteria 3401
154 Ga0070675_100064757 3300005354 Unclassified 3022
155 Ga0070675_100078505 3300005354 Bacteria 2749
156 Ga0070675_100189705 3300005354 Bacteria 1780
157 Ga0070671_100001192 3300005355 Bacteria 19490
158 Ga0070671_100001920 3300005355 Bacteria 15924
159 Ga0070671_100004338 3300005355 Bacteria 11224
160 Ga0070671_100005999 3300005355 Bacteria 9683
161 Ga0070671_100052400 3300005355 Bacteria 3393
162 Ga0070673_100000003 3300005364 Bacteria 216759
163 Ga0070673_100001023 3300005364 Bacteria 15833
164 Ga0070673_100011904 3300005364 Bacteria 5958
165 Ga0070673_100015606 3300005364 Bacteria 5342
166 Ga0070673_100034082 3300005364 Unclassified 3849
167 Ga0070673_100048651 3300005364 Bacteria 3307
168 Ga0070673_100069354 3300005364 Bacteria 2825
169 Ga0070673_100105555 3300005364 Unclassified 2327
170 Ga0070673_100134895 3300005364 Bacteria 2076
171 Ga0070673_100169830 3300005364 Bacteria 1861
172 Ga0070659_100003851 3300005366 Bacteria 10692
173 Ga0070659_100027076 3300005366 Bacteria 4414
174 Ga0070659_100031677 3300005366 Bacteria 4096
175 Ga0070659_100038542 3300005366 Bacteria 3728
176 Ga0070659_100078286 3300005366 Bacteria 2637
177 Ga0070667_100001236 3300005367 Bacteria 23182
178 Ga0070667_100006686 3300005367 Bacteria 9582
179 Ga0070667_100012516 3300005367 Bacteria 7017
180 Ga0070667_100013081 3300005367 Bacteria 6858
181 Ga0070667_100025739 3300005367 Bacteria 4893
182 Ga0070667_100108343 3300005367 Unclassified 2407
183 Ga0070667_100119262 3300005367 Bacteria 2294
184 Ga0070667_100145081 3300005367 Unclassified 2081
185 Ga0070713_100135064 3300005436 Bacteria 2179
186 Ga0070701_10077846 3300005438 Bacteria 1788
187 Ga0070705_100011663 3300005440 Bacteria 4442
188 Ga0070663_100035123 3300005455 Bacteria 3476
189 Ga0070663_100052494 3300005455 Bacteria 2907
190 Ga0070663_100059222 3300005455 Bacteria 2752
191 Ga0070678_100005233 3300005456 Bacteria 7469
192 Ga0070678_100013040 3300005456 Bacteria 5194
193 Ga0070678_100168349 3300005456 Bacteria 1782
194 Ga0070662_100000054 3300005457 Bacteria 60719
195 Ga0070662_100005103 3300005457 Bacteria 8368
196 Ga0070662_100008858 3300005457 Bacteria 6558
197 Ga0070662_100111484 3300005457 Bacteria 2084
198 Ga0070681_10042628 3300005458 Bacteria 4547
199 Ga0070681_10051241 3300005458 Bacteria 4117
200 Ga0070681_10094627 3300005458 Bacteria 2936
201 Ga0070681_10260774 3300005458 Bacteria 1645
202 Ga0068867_100000001 3300005459 Bacteria 427563
203 Ga0068867_100004058 3300005459 Bacteria 10306
204 Ga0068867_100018608 3300005459 Bacteria 4939
205 Ga0068867_100067089 3300005459 Bacteria 2674
206 Ga0068867_100072714 3300005459 Bacteria 2574
207 Ga0068867_100101963 3300005459 Bacteria 2193
208 Ga0068867_100179390 3300005459 Bacteria 1683
209 Ga0070698_100093392 3300005471 Bacteria 2988
210 Ga0070679_100000665 3300005530 Bacteria 29299
211 Ga0070679_100009081 3300005530 Bacteria 9380
212 Ga0070679_100012347 3300005530 Bacteria 8159
213 Ga0070679_100089788 3300005530 Bacteria 3060
214 Ga0070684_100000589 3300005535 Bacteria 25054
215 Ga0070684_100024374 3300005535 Bacteria 5075
216 Ga0070684_100045096 3300005535 Bacteria 3817
217 Ga0070684_100149241 3300005535 Bacteria 2117
218 Ga0068853_100002572 3300005539 Bacteria 13639
219 Ga0068853_100003164 3300005539 Bacteria 12586
220 Ga0068853_100004462 3300005539 Bacteria 10850
221 Ga0068853_100010823 3300005539 Bacteria 7388
222 Ga0068853_100016379 3300005539 Bacteria 6100
223 Ga0068853_100023944 3300005539 Bacteria 5117
224 Ga0070672_100002671 3300005543 Bacteria 11403
225 Ga0070672_100034008 3300005543 Bacteria 3865
226 Ga0070672_100036903 3300005543 Bacteria 3727
227 Ga0070672_100054755 3300005543 Bacteria 3124
228 Ga0070672_100102111 3300005543 Bacteria 2327
229 Ga0070672_100110094 3300005543 Bacteria 2244
230 Ga0070672_100220239 3300005543 Unclassified 1592
231 Ga0070696_100063722 3300005546 Bacteria 2582
232 Ga0070693_100121931 3300005547 Unclassified 1618
233 Ga0070665_100000001 3300005548 Bacteria 1083363
234 Ga0070665_100000010 3300005548 Bacteria 529545
235 Ga0070665_100000117 3300005548 Bacteria 149831
236 Ga0070665_100000858 3300005548 Bacteria 39506
237 Ga0070665_100001604 3300005548 Bacteria 26025
238 Ga0070665_100008265 3300005548 Bacteria 10522
239 Ga0070665_100049509 3300005548 Bacteria 4215
240 Ga0068855_100000033 3300005563 Bacteria 167299
241 Ga0068855_100000097 3300005563 Bacteria 106474
242 Ga0068855_100000189 3300005563 Bacteria 79227
243 Ga0068855_100000361 3300005563 Bacteria 56312
244 Ga0068855_100001432 3300005563 Bacteria 29672
245 Ga0068855_100010449 3300005563 Bacteria 11198
246 Ga0068855_100014725 3300005563 Bacteria 9423
247 Ga0068855_100021645 3300005563 Bacteria 7713
248 Ga0068855_100030000 3300005563 Bacteria 6504
249 Ga0068855_100088290 3300005563 Bacteria 3582
250 Ga0068855_100109855 3300005563 Bacteria 3166
251 Ga0068855_100129080 3300005563 Bacteria 2888
252 Ga0068855_100155285 3300005563 Bacteria 2600
253 Ga0070664_100001763 3300005564 Bacteria 17340
254 Ga0070664_100108257 3300005564 Bacteria 2423
255 Ga0070664_100145204 3300005564 Bacteria 2092
256 Ga0070664_100161703 3300005564 Unclassified 1981
257 Ga0070664_100238375 3300005564 Unclassified 1632
258 Ga0070664_100295202 3300005564 Bacteria 1463
259 Ga0068857_100000006 3300005577 Bacteria 168660
260 Ga0068857_100000416 3300005577 Bacteria 30150
261 Ga0068857_100001995 3300005577 Bacteria 16541
262 Ga0068857_100072849 3300005577 Bacteria 3061
263 Ga0068857_100092526 3300005577 Bacteria 2707
264 Ga0068857_100166601 3300005577 Unclassified 2001
265 Ga0068854_100001137 3300005578 Bacteria 15981
266 Ga0068854_100012640 3300005578 Bacteria 5532
267 Ga0068854_100030425 3300005578 Unclassified 3745
268 Ga0068854_100046999 3300005578 Bacteria 3075
269 Ga0068854_100074559 3300005578 Bacteria 2489
270 Ga0068854_100212741 3300005578 Bacteria 1526
271 Ga0068856_100001524 3300005614 Bacteria 24300
272 Ga0068856_100006605 3300005614 Bacteria 11365
273 Ga0068856_100019317 3300005614 Bacteria 6615
274 Ga0068856_100033216 3300005614 Bacteria 5052
275 Ga0068856_100044125 3300005614 Bacteria 4387
276 Ga0068856_100049707 3300005614 Bacteria 4133
277 Ga0068856_100076063 3300005614 Bacteria 3326
278 Ga0070702_100018818 3300005615 Bacteria 3590
279 Ga0068852_100001789 3300005616 Bacteria 14595
280 Ga0068852_100012306 3300005616 Bacteria 6490
281 Ga0068852_100029381 3300005616 Bacteria 4516
282 Ga0068852_100124015 3300005616 Bacteria 2369
283 Ga0068852_100148764 3300005616 Bacteria 2175
284 Ga0068852_100197264 3300005616 Bacteria 1903
285 Ga0068859_100000242 3300005617 Bacteria 53646
286 Ga0068859_100000397 3300005617 Bacteria 43279
287 Ga0068859_100007103 3300005617 Bacteria 11366
288 Ga0068859_100016634 3300005617 Bacteria 7384
289 Ga0068859_100020210 3300005617 Bacteria 6685
290 Ga0068859_100050940 3300005617 Bacteria 4161
291 Ga0068864_100007085 3300005618 Bacteria 9205
292 Ga0068864_100024122 3300005618 Bacteria 5114
293 Ga0068864_100035435 3300005618 Bacteria 4248
294 Ga0068864_100047564 3300005618 Bacteria 3685
295 Ga0068866_10006104 3300005718 Bacteria 5013
296 Ga0068866_10070976 3300005718 Bacteria 1840
297 Ga0068866_10085686 3300005718 Unclassified 1703
298 Ga0068861_100010485 3300005719 Bacteria 6432
299 Ga0068861_100016454 3300005719 Bacteria 5234
300 Ga0068851_10003183 3300005834 Bacteria 7276
301 Ga0068851_10006949 3300005834 Bacteria 5188
302 Ga0068870_10001223 3300005840 Bacteria 10330
303 Ga0068870_10005043 3300005840 Bacteria 5736
304 Ga0068870_10034383 3300005840 Bacteria 2593
305 Ga0068870_10097862 3300005840 Bacteria 1652
306 Ga0068863_100003280 3300005841 Bacteria 15977
307 Ga0068863_100006910 3300005841 Bacteria 11121
308 Ga0068863_100042965 3300005841 Bacteria 4293
309 Ga0068858_100001416 3300005842 Bacteria 24652
310 Ga0068858_100014158 3300005842 Bacteria 7521
311 Ga0068858_100028195 3300005842 Bacteria 5217
312 Ga0068858_100094303 3300005842 Unclassified 2788
313 Ga0068858_100122525 3300005842 Bacteria 2433
314 Ga0068858_100182600 3300005842 Bacteria 1981
315 Ga0068858_100265941 3300005842 Bacteria 1631
316 Ga0068858_100364055 3300005842 Bacteria 1386
317 Ga0068860_100000046 3300005843 Bacteria 214800
318 Ga0068860_100000700 3300005843 Bacteria 38538
319 Ga0068860_100001914 3300005843 Bacteria 22094
320 Ga0068860_100005835 3300005843 Bacteria 12393
321 Ga0068860_100014886 3300005843 Bacteria 7605
322 Ga0068860_100016701 3300005843 Bacteria 7158
323 Ga0068860_100029570 3300005843 Bacteria 5272
324 Ga0068860_100111058 3300005843 Bacteria 2620
325 Ga0068860_100139901 3300005843 Bacteria 2326
326 Ga0068860_100208693 3300005843 Bacteria 1894
327 Ga0068862_100045022 3300005844 Bacteria 3764
328 Ga0068862_100113984 3300005844 Bacteria 2376
329 Ga0068862_100219741 3300005844 Bacteria 1720
330 Ga0081455_10006925 3300005937 Bacteria 12058
331 Ga0081539_10000337 3300005985 Bacteria 103868
332 Ga0075364_10000169 3300006051 Bacteria 29011
333 Ga0075364_10001466 3300006051 Bacteria 12834
334 Ga0075364_10011431 3300006051 Bacteria 5394
335 Ga0075364_10033181 3300006051 Bacteria 3322
336 Ga0075367_10027430 3300006178 Bacteria 3240
337 Ga0075366_10000898 3300006195 Bacteria 14398
338 Ga0075366_10009323 3300006195 Bacteria 5481
339 Ga0075366_10033260 3300006195 Unclassified 3037
340 Ga0097621_100000247 3300006237 Bacteria 36324
341 Ga0097621_100000277 3300006237 Bacteria 34682
342 Ga0097621_100002714 3300006237 Bacteria 12118
343 Ga0097621_100005494 3300006237 Bacteria 8928
344 Ga0097621_100008121 3300006237 Bacteria 7545
345 Ga0097621_100008900 3300006237 Bacteria 7256
346 Ga0097621_100046710 3300006237 Bacteria 3505
347 Ga0097621_100136578 3300006237 Bacteria 2092
348 Ga0068871_100000455 3300006358 Bacteria 28102
349 Ga0068871_100001185 3300006358 Bacteria 17461
350 Ga0068871_100003771 3300006358 Bacteria 10436
351 Ga0068871_100015222 3300006358 Bacteria 5752
352 Ga0068871_100038211 3300006358 Bacteria 3832
353 Ga0068871_100039603 3300006358 Bacteria 3771
354 Ga0068871_100045918 3300006358 Bacteria 3517
355 Ga0075428_100031435 3300006844 Bacteria 5868
356 Ga0075428_100161497 3300006844 Bacteria 2432
357 Ga0075431_100047295 3300006847 Bacteria 4435
358 Ga0075429_100125763 3300006880 Bacteria 2242
359 Ga0068865_100000011 3300006881 Bacteria 154581
360 Ga0068865_100000076 3300006881 Bacteria 51732
361 Ga0068865_100001877 3300006881 Bacteria 12358
362 Ga0068865_100002323 3300006881 Bacteria 11209
363 Ga0097620_100000242 3300006931 Bacteria 53646
364 Ga0097620_100000397 3300006931 Bacteria 43279
365 Ga0097620_100007103 3300006931 Bacteria 11366
366 Ga0097620_100016633 3300006931 Bacteria 7384
367 Ga0097620_100020209 3300006931 Bacteria 6685
368 Ga0097620_100050942 3300006931 Bacteria 4161
369 Ga0099824_1008363 3300006942 Bacteria 13260
370 Ga0079104_1000078 3300006946 Bacteria 141909
371 Ga0079104_1000117 3300006946 Bacteria 114089
372 Ga0079104_1000227 3300006946 Bacteria 76897
373 Ga0079104_1000305 3300006946 Bacteria 62224
374 Ga0079104_1000836 3300006946 Bacteria 25615
375 Ga0079104_1005557 3300006946 Bacteria 5007
376 Ga0079104_1011258 3300006946 Bacteria 2887
377 Ga0079104_1017478 3300006946 Bacteria 2060
378 Ga0079104_1020654 3300006946 Bacteria 1809
379 Ga0099826_10001062 3300006948 Bacteria 15560
380 Ga0105251_10000230 3300009011 Bacteria 56255
381 Ga0105251_10000233 3300009011 Bacteria 55865
382 Ga0105251_10000760 3300009011 Bacteria 29421
383 Ga0105251_10004261 3300009011 Bacteria 9854
384 Ga0105251_10004664 3300009011 Bacteria 9224
385 Ga0105251_10007521 3300009011 Bacteria 6698
386 Ga0105251_10007546 3300009011 Bacteria 6679
387 Ga0105251_10053167 3300009011 Bacteria 1926
388 Ga0105244_10000017 3300009036 Bacteria 253386
389 Ga0105244_10000046 3300009036 Bacteria 143184
390 Ga0105244_10000266 3300009036 Bacteria 52668
391 Ga0105244_10001361 3300009036 Bacteria 19852
392 Ga0105244_10003529 3300009036 Bacteria 11115
393 Ga0105244_10013249 3300009036 Bacteria 4829
394 Ga0105244_10014481 3300009036 Bacteria 4557
395 Ga0105244_10021608 3300009036 Bacteria 3557
396 Ga0105244_10025737 3300009036 Bacteria 3193
397 Ga0105244_10036739 3300009036 Bacteria 2564
398 Ga0105250_10000012 3300009092 Bacteria 274899
399 Ga0105250_10000185 3300009092 Bacteria 53998
400 Ga0105250_10004683 3300009092 Bacteria 6247
401 Ga0105250_10008198 3300009092 Bacteria 4448
402 Ga0105250_10023274 3300009092 Bacteria 2496
403 Ga0105250_10043000 3300009092 Bacteria 1811
404 Ga0105240_10000074 3300009093 Bacteria 199611
405 Ga0105240_10000103 3300009093 Bacteria 172981
406 Ga0105240_10003631 3300009093 Bacteria 23897
407 Ga0105240_10003829 3300009093 Bacteria 23261
408 Ga0105240_10005745 3300009093 Bacteria 18403
409 Ga0105240_10011123 3300009093 Bacteria 12576
410 Ga0105240_10015220 3300009093 Bacteria 10466
411 Ga0105240_10016636 3300009093 Bacteria 9947
412 Ga0105240_10027109 3300009093 Bacteria 7507
413 Ga0105240_10032969 3300009093 Bacteria 6698
414 Ga0105240_10089262 3300009093 Bacteria 3770
415 Ga0105240_10101346 3300009093 Bacteria 3502
416 Ga0105240_10126435 3300009093 Bacteria 3071
417 Ga0105240_10147389 3300009093 Unclassified 2807
418 Ga0111539_10002966 3300009094 Bacteria 22505
419 Ga0111539_10119193 3300009094 Bacteria 3093
420 Ga0111539_10120129 3300009094 Bacteria 3079
421 Ga0111539_10325540 3300009094 Bacteria 1789
422 Ga0105245_10011909 3300009098 Bacteria 7563
423 Ga0105245_10048769 3300009098 Bacteria 3789
424 Ga0105245_10231648 3300009098 Bacteria 1787
425 Ga0105247_10000238 3300009101 Bacteria 51733
426 Ga0105247_10000319 3300009101 Bacteria 43234
427 Ga0105247_10003524 3300009101 Bacteria 10175
428 Ga0105247_10020148 3300009101 Unclassified 4009
429 Ga0114129_10011363 3300009147 Bacteria 12683
430 Ga0105243_10000012 3300009148 Bacteria 300885
431 Ga0105243_10000241 3300009148 Bacteria 62487
432 Ga0105243_10000260 3300009148 Bacteria 60060
433 Ga0105243_10090305 3300009148 Bacteria 2520
434 Ga0105241_10000013 3300009174 Bacteria 172249
435 Ga0105241_10000293 3300009174 Bacteria 37284
436 Ga0105241_10000530 3300009174 Bacteria 28739
437 Ga0105241_10002996 3300009174 Bacteria 12616
438 Ga0105241_10003032 3300009174 Bacteria 12548
439 Ga0105241_10003168 3300009174 Bacteria 12246
440 Ga0105241_10015322 3300009174 Bacteria 5615
441 Ga0105241_10038983 3300009174 Bacteria 3583
442 Ga0105241_10068084 3300009174 Bacteria 2757
443 Ga0105241_10260364 3300009174 Unclassified 1474
444 Ga0105242_10011381 3300009176 Bacteria 6839
445 Ga0105242_10016371 3300009176 Bacteria 5762
446 Ga0105242_10024565 3300009176 Bacteria 4760
447 Ga0105242_10095194 3300009176 Bacteria 2513
448 Ga0105242_10096669 3300009176 Bacteria 2496
449 Ga0105248_10007416 3300009177 Bacteria 12034
450 Ga0105248_10126228 3300009177 Bacteria 2886
451 Ga0105248_10314189 3300009177 Bacteria 1765
452 Ga0105237_10001686 3300009545 Bacteria 28604
453 Ga0105237_10002542 3300009545 Bacteria 22567
454 Ga0105237_10003907 3300009545 Bacteria 17471
455 Ga0105237_10011277 3300009545 Bacteria 9457
456 Ga0105237_10011674 3300009545 Bacteria 9296
457 Ga0105237_10025166 3300009545 Bacteria 6089
458 Ga0105237_10041982 3300009545 Bacteria 4612
459 Ga0105237_10045228 3300009545 Bacteria 4431
460 Ga0105237_10078754 3300009545 Bacteria 3285
