F495697

General Info

Members Datasets Scaffolds Average Seq Length
1786 656 3572 403

Family's Representative Sequence

Representative Sequence 3300006175|Ga0070712_100002253|Ga0070712_1000022535
Length 463
Sequence LLCAGAGAAAGKGGDLKTCSWDQARNLAAHFKIPTSGKTGQRWGTRHPISVHSWVGFKENGLKITDAKVFVTSPGRNFVTLKVYTDEGVYGLGDATLNGRELAVASYLRDHVVPCLIGRDPAQTEDVWQYLYRGAYWRRGPVTMTAIAAVDMALWDIKGKALNTPVYNLLGGKSRTGVLVYGHANGKDIEETVDEVGKYKEQGYLAIRAQSGIPGLASTYGVAKDKMFYEPAEKGLPPENLWSTEKYLLHVPKLFEALRLKFGDDLNLLHDVHHRLTPIEAARLGKSLEPYHLFWLEDAVPAELQEGFRLIRKHTTTPLAVGEVFNSVWDAHILITEQLIDYLRMTVVHSGGLTHLKKIAALAEVYHVRTGSHGATDLSPVAMAAALHFDIAINNFGIQEYMRHTQETDEVFPHAYSFHAGYLYPGDSPGLGVDYNEKLAEKFPYERAYLPVNRKVDGTMFNW