461 Ga0105237_10133804 3300009545 Bacteria 2474
462 Ga0105237_10134113 3300009545 Bacteria 2471
463 Ga0105237_10174882 3300009545 Bacteria 2147
464 Ga0105237_10180224 3300009545 Bacteria 2113
465 Ga0105238_10006037 3300009551 Bacteria 12010
466 Ga0105238_10034131 3300009551 Bacteria 5177
467 Ga0105238_10046342 3300009551 Bacteria 4388
468 Ga0105238_10071739 3300009551 Bacteria 3461
469 Ga0105238_10122480 3300009551 Bacteria 2580
470 Ga0105238_10202318 3300009551 Bacteria 1962
471 Ga0105238_10286743 3300009551 Bacteria 1628
472 Ga0105249_10011396 3300009553 Bacteria 7808
473 Ga0105249_10018519 3300009553 Bacteria 6199
474 Ga0105249_10044257 3300009553 Bacteria 4048
475 Ga0105249_10054601 3300009553 Unclassified 3654
476 Ga0105249_10074907 3300009553 Bacteria 3134
477 Ga0105239_10000048 3300010375 Bacteria 177855
478 Ga0105239_10000280 3300010375 Bacteria 75222
479 Ga0105239_10000696 3300010375 Bacteria 47844
480 Ga0105239_10001111 3300010375 Bacteria 37117
481 Ga0105239_10002752 3300010375 Bacteria 22079
482 Ga0105239_10009182 3300010375 Bacteria 11181
483 Ga0105239_10038267 3300010375 Bacteria 5256
484 Ga0105239_10053015 3300010375 Bacteria 4449
485 Ga0105239_10058061 3300010375 Bacteria 4245
486 Ga0105239_10058623 3300010375 Bacteria 4225
487 Ga0105239_10071665 3300010375 Bacteria 3807
488 Ga0105239_10076795 3300010375 Bacteria 3674
489 Ga0105239_10087369 3300010375 Bacteria 3437
490 Ga0105239_10094302 3300010375 Bacteria 3306
491 Ga0105239_10144933 3300010375 Bacteria 2648
492 Ga0105239_10224516 3300010375 Bacteria 2107
493 Ga0105246_10001408 3300011119 Bacteria 14231
494 Ga0105246_10007124 3300011119 Bacteria 6845
495 Ga0105246_10007306 3300011119 Bacteria 6769
496 Ga0105246_10025668 3300011119 Bacteria 3842
497 Ga0157373_10000127 3300013100 Bacteria 59397
498 Ga0157373_10001089 3300013100 Bacteria 20928
499 Ga0157373_10012333 3300013100 Bacteria 6284
500 Ga0157373_10019294 3300013100 Bacteria 4966
501 Ga0157373_10022692 3300013100 Bacteria 4553
502 Ga0157373_10042824 3300013100 Bacteria 3235
503 Ga0157373_10087577 3300013100 Bacteria 2194
504 Ga0157373_10089796 3300013100 Bacteria 2164
505 Ga0157373_10155386 3300013100 Bacteria 1609
506 Ga0157371_10000003 3300013102 Bacteria 543317
507 Ga0157371_10000172 3300013102 Bacteria 94447
508 Ga0157371_10000868 3300013102 Bacteria 34292
509 Ga0157371_10001625 3300013102 Bacteria 22997
510 Ga0157371_10002111 3300013102 Bacteria 19371
511 Ga0157371_10002204 3300013102 Bacteria 18888
512 Ga0157371_10003848 3300013102 Bacteria 13399
513 Ga0157371_10005778 3300013102 Bacteria 10362
514 Ga0157371_10011682 3300013102 Bacteria 6749
515 Ga0157371_10014562 3300013102 Bacteria 5930
516 Ga0157371_10025296 3300013102 Bacteria 4328
517 Ga0157371_10037827 3300013102 Bacteria 3453
518 Ga0157371_10041007 3300013102 Bacteria 3305
519 Ga0157371_10047958 3300013102 Bacteria 3037
520 Ga0157371_10049923 3300013102 Bacteria 2972
521 Ga0157371_10081240 3300013102 Bacteria 2295
522 Ga0157371_10117413 3300013102 Unclassified 1891
523 Ga0157370_10000181 3300013104 Bacteria 79297
524 Ga0157370_10000313 3300013104 Bacteria 60838
525 Ga0157370_10000326 3300013104 Bacteria 59716
526 Ga0157370_10000822 3300013104 Bacteria 39237
527 Ga0157370_10002652 3300013104 Bacteria 21482
528 Ga0157370_10003924 3300013104 Bacteria 17317
529 Ga0157370_10005338 3300013104 Bacteria 14435
530 Ga0157370_10012037 3300013104 Bacteria 9005
531 Ga0157370_10015635 3300013104 Bacteria 7707
532 Ga0157370_10067402 3300013104 Bacteria 3383
533 Ga0157370_10152496 3300013104 Bacteria 2150
534 Ga0157369_10000002 3300013105 Bacteria 524510
535 Ga0157369_10000007 3300013105 Bacteria 402562
536 Ga0157369_10005374 3300013105 Bacteria 14914
537 Ga0157369_10006651 3300013105 Bacteria 13357
538 Ga0157369_10014086 3300013105 Bacteria 9037
539 Ga0157369_10040373 3300013105 Bacteria 5094
540 Ga0157369_10055159 3300013105 Bacteria 4290
541 Ga0157369_10057285 3300013105 Bacteria 4204
542 Ga0157369_10069413 3300013105 Bacteria 3786
543 Ga0157369_10072059 3300013105 Bacteria 3708
544 Ga0157374_10000001 3300013296 Bacteria 1077351
545 Ga0157374_10000379 3300013296 Bacteria 40932
546 Ga0157374_10001320 3300013296 Bacteria 21133
547 Ga0157374_10001718 3300013296 Bacteria 18383
548 Ga0157374_10002276 3300013296 Bacteria 16148
549 Ga0157374_10022966 3300013296 Bacteria 5570
550 Ga0157374_10050560 3300013296 Bacteria 3864
551 Ga0157374_10066312 3300013296 Bacteria 3393
552 Ga0157378_10001147 3300013297 Bacteria 24056
553 Ga0157378_10002967 3300013297 Bacteria 15089
554 Ga0157378_10076603 3300013297 Bacteria 3014
555 Ga0157378_10137223 3300013297 Bacteria 2268
556 Ga0157378_10162506 3300013297 Bacteria 2089
557 Ga0163162_10000063 3300013306 Bacteria 104222
558 Ga0163162_10000369 3300013306 Bacteria 40837
559 Ga0163162_10001851 3300013306 Bacteria 19914
560 Ga0163162_10001857 3300013306 Bacteria 19899
561 Ga0163162_10003949 3300013306 Bacteria 14225
562 Ga0163162_10005520 3300013306 Bacteria 12225
563 Ga0163162_10005992 3300013306 Bacteria 11773
564 Ga0163162_10008396 3300013306 Bacteria 10073
565 Ga0163162_10037133 3300013306 Unclassified 4859
566 Ga0163162_10052107 3300013306 Bacteria 4109
567 Ga0163162_10124759 3300013306 Unclassified 2680
568 Ga0163162_10163657 3300013306 Bacteria 2348
569 Ga0163162_10173443 3300013306 Bacteria 2281
570 Ga0157372_10000026 3300013307 Bacteria 195407
571 Ga0157372_10000177 3300013307 Bacteria 70496
572 Ga0157372_10000459 3300013307 Bacteria 44769
573 Ga0157372_10000921 3300013307 Bacteria 32008
574 Ga0157372_10004228 3300013307 Bacteria 15351
575 Ga0157372_10008214 3300013307 Bacteria 11093
576 Ga0157372_10025866 3300013307 Bacteria 6383
577 Ga0157372_10040371 3300013307 Bacteria 5154
578 Ga0157372_10040920 3300013307 Bacteria 5122
579 Ga0157372_10052776 3300013307 Bacteria 4528
580 Ga0157372_10053382 3300013307 Bacteria 4505
581 Ga0157372_10067478 3300013307 Bacteria 4019
582 Ga0157372_10121606 3300013307 Bacteria 2999
583 Ga0157372_10189242 3300013307 Bacteria 2383
584 Ga0157372_10201868 3300013307 Bacteria 2303
585 Ga0157372_10202805 3300013307 Bacteria 2298
586 Ga0157372_10302542 3300013307 Bacteria 1860
587 Ga0157372_10330229 3300013307 Bacteria 1776
588 Ga0157372_10352794 3300013307 Bacteria 1714
589 Ga0157375_10000166 3300013308 Bacteria 61836
590 Ga0157375_10002575 3300013308 Bacteria 15751
591 Ga0157375_10005010 3300013308 Bacteria 11509
592 Ga0157375_10015162 3300013308 Bacteria 6894
593 Ga0157375_10047011 3300013308 Bacteria 4211
594 Ga0157375_10172336 3300013308 Bacteria 2312
595 Ga0157375_10241765 3300013308 Bacteria 1965
596 Ga0163163_10003388 3300014325 Bacteria 13533
597 Ga0163163_10057315 3300014325 Bacteria 3852
598 Ga0163163_10220469 3300014325 Bacteria 1945
599 Ga0157380_10018712 3300014326 Bacteria 5148
600 Ga0157380_10028028 3300014326 Bacteria 4290
601 Ga0157380_10036404 3300014326 Bacteria 3807
602 Ga0182008_10000004 3300014497 Bacteria 436804
603 Ga0182008_10001429 3300014497 Bacteria 16012
604 Ga0182008_10008294 3300014497 Bacteria 5677
605 Ga0157377_10002998 3300014745 Bacteria 7564
606 Ga0157377_10004515 3300014745 Bacteria 6422
607 Ga0157377_10006587 3300014745 Bacteria 5548
608 Ga0157377_10010180 3300014745 Bacteria 4642
609 Ga0157379_10011459 3300014968 Bacteria 7738
610 Ga0157379_10037998 3300014968 Bacteria 4295
611 Ga0157376_10000176 3300014969 Bacteria 44034
612 Ga0157376_10000721 3300014969 Bacteria 21396
613 Ga0157376_10001531 3300014969 Bacteria 15244
614 Ga0157376_10004624 3300014969 Bacteria 9589
615 Ga0157376_10007428 3300014969 Bacteria 7824
616 Ga0157376_10110414 3300014969 Bacteria 2419
617 Ga0157376_10125471 3300014969 Bacteria 2282
618 Ga0157376_10125954 3300014969 Bacteria 2278
619 Ga0157376_10228357 3300014969 Bacteria 1728
620 Ga0182006_1000009 3300015261 Bacteria 438243
621 Ga0182006_1000130 3300015261 Bacteria 80841
622 Ga0182006_1000180 3300015261 Bacteria 66625
623 Ga0182006_1001603 3300015261 Bacteria 13391
624 Ga0182006_1002117 3300015261 Bacteria 11070
625 Ga0182006_1005424 3300015261 Bacteria 6087
626 Ga0182006_1015934 3300015261 Bacteria 3213
627 Ga0182007_10000001 3300015262 Bacteria 1127301
628 Ga0182007_10000007 3300015262 Bacteria 376596
629 Ga0183366_1005 3300015679 Bacteria 163284
630 Ga0183370_1005 3300015680 Bacteria 163284
631 Ga0183373_1001 3300015682 Bacteria 1410374
632 Ga0183365_10004 3300015684 Bacteria 333304
633 Ga0183369_1016 3300015685 Bacteria 163284
634 Ga0183368_1009 3300015687 Bacteria 163284
635 Ga0163161_10000019 3300017792 Bacteria 216758
636 Ga0163161_10000028 3300017792 Bacteria 197151
637 Ga0163161_10000045 3300017792 Bacteria 130284
638 Ga0163161_10000376 3300017792 Bacteria 37317
639 Ga0163161_10000496 3300017792 Bacteria 32389
640 Ga0163161_10002301 3300017792 Bacteria 13703
641 Ga0163161_10002434 3300017792 Bacteria 13304
642 Ga0163161_10004909 3300017792 Bacteria 9307
643 Ga0163161_10154616 3300017792 Bacteria 1745
644 Ga0163161_10182786 3300017792 Bacteria 1609
645 Ga0213876_10000039 3300021384 Bacteria 173104
646 Ga0209436_102822 3300025208 Bacteria 4934
647 Ga0209436_103845 3300025208 Bacteria 3841
648 Ga0209147_100010 3300025229 Bacteria 741391
649 Ga0209563_100011 3300025230 Bacteria 1187808
650 Ga0207427_100125 3300025231 Bacteria 96142
651 Ga0209437_100008 3300025233 Bacteria 921142
652 Ga0209437_100089 3300025233 Bacteria 250476
653 Ga0209258_100075 3300025242 Bacteria 270751
654 Ga0207425_1000007 3300025245 Bacteria 777411
655 Ga0209646_1000091 3300025246 Bacteria 188727
656 Ga0209026_1000497 3300025250 Bacteria 28577
657 Ga0209677_101431 3300025253 Bacteria 10313
658 Ga0209148_1000085 3300025254 Bacteria 265193
659 Ga0209148_1000117 3300025254 Bacteria 188938
660 Ga0209148_1000600 3300025254 Bacteria 32520
661 Ga0209148_1003709 3300025254 Bacteria 4041
662 Ga0209129_1000006 3300025258 Bacteria 777761
663 Ga0209129_1000021 3300025258 Bacteria 445018
664 Ga0209233_1000024 3300025261 Bacteria 695418
665 Ga0209233_1000079 3300025261 Bacteria 346944
666 Ga0209565_1000082 3300025263 Bacteria 154452
667 Ga0209455_1000259 3300025272 Bacteria 61221
668 Ga0209455_1002019 3300025272 Bacteria 8298
669 Ga0209673_1000422 3300025273 Bacteria 73685
670 Ga0209130_1000320 3300025284 Bacteria 56333
671 Ga0209675_1000176 3300025291 Bacteria 73644
672 Ga0209676_1000008 3300025292 Bacteria 991778
673 Ga0209676_1000204 3300025292 Bacteria 132896
674 Ga0209025_1000043 3300025294 Bacteria 350458
675 Ga0209025_1000089 3300025294 Bacteria 254130
676 Ga0209025_1000999 3300025294 Bacteria 41918
677 Ga0209025_1003105 3300025294 Bacteria 16286
678 Ga0209025_1007368 3300025294 Bacteria 8230
679 Ga0209025_1009924 3300025294 Bacteria 6543
680 Ga0209564_1000438 3300025295 Bacteria 71794
681 Ga0209758_1000016 3300025297 Bacteria 778557
682 Ga0209758_1023838 3300025297 Bacteria 2750
683 Ga0209050_1000180 3300025298 Bacteria 142987
684 Ga0209256_1000323 3300025299 Bacteria 82313
685 Ga0207426_1000032 3300025302 Bacteria 457997
686 Ga0207426_1000057 3300025302 Bacteria 369548
687 Ga0207426_1000251 3300025302 Bacteria 117462
688 Ga0209257_1000004 3300025304 Bacteria 1678347
689 Ga0209257_1000005 3300025304 Bacteria 1592528
690 Ga0207656_10014318 3300025321 Bacteria 3053
691 Ga0207656_10026978 3300025321 Bacteria 2346
692 Ga0207696_1000040 3300025711 Bacteria 318695
693 Ga0207696_1000068 3300025711 Bacteria 228017
694 Ga0207696_1000245 3300025711 Bacteria 73998
695 Ga0207696_1000525 3300025711 Bacteria 31632
696 Ga0207696_1005540 3300025711 Bacteria 5222
697 Ga0207696_1021957 3300025711 Bacteria 2036
698 Ga0207655_1000023 3300025728 Bacteria 467070
699 Ga0207655_1000034 3300025728 Bacteria 364737
700 Ga0207655_1000053 3300025728 Bacteria 284129
701 Ga0207655_1000082 3300025728 Bacteria 213760
702 Ga0207655_1000106 3300025728 Bacteria 181416
703 Ga0207655_1000264 3300025728 Bacteria 82670
704 Ga0207655_1001062 3300025728 Bacteria 27373
705 Ga0207655_1002562 3300025728 Bacteria 14546
706 Ga0207655_1003694 3300025728 Bacteria 11272
707 Ga0207655_1005115 3300025728 Bacteria 9042
708 Ga0207713_1000017 3300025735 Bacteria 394495
709 Ga0207713_1000044 3300025735 Bacteria 238074
710 Ga0207713_1000053 3300025735 Bacteria 222068
711 Ga0207713_1000062 3300025735 Bacteria 208832
712 Ga0207713_1000066 3300025735 Bacteria 195645
713 Ga0207713_1006048 3300025735 Bacteria 7463
714 Ga0207713_1006491 3300025735 Bacteria 7113
715 Ga0207713_1007033 3300025735 Bacteria 6741
716 Ga0207713_1013766 3300025735 Bacteria 4242
717 Ga0207713_1061774 3300025735 Bacteria 1424
718 Ga0207682_10003471 3300025893 Bacteria 6833
719 Ga0207642_10021917 3300025899 Bacteria 2524
720 Ga0207642_10032843 3300025899 Bacteria 2190
721 Ga0207642_10068285 3300025899 Bacteria 1681
722 Ga0207710_10000104 3300025900 Bacteria 107245
723 Ga0207710_10000693 3300025900 Bacteria 18877
724 Ga0207710_10016084 3300025900 Bacteria 3164
725 Ga0207680_10000268 3300025903 Bacteria 24842
726 Ga0207647_10000046 3300025904 Bacteria 90148
727 Ga0207647_10001200 3300025904 Bacteria 19960
728 Ga0207647_10027349 3300025904 Bacteria 3718
729 Ga0207647_10058493 3300025904 Bacteria 2360
730 Ga0207645_10000088 3300025907 Bacteria 65894
731 Ga0207645_10000542 3300025907 Bacteria 31431
732 Ga0207645_10001902 3300025907 Bacteria 16850
733 Ga0207645_10025938 3300025907 Bacteria 3790
734 Ga0207645_10075539 3300025907 Unclassified 2157
735 Ga0207643_10006182 3300025908 Bacteria 6408
736 Ga0207643_10039172 3300025908 Unclassified 2666
737 Ga0207643_10060148 3300025908 Bacteria 2168
738 Ga0207643_10061613 3300025908 Bacteria 2143
739 Ga0207643_10095996 3300025908 Bacteria 1733
740 Ga0207705_10000076 3300025909 Bacteria 122975
741 Ga0207705_10000107 3300025909 Bacteria 94984
742 Ga0207705_10010608 3300025909 Bacteria 6695
743 Ga0207705_10012996 3300025909 Bacteria 6009
744 Ga0207705_10041503 3300025909 Bacteria 3301
745 Ga0207654_10000016 3300025911 Bacteria 211550
746 Ga0207654_10000738 3300025911 Bacteria 18178
747 Ga0207654_10000743 3300025911 Bacteria 18094
748 Ga0207654_10002549 3300025911 Bacteria 9245
749 Ga0207654_10013839 3300025911 Bacteria 4156
750 Ga0207654_10018530 3300025911 Bacteria 3654
751 Ga0207654_10029628 3300025911 Bacteria 2999
752 Ga0207707_10000487 3300025912 Bacteria 41080
753 Ga0207707_10012617 3300025912 Bacteria 7342
754 Ga0207707_10099580 3300025912 Bacteria 2540
755 Ga0207707_10154843 3300025912 Bacteria 2004
756 Ga0207695_10000019 3300025913 Bacteria 732137
757 Ga0207695_10000282 3300025913 Bacteria 126242
758 Ga0207695_10002490 3300025913 Bacteria 27118
759 Ga0207695_10004745 3300025913 Bacteria 18394
760 Ga0207695_10010448 3300025913 Bacteria 11353
761 Ga0207695_10015766 3300025913 Bacteria 8881
762 Ga0207695_10020921 3300025913 Bacteria 7477
763 Ga0207695_10023840 3300025913 Bacteria 6907
764 Ga0207695_10045195 3300025913 Bacteria 4677
765 Ga0207695_10063197 3300025913 Bacteria 3817
766 Ga0207695_10084084 3300025913 Bacteria 3213
767 Ga0207671_10000572 3300025914 Bacteria 49400
768 Ga0207671_10003026 3300025914 Bacteria 17227
769 Ga0207671_10003229 3300025914 Bacteria 16398
770 Ga0207671_10019811 3300025914 Bacteria 5136
771 Ga0207671_10030327 3300025914 Bacteria 4033
772 Ga0207671_10035305 3300025914 Bacteria 3712
773 Ga0207671_10058291 3300025914 Bacteria 2863
774 Ga0207671_10113039 3300025914 Bacteria 2068
775 Ga0207660_10002080 3300025917 Bacteria 13256
776 Ga0207660_10008225 3300025917 Bacteria 6751
777 Ga0207660_10040547 3300025917 Bacteria 3261
778 Ga0207660_10050798 3300025917 Bacteria 2946
779 Ga0207662_10025868 3300025918 Bacteria 3382
780 Ga0207657_10011508 3300025919 Bacteria 8783
781 Ga0207657_10018840 3300025919 Bacteria 6572
782 Ga0207657_10023001 3300025919 Bacteria 5814
783 Ga0207657_10030460 3300025919 Bacteria 4897
784 Ga0207657_10084456 3300025919 Bacteria 2661
785 Ga0207657_10091159 3300025919 Bacteria 2542
786 Ga0207657_10166850 3300025919 Bacteria 1785
787 Ga0207657_10225106 3300025919 Bacteria 1501
788 Ga0207649_10004270 3300025920 Bacteria 7777
789 Ga0207652_10000055 3300025921 Bacteria 115420
790 Ga0207652_10000103 3300025921 Bacteria 91988
791 Ga0207652_10003723 3300025921 Bacteria 12514
792 Ga0207652_10052292 3300025921 Bacteria 3505
793 Ga0207652_10070422 3300025921 Bacteria 3037
794 Ga0207652_10152500 3300025921 Unclassified 2069
795 Ga0207681_10005187 3300025923 Bacteria 8002
796 Ga0207681_10010237 3300025923 Bacteria 5742
797 Ga0207681_10149448 3300025923 Unclassified 1749
798 Ga0207694_10002468 3300025924 Bacteria 15055
799 Ga0207694_10007215 3300025924 Bacteria 8439
800 Ga0207694_10048422 3300025924 Bacteria 3289
801 Ga0207650_10057853 3300025925 Bacteria 2885
802 Ga0207650_10252522 3300025925 Bacteria 1428
803 Ga0207659_10005711 3300025926 Bacteria 7574
804 Ga0207659_10027151 3300025926 Bacteria 3872
805 Ga0207659_10107651 3300025926 Bacteria 2113
806 Ga0207659_10125849 3300025926 Bacteria 1971
807 Ga0207687_10026062 3300025927 Bacteria 3914
808 Ga0207687_10035758 3300025927 Bacteria 3380
809 Ga0207700_10127297 3300025928 Bacteria 2074
810 Ga0207644_10011358 3300025931 Bacteria 5891
811 Ga0207690_10013651 3300025932 Bacteria 4886
812 Ga0207690_10018497 3300025932 Bacteria 4274
813 Ga0207690_10059178 3300025932 Bacteria 2595
814 Ga0207690_10079861 3300025932 Bacteria 2281
815 Ga0207690_10178767 3300025932 Bacteria 1596
816 Ga0207706_10000115 3300025933 Bacteria 86484
817 Ga0207706_10014773 3300025933 Bacteria 7069
818 Ga0207706_10019052 3300025933 Bacteria 6173
819 Ga0207706_10028637 3300025933 Bacteria 4974
820 Ga0207706_10036150 3300025933 Bacteria 4388
821 Ga0207706_10069027 3300025933 Bacteria 3108
822 Ga0207706_10134591 3300025933 Bacteria 2174
823 Ga0207686_10005472 3300025934 Bacteria 6815
824 Ga0207709_10000006 3300025935 Bacteria 800946
825 Ga0207709_10000119 3300025935 Bacteria 121452
826 Ga0207709_10004334 3300025935 Bacteria 8210
827 Ga0207670_10062107 3300025936 Bacteria 2552
828 Ga0207669_10055806 3300025937 Bacteria 2394
829 Ga0207704_10000001 3300025938 Bacteria 716296
830 Ga0207704_10004504 3300025938 Bacteria 6369
831 Ga0207704_10008805 3300025938 Bacteria 4846
832 Ga0207691_10000293 3300025940 Bacteria 49545
833 Ga0207691_10008395 3300025940 Bacteria 9925
834 Ga0207691_10030637 3300025940 Bacteria 5025
835 Ga0207691_10042120 3300025940 Bacteria 4210
836 Ga0207691_10151393 3300025940 Bacteria 2039
837 Ga0207691_10153826 3300025940 Bacteria 2021
838 Ga0207711_10020817 3300025941 Bacteria 5474
839 Ga0207711_10168828 3300025941 Bacteria 1984
840 Ga0207689_10001830 3300025942 Bacteria 20104
841 Ga0207689_10002330 3300025942 Bacteria 17781
842 Ga0207689_10006044 3300025942 Bacteria 10703
843 Ga0207689_10014794 3300025942 Bacteria 6623
844 Ga0207689_10033869 3300025942 Bacteria 4243
845 Ga0207689_10047061 3300025942 Unclassified 3563
846 Ga0207661_10001626 3300025944 Bacteria 15292
847 Ga0207661_10002021 3300025944 Bacteria 13987
848 Ga0207661_10056983 3300025944 Bacteria 3140
849 Ga0207679_10001158 3300025945 Bacteria 16816
850 Ga0207679_10049597 3300025945 Bacteria 3064
851 Ga0207679_10106915 3300025945 Bacteria 2200
852 Ga0207667_10000046 3300025949 Bacteria 245420
853 Ga0207667_10000135 3300025949 Bacteria 111565
854 Ga0207667_10000190 3300025949 Bacteria 90197
855 Ga0207667_10000391 3300025949 Bacteria 59208
856 Ga0207667_10001258 3300025949 Bacteria 31777
857 Ga0207667_10003647 3300025949 Bacteria 18980
858 Ga0207667_10004453 3300025949 Bacteria 17151
859 Ga0207667_10015326 3300025949 Bacteria 8715
860 Ga0207667_10044880 3300025949 Bacteria 4682
861 Ga0207667_10058074 3300025949 Bacteria 4060
862 Ga0207667_10073823 3300025949 Bacteria 3544
863 Ga0207667_10097647 3300025949 Bacteria 3032
864 Ga0207667_10212267 3300025949 Bacteria 1984
865 Ga0207667_10228621 3300025949 Bacteria 1905
866 Ga0207651_10000002 3300025960 Bacteria 427663
867 Ga0207651_10002459 3300025960 Bacteria 8847
868 Ga0207651_10054310 3300025960 Bacteria 2744
869 Ga0207651_10071052 3300025960 Bacteria 2465
870 Ga0207651_10072948 3300025960 Bacteria 2439
871 Ga0207651_10080997 3300025960 Bacteria 2339
872 Ga0207651_10127472 3300025960 Bacteria 1942
873 Ga0207712_10017200 3300025961 Bacteria 4692
874 Ga0207712_10018615 3300025961 Bacteria 4526
875 Ga0207712_10023530 3300025961 Bacteria 4067
876 Ga0207712_10024170 3300025961 Bacteria 4020
877 Ga0207668_10001840 3300025972 Bacteria 12381
878 Ga0207668_10013298 3300025972 Bacteria 5063
879 Ga0207668_10062151 3300025972 Bacteria 2629
880 Ga0207640_10000710 3300025981 Bacteria 19310
881 Ga0207640_10022246 3300025981 Bacteria 3791
882 Ga0207640_10228886 3300025981 Bacteria 1429
883 Ga0207658_10001199 3300025986 Bacteria 20672
884 Ga0207658_10006063 3300025986 Bacteria 8256
885 Ga0207658_10007214 3300025986 Bacteria 7577
886 Ga0207658_10008446 3300025986 Bacteria 7009
887 Ga0207658_10166523 3300025986 Bacteria 1811
888 Ga0207677_10000042 3300026023 Bacteria 110706
889 Ga0207677_10005877 3300026023 Bacteria 6676
890 Ga0207677_10013999 3300026023 Bacteria 4668
891 Ga0207677_10052863 3300026023 Unclassified 2762
892 Ga0207677_10058186 3300026023 Bacteria 2659
893 Ga0207703_10000495 3300026035 Bacteria 40916
894 Ga0207703_10003145 3300026035 Bacteria 13927
895 Ga0207703_10006159 3300026035 Bacteria 9602
896 Ga0207703_10153412 3300026035 Bacteria 2011
897 Ga0207639_10001961 3300026041 Bacteria 13824
898 Ga0207639_10002864 3300026041 Bacteria 11589
899 Ga0207639_10016353 3300026041 Bacteria 5247
900 Ga0207639_10018367 3300026041 Bacteria 4968
901 Ga0207639_10065102 3300026041 Bacteria 2829
902 Ga0207639_10077694 3300026041 Bacteria 2618
903 Ga0207639_10119487 3300026041 Bacteria 2163
904 Ga0207678_10039235 3300026067 Bacteria 4110
905 Ga0207678_10072591 3300026067 Bacteria 2949
906 Ga0207702_10000165 3300026078 Bacteria 79066
907 Ga0207702_10010109 3300026078 Bacteria 7906
908 Ga0207702_10017996 3300026078 Bacteria 5849
909 Ga0207702_10030948 3300026078 Bacteria 4460
910 Ga0207702_10034461 3300026078 Bacteria 4233
911 Ga0207641_10000053 3300026088 Bacteria 173468
912 Ga0207641_10000734 3300026088 Bacteria 35187
913 Ga0207641_10005551 3300026088 Bacteria 10750
914 Ga0207641_10018211 3300026088 Bacteria 5757
915 Ga0207641_10018628 3300026088 Bacteria 5691
916 Ga0207648_10000001 3300026089 Bacteria 427499
917 Ga0207648_10003474 3300026089 Bacteria 16523
918 Ga0207648_10005517 3300026089 Bacteria 12755
919 Ga0207648_10020072 3300026089 Bacteria 6028
920 Ga0207648_10021881 3300026089 Bacteria 5745
921 Ga0207648_10079790 3300026089 Bacteria 2855
922 Ga0207648_10090555 3300026089 Bacteria 2673
923 Ga0207648_10136337 3300026089 Bacteria 2162
924 Ga0207676_10057538 3300026095 Bacteria 3062
925 Ga0207676_10103841 3300026095 Bacteria 2362
926 Ga0207674_10000018 3300026116 Bacteria 167809
927 Ga0207674_10000672 3300026116 Bacteria 44419
928 Ga0207674_10002568 3300026116 Bacteria 22867
929 Ga0207674_10011114 3300026116 Bacteria 10125
930 Ga0207674_10015732 3300026116 Bacteria 8300
931 Ga0207674_10028279 3300026116 Bacteria 5918
932 Ga0207674_10057821 3300026116 Bacteria 3931
933 Ga0207674_10116814 3300026116 Bacteria 2639
934 Ga0207675_100005554 3300026118 Bacteria 12068
935 Ga0207675_100017826 3300026118 Bacteria 6625
936 Ga0207675_100119454 3300026118 Bacteria 2493
937 Ga0207683_10011668 3300026121 Bacteria 7500
938 Ga0207683_10021472 3300026121 Bacteria 5528
939 Ga0207683_10067406 3300026121 Bacteria 3157
940 Ga0207683_10108019 3300026121 Bacteria 2490
941 Ga0207683_10155591 3300026121 Unclassified 2064
942 Ga0207698_10001560 3300026142 Bacteria 13354
943 Ga0207698_10007731 3300026142 Bacteria 6746
944 Ga0207698_10025890 3300026142 Bacteria 4142
945 Ga0207698_10134973 3300026142 Bacteria 2116
946 Ga0209281_1000031 3300027111 Bacteria 422772
947 Ga0209281_1000065 3300027111 Bacteria 285579
948 Ga0209281_1000088 3300027111 Bacteria 245908
949 Ga0209281_1000107 3300027111 Bacteria 218397
950 Ga0209281_1000112 3300027111 Bacteria 213847
951 Ga0209281_1000162 3300027111 Bacteria 159535
952 Ga0209281_1000327 3300027111 Bacteria 82960
953 Ga0209281_1000606 3300027111 Bacteria 40572
954 Ga0209281_1000649 3300027111 Bacteria 37518
955 Ga0209281_1001280 3300027111 Bacteria 16155
956 Ga0209281_1010279 3300027111 Bacteria 2151
957 Ga0209371_1000010 3300027312 Bacteria 922021
958 Ga0209371_1000027 3300027312 Bacteria 448853
959 Ga0209371_1000029 3300027312 Bacteria 424797
960 Ga0209371_1000092 3300027312 Bacteria 171648
961 Ga0209371_1000146 3300027312 Bacteria 115378
962 Ga0209371_1000266 3300027312 Bacteria 61272
963 Ga0209371_1000270 3300027312 Bacteria 60585
964 Ga0209371_1004055 3300027312 Bacteria 6619
965 Ga0209371_1009262 3300027312 Bacteria 3146
966 Ga0209371_1014847 3300027312 Bacteria 2118
967 Ga0209489_109199 3300027361 Bacteria 12544
968 Ga0207428_10079113 3300027907 Bacteria 2571
969 Ga0268266_10000032 3300028379 Bacteria 395079
970 Ga0268266_10000049 3300028379 Bacteria 307763
971 Ga0268266_10000079 3300028379 Bacteria 213545
972 Ga0268266_10004031 3300028379 Bacteria 14202
973 Ga0268266_10095689 3300028379 Bacteria 2608
974 Ga0268266_10100658 3300028379 Bacteria 2546
975 Ga0268265_10018409 3300028380 Unclassified 4840
976 Ga0268265_10136426 3300028380 Bacteria 2048
977 Ga0268265_10164881 3300028380 Bacteria 1887
978 Ga0268264_10000041 3300028381 Bacteria 372501
979 Ga0268264_10000176 3300028381 Bacteria 136166
980 Ga0268264_10004390 3300028381 Bacteria 12032
981 Ga0268264_10007057 3300028381 Bacteria 9416
982 Ga0268264_10011611 3300028381 Bacteria 7267
983 Ga0268264_10017902 3300028381 Bacteria 5797
984 Ga0268264_10019208 3300028381 Bacteria 5585
985 Ga0268264_10022094 3300028381 Bacteria 5192
986 Ga0268264_10125354 3300028381 Bacteria 2269
987 Ga0268264_10193439 3300028381 Bacteria 1856
988 Ga0307517_10000429 3300028786 Bacteria 72171
989 Ga0307517_10001171 3300028786 Bacteria 44114
990 Ga0307517_10002048 3300028786 Bacteria 32795
991 Ga0307515_10000061 3300028794 Bacteria 251841
992 Ga0307515_10001027 3300028794 Bacteria 63746
993 Ga0307515_10001574 3300028794 Bacteria 50970
994 Ga0307515_10015963 3300028794 Bacteria 13791
995 Ga0265338_10025958 3300028800 Bacteria 5924
996 Ga0265338_10094575 3300028800 Bacteria 2458
997 Ga0237817_10010 3300030083 Bacteria 78285
998 Ga0268256_1000022 3300030500 Bacteria 531115
999 Ga0268256_1000032 3300030500 Bacteria 424603
1000 Ga0268256_1000045 3300030500 Bacteria 330053
1001 Ga0268256_1000082 3300030500 Bacteria 171648
1002 Ga0268256_1000117 3300030500 Bacteria 115176
1003 Ga0268256_1000248 3300030500 Bacteria 56898
1004 Ga0268256_1003628 3300030500 Bacteria 6861
1005 Ga0268256_1003783 3300030500 Bacteria 6620
1006 Ga0268256_1005563 3300030500 Bacteria 4915
1007 Ga0268256_1005828 3300030500 Bacteria 4736
1008 Ga0307511_10001833 3300030521 Bacteria 22329
1009 Ga0307511_10035570 3300030521 Bacteria 4346
1010 Ga0316176_1186872 3300030732 Bacteria 4413
1011 Ga0316181_1204273 3300030744 Bacteria 12316
1012 Ga0265332_10018318 3300031238 Bacteria 3090
1013 Ga0265327_10000051 3300031251 Bacteria 257963
1014 Ga0265327_10023081 3300031251 Bacteria 3696
1015 Ga0265327_10102392 3300031251 Unclassified 1380
1016 Ga0265316_10006677 3300031344 Bacteria 10991
1017 Ga0265316_10137960 3300031344 Unclassified 1834
1018 Ga0307513_10005109 3300031456 Bacteria 17369
1019 Ga0307513_10017431 3300031456 Bacteria 8612
1020 Ga0307513_10060749 3300031456 Bacteria 4005
1021 Ga0307513_10177668 3300031456 Unclassified 1996
1022 Ga0307513_10179938 3300031456 Bacteria 1979
1023 Ga0307513_10242293 3300031456 Bacteria 1607
1024 Ga0307513_10263851 3300031456 Bacteria 1510
1025 Ga0307509_10000019 3300031507 Bacteria 256151
1026 Ga0307509_10085073 3300031507 Bacteria 3256
1027 Ga0307509_10093472 3300031507 Bacteria 3069
1028 Ga0307509_10095342 3300031507 Bacteria 3031
1029 Ga0307509_10192126 3300031507 Bacteria 1891
1030 Ga0307408_100000005 3300031548 Bacteria 529098
1031 Ga0307408_100072036 3300031548 Unclassified 2557
1032 Ga0307508_10002356 3300031616 Bacteria 19994
1033 Ga0307514_10035615 3300031649 Bacteria 3961
1034 Ga0316575_10008091 3300031665 Bacteria 3822
1035 Ga0265314_10011967 3300031711 Bacteria 7115
1036 Ga0307516_10001571 3300031730 Bacteria 31452
1037 Ga0307516_10019622 3300031730 Bacteria 6999
1038 Ga0307405_10000003 3300031731 Bacteria 569064
1039 Ga0307405_10000019 3300031731 Bacteria 167960
1040 Ga0307413_10000959 3300031824 Bacteria 10337
1041 Ga0307413_10001519 3300031824 Bacteria 8893
1042 Ga0307413_10050336 3300031824 Bacteria 2503
1043 Ga0307518_10012267 3300031838 Bacteria 6128
1044 Ga0307407_10000019 3300031903 Bacteria 129701
1045 Ga0307407_10000021 3300031903 Bacteria 122064
1046 Ga0307407_10088738 3300031903 Bacteria 1890
1047 Ga0307412_10055732 3300031911 Unclassified 2631
1048 Ga0307409_100027918 3300031995 Bacteria 4010
1049 Ga0307409_100179525 3300031995 Unclassified 1873
1050 Ga0307416_100000043 3300032002 Bacteria 130035
1051 Ga0307416_100000232 3300032002 Bacteria 29680
1052 Ga0307416_100000252 3300032002 Bacteria 28542
1053 Ga0307416_100001520 3300032002 Bacteria 12660
1054 Ga0307414_10000053 3300032004 Bacteria 121338
1055 Ga0307414_10002363 3300032004 Bacteria 9864
1056 Ga0307414_10004482 3300032004 Bacteria 7587
1057 Ga0307414_10005497 3300032004 Bacteria 6984
1058 Ga0307414_10006818 3300032004 Bacteria 6388
1059 Ga0307414_10032784 3300032004 Bacteria 3425
1060 Ga0307411_10000006 3300032005 Bacteria 382357
1061 Ga0307411_10000009 3300032005 Bacteria 319906
1062 Ga0307415_100009832 3300032126 Bacteria 5388
1063 Ga0307415_100165412 3300032126 Bacteria 1719
1064 Ga0307507_10000510 3300033179 Bacteria 81853
1065 Ga0307510_10000002 3300033180 Bacteria 801565
1066 Ga0307510_10020428 3300033180 Bacteria 7735
1067 Ga0307510_10020871 3300033180 Bacteria 7646
1068 Ga0373936_0012250 3300035113 Bacteria 3260
1069 Ga0373936_0012969 3300035113 Bacteria 3177
1070 Ga0373937_0057048 3300036401 Bacteria 3587
1071 Ga0373937_0140797 3300036401 Unclassified 2257
1072 Ga0395899_0000002 3300037312 Bacteria 1324310
1073 Ga0395899_0000055 3300037312 Bacteria 220579
1074 Ga0395899_0001560 3300037312 Bacteria 19297
1075 Ga0395899_0001714 3300037312 Bacteria 18241
1076 Ga0395899_0007754 3300037312 Bacteria 8277
1077 Ga0395899_0014865 3300037312 Bacteria 5942
1078 Ga0395899_0020675 3300037312 Bacteria 4990
1079 Ga0395899_0047617 3300037312 Bacteria 3191
1080 Ga0395900_0000285 3300037418 Bacteria 75772
1081 Ga0395900_0000322 3300037418 Bacteria 70864
1082 Ga0395900_0001027 3300037418 Bacteria 35806