Samples

Sample ID Description Type Environment
1 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
6 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
7 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
8 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
9 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
10 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
11 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
12 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
13 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
14 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
15 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
16 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
17 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
18 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
19 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
20 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
21 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
22 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
23 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
24 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
25 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
26 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
27 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
28 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
29 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
30 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
31 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
32 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
33 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
34 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
35 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
36 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
37 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
38 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
39 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
40 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
41 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
42 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
43 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
44 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
45 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
46 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
47 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
48 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
49 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
50 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
51 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
52 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
53 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
54 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
55 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
56 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
57 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
58 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
59 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
60 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
61 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
62 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
63 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
64 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
65 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
66 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
67 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
68 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
69 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
70 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
71 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
72 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
73 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
74 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
75 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
76 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
77 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
78 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
79 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
80 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
81 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
82 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
83 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
84 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
85 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
86 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
87 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
88 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
89 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
90 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
91 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
92 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
93 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
94 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
95 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
96 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
97 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
98 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
99 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
100 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
101 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
102 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
103 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
104 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
105 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
106 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
107 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
108 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
109 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
110 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
111 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
112 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
113 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
114 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
115 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
116 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
117 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
118 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
119 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
120 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
121 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
122 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
123 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
124 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
125 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
126 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
127 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
128 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
129 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
130 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
131 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
132 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
133 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
134 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
135 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
136 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
137 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
138 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
139 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
140 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
141 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
142 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
143 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
144 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
145 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
146 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
147 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
148 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
149 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
150 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
151 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
152 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
153 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
154 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
155 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
156 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
157 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
158 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
159 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
160 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
161 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
162 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
163 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
164 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
165 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
166 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
167 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
168 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
169 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
170 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
171 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
172 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
173 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
174 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
175 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
176 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
177 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
178 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
179 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
180 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
181 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
182 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
183 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
184 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
185 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
186 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
187 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
188 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
189 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
190 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
191 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
192 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
193 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
194 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
195 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
196 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
197 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
244 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
246 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
247 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
248 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
249 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
250 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
251 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
252 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
253 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
254 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
255 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
256 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