1083 Ga0395900_0003451 3300037418 Bacteria 17088
1084 Ga0395900_0004551 3300037418 Bacteria 14660
1085 Ga0395900_0005771 3300037418 Bacteria 12934
1086 Ga0395900_0035403 3300037418 Bacteria 5142
1087 Ga0395900_0067592 3300037418 Bacteria 3672
1088 Ga0395900_0102015 3300037418 Bacteria 2947
1089 Ga0395900_0118787 3300037418 Bacteria 2713
1090 Ga0395900_0176938 3300037418 Bacteria 2170
1091 Ga0395900_0255098 3300037418 Bacteria 1753
1092 Ga0395898_0001240 3300037466 Bacteria 38058
1093 Ga0395898_0038993 3300037466 Bacteria 4705
1094 Ga0395898_0048311 3300037466 Bacteria 4174
1095 Ga0395898_0058344 3300037466 Unclassified 3757
1096 Ga0395898_0081995 3300037466 Bacteria 3110
1097 Ga0395898_0083914 3300037466 Bacteria 3070
1098 Ga0395905_0000070 3300037471 Bacteria 175662
1099 Ga0395905_0000716 3300037471 Bacteria 43859
1100 Ga0395905_0017759 3300037471 Bacteria 6756
1101 Ga0395905_0021327 3300037471 Bacteria 6128
1102 Ga0395905_0061121 3300037471 Unclassified 3523
1103 Ga0395901_0000332 3300038443 Bacteria 57814
1104 Ga0395901_0003481 3300038443 Bacteria 15860
1105 Ga0395901_0009872 3300038443 Bacteria 9675
1106 Ga0395901_0017512 3300038443 Bacteria 7313
1107 Ga0395901_0061345 3300038443 Bacteria 3912
1108 Ga0395901_0208062 3300038443 Bacteria 2048
1109 Ga0395901_0218072 3300038443 Bacteria 1994
1110 Ga0395901_0236184 3300038443 Bacteria 1908
1111 Ga0395901_0304788 3300038443 Bacteria 1651
1112 Ga0436365_0171687 3300039437 Bacteria 172237
1113 Ga0436361_0059626 3300039447 Bacteria 8081
1114 Ga0439438_000001 3300041405 Bacteria 1263568
1115 Ga0439438_002410 3300041405 Bacteria 7969
1116 Ga0439438_002877 3300041405 Bacteria 7159
1117 Ga0439439_0030538 3300041406 Bacteria 1370
1118 Ga0439447_000193 3300041407 Bacteria 21766
1119 Ga0439447_000563 3300041407 Bacteria 13807
1120 Ga0451791_1638987 3300041451 Bacteria 2124
1121 Ga0451800_0868019 3300041459 Bacteria 2285
1122 Ga0451807_2607721 3300041486 Bacteria 3505
1123 Ga0451837_0156886 3300041494 Bacteria 1202
1124 Ga0439442_014730 3300042002 Unclassified 1610
1125 Ga0439448_0003051 3300042005 Bacteria 4601
1126 Ga0439448_0008130 3300042005 Bacteria 3063
1127 Ga0439448_0025228 3300042005 Bacteria 1863
1128 Ga0439432_002021 3300042006 Bacteria 7680
1129 Ga0439432_010316 3300042006 Bacteria 3239
1130 Ga0439449_0002186 3300042007 Bacteria 7688
1131 Ga0439449_0028771 3300042007 Bacteria 2071
1132 Ga0439452_000010 3300042010 Bacteria 459139
1133 Ga0439452_000012 3300042010 Bacteria 412478
1134 Ga0439452_000039 3300042010 Bacteria 145243
1135 Ga0439452_003330 3300042010 Bacteria 5652
1136 Ga0439455_0001320 3300042012 Bacteria 4085
1137 Ga0439457_007044 3300042014 Bacteria 2713
1138 Ga0439457_007246 3300042014 Bacteria 2670
1139 Ga0439458_0000056 3300042157 Bacteria 19343
1140 Ga0439458_0000106 3300042157 Bacteria 16619
1141 Ga0439464_0003228 3300042439 Bacteria 4103
1142 Ga0451577_0000660 3300042876 Bacteria 54407
1143 Ga0451577_0022846 3300042876 Bacteria 5709
1144 Ga0451577_0026427 3300042876 Bacteria 5259
1145 Ga0451577_0063292 3300042876 Bacteria 3299
1146 Ga0451577_0163772 3300042876 Bacteria 2003
1147 Ga0451577_0195649 3300042876 Unclassified 1825
1148 Ga0451577_0290746 3300042876 Bacteria 1481
1149 Ga0466969_0011304 3300044656 Bacteria 4727
1150 Ga0466969_0017683 3300044656 Bacteria 3720
1151 Ga0466969_0073274 3300044656 Bacteria 1643
1152 Ga0466972_0000008 3300044658 Bacteria 264518
1153 Ga0466972_0000032 3300044658 Bacteria 159445
1154 Ga0466972_0000099 3300044658 Bacteria 76709
1155 Ga0466972_0008359 3300044658 Bacteria 5188
1156 Ga0466972_0032304 3300044658 Bacteria 2571
1157 Ga0466981_0000033 3300044669 Bacteria 64864
1158 Ga0453683_0000135 3300044673 Bacteria 107930
1159 Ga0453683_0026343 3300044673 Bacteria 3692
1160 Ga0453683_0100006 3300044673 Bacteria 1820
1161 Ga0453683_0107530 3300044673 Bacteria 1753
1162 Ga0466966_0000157 3300044684 Bacteria 44093
1163 Ga0466966_0000222 3300044684 Bacteria 38030
1164 Ga0466966_0002934 3300044684 Bacteria 11237
1165 Ga0466966_0008700 3300044684 Bacteria 6719
1166 Ga0466966_0076017 3300044684 Bacteria 2097
1167 Ga0466961_0000565 3300044693 Bacteria 23538
1168 Ga0466961_0010853 3300044693 Bacteria 5817
1169 Ga0466961_0027192 3300044693 Bacteria 3678
1170 Ga0466964_0006766 3300044706 Bacteria 4273
1171 Ga0466964_0007857 3300044706 Bacteria 3994
1172 Ga0453684_0000553 3300044712 Bacteria 141396
1173 Ga0453684_0001244 3300044712 Bacteria 77266
1174 Ga0453684_0003919 3300044712 Bacteria 32695
1175 Ga0453684_0009187 3300044712 Bacteria 17377
1176 Ga0453684_0011435 3300044712 Bacteria 14889
1177 Ga0453684_0027373 3300044712 Bacteria 8179
1178 Ga0453684_0049262 3300044712 Bacteria 5558
1179 Ga0453684_0072712 3300044712 Bacteria 4339
1180 Ga0453684_0084391 3300044712 Bacteria 3950
1181 Ga0453684_0325186 3300044712 Bacteria 1740
1182 Ga0466971_0002102 3300044719 Bacteria 8444
1183 Ga0466971_0002161 3300044719 Bacteria 8316
1184 Ga0466968_0005875 3300044735 Bacteria 4606
1185 Ga0466970_0008939 3300044765 Bacteria 5052
1186 Ga0466970_0031607 3300044765 Bacteria 2796
1187 Ga0466970_0037259 3300044765 Bacteria 2577
1188 Ga0466957_0000013 3300044842 Bacteria 71310
1189 Ga0466957_0004749 3300044842 Bacteria 7609
1190 Ga0466957_0006610 3300044842 Bacteria 6557
1191 Ga0466957_0030457 3300044842 Bacteria 3222
1192 Ga0466960_0031512 3300044901 Bacteria 2448
1193 Ga0466960_0076825 3300044901 Bacteria 1673
1194 Ga0466959_0001636 3300045049 Bacteria 13844
1195 Ga0466959_0005022 3300045049 Bacteria 8985
1196 Ga0466959_0010903 3300045049 Bacteria 6516
1197 Ga0466959_0019618 3300045049 Bacteria 4972
1198 Ga0466959_0027743 3300045049 Bacteria 4199
1199 Ga0451576_0000112 3300045051 Bacteria 209574
1200 Ga0451576_0001577 3300045051 Bacteria 38299
1201 Ga0451576_0056604 3300045051 Bacteria 4100
1202 Ga0451576_0058884 3300045051 Bacteria 4012
1203 Ga0451576_0209097 3300045051 Bacteria 2038
1204 Ga0466958_0001403 3300045836 Bacteria 11395
1205 Ga0466958_0002680 3300045836 Bacteria 9016
1206 Ga0466967_0027952 3300045976 Bacteria 4700
1207 Ga0466967_0038134 3300045976 Bacteria 4119
1208 Ga0495627_000181 3300046453 Bacteria 71127
1209 Ga0495627_002499 3300046453 Bacteria 8778
1210 Ga0495592_0162110 3300046454 Bacteria 1538
1211 Ga0495590_0007233 3300046457 Bacteria 4292
1212 Ga0495591_000029 3300046458 Bacteria 179657
1213 Ga0495591_000094 3300046458 Bacteria 101106
1214 Ga0495591_006502 3300046458 Bacteria 5160
1215 Ga0495638_0003576 3300046460 Bacteria 12171
1216 Ga0495638_0014448 3300046460 Bacteria 5335
1217 Ga0495638_0041297 3300046460 Bacteria 2919
1218 Ga0495638_0105728 3300046460 Bacteria 1677
1219 Ga0495638_0112814 3300046460 Bacteria 1613
1220 Ga0495651_0057753 3300046462 Bacteria 2979
1221 Ga0495650_0000033 3300046471 Bacteria 412188
1222 Ga0495650_0000103 3300046471 Bacteria 210023
1223 Ga0495650_0000167 3300046471 Bacteria 145804
1224 Ga0495650_0000189 3300046471 Bacteria 133931
1225 Ga0495650_0000519 3300046471 Bacteria 57139
1226 Ga0495582_0058936 3300046473 Bacteria 2118
1227 Ga0495605_0000055 3300046474 Bacteria 157514
1228 Ga0495605_0000068 3300046474 Bacteria 137743
1229 Ga0495605_0055374 3300046474 Bacteria 1916
1230 Ga0495584_0000576 3300046491 Bacteria 24776
1231 Ga0495584_0001279 3300046491 Bacteria 15309
1232 Ga0495584_0023801 3300046491 Bacteria 3104
1233 Ga0495585_0000018 3300046492 Bacteria 162473
1234 Ga0495585_0001568 3300046492 Bacteria 17756
1235 Ga0495596_0003492 3300046500 Bacteria 7934
1236 Ga0495596_0006128 3300046500 Bacteria 5585
1237 Ga0495607_0001005 3300046501 Bacteria 25961
1238 Ga0495607_0003503 3300046501 Bacteria 11999
1239 Ga0495607_0006487 3300046501 Bacteria 8227
1240 Ga0495606_0000008 3300046507 Bacteria 321373
1241 Ga0495606_0000419 3300046507 Bacteria 71128
1242 Ga0495606_0000619 3300046507 Bacteria 55941
1243 Ga0495606_0001898 3300046507 Bacteria 26072
1244 Ga0495606_0004447 3300046507 Bacteria 14002
1245 Ga0495606_0014229 3300046507 Bacteria 6224
1246 Ga0495606_0020180 3300046507 Bacteria 4925
1247 Ga0495606_0028183 3300046507 Bacteria 3966
1248 Ga0495606_0037911 3300046507 Bacteria 3268
1249 Ga0495610_0000148 3300046512 Bacteria 77303
1250 Ga0495610_0000266 3300046512 Bacteria 54387
1251 Ga0495610_0001323 3300046512 Bacteria 21995
1252 Ga0495610_0004181 3300046512 Bacteria 10786
1253 Ga0495610_0007362 3300046512 Bacteria 7348
1254 Ga0495610_0022376 3300046512 Bacteria 3459
1255 Ga0495616_0002554 3300046513 Bacteria 12011
1256 Ga0495616_0004107 3300046513 Bacteria 9231
1257 Ga0495616_0015961 3300046513 Bacteria 4164
1258 Ga0495616_0023858 3300046513 Bacteria 3287
1259 Ga0495616_0049087 3300046513 Bacteria 2117
1260 Ga0495618_0019272 3300046514 Bacteria 4196
1261 Ga0495630_0041133 3300046517 Bacteria 3452
1262 Ga0495630_0154644 3300046517 Bacteria 1746
1263 Ga0495630_0207858 3300046517 Bacteria 1494
1264 Ga0495637_0032499 3300046520 Bacteria 2298
1265 Ga0495637_0065569 3300046520 Bacteria 1478
1266 Ga0495644_0016290 3300046523 Unclassified 2845
1267 Ga0495644_0044795 3300046523 Bacteria 1664
1268 Ga0495648_0002776 3300046524 Bacteria 15794
1269 Ga0495648_0003058 3300046524 Bacteria 14968
1270 Ga0495648_0004838 3300046524 Bacteria 11366
1271 Ga0495642_0044151 3300046528 Bacteria 1819
1272 Ga0495654_0000078 3300046530 Bacteria 110443
1273 Ga0495654_0000572 3300046530 Bacteria 29558
1274 Ga0495654_0000616 3300046530 Bacteria 28330
1275 Ga0495654_0026535 3300046530 Bacteria 2977
1276 Ga0495609_0000038 3300046538 Bacteria 182264
1277 Ga0495609_0000190 3300046538 Bacteria 61573
1278 Ga0495609_0000254 3300046538 Bacteria 50695
1279 Ga0495609_0001935 3300046538 Bacteria 13177
1280 Ga0495609_0025233 3300046538 Bacteria 2726
1281 Ga0495622_0000053 3300046557 Bacteria 102938
1282 Ga0495633_0000022 3300046558 Bacteria 226582
1283 Ga0495633_0000177 3300046558 Bacteria 82953
1284 Ga0495668_0000009 3300046616 Bacteria 492623
1285 Ga0495668_0001086 3300046616 Bacteria 28354
1286 Ga0495668_0001824 3300046616 Bacteria 19303
1287 Ga0495668_0003068 3300046616 Bacteria 12940
1288 Ga0495668_0010689 3300046616 Bacteria 5545
1289 Ga0495625_0000017 3300046660 Bacteria 299728
1290 Ga0495625_0000375 3300046660 Bacteria 68361
1291 Ga0495625_0000785 3300046660 Bacteria 44141
1292 Ga0495625_0001098 3300046660 Bacteria 35115
1293 Ga0495625_0007459 3300046660 Bacteria 9513
1294 Ga0495625_0013468 3300046660 Bacteria 6571
1295 Ga0495625_0029100 3300046660 Bacteria 4135
1296 Ga0495625_0042106 3300046660 Bacteria 3321
1297 Ga0495635_0099339 3300046663 Bacteria 1989
1298 Ga0495659_0001483 3300046664 Bacteria 7958
1299 Ga0495661_0000070 3300046665 Bacteria 124795
1300 Ga0495661_0000400 3300046665 Bacteria 46177
1301 Ga0495661_0000838 3300046665 Bacteria 28709
1302 Ga0495661_0002871 3300046665 Bacteria 13037
1303 Ga0495661_0043170 3300046665 Bacteria 2773
1304 Ga0495661_0131899 3300046665 Bacteria 1368
1305 Ga0495588_0000172 3300046674 Bacteria 81934
1306 Ga0495658_0032269 3300046683 Bacteria 2859
1307 Ga0495658_0033214 3300046683 Bacteria 2824
1308 Ga0495669_0005794 3300046684 Bacteria 5151
1309 Ga0495613_0063067 3300046689 Bacteria 2712
1310 Ga0495671_0003259 3300046692 Bacteria 10072
1311 Ga0495649_0000008 3300046694 Bacteria 483706
1312 Ga0495649_0001447 3300046694 Bacteria 17893
1313 Ga0495649_0012203 3300046694 Bacteria 5009
1314 Ga0495649_0044924 3300046694 Bacteria 2411
1315 Ga0495589_0000010 3300046794 Bacteria 250407
1316 Ga0495589_0000126 3300046794 Bacteria 70547
1317 Ga0495589_0000211 3300046794 Bacteria 49487
1318 Ga0495589_0008358 3300046794 Bacteria 5409
1319 Ga0495660_0000011 3300046810 Bacteria 361397
1320 Ga0495660_0000047 3300046810 Bacteria 149291
1321 Ga0495674_0035314 3300047319 Unclassified 4512
1322 Ga0495672_0000004 3300047320 Bacteria 631810
1323 Ga0495672_0000392 3300047320 Bacteria 53737
1324 Ga0495672_0001319 3300047320 Bacteria 24677
1325 Ga0495672_0042879 3300047320 Bacteria 2725
1326 Ga0495672_0043010 3300047320 Bacteria 2719
1327 Ga0495680_0062162 3300047322 Bacteria 2872
1328 Ga0495683_0009241 3300047323 Bacteria 5253
1329 Ga0495683_0033417 3300047323 Bacteria 2617
1330 Ga0495687_000001 3300047443 Bacteria 1215582
1331 Ga0495687_000071 3300047443 Bacteria 159096
1332 Ga0495687_000363 3300047443 Bacteria 56664
1333 Ga0495687_003106 3300047443 Bacteria 12423
1334 Ga0495687_004707 3300047443 Bacteria 9058
1335 Ga0495675_0084072 3300047444 Bacteria 2003
1336 Ga0495677_0000016 3300047445 Bacteria 126981
1337 Ga0495677_0003062 3300047445 Bacteria 6500
1338 Ga0495677_0012949 3300047445 Bacteria 3037
1339 Ga0495673_0000023 3300047469 Bacteria 539904
1340 Ga0495673_0000079 3300047469 Bacteria 202569
1341 Ga0495681_0011881 3300047470 Bacteria 5148
1342 Ga0495686_0001966 3300047472 Bacteria 20417
1343 Ga0495686_0035024 3300047472 Bacteria 3230
1344 Ga0495602_0082369 3300048088 Bacteria 2701
1345 Ga0495626_0000042 3300048091 Bacteria 169058
1346 Ga0495626_0000533 3300048091 Bacteria 37890
1347 Ga0496100_0032077 3300048903 Unclassified 3272
1348 Ga0496101_0000029 3300048904 Bacteria 198515
1349 Ga0496101_0030747 3300048904 Bacteria 3769
1350 Ga0496102_0001288 3300048905 Bacteria 22599
1351 Ga0496102_0076783 3300048905 Bacteria 3073
1352 Ga0496103_0154689 3300048906 Bacteria 1469
1353 Ga0496104_0000098 3300048907 Bacteria 84601
1354 Ga0496104_0108208 3300048907 Bacteria 2664
1355 Ga0496105_0020177 3300048908 Bacteria 5382
1356 Ga0496106_0016890 3300048909 Bacteria 5401
1357 Ga0496106_0186055 3300048909 Unclassified 1650
1358 Ga0496107_0002047 3300048910 Bacteria 12887
1359 Ga0496109_0019183 3300048912 Bacteria 6023
1360 Ga0496111_0153113 3300048914 Bacteria 1711
1361 Ga0496113_0022284 3300048916 Bacteria 4478
1362 Ga0496115_0109466 3300048918 Bacteria 2269
1363 Ga0496116_0000075 3300048919 Bacteria 231674
1364 Ga0496116_0000077 3300048919 Bacteria 227959
1365 Ga0496116_0006079 3300048919 Bacteria 11043
1366 Ga0496116_0028515 3300048919 Bacteria 4042
1367 Ga0496116_0032177 3300048919 Bacteria 3742
1368 Ga0496116_0035909 3300048919 Bacteria 3476
1369 Ga0496116_0041821 3300048919 Bacteria 3140
1370 Ga0496116_0041883 3300048919 Bacteria 3137
1371 Ga0496117_0000054 3300048920 Bacteria 278013
1372 Ga0496117_0000593 3300048920 Bacteria 59578
1373 Ga0496117_0000635 3300048920 Bacteria 56535
1374 Ga0496117_0002611 3300048920 Bacteria 22395
1375 Ga0496117_0006228 3300048920 Bacteria 12166
1376 Ga0496117_0025066 3300048920 Bacteria 4698
1377 Ga0496117_0051088 3300048920 Bacteria 2926
1378 Ga0496117_0129807 3300048920 Bacteria 1530
1379 Ga0496118_0000045 3300048921 Bacteria 275165
1380 Ga0496118_0006469 3300048921 Bacteria 12865
1381 Ga0496118_0008371 3300048921 Bacteria 10697
1382 Ga0496118_0032272 3300048921 Bacteria 4319
1383 Ga0496118_0033182 3300048921 Bacteria 4241
1384 Ga0496118_0040958 3300048921 Bacteria 3675
1385 Ga0496118_0057976 3300048921 Bacteria 2898
1386 Ga0496118_0067077 3300048921 Bacteria 2615
1387 Ga0496118_0084529 3300048921 Bacteria 2213
1388 Ga0496118_0086752 3300048921 Bacteria 2174
1389 Ga0496119_0000023 3300048922 Bacteria 259882
1390 Ga0496119_0001077 3300048922 Bacteria 34526
1391 Ga0496119_0001451 3300048922 Bacteria 28525
1392 Ga0496119_0001653 3300048922 Bacteria 26225
1393 Ga0496119_0002580 3300048922 Bacteria 19700
1394 Ga0496119_0009788 3300048922 Bacteria 8155
1395 Ga0496119_0015944 3300048922 Bacteria 5749
1396 Ga0496119_0022542 3300048922 Bacteria 4502
1397 Ga0496119_0024430 3300048922 Bacteria 4251
1398 Ga0496119_0041172 3300048922 Bacteria 2945
1399 Ga0496119_0049672 3300048922 Bacteria 2591
1400 Ga0496120_0000112 3300048923 Bacteria 136735
1401 Ga0496120_0000139 3300048923 Bacteria 120489
1402 Ga0496120_0000177 3300048923 Bacteria 108260
1403 Ga0496120_0000407 3300048923 Bacteria 69144
1404 Ga0496120_0007202 3300048923 Bacteria 8326
1405 Ga0496120_0009875 3300048923 Bacteria 6723
1406 Ga0496120_0018341 3300048923 Bacteria 4514
1407 Ga0496120_0022093 3300048923 Bacteria 4006
1408 Ga0496120_0035790 3300048923 Bacteria 2961
1409 Ga0496120_0039461 3300048923 Bacteria 2785
1410 Ga0496121_0000010 3300048924 Bacteria 793488
1411 Ga0496121_0002021 3300048924 Bacteria 32182
1412 Ga0496121_0005398 3300048924 Bacteria 16413
1413 Ga0496121_0013963 3300048924 Bacteria 8579
1414 Ga0496121_0034633 3300048924 Bacteria 4542
1415 Ga0496121_0054576 3300048924 Bacteria 3336
1416 Ga0496121_0074282 3300048924 Bacteria 2720
1417 Ga0496121_0119078 3300048924 Bacteria 1997
1418 Ga0496121_0136441 3300048924 Bacteria 1827
1419 Ga0496122_0000108 3300048925 Bacteria 191029
1420 Ga0496122_0000348 3300048925 Bacteria 99830
1421 Ga0496122_0000771 3300048925 Bacteria 61695
1422 Ga0496122_0001079 3300048925 Bacteria 47351
1423 Ga0496122_0003177 3300048925 Bacteria 21905
1424 Ga0496122_0005356 3300048925 Bacteria 15325
1425 Ga0496122_0018906 3300048925 Bacteria 6328
1426 Ga0496122_0020291 3300048925 Bacteria 6014
1427 Ga0496122_0025156 3300048925 Bacteria 5181
1428 Ga0496122_0026213 3300048925 Bacteria 5033
1429 Ga0496122_0042259 3300048925 Bacteria 3588
1430 Ga0496122_0043681 3300048925 Bacteria 3507
1431 Ga0496122_0070880 3300048925 Bacteria 2486
1432 Ga0496123_0000065 3300048926 Bacteria 211758
1433 Ga0496123_0000424 3300048926 Bacteria 76245
1434 Ga0496123_0000781 3300048926 Bacteria 51428
1435 Ga0496123_0002969 3300048926 Bacteria 19747
1436 Ga0496123_0005408 3300048926 Bacteria 12865
1437 Ga0496123_0008601 3300048926 Bacteria 9343
1438 Ga0496123_0009042 3300048926 Bacteria 9030
1439 Ga0496123_0011737 3300048926 Bacteria 7553
1440 Ga0496123_0012625 3300048926 Bacteria 7179
1441 Ga0496123_0015732 3300048926 Bacteria 6188
1442 Ga0496123_0079081 3300048926 Bacteria 2011
1443 Ga0496124_0000100 3300048927 Bacteria 181404
1444 Ga0496124_0001570 3300048927 Bacteria 33020
1445 Ga0496124_0005306 3300048927 Bacteria 14562
1446 Ga0496124_0005767 3300048927 Bacteria 13782
1447 Ga0496124_0005834 3300048927 Bacteria 13666
1448 Ga0496124_0007587 3300048927 Bacteria 11503
1449 Ga0496124_0022824 3300048927 Bacteria 5729
1450 Ga0496124_0025452 3300048927 Bacteria 5359
1451 Ga0496125_0000070 3300048928 Bacteria 245793
1452 Ga0496125_0000104 3300048928 Bacteria 201270
1453 Ga0496125_0000509 3300048928 Bacteria 67449
1454 Ga0496125_0003423 3300048928 Bacteria 19252
1455 Ga0496125_0009046 3300048928 Bacteria 10312
1456 Ga0496125_0016571 3300048928 Bacteria 7069
1457 Ga0496125_0019538 3300048928 Bacteria 6385
1458 Ga0496125_0117900 3300048928 Bacteria 1902
1459 Ga0496125_0181345 3300048928 Bacteria 1402
1460 Ga0496126_0001489 3300048929 Bacteria 36334
1461 Ga0496126_0001777 3300048929 Bacteria 31874
1462 Ga0496126_0040747 3300048929 Bacteria 4304
1463 Ga0496126_0044023 3300048929 Bacteria 4113
1464 Ga0496126_0049927 3300048929 Bacteria 3816
1465 Ga0496126_0087468 3300048929 Bacteria 2745
1466 Ga0501344_00526 3300049133 Bacteria 1617
1467 Ga0501345_00240 3300049134 Bacteria 1676
1468 Ga0495678_000415 3300049459 Bacteria 43047
1469 Ga0495678_006121 3300049459 Bacteria 6463
1470 Ga0495682_0000004 3300049460 Bacteria 378337
1471 Ga0495682_0043443 3300049460 Bacteria 1646
1472 Ga0501300_002577 3300049523 Bacteria 2717
1473 Ga0501315_000769 3300049531 Bacteria 2411
1474 Ga0501334_00617 3300049550 Bacteria 1706
1475 Ga0501336_000088 3300049552 Bacteria 3212
1476 Ga0501340_000804 3300049556 Bacteria 1529
1477 Ga0501032_0003830 3300049569 Bacteria 11429
1478 Ga0501032_0066866 3300049569 Unclassified 2402
1479 Ga0501033_0032638 3300049570 Bacteria 3911
1480 Ga0501034_0026227 3300049571 Bacteria 5935
1481 Ga0501034_0035363 3300049571 Bacteria 5065
1482 Ga0501034_0103328 3300049571 Bacteria 2843
1483 Ga0501036_0127085 3300049572 Unclassified 2153
1484 Ga0501037_0014870 3300049573 Bacteria 5726
1485 Ga0501037_0024855 3300049573 Bacteria 4429
1486 Ga0501038_0112597 3300049574 Bacteria 2253
1487 Ga0501043_0068988 3300049579 Unclassified 2777
1488 Ga0501043_0147839 3300049579 Unclassified 1839
1489 Ga0501047_0011115 3300049581 Bacteria 8520
1490 Ga0501047_0013626 3300049581 Bacteria 7714
1491 Ga0501047_0015992 3300049581 Bacteria 7154
1492 Ga0501047_0032071 3300049581 Bacteria 5070
1493 Ga0501047_0046535 3300049581 Bacteria 4193
1494 Ga0501047_0112786 3300049581 Bacteria 2601
1495 Ga0501069_0028606 3300049585 Bacteria 3057
1496 Ga0501070_0116525 3300049586 Bacteria 2206
1497 Ga0501071_0012334 3300049587 Bacteria 5795
1498 Ga0501074_0004546 3300049590 Bacteria 9930
1499 Ga0501199_001224 3300049650 Bacteria 2310
1500 Ga0501217_008773 3300049661 Bacteria 2190
1501 Ga0501236_000080 3300049670 Bacteria 8714
1502 Ga0501249_000030 3300049679 Bacteria 80958
1503 Ga0501257_021605 3300049686 Unclassified 1519
1504 Ga0501245_002382 3300049708 Bacteria 2510
1505 Ga0501241_009726 3300049758 Bacteria 1750
1506 Ga0501264_000029 3300049761 Bacteria 22049
1507 Ga0501266_000008 3300049763 Bacteria 241629
1508 Ga0501266_000013 3300049763 Bacteria 183849
1509 Ga0501035_0000359 3300049822 Bacteria 52585
1510 Ga0501035_0033273 3300049822 Bacteria 4688
1511 Ga0501035_0075798 3300049822 Bacteria 2975
1512 Ga0501044_0005351 3300049823 Bacteria 14267
1513 Ga0501044_0017177 3300049823 Bacteria 7763
1514 Ga0501044_0020067 3300049823 Bacteria 7136
1515 Ga0501044_0391186 3300049823 Unclassified 1304
1516 nmdc:mga00v17_196_c1 3300050491 Bacteria 36286
1517 nmdc:mga00v17_23251_c1 3300050491 Bacteria 3584
1518 nmdc:mga00v17_4576_c1 3300050491 Bacteria 7211
1519 nmdc:mga0k408_1724_c1 3300050493 Bacteria 11736
1520 nmdc:mga0k408_66023_c1 3300050493 Bacteria 2107
1521 nmdc:mga06z11_8598_c1 3300050494 Bacteria 4267
1522 nmdc:mga09592_100881_c1 3300050508 Bacteria 2472
1523 nmdc:mga08y16_334798_c1 3300050511 Bacteria 1556
1524 nmdc:mga08y16_62681_c1 3300050511 Bacteria 3883
1525 nmdc:mga08y16_65537_c1 3300050511 Bacteria 3792
1526 Ga0495619_0116661 3300053085 Bacteria 1828
1527 Ga0500578_0000001 3300053086 Bacteria 317120
1528 Ga0500578_0000065 3300053086 Bacteria 117032
1529 Ga0500578_0021415 3300053086 Bacteria 4154
1530 Ga0500644_0000078 3300053088 Bacteria 59447
1531 Ga0500646_0001488 3300053090 Bacteria 6161
1532 Ga0500583_0000013 3300053092 Bacteria 150087
1533 Ga0500583_0000083 3300053092 Bacteria 53982
1534 Ga0500583_0001261 3300053092 Bacteria 7225
1535 Ga0500583_0051084 3300053092 Bacteria 1920
1536 Ga0500641_0000012 3300053096 Bacteria 164908
1537 Ga0500558_074059 3300053106 Bacteria 1399
1538 Ga0500562_000003 3300053108 Bacteria 293779
1539 Ga0500569_000269 3300053109 Bacteria 8190
1540 Ga0500608_000802 3300053122 Bacteria 11412
1541 Ga0500608_009290 3300053122 Bacteria 4168
1542 Ga0500618_000290 3300053125 Bacteria 38288
1543 Ga0500621_000001 3300053126 Bacteria 1049698
1544 Ga0500658_0000005 3300053134 Bacteria 369268
1545 Ga0500658_0000043 3300053134 Bacteria 73664
1546 Ga0500658_0003731 3300053134 Bacteria 5738
1547 Ga0500559_0000112 3300053136 Bacteria 63817
1548 Ga0500559_0011531 3300053136 Bacteria 3775
1549 Ga0500559_0014817 3300053136 Bacteria 3294
1550 Ga0500568_0007556 3300053139 Bacteria 5319
1551 Ga0500577_0002288 3300053142 Bacteria 4883
1552 Ga0500586_000866 3300053145 Bacteria 6263
1553 Ga0500588_0002345 3300053146 Bacteria 3832
1554 Ga0500588_0007061 3300053146 Bacteria 2576
1555 Ga0500616_0000075 3300053153 Bacteria 221455
1556 Ga0500616_0036958 3300053153 Bacteria 2646
1557 Ga0500622_0000066 3300053156 Bacteria 124842
1558 Ga0500622_0000475 3300053156 Bacteria 37778
1559 Ga0500622_0000546 3300053156 Bacteria 34660
1560 Ga0500622_0000677 3300053156 Bacteria 30106
1561 Ga0500622_0001523 3300053156 Bacteria 18373
1562 Ga0500622_0002438 3300053156 Bacteria 13428
1563 Ga0500622_0005953 3300053156 Bacteria 7182
1564 Ga0500622_0021019 3300053156 Bacteria 3464
1565 Ga0500622_0094691 3300053156 Bacteria 1477
1566 Ga0500624_000479 3300053157 Bacteria 11822
1567 Ga0500627_0089310 3300053158 Bacteria 1379
1568 Ga0500633_0005708 3300053160 Bacteria 2984
1569 Ga0500636_0017902 3300053177 Bacteria 4188
1570 Ga0500637_0018077 3300053178 Bacteria 3782
1571 Ga0500637_0031875 3300053178 Bacteria 2937
1572 Ga0500584_001081 3300053726 Bacteria 8990
1573 Ga0500611_000094 3300053727 Bacteria 25623
1574 Ga0500645_020539 3300053730 Bacteria 2047
1575 Ga0500661_010982 3300055283 Bacteria 1643
1576 Ga0466962_0006890 3300061719 Bacteria 5449
1577 Ga0466962_0007818 3300061719 Bacteria 5126
1578 2932088224 2932082852 Bacteria 6563563
1579 2506580849 2506520007 Bacteria 5442880
1580 2506585988 2506520008 Bacteria 5443009
1581 2508854656 2508501071 Bacteria 5454741
1582 2511125239 2510917020 Bacteria 5657507
1583 2511379307 2511231025 Bacteria 5324661
1584 2511436175 2511231035 Bacteria 5341610
1585 2547698305 2547132181 Bacteria 4945084
1586 2548648108 2547132416 Bacteria 4633861
1587 2562464823 2561511199 Bacteria 5155034
1588 2585152119 2582581280 Bacteria 5994497
1589 2585194397 2582581293 Bacteria 5907401
1590 2586208182 2585427687 Bacteria 5544917
1591 2599411825 2599185169 Bacteria 5441380
1592 2599480972 2599185184 Bacteria 6430550
1593 2599927203 2599185299 Bacteria 4854625
1594 2600198675 2599185353 Bacteria 2219443
1595 2600401392 2600254943 Bacteria 2613887
1596 2601524502 2600255254 Bacteria 5281859
1597 2601529656 2600255255 Bacteria 5282785
1598 2601534694 2600255256 Bacteria 5597742
1599 2601539279 2600255257 Bacteria 5597196
1600 2601616490 2600255280 Bacteria 5292309
1601 2601621212 2600255281 Bacteria 5288753
1602 2601646191 2600255287 Bacteria 5210468
1603 2601649609 2600255288 Bacteria 5282738
1604 2601654536 2600255289 Bacteria 5281907
1605 2601660190 2600255290 Bacteria 5282218
1606 2601664305 2600255291 Bacteria 5217298
1607 2601699121 2600255298 Bacteria 5215185
1608 2601702530 2600255299 Bacteria 5218662
1609 2601707280 2600255300 Bacteria 5287774
1610 2601712301 2600255301 Bacteria 5280532
1611 2601717797 2600255302 Bacteria 5288235
1612 2601723033 2600255303 Bacteria 5219315
1613 2601727725 2600255304 Bacteria 5283973
1614 2601732742 2600255305 Bacteria 5282329
1615 2601737489 2600255306 Bacteria 5281613
1616 2601741908 2600255307 Bacteria 5439064
1617 2601752806 2600255309 Bacteria 5431045
1618 2601757628 2600255310 Bacteria 5600903
1619 2601763987 2600255311 Bacteria 5598766
1620 2602021768 2600255392 Bacteria 5437392
1621 2603640335 2602042046 Bacteria 5483348
1622 2603645984 2602042047 Bacteria 4697674
1623 2603662469 2602042052 Bacteria 5215873
1624 2603667365 2602042053 Bacteria 5214361
1625 2603701762 2602042066 Bacteria 4423871
1626 2603706421 2602042067 Bacteria 4863713
1627 2603840151 2602042103 Bacteria 5284714
1628 2603845228 2602042104 Bacteria 5281639
1629 2603850301 2602042105 Bacteria 5282303
1630 2603855369 2602042106 Bacteria 5282744
1631 2603868365 2602042109 Bacteria 5152801
1632 2603873183 2602042110 Bacteria 5283285
1633 2603878176 2602042111 Bacteria 5212080
1634 2606050130 2603880178 Bacteria 5283018
1635 2606071794 2603880184 Bacteria 5217896
1636 2606147813 2603880202 Bacteria 5284684
1637 2606178252 2603880211 Bacteria 5284226
1638 2608668621 2608642108 Bacteria 4104624
1639 2609911247 2609459761 Bacteria 5513740
1640 2637222953 2636415599 Bacteria 5718434
1641 2643801201 2643221556 Bacteria 7251154
1642 2644008708 2643221600 Bacteria 5530138
1643 2644012756 2643221600 Bacteria 5530138
1644 2644370447 2643221667 Bacteria 5627472
1645 2644471807 2643221684 Bacteria 7145183
1646 2644641775 2643221716 Bacteria 4986332
1647 2644682108 2643221725 Bacteria 5087956
1648 2650897646 2648501693 Bacteria 5069560
1649 2656276689 2654587920 Bacteria 5475511
1650 2671105268 2667528172 Bacteria 5170840
1651 2676408767 2675903046 Bacteria 5451247
1652 2681998904 2681812866 Bacteria 4552357
1653 2682009644 2681812869 Bacteria 5014465
1654 2686352542 2684622997 Bacteria 4624240
1655 2689447405 2687453601 Bacteria 5546041
1656 2707100922 2706794495 Bacteria 4536932
1657 2722729328 2721755487 Bacteria 6357185
1658 2738713891 2738541276 Bacteria 4690596
1659 2738731680 2738541278 Bacteria 9755573
1660 2738735539 2738541279 Bacteria 6149495
1661 2738756502 2738541283 Bacteria 7222293
1662 2738768116 2738541285 Bacteria 6150075
1663 2738855270 2738541302 Bacteria 5944758
1664 2739217121 2738543007 Bacteria 6149845
1665 2739589307 2739367651 Bacteria 6359826
1666 2739617702 2739367656 Bacteria 5152243
1667 2739648453 2739367663 Bacteria 5040914
1668 2740001760 2739367857 Bacteria 5433684
1669 2740003712 2739367857 Bacteria 5433684
1670 2740006576 2739367858 Bacteria 5432813
1671 2740008529 2739367858 Bacteria 5432813
1672 2753857927 2751185917 Bacteria 4551186
1673 2765591058 2765235842 Bacteria 4799256
1674 2772441213 2772190666 Bacteria 5117644
1675 2777021292 2775507074 Bacteria 5532402
1676 2792311203 2791355010 Bacteria 4864581
1677 2793403654 2791355275 Bacteria 4429597
1678 2802655062 2802428842 Bacteria 4926114
1679 2807180286 2806310673 Bacteria 4801221
1680 2809124742 2808606414 Bacteria 4917181
1681 2813726581 2811995292 Bacteria 5303342
1682 2814693953 2814123068 Bacteria 5687681
1683 2819546719 2818991437 Bacteria 5805520
1684 2819548959 2818991437 Bacteria 5805520
1685 2819677715 2818991460 Bacteria 7595395
1686 2821141812 2821136567 Bacteria 8080116
1687 2823378178 2823373977 Bacteria 4779415
1688 2842715397 2842711865 Bacteria 7155354
1689 2842723825 2842722452 Bacteria 6263924
1690 2842725467 2842722452 Bacteria 6263924
1691 2842908894 2842903701 Bacteria 6986368
1692 2842910337 2842909656 Bacteria 6185908
1693 2842912746 2842909656 Bacteria 6185908
1694 2844429430 2844425489 Bacteria 4854065
1695 2844532101 2844528606 Bacteria 4733806
1696 2847800780 2847797336 Bacteria 5176640
1697 2849282034 2849281842 Bacteria 6065644
1698 2852625838 2852623160 Bacteria 4376875
1699 2854603326 2854601825 Bacteria 4797592
1700 2855195947 2855195626 Bacteria 4927512
1701 2857559223 2857558681 Bacteria 6617694
1702 2857567031 2857564685 Bacteria 6290584
1703 2857620826 2857618242 Bacteria 5635925
1704 2857622380 2857618242 Bacteria 5635925
1705 2857631743 2857627736 Bacteria 5625397
1706 2865017802 2865014394 Bacteria 4764573
1707 2869556838 2869551831 Bacteria 5474685
1708 2871286344 2871282230 Bacteria 4917173
1709 2876602791 2876601092 Bacteria 5114497
1710 2881361078 2881359912 Bacteria 4935907
1711 2881614088 2881609920 Bacteria 4405319
1712 2883072422 2883068021 Bacteria 6192739
1713 2884086821 2884086401 Bacteria 5005459
1714 2884637941 2884634485 Bacteria 3928637
1715 2884794559 2884791551 Bacteria 8511252
1716 2884797658 2884791551 Bacteria 8511252
1717 2884935634 2884933994 Bacteria 4535041
1718 2888371337 2888366609 Bacteria 5155009