257 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
258 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
259 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
260 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
261 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
262 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
263 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
264 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
265 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
266 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
267 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
268 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
269 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
270 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
271 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
272 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
273 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
274 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
275 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
276 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
277 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
278 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
279 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
280 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
281 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
282 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
283 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
284 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
285 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
286 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
287 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
288 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
289 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
290 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
291 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
292 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
293 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
294 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
295 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
296 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
297 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
298 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
299 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
300 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
301 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
302 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
303 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
304 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
305 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
306 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
307 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
308 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
309 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
310 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
311 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
312 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
313 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
314 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
315 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
316 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
317 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
318 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
319 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
320 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
321 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
322 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
323 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
324 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
325 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
326 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
327 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
328 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
329 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
330 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
331 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
332 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
333 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
334 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
335 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
336 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
337 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
338 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
339 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
340 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
341 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
342 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
343 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
344 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
345 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
346 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
347 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
348 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
349 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
350 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
351 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
352 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
353 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
354 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
355 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
356 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
357 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
358 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
359 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
360 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
361 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
362 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
363 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
364 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
365 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
366 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
367 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
368 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
369 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
370 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
371 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
372 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
373 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
374 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
375 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
376 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
377 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
378 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
379 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
380 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
381 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
382 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
383 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
384 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
385 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
386 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
387 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
388 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
389 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
390 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
391 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
392 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
393 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
394 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
395 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
396 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
397 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
398 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
399 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
400 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
401 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
402 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
403 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
404 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
405 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
406 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
407 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
408 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
409 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
410 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
411 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
412 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
413 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
414 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
415 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
416 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
417 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
418 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
419 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
420 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
421 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
422 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
423 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
424 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
425 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
426 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
427 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
428 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
429 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
430 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
431 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
432 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
433 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
434 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
435 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
436 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
437 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
438 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
439 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
440 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
441 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
442 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
443 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
444 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
445 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
446 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
447 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
448 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
449 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
450 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
451 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
452 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
453 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
454 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
455 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
456 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
457 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
458 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
459 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
460 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