1719 2896114998 2896109856 Bacteria 7140722
1720 2896318303 2896317667 Bacteria 4606601
1721 2904425866 2904424332 Bacteria 7633521
1722 2904445327 2904445276 Bacteria 5310396
1723 2904446890 2904445276 Bacteria 5310396
1724 2904469773 2904467357 Bacteria 8057758
1725 2904508258 2904504865 Bacteria 5152820
1726 2904517953 2904513164 Bacteria 5476410
1727 2904780994 2904780799 Bacteria 5840761
1728 2910248856 2910245624 Bacteria 6935613
1729 2911141532 2911138879 Bacteria 5811561
1730 2914763139 2914759650 Bacteria 4701441
1731 2919180542 2919177583 Bacteria 5641607
1732 2919194710 2919191525 Bacteria 5765973
1733 2919195084 2919191525 Bacteria 5765973
1734 2919442701 2919437846 Bacteria 6199444
1735 2919686630 2919683626 Bacteria 5534354
1736 2919693833 2919692658 Bacteria 5943958
1737 2923636967 2923634449 Bacteria 4753480
1738 2927836603 2927833300 Bacteria 4923934
1739 2928080884 2928078545 Bacteria 6534839
1740 2928150209 2928147474 Bacteria 6512076
1741 2928521664 2928519762 Bacteria 1953908
1742 2929150922 2929150217 Bacteria 5462483
1743 2929183293 2929177148 Bacteria 7883697
1744 2929245409 2929239360 Bacteria 7745570
1745 2929926121 2929921140 Bacteria 8649150
1746 2932409353 2932406140 Bacteria 5134491
1747 2935628814 2935625433 Bacteria 5042964
1748 2937540172 2937539931 Bacteria 4639830
1749 2937968881 2937967321 Bacteria 5094075
1750 2939576739 2939573065 Bacteria 4926053
1751 2939581142 2939577877 Bacteria 5132791
1752 2939602955 2939602548 Bacteria 4950493
1753 2939620708 2939617950 Bacteria 4820956
1754 2945875623 2945874760 Bacteria 5527237
1755 2945953877 2945951305 Bacteria 4918162
1756 2945979253 2945977869 Bacteria 7777518
1757 2945999751 2945997725 Bacteria 6404843
1758 2946002447 2945997725 Bacteria 6404843
1759 2946014876 2946013367 Bacteria 7766675
1760 2954017567 2954016120 Bacteria 6446024
1761 2954019333 2954016120 Bacteria 6446024
1762 2969079980 2969079654 Bacteria 5439582
1763 2974314709 2974310843 Bacteria 4947816
1764 2974440493 2974435778 Bacteria 4876478
1765 2978976368 2978975091 Bacteria 4704313
1766 2984495760 2984494565 Bacteria 5000175
1767 2984562434 2984559226 Bacteria 5683096
1768 2984600492 2984595703 Bacteria 5682994
1769 2990265447 2990261002 Bacteria 4919493
1770 640940217 640753048 Bacteria 5495657
1771 8003151862 8003151029 Bacteria 8187759
1772 8004593997 8004592986 Bacteria 5122074
1773 8007371409 8007371054 Bacteria 4849201
1774 8015395176 8015394850 Bacteria 5064660
1775 8016736785 8016733728 Bacteria 5274317
1776 8018222442 8018221730 Bacteria 4616064
1777 8018408926 8018405270 Bacteria 4978981
1778 8019502018 8019499862 Bacteria 5169538
1779 8019507336 8019504834 Bacteria 4819156
1780 8047675401 8047673197 Bacteria 7395230
1781 8054307940 8054307821 Bacteria 5212224
1782 8055590297 8055588893 Bacteria 3619545
1783 8055597190 8055592153 Bacteria 5961247
1784 8056442408 8056440228 Bacteria 4946504
1785 RicEn_C3870
1786 SwRhRL2b_contig_631140
1787 MBSR1b_contig_5928364
1788 JGI24740J21852_10003107
1789 JGI24740J21852_10012470
1790 JGI24737J22298_10031040
1791 JGI24735J21928_10000028
1792 JGI24735J21928_10005158
1793 JGI24735J21928_10008798
1794 JGI24735J21928_10019190
1795 JGI24738J21930_10003820
1796 JGI25162J39368_1000047
1797 JGI25162J39368_1000183
1798 JGI25162J39368_1000496
1799 JGI25154J39366_1000080
1800 JGI25152J39213_1000513
1801 JGI25150J39212_1000008
1802 JGI25151J46595_10000014
1803 JGI25151J46595_10000887
1804 JGI25151J46595_10002451
1805 JGI25151J46595_10005962
1806 JGI25165J46597_1000043
1807 JGI25165J46597_1000802
1808 JGI25153J46596_10000020
1809 JGI25153J46596_10002621
1810 rootH1_10000810
1811 rootH1_10002962
1812 rootH1_10036744
1813 rootH1_10055138
1814 rootH2_10000230
1815 rootH2_10003679
1816 rootH2_10011814
1817 rootH2_10013605
1818 rootH2_10024296
1819 rootH2_10051442
1820 rootH2_10056661
1821 rootH2_10071853
1822 rootH2_10118897
1823 rootH2_10123222
1824 rootH2_10141248
1825 rootH2_10161859
1826 rootL2_10027207
1827 rootL2_10054875
1828 rootL2_10067288
1829 rootL2_10070945
1830 rootL2_10127765
1831 rootL2_10154743
1832 rootL2_10200472
1833 rootH1_10000727
1834 rootH1_10003785
1835 rootH1_10018881
1836 rootH1_10034687
1837 rootH1_10040702
1838 rootH1_10047799
1839 rootH1_10051913
1840 rootH1_10060101
1841 rootH1_10104912
1842 rootH1_10109702
1843 rootH1_10119890
1844 rootH1_10178156
1845 rootH1_10198885
1846 rootH1_10228699
1847 rootH1_10367847
1848 JGI25160J50197_1001583
1849 JGI25160J50197_1001791
1850 Ga0006562J51391_1029369
1851 Ga0055532_1000238
1852 Ga0055525_1000028
1853 Ga0055542_1007574
1854 Ga0055526_1000131
1855 Ga0055537_1000100
1856 Ga0055536_1000036
1857 Ga0055536_1005098
1858 Ga0055534_1000085
1859 Ga0055528_1000458
1860 Ga0055530_10001821
1861 Ga0055531_10000015
1862 Ga0055531_10000132
1863 Ga0058692_1000146
1864 Ga0058692_1000443
1865 Ga0058692_1001071
1866 Ga0065165_1004837
1867 Ga0065165_1015046
1868 Ga0065703_1018789
1869 Ga0065714_10003442
1870 Ga0065714_10005093
1871 Ga0065714_10064423
1872 Ga0065704_10000577
1873 Ga0065704_10071197
1874 Ga0065704_10071631
1875 Ga0065704_10101511
1876 Ga0065715_10012402
1877 Ga0065715_10134393
1878 Ga0070658_10000014
1879 Ga0070658_10000721
1880 Ga0070658_10038243
1881 Ga0070658_10043816
1882 Ga0070658_10079035
1883 Ga0070658_10226872
1884 Ga0070676_10000207
1885 Ga0070676_10000487
1886 Ga0070676_10003430
1887 Ga0070676_10009602
1888 Ga0070676_10064499
1889 Ga0070683_100000859
1890 Ga0070683_100002782
1891 Ga0070683_100014746
1892 Ga0070683_100034878
1893 Ga0070690_100008784
1894 Ga0070690_100009170
1895 Ga0070690_100139300
1896 Ga0070670_100026107
1897 Ga0070670_100046396
1898 Ga0070670_100211792
1899 Ga0070677_10002635
1900 Ga0068869_100000107
1901 Ga0068869_100013547
1902 Ga0068869_100124699
1903 Ga0070666_10000432
1904 Ga0070666_10001827
1905 Ga0070666_10001999
1906 Ga0070666_10041185
1907 Ga0070680_100000224
1908 Ga0070680_100001771
1909 Ga0070680_100019931
1910 Ga0070682_100000299
1911 Ga0070682_100012301
1912 Ga0070682_100038149
1913 Ga0068868_100000256
1914 Ga0068868_100010309
1915 Ga0068868_100011101
1916 Ga0068868_100014519
1917 Ga0070660_100006203
1918 Ga0070660_100014661
1919 Ga0070660_100020365
1920 Ga0070660_100201502
1921 Ga0070660_100212195
1922 Ga0070689_100192319
1923 Ga0070689_100200100
1924 Ga0070691_10006501
1925 Ga0070661_100006405
1926 Ga0070661_100025950
1927 Ga0070661_100040837
1928 Ga0070668_100001216
1929 Ga0070668_100030597
1930 Ga0070668_100033130
1931 Ga0070669_100006366
1932 Ga0070669_100041267
1933 Ga0070669_100177786
1934 Ga0070675_100011184
1935 Ga0070675_100014343
1936 Ga0070675_100050928
1937 Ga0070675_100064757
1938 Ga0070675_100078505
1939 Ga0070675_100189705
1940 Ga0070671_100001192
1941 Ga0070671_100001920
1942 Ga0070671_100004338
1943 Ga0070671_100005999
1944 Ga0070671_100052400
1945 Ga0070673_100000003
1946 Ga0070673_100001023
1947 Ga0070673_100011904
1948 Ga0070673_100015606
1949 Ga0070673_100034082
1950 Ga0070673_100048651
1951 Ga0070673_100069354
1952 Ga0070673_100105555
1953 Ga0070673_100134895
1954 Ga0070673_100169830
1955 Ga0070659_100003851
1956 Ga0070659_100027076
1957 Ga0070659_100031677
1958 Ga0070659_100038542
1959 Ga0070659_100078286
1960 Ga0070667_100001236
1961 Ga0070667_100006686
1962 Ga0070667_100012516
1963 Ga0070667_100013081
1964 Ga0070667_100025739
1965 Ga0070667_100108343
1966 Ga0070667_100119262
1967 Ga0070667_100145081
1968 Ga0070713_100135064
1969 Ga0070701_10077846
1970 Ga0070705_100011663
1971 Ga0070663_100035123
1972 Ga0070663_100052494
1973 Ga0070663_100059222
1974 Ga0070678_100005233
1975 Ga0070678_100013040
1976 Ga0070678_100168349
1977 Ga0070662_100000054
1978 Ga0070662_100005103
1979 Ga0070662_100008858
1980 Ga0070662_100111484
1981 Ga0070681_10042628
1982 Ga0070681_10051241
1983 Ga0070681_10094627
1984 Ga0070681_10260774
1985 Ga0068867_100000001
1986 Ga0068867_100004058
1987 Ga0068867_100018608
1988 Ga0068867_100067089
1989 Ga0068867_100072714
1990 Ga0068867_100101963
1991 Ga0068867_100179390
1992 Ga0070698_100093392
1993 Ga0070679_100000665
1994 Ga0070679_100009081
1995 Ga0070679_100012347
1996 Ga0070679_100089788
1997 Ga0070684_100000589
1998 Ga0070684_100024374
1999 Ga0070684_100045096
2000 Ga0070684_100149241
2001 Ga0068853_100002572
2002 Ga0068853_100003164
2003 Ga0068853_100004462
2004 Ga0068853_100010823
2005 Ga0068853_100016379
2006 Ga0068853_100023944
2007 Ga0070672_100002671
2008 Ga0070672_100034008
2009 Ga0070672_100036903
2010 Ga0070672_100054755
2011 Ga0070672_100102111
2012 Ga0070672_100110094
2013 Ga0070672_100220239
2014 Ga0070696_100063722
2015 Ga0070693_100121931
2016 Ga0070665_100000001
2017 Ga0070665_100000010
2018 Ga0070665_100000117
2019 Ga0070665_100000858
2020 Ga0070665_100001604
2021 Ga0070665_100008265
2022 Ga0070665_100049509
2023 Ga0068855_100000033
2024 Ga0068855_100000097
2025 Ga0068855_100000189
2026 Ga0068855_100000361
2027 Ga0068855_100001432
2028 Ga0068855_100010449
2029 Ga0068855_100014725
2030 Ga0068855_100021645
2031 Ga0068855_100030000
2032 Ga0068855_100088290
2033 Ga0068855_100109855
2034 Ga0068855_100129080
2035 Ga0068855_100155285
2036 Ga0070664_100001763
2037 Ga0070664_100108257
2038 Ga0070664_100145204
2039 Ga0070664_100161703
2040 Ga0070664_100238375
2041 Ga0070664_100295202
2042 Ga0068857_100000006
2043 Ga0068857_100000416
2044 Ga0068857_100001995
2045 Ga0068857_100072849
2046 Ga0068857_100092526
2047 Ga0068857_100166601
2048 Ga0068854_100001137
2049 Ga0068854_100012640
2050 Ga0068854_100030425
2051 Ga0068854_100046999
2052 Ga0068854_100074559
2053 Ga0068854_100212741
2054 Ga0068856_100001524
2055 Ga0068856_100006605
2056 Ga0068856_100019317
2057 Ga0068856_100033216
2058 Ga0068856_100044125
2059 Ga0068856_100049707
2060 Ga0068856_100076063
2061 Ga0070702_100018818
2062 Ga0068852_100001789
2063 Ga0068852_100012306
2064 Ga0068852_100029381
2065 Ga0068852_100124015
2066 Ga0068852_100148764
2067 Ga0068852_100197264
2068 Ga0068859_100000242
2069 Ga0068859_100000397
2070 Ga0068859_100007103
2071 Ga0068859_100016634
2072 Ga0068859_100020210
2073 Ga0068859_100050940
2074 Ga0068864_100007085
2075 Ga0068864_100024122
2076 Ga0068864_100035435
2077 Ga0068864_100047564
2078 Ga0068866_10006104
2079 Ga0068866_10070976
2080 Ga0068866_10085686
2081 Ga0068861_100010485
2082 Ga0068861_100016454
2083 Ga0068851_10003183
2084 Ga0068851_10006949
2085 Ga0068870_10001223
2086 Ga0068870_10005043
2087 Ga0068870_10034383
2088 Ga0068870_10097862
2089 Ga0068863_100003280
2090 Ga0068863_100006910
2091 Ga0068863_100042965
2092 Ga0068858_100001416
2093 Ga0068858_100014158
2094 Ga0068858_100028195
2095 Ga0068858_100094303
2096 Ga0068858_100122525
2097 Ga0068858_100182600
2098 Ga0068858_100265941
2099 Ga0068858_100364055
2100 Ga0068860_100000046
2101 Ga0068860_100000700
2102 Ga0068860_100001914
2103 Ga0068860_100005835
2104 Ga0068860_100014886
2105 Ga0068860_100016701
2106 Ga0068860_100029570
2107 Ga0068860_100111058
2108 Ga0068860_100139901
2109 Ga0068860_100208693
2110 Ga0068862_100045022
2111 Ga0068862_100113984
2112 Ga0068862_100219741
2113 Ga0081455_10006925
2114 Ga0081539_10000337
2115 Ga0075364_10000169
2116 Ga0075364_10001466
2117 Ga0075364_10011431
2118 Ga0075364_10033181
2119 Ga0075367_10027430
2120 Ga0075366_10000898
2121 Ga0075366_10009323
2122 Ga0075366_10033260
2123 Ga0097621_100000247
2124 Ga0097621_100000277
2125 Ga0097621_100002714
2126 Ga0097621_100005494
2127 Ga0097621_100008121
2128 Ga0097621_100008900
2129 Ga0097621_100046710
2130 Ga0097621_100136578
2131 Ga0068871_100000455
2132 Ga0068871_100001185
2133 Ga0068871_100003771
2134 Ga0068871_100015222
2135 Ga0068871_100038211
2136 Ga0068871_100039603
2137 Ga0068871_100045918
2138 Ga0075428_100031435
2139 Ga0075428_100161497
2140 Ga0075431_100047295
2141 Ga0075429_100125763
2142 Ga0068865_100000011
2143 Ga0068865_100000076
2144 Ga0068865_100001877
2145 Ga0068865_100002323
2146 Ga0097620_100000242
2147 Ga0097620_100000397
2148 Ga0097620_100007103
2149 Ga0097620_100016633
2150 Ga0097620_100020209
2151 Ga0097620_100050942
2152 Ga0099824_1008363
2153 Ga0079104_1000078
2154 Ga0079104_1000117
2155 Ga0079104_1000227
2156 Ga0079104_1000305
2157 Ga0079104_1000836
2158 Ga0079104_1005557
2159 Ga0079104_1011258
2160 Ga0079104_1017478
2161 Ga0079104_1020654
2162 Ga0099826_10001062
2163 Ga0105251_10000230
2164 Ga0105251_10000233
2165 Ga0105251_10000760
2166 Ga0105251_10004261
2167 Ga0105251_10004664
2168 Ga0105251_10007521
2169 Ga0105251_10007546
2170 Ga0105251_10053167
2171 Ga0105244_10000017
2172 Ga0105244_10000046
2173 Ga0105244_10000266
2174 Ga0105244_10001361
2175 Ga0105244_10003529
2176 Ga0105244_10013249
2177 Ga0105244_10014481
2178 Ga0105244_10021608
2179 Ga0105244_10025737
2180 Ga0105244_10036739
2181 Ga0105250_10000012
2182 Ga0105250_10000185
2183 Ga0105250_10004683
2184 Ga0105250_10008198
2185 Ga0105250_10023274
2186 Ga0105250_10043000
2187 Ga0105240_10000074
2188 Ga0105240_10000103
2189 Ga0105240_10003631
2190 Ga0105240_10003829
2191 Ga0105240_10005745
2192 Ga0105240_10011123
2193 Ga0105240_10015220
2194 Ga0105240_10016636
2195 Ga0105240_10027109
2196 Ga0105240_10032969
2197 Ga0105240_10089262
2198 Ga0105240_10101346
2199 Ga0105240_10126435
2200 Ga0105240_10147389
2201 Ga0111539_10002966
2202 Ga0111539_10119193
2203 Ga0111539_10120129
2204 Ga0111539_10325540
2205 Ga0105245_10011909
2206 Ga0105245_10048769
2207 Ga0105245_10231648
2208 Ga0105247_10000238
2209 Ga0105247_10000319
2210 Ga0105247_10003524
2211 Ga0105247_10020148
2212 Ga0114129_10011363
2213 Ga0105243_10000012
2214 Ga0105243_10000241
2215 Ga0105243_10000260
2216 Ga0105243_10090305
2217 Ga0105241_10000013
2218 Ga0105241_10000293
2219 Ga0105241_10000530
2220 Ga0105241_10002996
2221 Ga0105241_10003032
2222 Ga0105241_10003168
2223 Ga0105241_10015322
2224 Ga0105241_10038983
2225 Ga0105241_10068084
2226 Ga0105241_10260364
2227 Ga0105242_10011381
2228 Ga0105242_10016371
2229 Ga0105242_10024565
2230 Ga0105242_10095194
2231 Ga0105242_10096669
2232 Ga0105248_10007416
2233 Ga0105248_10126228
2234 Ga0105248_10314189
2235 Ga0105237_10001686
2236 Ga0105237_10002542
2237 Ga0105237_10003907
2238 Ga0105237_10011277
2239 Ga0105237_10011674
2240 Ga0105237_10025166
2241 Ga0105237_10041982
2242 Ga0105237_10045228
2243 Ga0105237_10078754
2244 Ga0105237_10133804
2245 Ga0105237_10134113
2246 Ga0105237_10174882
2247 Ga0105237_10180224
2248 Ga0105238_10006037
2249 Ga0105238_10034131
2250 Ga0105238_10046342
2251 Ga0105238_10071739
2252 Ga0105238_10122480
2253 Ga0105238_10202318
2254 Ga0105238_10286743
2255 Ga0105249_10011396
2256 Ga0105249_10018519
2257 Ga0105249_10044257
2258 Ga0105249_10054601
2259 Ga0105249_10074907
2260 Ga0105239_10000048
2261 Ga0105239_10000280
2262 Ga0105239_10000696
2263 Ga0105239_10001111
2264 Ga0105239_10002752
2265 Ga0105239_10009182
2266 Ga0105239_10038267
2267 Ga0105239_10053015
2268 Ga0105239_10058061
2269 Ga0105239_10058623
2270 Ga0105239_10071665
2271 Ga0105239_10076795
2272 Ga0105239_10087369
2273 Ga0105239_10094302
2274 Ga0105239_10144933
2275 Ga0105239_10224516
2276 Ga0105246_10001408
2277 Ga0105246_10007124
2278 Ga0105246_10007306
2279 Ga0105246_10025668
2280 Ga0157373_10000127
2281 Ga0157373_10001089
2282 Ga0157373_10012333
2283 Ga0157373_10019294
2284 Ga0157373_10022692
2285 Ga0157373_10042824
2286 Ga0157373_10087577
2287 Ga0157373_10089796
2288 Ga0157373_10155386
2289 Ga0157371_10000003
2290 Ga0157371_10000172
2291 Ga0157371_10000868
2292 Ga0157371_10001625
2293 Ga0157371_10002111
2294 Ga0157371_10002204
2295 Ga0157371_10003848
2296 Ga0157371_10005778
2297 Ga0157371_10011682
2298 Ga0157371_10014562
2299 Ga0157371_10025296
2300 Ga0157371_10037827
2301 Ga0157371_10041007
2302 Ga0157371_10047958
2303 Ga0157371_10049923
2304 Ga0157371_10081240
2305 Ga0157371_10117413
2306 Ga0157370_10000181
2307 Ga0157370_10000313
2308 Ga0157370_10000326
2309 Ga0157370_10000822
2310 Ga0157370_10002652
2311 Ga0157370_10003924
2312 Ga0157370_10005338
2313 Ga0157370_10012037
2314 Ga0157370_10015635
2315 Ga0157370_10067402
2316 Ga0157370_10152496
2317 Ga0157369_10000002
2318 Ga0157369_10000007
2319 Ga0157369_10005374
2320 Ga0157369_10006651
2321 Ga0157369_10014086
2322 Ga0157369_10040373
2323 Ga0157369_10055159
2324 Ga0157369_10057285
2325 Ga0157369_10069413
2326 Ga0157369_10072059
2327 Ga0157374_10000001
2328 Ga0157374_10000379
2329 Ga0157374_10001320
2330 Ga0157374_10001718
2331 Ga0157374_10002276
2332 Ga0157374_10022966
2333 Ga0157374_10050560
2334 Ga0157374_10066312
2335 Ga0157378_10001147
2336 Ga0157378_10002967
2337 Ga0157378_10076603
2338 Ga0157378_10137223
2339 Ga0157378_10162506
2340 Ga0163162_10000063
2341 Ga0163162_10000369
2342 Ga0163162_10001851
2343 Ga0163162_10001857
2344 Ga0163162_10003949
2345 Ga0163162_10005520
2346 Ga0163162_10005992
2347 Ga0163162_10008396
2348 Ga0163162_10037133
2349 Ga0163162_10052107
2350 Ga0163162_10124759
2351 Ga0163162_10163657
2352 Ga0163162_10173443
2353 Ga0157372_10000026
2354 Ga0157372_10000177
2355 Ga0157372_10000459
2356 Ga0157372_10000921
2357 Ga0157372_10004228
2358 Ga0157372_10008214
2359 Ga0157372_10025866
2360 Ga0157372_10040371
2361 Ga0157372_10040920
2362 Ga0157372_10052776
2363 Ga0157372_10053382
2364 Ga0157372_10067478
2365 Ga0157372_10121606
2366 Ga0157372_10189242
2367 Ga0157372_10201868
2368 Ga0157372_10202805
2369 Ga0157372_10302542
2370 Ga0157372_10330229
2371 Ga0157372_10352794
2372 Ga0157375_10000166
2373 Ga0157375_10002575
2374 Ga0157375_10005010
2375 Ga0157375_10015162
2376 Ga0157375_10047011
2377 Ga0157375_10172336
2378 Ga0157375_10241765
2379 Ga0163163_10003388
2380 Ga0163163_10057315
2381 Ga0163163_10220469
2382 Ga0157380_10018712
2383 Ga0157380_10028028
2384 Ga0157380_10036404
2385 Ga0182008_10000004
2386 Ga0182008_10001429
2387 Ga0182008_10008294
2388 Ga0157377_10002998
2389 Ga0157377_10004515
2390 Ga0157377_10006587
2391 Ga0157377_10010180
2392 Ga0157379_10011459
2393 Ga0157379_10037998
2394 Ga0157376_10000176
2395 Ga0157376_10000721
2396 Ga0157376_10001531
2397 Ga0157376_10004624
2398 Ga0157376_10007428
2399 Ga0157376_10110414
2400 Ga0157376_10125471
2401 Ga0157376_10125954
2402 Ga0157376_10228357
2403 Ga0182006_1000009
2404 Ga0182006_1000130
2405 Ga0182006_1000180
2406 Ga0182006_1001603
2407 Ga0182006_1002117
2408 Ga0182006_1005424
2409 Ga0182006_1015934
2410 Ga0182007_10000001
2411 Ga0182007_10000007
2412 Ga0183366_1005
2413 Ga0183370_1005
2414 Ga0183373_1001
2415 Ga0183365_10004
2416 Ga0183369_1016
2417 Ga0183368_1009
2418 Ga0163161_10000019
2419 Ga0163161_10000028
2420 Ga0163161_10000045
2421 Ga0163161_10000376
2422 Ga0163161_10000496
2423 Ga0163161_10002301
2424 Ga0163161_10002434
2425 Ga0163161_10004909
2426 Ga0163161_10154616
2427 Ga0163161_10182786
2428 Ga0213876_10000039
2429 Ga0209436_102822
2430 Ga0209436_103845
2431 Ga0209147_100010
2432 Ga0209563_100011
2433 Ga0207427_100125
2434 Ga0209437_100008
2435 Ga0209437_100089
2436 Ga0209258_100075
2437 Ga0207425_1000007
2438 Ga0209646_1000091
2439 Ga0209026_1000497
2440 Ga0209677_101431
2441 Ga0209148_1000085
2442 Ga0209148_1000117
2443 Ga0209148_1000600
2444 Ga0209148_1003709
2445 Ga0209129_1000006
2446 Ga0209129_1000021
2447 Ga0209233_1000024
2448 Ga0209233_1000079
2449 Ga0209565_1000082
2450 Ga0209455_1000259
2451 Ga0209455_1002019
2452 Ga0209673_1000422
2453 Ga0209130_1000320
2454 Ga0209675_1000176
2455 Ga0209676_1000008
2456 Ga0209676_1000204
2457 Ga0209025_1000043
2458 Ga0209025_1000089
2459 Ga0209025_1000999
2460 Ga0209025_1003105
2461 Ga0209025_1007368
2462 Ga0209025_1009924
2463 Ga0209564_1000438
2464 Ga0209758_1000016
2465 Ga0209758_1023838
2466 Ga0209050_1000180
2467 Ga0209256_1000323
2468 Ga0207426_1000032
2469 Ga0207426_1000057
2470 Ga0207426_1000251
2471 Ga0209257_1000004
2472 Ga0209257_1000005
2473 Ga0207656_10014318
2474 Ga0207656_10026978
2475 Ga0207696_1000040
2476 Ga0207696_1000068
2477 Ga0207696_1000245
2478 Ga0207696_1000525
2479 Ga0207696_1005540
2480 Ga0207696_1021957
2481 Ga0207655_1000023
2482 Ga0207655_1000034
2483 Ga0207655_1000053
2484 Ga0207655_1000082
2485 Ga0207655_1000106
2486 Ga0207655_1000264
2487 Ga0207655_1001062
2488 Ga0207655_1002562
2489 Ga0207655_1003694
2490 Ga0207655_1005115
2491 Ga0207713_1000017
2492 Ga0207713_1000044
2493 Ga0207713_1000053
2494 Ga0207713_1000062
2495 Ga0207713_1000066
2496 Ga0207713_1006048
2497 Ga0207713_1006491
2498 Ga0207713_1007033
2499 Ga0207713_1013766
2500 Ga0207713_1061774
2501 Ga0207682_10003471
2502 Ga0207642_10021917
2503 Ga0207642_10032843
2504 Ga0207642_10068285
2505 Ga0207710_10000104
2506 Ga0207710_10000693
2507 Ga0207710_10016084
2508 Ga0207680_10000268
2509 Ga0207647_10000046
2510 Ga0207647_10001200
2511 Ga0207647_10027349
2512 Ga0207647_10058493
2513 Ga0207645_10000088
2514 Ga0207645_10000542
2515 Ga0207645_10001902
2516 Ga0207645_10025938
2517 Ga0207645_10075539
2518 Ga0207643_10006182
2519 Ga0207643_10039172
2520 Ga0207643_10060148
2521 Ga0207643_10061613
2522 Ga0207643_10095996
2523 Ga0207705_10000076
2524 Ga0207705_10000107
2525 Ga0207705_10010608
2526 Ga0207705_10012996
2527 Ga0207705_10041503
2528 Ga0207654_10000016
2529 Ga0207654_10000738
2530 Ga0207654_10000743
2531 Ga0207654_10002549
2532 Ga0207654_10013839
2533 Ga0207654_10018530
2534 Ga0207654_10029628
2535 Ga0207707_10000487
2536 Ga0207707_10012617
2537 Ga0207707_10099580
2538 Ga0207707_10154843
2539 Ga0207695_10000019
2540 Ga0207695_10000282
2541 Ga0207695_10002490
2542 Ga0207695_10004745
2543 Ga0207695_10010448
2544 Ga0207695_10015766
2545 Ga0207695_10020921
2546 Ga0207695_10023840
2547 Ga0207695_10045195
2548 Ga0207695_10063197
2549 Ga0207695_10084084
2550 Ga0207671_10000572
2551 Ga0207671_10003026
2552 Ga0207671_10003229
2553 Ga0207671_10019811
2554 Ga0207671_10030327
2555 Ga0207671_10035305
2556 Ga0207671_10058291
2557 Ga0207671_10113039
2558 Ga0207660_10002080
2559 Ga0207660_10008225
2560 Ga0207660_10040547
2561 Ga0207660_10050798
2562 Ga0207662_10025868
2563 Ga0207657_10011508
2564 Ga0207657_10018840
2565 Ga0207657_10023001
2566 Ga0207657_10030460
2567 Ga0207657_10084456
2568 Ga0207657_10091159
2569 Ga0207657_10166850
2570 Ga0207657_10225106
2571 Ga0207649_10004270
2572 Ga0207652_10000055
2573 Ga0207652_10000103
2574 Ga0207652_10003723
2575 Ga0207652_10052292
2576 Ga0207652_10070422
2577 Ga0207652_10152500
2578 Ga0207681_10005187
2579 Ga0207681_10010237
2580 Ga0207681_10149448
2581 Ga0207694_10002468
2582 Ga0207694_10007215
2583 Ga0207694_10048422
2584 Ga0207650_10057853
2585 Ga0207650_10252522
2586 Ga0207659_10005711
2587 Ga0207659_10027151
2588 Ga0207659_10107651
2589 Ga0207659_10125849
2590 Ga0207687_10026062
2591 Ga0207687_10035758
2592 Ga0207700_10127297
2593 Ga0207644_10011358
2594 Ga0207690_10013651
2595 Ga0207690_10018497
2596 Ga0207690_10059178
2597 Ga0207690_10079861
2598 Ga0207690_10178767
2599 Ga0207706_10000115
2600 Ga0207706_10014773
2601 Ga0207706_10019052
2602 Ga0207706_10028637
2603 Ga0207706_10036150
2604 Ga0207706_10069027
2605 Ga0207706_10134591
2606 Ga0207686_10005472
2607 Ga0207709_10000006
2608 Ga0207709_10000119
2609 Ga0207709_10004334
2610 Ga0207670_10062107
2611 Ga0207669_10055806
2612 Ga0207704_10000001
2613 Ga0207704_10004504
2614 Ga0207704_10008805
2615 Ga0207691_10000293
2616 Ga0207691_10008395
2617 Ga0207691_10030637
2618 Ga0207691_10042120
2619 Ga0207691_10151393
2620 Ga0207691_10153826
2621 Ga0207711_10020817
2622 Ga0207711_10168828
2623 Ga0207689_10001830
2624 Ga0207689_10002330
2625 Ga0207689_10006044
2626 Ga0207689_10014794
2627 Ga0207689_10033869
2628 Ga0207689_10047061
2629 Ga0207661_10001626
2630 Ga0207661_10002021
2631 Ga0207661_10056983
2632 Ga0207679_10001158
2633 Ga0207679_10049597
2634 Ga0207679_10106915
2635 Ga0207667_10000046
2636 Ga0207667_10000135
2637 Ga0207667_10000190
2638 Ga0207667_10000391
2639 Ga0207667_10001258
2640 Ga0207667_10003647
2641 Ga0207667_10004453
2642 Ga0207667_10015326
2643 Ga0207667_10044880
2644 Ga0207667_10058074
2645 Ga0207667_10073823
2646 Ga0207667_10097647
2647 Ga0207667_10212267
2648 Ga0207667_10228621
2649 Ga0207651_10000002
2650 Ga0207651_10002459
2651 Ga0207651_10054310
2652 Ga0207651_10071052
2653 Ga0207651_10072948
2654 Ga0207651_10080997
2655 Ga0207651_10127472
2656 Ga0207712_10017200
2657 Ga0207712_10018615
2658 Ga0207712_10023530
2659 Ga0207712_10024170
2660 Ga0207668_10001840
2661 Ga0207668_10013298
2662 Ga0207668_10062151
2663 Ga0207640_10000710
2664 Ga0207640_10022246
2665 Ga0207640_10228886
2666 Ga0207658_10001199
2667 Ga0207658_10006063
2668 Ga0207658_10007214
2669 Ga0207658_10008446
2670 Ga0207658_10166523
2671 Ga0207677_10000042
2672 Ga0207677_10005877
2673 Ga0207677_10013999
2674 Ga0207677_10052863
2675 Ga0207677_10058186
2676 Ga0207703_10000495
2677 Ga0207703_10003145
2678 Ga0207703_10006159
2679 Ga0207703_10153412
2680 Ga0207639_10001961
2681 Ga0207639_10002864
2682 Ga0207639_10016353
2683 Ga0207639_10018367
2684 Ga0207639_10065102
2685 Ga0207639_10077694
2686 Ga0207639_10119487
2687 Ga0207678_10039235
2688 Ga0207678_10072591
2689 Ga0207702_10000165
2690 Ga0207702_10010109
2691 Ga0207702_10017996
2692 Ga0207702_10030948
2693 Ga0207702_10034461
2694 Ga0207641_10000053
2695 Ga0207641_10000734
2696 Ga0207641_10005551
2697 Ga0207641_10018211
2698 Ga0207641_10018628
2699 Ga0207648_10000001
2700 Ga0207648_10003474
2701 Ga0207648_10005517
2702 Ga0207648_10020072
2703 Ga0207648_10021881
2704 Ga0207648_10079790
2705 Ga0207648_10090555
2706 Ga0207648_10136337
2707 Ga0207676_10057538
2708 Ga0207676_10103841
2709 Ga0207674_10000018
2710 Ga0207674_10000672
2711 Ga0207674_10002568
2712 Ga0207674_10011114
2713 Ga0207674_10015732
2714 Ga0207674_10028279
2715 Ga0207674_10057821
2716 Ga0207674_10116814
2717 Ga0207675_100005554
2718 Ga0207675_100017826
2719 Ga0207675_100119454
2720 Ga0207683_10011668
2721 Ga0207683_10021472
2722 Ga0207683_10067406
2723 Ga0207683_10108019
2724 Ga0207683_10155591
2725 Ga0207698_10001560
2726 Ga0207698_10007731
2727 Ga0207698_10025890
2728 Ga0207698_10134973
2729 Ga0209281_1000031
2730 Ga0209281_1000065
2731 Ga0209281_1000088
2732 Ga0209281_1000107
2733 Ga0209281_1000112
2734 Ga0209281_1000162
2735 Ga0209281_1000327
2736 Ga0209281_1000606
2737 Ga0209281_1000649
2738 Ga0209281_1001280
2739 Ga0209281_1010279
2740 Ga0209371_1000010
2741 Ga0209371_1000027
2742 Ga0209371_1000029
2743 Ga0209371_1000092
2744 Ga0209371_1000146
2745 Ga0209371_1000266
2746 Ga0209371_1000270
2747 Ga0209371_1004055
2748 Ga0209371_1009262
2749 Ga0209371_1014847
2750 Ga0209489_109199
2751 Ga0207428_10079113
2752 Ga0268266_10000032
2753 Ga0268266_10000049
2754 Ga0268266_10000079
2755 Ga0268266_10004031
2756 Ga0268266_10095689
2757 Ga0268266_10100658
2758 Ga0268265_10018409
2759 Ga0268265_10136426
2760 Ga0268265_10164881
2761 Ga0268264_10000041
2762 Ga0268264_10000176
2763 Ga0268264_10004390
2764 Ga0268264_10007057
2765 Ga0268264_10011611
2766 Ga0268264_10017902
2767 Ga0268264_10019208
2768 Ga0268264_10022094
2769 Ga0268264_10125354
2770 Ga0268264_10193439
2771 Ga0307517_10000429
2772 Ga0307517_10001171
2773 Ga0307517_10002048
2774 Ga0307515_10000061
2775 Ga0307515_10001027
2776 Ga0307515_10001574
2777 Ga0307515_10015963
2778 Ga0265338_10025958
2779 Ga0265338_10094575
2780 Ga0237817_10010
2781 Ga0268256_1000022
2782 Ga0268256_1000032
2783 Ga0268256_1000045
2784 Ga0268256_1000082
2785 Ga0268256_1000117
2786 Ga0268256_1000248
2787 Ga0268256_1003628
2788 Ga0268256_1003783
2789 Ga0268256_1005563
2790 Ga0268256_1005828
2791 Ga0307511_10001833
2792 Ga0307511_10035570
2793 Ga0316176_1186872
2794 Ga0316181_1204273
2795 Ga0265332_10018318
2796 Ga0265327_10000051
2797 Ga0265327_10023081
2798 Ga0265327_10102392
2799 Ga0265316_10006677
2800 Ga0265316_10137960
2801 Ga0307513_10005109
2802 Ga0307513_10017431
2803 Ga0307513_10060749
2804 Ga0307513_10177668
2805 Ga0307513_10179938
2806 Ga0307513_10242293
2807 Ga0307513_10263851
2808 Ga0307509_10000019
2809 Ga0307509_10085073
2810 Ga0307509_10093472
2811 Ga0307509_10095342
2812 Ga0307509_10192126
2813 Ga0307408_100000005
2814 Ga0307408_100072036
2815 Ga0307508_10002356
2816 Ga0307514_10035615
2817 Ga0316575_10008091
2818 Ga0265314_10011967
2819 Ga0307516_10001571
2820 Ga0307516_10019622
2821 Ga0307405_10000003
2822 Ga0307405_10000019
2823 Ga0307413_10000959
2824 Ga0307413_10001519
2825 Ga0307413_10050336
2826 Ga0307518_10012267
2827 Ga0307407_10000019
2828 Ga0307407_10000021
2829 Ga0307407_10088738
2830 Ga0307412_10055732
2831 Ga0307409_100027918
2832 Ga0307409_100179525
2833 Ga0307416_100000043
2834 Ga0307416_100000232
2835 Ga0307416_100000252
2836 Ga0307416_100001520
2837 Ga0307414_10000053
2838 Ga0307414_10002363
2839 Ga0307414_10004482
2840 Ga0307414_10005497
2841 Ga0307414_10006818
2842 Ga0307414_10032784
2843 Ga0307411_10000006
2844 Ga0307411_10000009
2845 Ga0307415_100009832
2846 Ga0307415_100165412
2847 Ga0307507_10000510
2848 Ga0307510_10000002
2849 Ga0307510_10020428
2850 Ga0307510_10020871
2851 Ga0373936_0012250
2852 Ga0373936_0012969
2853 Ga0373937_0057048
2854 Ga0373937_0140797
2855 Ga0395899_0000002
2856 Ga0395899_0000055
2857 Ga0395899_0001560
2858 Ga0395899_0001714
2859 Ga0395899_0007754
2860 Ga0395899_0014865
2861 Ga0395899_0020675
2862 Ga0395899_0047617
2863 Ga0395900_0000285
2864 Ga0395900_0000322
2865 Ga0395900_0001027
2866 Ga0395900_0003451
2867 Ga0395900_0004551
2868 Ga0395900_0005771
2869 Ga0395900_0035403
2870 Ga0395900_0067592
2871 Ga0395900_0102015
2872 Ga0395900_0118787
2873 Ga0395900_0176938
2874 Ga0395900_0255098
2875 Ga0395898_0001240
2876 Ga0395898_0038993
2877 Ga0395898_0048311
2878 Ga0395898_0058344
2879 Ga0395898_0081995
2880 Ga0395898_0083914
2881 Ga0395905_0000070
2882 Ga0395905_0000716
2883 Ga0395905_0017759
2884 Ga0395905_0021327
2885 Ga0395905_0061121
2886 Ga0395901_0000332
2887 Ga0395901_0003481
2888 Ga0395901_0009872
2889 Ga0395901_0017512
2890 Ga0395901_0061345
2891 Ga0395901_0208062
2892 Ga0395901_0218072
2893 Ga0395901_0236184
2894 Ga0395901_0304788
2895 Ga0436365_0171687
2896 Ga0436361_0059626
2897 Ga0439438_000001
2898 Ga0439438_002410
2899 Ga0439438_002877
2900 Ga0439439_0030538
2901 Ga0439447_000193
2902 Ga0439447_000563
2903 Ga0451791_1638987
2904 Ga0451800_0868019
2905 Ga0451807_2607721
2906 Ga0451837_0156886
2907 Ga0439442_014730
2908 Ga0439448_0003051
2909 Ga0439448_0008130
2910 Ga0439448_0025228
2911 Ga0439432_002021
2912 Ga0439432_010316
2913 Ga0439449_0002186
2914 Ga0439449_0028771
2915 Ga0439452_000010
2916 Ga0439452_000012
2917 Ga0439452_000039
2918 Ga0439452_003330
2919 Ga0439455_0001320
2920 Ga0439457_007044
2921 Ga0439457_007246
2922 Ga0439458_0000056
2923 Ga0439458_0000106
2924 Ga0439464_0003228
2925 Ga0451577_0000660