461 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
462 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
463 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
464 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
465 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
466 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
467 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
468 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
469 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
470 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
471 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
472 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
473 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
474 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
475 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
476 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
477 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
478 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
479 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
480 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
481 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
482 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
483 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
484 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
485 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
486 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
487 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
488 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
489 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
490 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
491 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
492 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
493 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
494 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
495 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
496 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
497 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
498 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
499 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
500 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
501 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
502 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
503 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
504 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
505 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
506 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
507 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
508 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
509 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
510 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
511 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
512 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
513 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
514 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
515 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
516 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
517 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
518 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
519 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
520 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
521 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
522 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
523 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
524 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
525 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
526 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
527 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
528 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
529 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
530 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
531 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
532 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
533 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
534 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
535 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
536 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
537 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
538 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
539 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
540 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
541 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
542 2501025501 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
543 2501025504 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
544 2508501050 Microvirga lupini Lut6 Isolate Nodule
545 2508501114 Microvirga lotononidis WSM3557 Isolate Nodule
546 2510917014 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
547 2510917015 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
548 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
549 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
550 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
551 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
552 2522572158 Azospirillum halopraeferens DSM 3675 Isolate Unclassified
553 2582580736 Prauserella sp. Am3 Isolate Unclassified
554 2582581279 Caulobacter henricii OK261 Isolate Rhizosphere
555 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
556 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
557 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
558 2599185240 Burkholderia sp. NFPP32 Isolate Rhizoplane
559 2599185355 Burkholderia sp. NFACC33-1 Isolate Rhizoplane
560 2599185359 Sphingomonas sp. NFR04 Isolate Rhizoplane
561 2600255067 Paraburkholderia kururiensis thiooxydans NBRC 107107 Isolate Unclassified
562 2643221545 Caulobacter sp. Root1455 Isolate Unclassified
563 2643221560 Sphingopyxis sp. Root1497 Isolate Unclassified
564 2643221619 Agromyces sp. Root81 Isolate Unclassified
565 2643221629 Devosia sp. Root105 Isolate Unclassified
566 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
567 2643221662 Devosia sp. Root413D1 Isolate Unclassified
568 2643221691 Caulobacter sp. Root487D2Y Isolate Unclassified
569 2675903129 Burkholderia pyrrocinia NFIX32 Isolate Rhizoplane
570 2690315857 Rheinheimera sp. EpRS3 Isolate Unclassified
571 2738541296 Paraburkholderia sp. GV073 Isolate Unclassified
572 2738541298 Paraburkholderia sp. GV068 Isolate Unclassified
573 2738541306 Paraburkholderia sp. GV052 Isolate Unclassified
574 2738543002 Paraburkholderia sp. GV072 Isolate Unclassified
575 2738543008 Paraburkholderia sp. GV060 Isolate Unclassified
576 2738543034 Rhodococcus sp. OK269 Isolate Unclassified
577 2747842501 Xanthomonas sp. WCS2014-23 Isolate Unclassified
578 2773857925 Microvirga vignae BR3299 Isolate Unclassified
579 2775506735 Arthrobacter sp. S95 1704 Isolate Unclassified
580 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
581 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
582 2791355261 Rhizobium sp. J15 Isolate Nodule
583 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
584 2808606384 Burkholderia sp. SJZ089 Isolate Rhizosphere
585 2808606390 Burkholderia sp. SJZ115 Isolate Rhizosphere
586 2808606391 Burkholderia sp. SJZ091 Isolate Rhizosphere
587 2818991450 Burkholderia sp. 604 Isolate Unclassified
588 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
589 2844533157 Inquilinus sp. R-72501 v. 2 Isolate Unclassified
590 2844841374 Leifsonia soli DSM 23871 Isolate Rhizosphere
591 2862574272 Streptomyces sp. AcE210 Isolate Nodule
592 2866552031 Saccharopolyspora rhizosphaerae H219 Isolate Unclassified
593 2870068957 Burkholderia sp. JP2-270 Isolate Unclassified
594 2882456835 Microvirga sp. KLBC 81 Isolate Unclassified
595 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
596 2884763398 Leifsonia sp. PS1209 Isolate Stem Tuber
597 2885270888 Paraburkholderia sp. UYCPa14C Isolate Unclassified
598 2891554331 Microbispora sp. CL1-1 Isolate Unclassified
599 2891670763 Buttiauxella sp. B2 Isolate Rhizosphere
600 2894232714 Microvirga tunisiensis Lmie10 Isolate Nodule
601 2894414249 Luteimonas sp. LNNU 24178 Isolate Rhizosphere
602 2897803580 Azospirillum doebereinerae GSF71 Isolate Unclassified
603 2899370129 Amycolatopsis alkalitolerans SYSUP0005 Isolate Stem Tuber
604 2900634093 Paraburkholderia dipogonis ICMP 19430 Isolate Unclassified
605 2904479285 Comamonas sediminis 4487 Isolate Rhizosphere
606 2904483920 Paraburkholderia caledonica 575 Isolate Unclassified
607 2904615490 Paraburkholderia franconis CNPSo 3157 Isolate Unclassified
608 2904765812 Rhodococcus fascians 1590 Isolate Rhizosphere
609 2904770941 Rhodococcus fascians 1339 Isolate Rhizosphere
610 2908811453 Rhodococcus sp. 1R11 Isolate Unclassified
611 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
612 2919420072 Rhodococcus fascians 3241 Isolate Rhizosphere
613 2919432681 Rhodococcus sp. 3258 Isolate Rhizosphere
614 2919513703 Luteimonas sp. 3794 Isolate Unclassified
615 2919523602 Leifsonia shinshuensis 3821 Isolate Unclassified
616 2919527303 Paraburkholderia strydomiana 3827 Isolate Unclassified
617 2919534386 Rheinheimera pacifica 3879 Isolate Unclassified
618 2919675420 Luteimonas terrae 4099 Isolate Unclassified
619 2921643360 Paraburkholderia steynii HC1.1ba Isolate Nodule
620 2928027323 Sphingomonas sp. 1185 Isolate Unclassified
621 2928108538 Paraburkholderia terricola 1595 Isolate Rhizosphere
622 2928135762 Paraburkholderia terricola 1988 Isolate Unclassified
623 2928153084 Leifsonia sp. 563 Isolate Unclassified
624 2928157003 Burkholderia ambifaria 566 Isolate Unclassified
625 2928163908 Burkholderia sp. 567 Isolate Unclassified
626 2928503688 Paraburkholderia terricola 1263 Isolate Rhizosphere
627 2928526807 Sphingomonas trueperi 1770 Isolate Rhizosphere
628 2939598168 Arthrobacter sp. 754 Isolate Rhizosphere
629 2945934425 Paraburkholderia graminis W1I13 Isolate Rhizosphere
630 2946059875 Arthrobacter sp. SLBN-112 Isolate Rhizosphere
631 2981990288 Burkholderia sp. PvR073 Isolate Rhizosphere
632 2984555340 Sphingomonas sp. SORGH_AS789 Isolate Aerial Root
633 2984564862 Sphingomonas sp. SORGH_AS870 Isolate Aerial Root
634 2990703756 Paraburkholderia graminis SLBN-33 Isolate Rhizosphere
635 2993356040 Sphingomonas sp. SORGH_AS742 Isolate Aerial Root
636 2996221748 Micromonospora veneta CAP181 Isolate Unclassified
637 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
638 3006425503 Streptomyces zingiberis PLAI1-29 Isolate Unclassified
639 642555113 Paraburkholderia phytofirmans PsJN Isolate Unclassified
640 8003014200 Lysobacter changpingensis Cm-3-T8 Isolate Rhizosphere
641 8005382845 Rhizobium sp. R634 Isolate Nodule
642 8005395548 Rhizobium sp. R339 Isolate Nodule
643 8020938398 Burkholderia sp. BE12 Isolate Rhizosphere
644 8020945358 Burkholderia sp. BE17 Isolate Rhizosphere
645 8020953355 Burkholderia sp. BE24 Isolate Rhizosphere
646 8047710418 Umezawaea endophytica DSM 103496 Isolate Unclassified
647 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
648 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
649 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
650 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
651 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
652 8054302542 Novosphingobium kaempferiae Sx8-5 Isolate Rhizosphere
653 8054472261 Pseudonocardia terrae RS11V-5 Isolate Rhizosphere
654 8055266321 Paraburkholderia rhynchosiae LMG 27174 Isolate Nodule
655 8055301274 Paraburkholderia kirstenboschensis LMG 28727 Isolate Nodule
656 8056060235 Nocardiopsis endophytica RSe5-2 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 92.78
Metatranscriptomes 0.22
Isolates 7