2926 Ga0451577_0022846
2927 Ga0451577_0026427
2928 Ga0451577_0063292
2929 Ga0451577_0163772
2930 Ga0451577_0195649
2931 Ga0451577_0290746
2932 Ga0466969_0011304
2933 Ga0466969_0017683
2934 Ga0466969_0073274
2935 Ga0466972_0000008
2936 Ga0466972_0000032
2937 Ga0466972_0000099
2938 Ga0466972_0008359
2939 Ga0466972_0032304
2940 Ga0466981_0000033
2941 Ga0453683_0000135
2942 Ga0453683_0026343
2943 Ga0453683_0100006
2944 Ga0453683_0107530
2945 Ga0466966_0000157
2946 Ga0466966_0000222
2947 Ga0466966_0002934
2948 Ga0466966_0008700
2949 Ga0466966_0076017
2950 Ga0466961_0000565
2951 Ga0466961_0010853
2952 Ga0466961_0027192
2953 Ga0466964_0006766
2954 Ga0466964_0007857
2955 Ga0453684_0000553
2956 Ga0453684_0001244
2957 Ga0453684_0003919
2958 Ga0453684_0009187
2959 Ga0453684_0011435
2960 Ga0453684_0027373
2961 Ga0453684_0049262
2962 Ga0453684_0072712
2963 Ga0453684_0084391
2964 Ga0453684_0325186
2965 Ga0466971_0002102
2966 Ga0466971_0002161
2967 Ga0466968_0005875
2968 Ga0466970_0008939
2969 Ga0466970_0031607
2970 Ga0466970_0037259
2971 Ga0466957_0000013
2972 Ga0466957_0004749
2973 Ga0466957_0006610
2974 Ga0466957_0030457
2975 Ga0466960_0031512
2976 Ga0466960_0076825
2977 Ga0466959_0001636
2978 Ga0466959_0005022
2979 Ga0466959_0010903
2980 Ga0466959_0019618
2981 Ga0466959_0027743
2982 Ga0451576_0000112
2983 Ga0451576_0001577
2984 Ga0451576_0056604
2985 Ga0451576_0058884
2986 Ga0451576_0209097
2987 Ga0466958_0001403
2988 Ga0466958_0002680
2989 Ga0466967_0027952
2990 Ga0466967_0038134
2991 Ga0495627_000181
2992 Ga0495627_002499
2993 Ga0495592_0162110
2994 Ga0495590_0007233
2995 Ga0495591_000029
2996 Ga0495591_000094
2997 Ga0495591_006502
2998 Ga0495638_0003576
2999 Ga0495638_0014448
3000 Ga0495638_0041297
3001 Ga0495638_0105728
3002 Ga0495638_0112814
3003 Ga0495651_0057753
3004 Ga0495650_0000033
3005 Ga0495650_0000103
3006 Ga0495650_0000167
3007 Ga0495650_0000189
3008 Ga0495650_0000519
3009 Ga0495582_0058936
3010 Ga0495605_0000055
3011 Ga0495605_0000068
3012 Ga0495605_0055374
3013 Ga0495584_0000576
3014 Ga0495584_0001279
3015 Ga0495584_0023801
3016 Ga0495585_0000018
3017 Ga0495585_0001568
3018 Ga0495596_0003492
3019 Ga0495596_0006128
3020 Ga0495607_0001005
3021 Ga0495607_0003503
3022 Ga0495607_0006487
3023 Ga0495606_0000008
3024 Ga0495606_0000419
3025 Ga0495606_0000619
3026 Ga0495606_0001898
3027 Ga0495606_0004447
3028 Ga0495606_0014229
3029 Ga0495606_0020180
3030 Ga0495606_0028183
3031 Ga0495606_0037911
3032 Ga0495610_0000148
3033 Ga0495610_0000266
3034 Ga0495610_0001323
3035 Ga0495610_0004181
3036 Ga0495610_0007362
3037 Ga0495610_0022376
3038 Ga0495616_0002554
3039 Ga0495616_0004107
3040 Ga0495616_0015961
3041 Ga0495616_0023858
3042 Ga0495616_0049087
3043 Ga0495618_0019272
3044 Ga0495630_0041133
3045 Ga0495630_0154644
3046 Ga0495630_0207858
3047 Ga0495637_0032499
3048 Ga0495637_0065569
3049 Ga0495644_0016290
3050 Ga0495644_0044795
3051 Ga0495648_0002776
3052 Ga0495648_0003058
3053 Ga0495648_0004838
3054 Ga0495642_0044151
3055 Ga0495654_0000078
3056 Ga0495654_0000572
3057 Ga0495654_0000616
3058 Ga0495654_0026535
3059 Ga0495609_0000038
3060 Ga0495609_0000190
3061 Ga0495609_0000254
3062 Ga0495609_0001935
3063 Ga0495609_0025233
3064 Ga0495622_0000053
3065 Ga0495633_0000022
3066 Ga0495633_0000177
3067 Ga0495668_0000009
3068 Ga0495668_0001086
3069 Ga0495668_0001824
3070 Ga0495668_0003068
3071 Ga0495668_0010689
3072 Ga0495625_0000017
3073 Ga0495625_0000375
3074 Ga0495625_0000785
3075 Ga0495625_0001098
3076 Ga0495625_0007459
3077 Ga0495625_0013468
3078 Ga0495625_0029100
3079 Ga0495625_0042106
3080 Ga0495635_0099339
3081 Ga0495659_0001483
3082 Ga0495661_0000070
3083 Ga0495661_0000400
3084 Ga0495661_0000838
3085 Ga0495661_0002871
3086 Ga0495661_0043170
3087 Ga0495661_0131899
3088 Ga0495588_0000172
3089 Ga0495658_0032269
3090 Ga0495658_0033214
3091 Ga0495669_0005794
3092 Ga0495613_0063067
3093 Ga0495671_0003259
3094 Ga0495649_0000008
3095 Ga0495649_0001447
3096 Ga0495649_0012203
3097 Ga0495649_0044924
3098 Ga0495589_0000010
3099 Ga0495589_0000126
3100 Ga0495589_0000211
3101 Ga0495589_0008358
3102 Ga0495660_0000011
3103 Ga0495660_0000047
3104 Ga0495674_0035314
3105 Ga0495672_0000004
3106 Ga0495672_0000392
3107 Ga0495672_0001319
3108 Ga0495672_0042879
3109 Ga0495672_0043010
3110 Ga0495680_0062162
3111 Ga0495683_0009241
3112 Ga0495683_0033417
3113 Ga0495687_000001
3114 Ga0495687_000071
3115 Ga0495687_000363
3116 Ga0495687_003106
3117 Ga0495687_004707
3118 Ga0495675_0084072
3119 Ga0495677_0000016
3120 Ga0495677_0003062
3121 Ga0495677_0012949
3122 Ga0495673_0000023
3123 Ga0495673_0000079
3124 Ga0495681_0011881
3125 Ga0495686_0001966
3126 Ga0495686_0035024
3127 Ga0495602_0082369
3128 Ga0495626_0000042
3129 Ga0495626_0000533
3130 Ga0496100_0032077
3131 Ga0496101_0000029
3132 Ga0496101_0030747
3133 Ga0496102_0001288
3134 Ga0496102_0076783
3135 Ga0496103_0154689
3136 Ga0496104_0000098
3137 Ga0496104_0108208
3138 Ga0496105_0020177
3139 Ga0496106_0016890
3140 Ga0496106_0186055
3141 Ga0496107_0002047
3142 Ga0496109_0019183
3143 Ga0496111_0153113
3144 Ga0496113_0022284
3145 Ga0496115_0109466
3146 Ga0496116_0000075
3147 Ga0496116_0000077
3148 Ga0496116_0006079
3149 Ga0496116_0028515
3150 Ga0496116_0032177
3151 Ga0496116_0035909
3152 Ga0496116_0041821
3153 Ga0496116_0041883
3154 Ga0496117_0000054
3155 Ga0496117_0000593
3156 Ga0496117_0000635
3157 Ga0496117_0002611
3158 Ga0496117_0006228
3159 Ga0496117_0025066
3160 Ga0496117_0051088
3161 Ga0496117_0129807
3162 Ga0496118_0000045
3163 Ga0496118_0006469
3164 Ga0496118_0008371
3165 Ga0496118_0032272
3166 Ga0496118_0033182
3167 Ga0496118_0040958
3168 Ga0496118_0057976
3169 Ga0496118_0067077
3170 Ga0496118_0084529
3171 Ga0496118_0086752
3172 Ga0496119_0000023
3173 Ga0496119_0001077
3174 Ga0496119_0001451
3175 Ga0496119_0001653
3176 Ga0496119_0002580
3177 Ga0496119_0009788
3178 Ga0496119_0015944
3179 Ga0496119_0022542
3180 Ga0496119_0024430
3181 Ga0496119_0041172
3182 Ga0496119_0049672
3183 Ga0496120_0000112
3184 Ga0496120_0000139
3185 Ga0496120_0000177
3186 Ga0496120_0000407
3187 Ga0496120_0007202
3188 Ga0496120_0009875
3189 Ga0496120_0018341
3190 Ga0496120_0022093
3191 Ga0496120_0035790
3192 Ga0496120_0039461
3193 Ga0496121_0000010
3194 Ga0496121_0002021
3195 Ga0496121_0005398
3196 Ga0496121_0013963
3197 Ga0496121_0034633
3198 Ga0496121_0054576
3199 Ga0496121_0074282
3200 Ga0496121_0119078
3201 Ga0496121_0136441
3202 Ga0496122_0000108
3203 Ga0496122_0000348
3204 Ga0496122_0000771
3205 Ga0496122_0001079
3206 Ga0496122_0003177
3207 Ga0496122_0005356
3208 Ga0496122_0018906
3209 Ga0496122_0020291
3210 Ga0496122_0025156
3211 Ga0496122_0026213
3212 Ga0496122_0042259
3213 Ga0496122_0043681
3214 Ga0496122_0070880
3215 Ga0496123_0000065
3216 Ga0496123_0000424
3217 Ga0496123_0000781
3218 Ga0496123_0002969
3219 Ga0496123_0005408
3220 Ga0496123_0008601
3221 Ga0496123_0009042
3222 Ga0496123_0011737
3223 Ga0496123_0012625
3224 Ga0496123_0015732
3225 Ga0496123_0079081
3226 Ga0496124_0000100
3227 Ga0496124_0001570
3228 Ga0496124_0005306
3229 Ga0496124_0005767
3230 Ga0496124_0005834
3231 Ga0496124_0007587
3232 Ga0496124_0022824
3233 Ga0496124_0025452
3234 Ga0496125_0000070
3235 Ga0496125_0000104
3236 Ga0496125_0000509
3237 Ga0496125_0003423
3238 Ga0496125_0009046
3239 Ga0496125_0016571
3240 Ga0496125_0019538
3241 Ga0496125_0117900
3242 Ga0496125_0181345
3243 Ga0496126_0001489
3244 Ga0496126_0001777
3245 Ga0496126_0040747
3246 Ga0496126_0044023
3247 Ga0496126_0049927
3248 Ga0496126_0087468
3249 Ga0501344_00526
3250 Ga0501345_00240
3251 Ga0495678_000415
3252 Ga0495678_006121
3253 Ga0495682_0000004
3254 Ga0495682_0043443
3255 Ga0501300_002577
3256 Ga0501315_000769
3257 Ga0501334_00617
3258 Ga0501336_000088
3259 Ga0501340_000804
3260 Ga0501032_0003830
3261 Ga0501032_0066866
3262 Ga0501033_0032638
3263 Ga0501034_0026227
3264 Ga0501034_0035363
3265 Ga0501034_0103328
3266 Ga0501036_0127085
3267 Ga0501037_0014870
3268 Ga0501037_0024855
3269 Ga0501038_0112597
3270 Ga0501043_0068988
3271 Ga0501043_0147839
3272 Ga0501047_0011115
3273 Ga0501047_0013626
3274 Ga0501047_0015992
3275 Ga0501047_0032071
3276 Ga0501047_0046535
3277 Ga0501047_0112786
3278 Ga0501069_0028606
3279 Ga0501070_0116525
3280 Ga0501071_0012334
3281 Ga0501074_0004546
3282 Ga0501199_001224
3283 Ga0501217_008773
3284 Ga0501236_000080
3285 Ga0501249_000030
3286 Ga0501257_021605
3287 Ga0501245_002382
3288 Ga0501241_009726
3289 Ga0501264_000029
3290 Ga0501266_000008
3291 Ga0501266_000013
3292 Ga0501035_0000359
3293 Ga0501035_0033273
3294 Ga0501035_0075798
3295 Ga0501044_0005351
3296 Ga0501044_0017177
3297 Ga0501044_0020067
3298 Ga0501044_0391186
3299 nmdc:mga00v17_196_c1
3300 nmdc:mga00v17_23251_c1
3301 nmdc:mga00v17_4576_c1
3302 nmdc:mga0k408_1724_c1
3303 nmdc:mga0k408_66023_c1
3304 nmdc:mga06z11_8598_c1
3305 nmdc:mga09592_100881_c1
3306 nmdc:mga08y16_334798_c1
3307 nmdc:mga08y16_62681_c1
3308 nmdc:mga08y16_65537_c1
3309 Ga0495619_0116661
3310 Ga0500578_0000001
3311 Ga0500578_0000065
3312 Ga0500578_0021415
3313 Ga0500644_0000078
3314 Ga0500646_0001488
3315 Ga0500583_0000013
3316 Ga0500583_0000083
3317 Ga0500583_0001261
3318 Ga0500583_0051084
3319 Ga0500641_0000012
3320 Ga0500558_074059
3321 Ga0500562_000003
3322 Ga0500569_000269
3323 Ga0500608_000802
3324 Ga0500608_009290
3325 Ga0500618_000290
3326 Ga0500621_000001
3327 Ga0500658_0000005
3328 Ga0500658_0000043
3329 Ga0500658_0003731
3330 Ga0500559_0000112
3331 Ga0500559_0011531
3332 Ga0500559_0014817
3333 Ga0500568_0007556
3334 Ga0500577_0002288
3335 Ga0500586_000866
3336 Ga0500588_0002345
3337 Ga0500588_0007061
3338 Ga0500616_0000075
3339 Ga0500616_0036958
3340 Ga0500622_0000066
3341 Ga0500622_0000475
3342 Ga0500622_0000546
3343 Ga0500622_0000677
3344 Ga0500622_0001523
3345 Ga0500622_0002438
3346 Ga0500622_0005953
3347 Ga0500622_0021019
3348 Ga0500622_0094691
3349 Ga0500624_000479
3350 Ga0500627_0089310
3351 Ga0500633_0005708
3352 Ga0500636_0017902
3353 Ga0500637_0018077
3354 Ga0500637_0031875
3355 Ga0500584_001081
3356 Ga0500611_000094
3357 Ga0500645_020539
3358 Ga0500661_010982
3359 Ga0466962_0006890
3360 Ga0466962_0007818
3361 2932088224
3362 2506580849
3363 2506585988
3364 2508854656
3365 2511125239
3366 2511379307
3367 2511436175
3368 2547698305
3369 2548648108
3370 2562464823
3371 2585152119
3372 2585194397
3373 2586208182
3374 2599411825
3375 2599480972
3376 2599927203
3377 2600198675
3378 2600401392
3379 2601524502
3380 2601529656
3381 2601534694
3382 2601539279
3383 2601616490
3384 2601621212
3385 2601646191
3386 2601649609
3387 2601654536
3388 2601660190
3389 2601664305
3390 2601699121
3391 2601702530
3392 2601707280
3393 2601712301
3394 2601717797
3395 2601723033
3396 2601727725
3397 2601732742
3398 2601737489
3399 2601741908
3400 2601752806
3401 2601757628
3402 2601763987
3403 2602021768
3404 2603640335
3405 2603645984
3406 2603662469
3407 2603667365
3408 2603701762
3409 2603706421
3410 2603840151
3411 2603845228
3412 2603850301
3413 2603855369
3414 2603868365
3415 2603873183
3416 2603878176
3417 2606050130
3418 2606071794
3419 2606147813
3420 2606178252
3421 2608668621
3422 2609911247
3423 2637222953
3424 2643801201
3425 2644008708
3426 2644012756
3427 2644370447
3428 2644471807
3429 2644641775
3430 2644682108
3431 2650897646
3432 2656276689
3433 2671105268
3434 2676408767
3435 2681998904
3436 2682009644
3437 2686352542
3438 2689447405
3439 2707100922
3440 2722729328
3441 2738713891
3442 2738731680
3443 2738735539
3444 2738756502
3445 2738768116
3446 2738855270
3447 2739217121
3448 2739589307
3449 2739617702
3450 2739648453
3451 2740001760
3452 2740003712
3453 2740006576
3454 2740008529
3455 2753857927
3456 2765591058
3457 2772441213
3458 2777021292
3459 2792311203
3460 2793403654
3461 2802655062
3462 2807180286
3463 2809124742
3464 2813726581
3465 2814693953
3466 2819546719
3467 2819548959
3468 2819677715
3469 2821141812
3470 2823378178
3471 2842715397
3472 2842723825
3473 2842725467
3474 2842908894
3475 2842910337
3476 2842912746
3477 2844429430
3478 2844532101
3479 2847800780
3480 2849282034
3481 2852625838
3482 2854603326
3483 2855195947
3484 2857559223
3485 2857567031
3486 2857620826
3487 2857622380
3488 2857631743
3489 2865017802
3490 2869556838
3491 2871286344
3492 2876602791
3493 2881361078
3494 2881614088
3495 2883072422
3496 2884086821
3497 2884637941
3498 2884794559
3499 2884797658
3500 2884935634
3501 2888371337
3502 2896114998
3503 2896318303
3504 2904425866
3505 2904445327
3506 2904446890
3507 2904469773
3508 2904508258
3509 2904517953
3510 2904780994
3511 2910248856
3512 2911141532
3513 2914763139
3514 2919180542
3515 2919194710
3516 2919195084
3517 2919442701
3518 2919686630
3519 2919693833
3520 2923636967
3521 2927836603
3522 2928080884
3523 2928150209
3524 2928521664
3525 2929150922
3526 2929183293
3527 2929245409
3528 2929926121
3529 2932409353
3530 2935628814
3531 2937540172
3532 2937968881
3533 2939576739
3534 2939581142
3535 2939602955
3536 2939620708
3537 2945875623
3538 2945953877
3539 2945979253
3540 2945999751
3541 2946002447
3542 2946014876
3543 2954017567
3544 2954019333
3545 2969079980
3546 2974314709
3547 2974440493
3548 2978976368
3549 2984495760
3550 2984562434
3551 2984600492
3552 2990265447
3553 640940217
3554 8003151862
3555 8004593997
3556 8007371409
3557 8015395176
3558 8016736785
3559 8018222442
3560 8018408926
3561 8019502018
3562 8019507336
3563 8047675401
3564 8054307940
3565 8055590297
3566 8055597190
3567 8056442408

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02447

GntP_permease

GntP family permease

42

477

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
4f35-assembly2.cif.gz_B crystal structure of a bacterial dicarboxylate/sodium symporter 0.642 8 360
4r0c-assembly1.cif.gz_B crystal structure of the alcanivorax borkumensis ydah transporter reveals an unusual topology 0.6034 11 373
6ol0-assembly2.cif.gz_B structure of vcindy bound to malate 0.5988 8 360
7qha-assembly1.cif.gz_B cryo-em structure of the tripartite atp-independent periplasmic (trap) transporter siaqm from photobacterium profundum in amphipol 0.5911 4 374
4r0c-assembly1.cif.gz_B crystal structure of the alcanivorax borkumensis ydah transporter reveals an unusual topology 0.5856 11 373
ID Description Score Start End Superfamily
af_I6YCG9_3_406_1.20.1530.20 Mainly Alpha;Up-down Bundle;Na+/H+ antiporter like fold; 0.6106 10 375 1.20.1530.20
af_I6YCG9_3_406_1.20.1530.20 Mainly Alpha;Up-down Bundle;Na+/H+ antiporter like fold; 0.5952 10 375 1.20.1530.20
af_P0CE94_1155_1278_1.20.1420.10 Mainly Alpha;Up-down Bundle;A middle domain of Talin 1;Talin, central domain 0.3701 196 291 1.20.1420.10
af_A0A0R4IIA7_1847_1972_1.20.120.230 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Alpha-catenin/vinculin-like 0.3527 101 263 1.20.120.230
af_A0A0R4IIA7_1847_1972_1.20.120.230 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Alpha-catenin/vinculin-like 0.3371 101 263 1.20.120.230
ID Description Score Start End GO Terms
AF-A0A7X2MN99-F1-model_v4 Gluconate transporter 0.966 3 293 GO:0005886
GO:0015128
AF-A0A6M1HS67-F1-model_v4 deleted 0.9578 75 276
AF-A0A3S4ICG4-F1-model_v4 deleted 0.957 3 291
AF-A0A5W9WTU6-F1-model_v4 Gluconate permease 0.9529 3 263 GO:0005886
GO:0015128
GO:0015568
AF-A0A7Y2UEX4-F1-model_v4 deleted 0.9512 3 189

Map