Biome Distribution

Category Percentage (%)
Aerial Root 0.17
Bulb 0
Endosphere 11.48
Nodule 0.62
Rhizoplane 3.92
Rhizosphere 75.81
Stem 0
Stem Tuber 0.11
Unclassified 0.78

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070712_100002253 3300006175 Bacteria 11861
2 JGI24740J21852_10002353 3300001979 Bacteria 8602
3 JGI24739J22299_10019871 3300001989 Bacteria 2402
4 JGI24735J21928_10004339 3300002067 Bacteria 4773
5 JGI24735J21928_10015543 3300002067 Bacteria 2373
6 JGI24738J21930_10000419 3300002075 Bacteria 11982
7 JGI25156J39149_1001063 3300002705 Bacteria 12674
8 JGI25156J39149_1003773 3300002705 Bacteria 4834
9 JGI25156J39149_1010843 3300002705 Bacteria 2109
10 JGI25162J39368_1000115 3300002737 Bacteria 88006
11 JGI25162J39368_1000764 3300002737 Bacteria 21773
12 JGI25157J39369_1000132 3300002741 Bacteria 62647
13 JGI25163J39215_1000228 3300002771 Bacteria 21041
14 JGI25164J39214_1000090 3300002772 Bacteria 90565
15 JGI25164J39214_1000376 3300002772 Bacteria 26529
16 JGI25150J39212_1000156 3300002774 Bacteria 38549
17 JGI25150J39212_1002133 3300002774 Bacteria 5111
18 JGI25151J46595_10000133 3300003187 Bacteria 99030
19 JGI25151J46595_10000293 3300003187 Bacteria 55849
20 JGI25151J46595_10017338 3300003187 Bacteria 3126
21 JGI25151J46595_10017984 3300003187 Bacteria 3049
22 JGI25151J46595_10018692 3300003187 Bacteria 2966
23 JGI25406J46586_10002396 3300003203 Bacteria 8862
24 JGI25165J46597_1000014 3300003214 Bacteria 390383
25 JGI25165J46597_1000194 3300003214 Bacteria 91012
26 JGI25165J46597_1000492 3300003214 Bacteria 38146
27 JGI25153J46596_10000058 3300003215 Bacteria 132614
28 JGI25153J46596_10000260 3300003215 Bacteria 42298
29 rootH2_10029369 3300003320 Bacteria 6864
30 JGI25160J50197_1000237 3300003354 Bacteria 42860
31 JGI25160J50197_1004969 3300003354 Bacteria 5645
32 Ga0006562J51391_1133533 3300003578 Bacteria 9750
33 Ga0006562J51391_1133534 3300003578 Bacteria 9352
34 Ga0055538_1001068 3300003751 Bacteria 6068
35 Ga0055539_1000008 3300003752 Bacteria 537665
36 Ga0055533_1000001 3300003756 Bacteria 1863437
37 Ga0055533_1000106 3300003756 Bacteria 104514
38 Ga0055532_1000003 3300003758 Bacteria 494004
39 Ga0055525_1000197 3300003759 Bacteria 71227
40 Ga0055527_1000006 3300003760 Bacteria 494004
41 Ga0055527_1000023 3300003760 Bacteria 204513
42 Ga0055535_1000003 3300003761 Bacteria 494004
43 Ga0055535_1000106 3300003761 Bacteria 90565
44 Ga0055542_1000007 3300003762 Bacteria 494004
45 Ga0055542_1000023 3300003762 Bacteria 292964
46 Ga0055542_1000150 3300003762 Bacteria 88006
47 Ga0055542_1000245 3300003762 Bacteria 62120
48 Ga0055529_1000003 3300003763 Bacteria 494004
49 Ga0055529_1000168 3300003763 Bacteria 90565
50 Ga0055529_1000178 3300003763 Bacteria 86969
51 Ga0055529_1000180 3300003763 Bacteria 86768
52 Ga0055529_1001704 3300003763 Bacteria 5644
53 Ga0055524_1001508 3300003775 Bacteria 13200
54 Ga0055524_1003884 3300003775 Bacteria 7085
55 Ga0055524_1009055 3300003775 Bacteria 4083
56 Ga0055528_1002495 3300003790 Bacteria 9820
57 Ga0055530_10003173 3300003791 Bacteria 9652
58 Ga0055531_10008726 3300003794 Bacteria 5294
59 Ga0055531_10017067 3300003794 Bacteria 3088
60 Ga0058692_1000057 3300003856 Bacteria 103718
61 Ga0058692_1000132 3300003856 Bacteria 47060
62 Ga0065165_1000467 3300005262 Bacteria 63318
63 Ga0070658_10004201 3300005327 Bacteria 11791
64 Ga0070658_10061587 3300005327 Bacteria 3057
65 Ga0070658_10105986 3300005327 Bacteria 2325
66 Ga0070658_10151588 3300005327 Bacteria 1941
67 Ga0070658_10166573 3300005327 Bacteria 1850
68 Ga0070676_10036864 3300005328 Bacteria 2818
69 Ga0070676_10072911 3300005328 Bacteria 2065
70 Ga0070683_100000275 3300005329 Bacteria 35321
71 Ga0070683_100001898 3300005329 Bacteria 16342
72 Ga0070683_100084656 3300005329 Bacteria 2971
73 Ga0070683_100136036 3300005329 Bacteria 2327
74 Ga0070670_100019420 3300005331 Bacteria 5831
75 Ga0070670_100067971 3300005331 Bacteria 3058
76 Ga0068869_100044412 3300005334 Bacteria 3195
77 Ga0070666_10013441 3300005335 Bacteria 5195
78 Ga0070666_10074322 3300005335 Bacteria 2316
79 Ga0070680_100002253 3300005336 Bacteria 14249
80 Ga0070680_100046178 3300005336 Bacteria 3542
81 Ga0070682_100004503 3300005337 Bacteria 7739
82 Ga0070682_100119464 3300005337 Bacteria 1767
83 Ga0070682_100190654 3300005337 Bacteria 1439
84 Ga0068868_100003303 3300005338 Bacteria 11220
85 Ga0068868_100003327 3300005338 Bacteria 11183
86 Ga0068868_100044533 3300005338 Bacteria 3469
87 Ga0068868_100072725 3300005338 Bacteria 2744
88 Ga0068868_100095338 3300005338 Bacteria 2402
89 Ga0068868_100096109 3300005338 Bacteria 2392
90 Ga0068868_100122122 3300005338 Unclassified 2125
91 Ga0070660_100005604 3300005339 Bacteria 8704
92 Ga0070689_100004517 3300005340 Bacteria 9424
93 Ga0070687_100005004 3300005343 Bacteria 5338
94 Ga0070687_100014478 3300005343 Bacteria 3543
95 Ga0070661_100001245 3300005344 Bacteria 17894
96 Ga0070661_100001901 3300005344 Bacteria 14468
97 Ga0070661_100023882 3300005344 Bacteria 4386
98 Ga0070661_100028281 3300005344 Bacteria 4043
99 Ga0070661_100030036 3300005344 Bacteria 3924
100 Ga0070661_100071961 3300005344 Bacteria 2544
101 Ga0070661_100072200 3300005344 Bacteria 2540
102 Ga0070661_100112220 3300005344 Bacteria 2037
103 Ga0070692_10051524 3300005345 Bacteria 2141
104 Ga0070692_10083109 3300005345 Bacteria 1728
105 Ga0070668_100013552 3300005347 Bacteria 6086
106 Ga0070668_100066247 3300005347 Bacteria 2802
107 Ga0070668_100098480 3300005347 Bacteria 2314
108 Ga0070675_100003560 3300005354 Bacteria 11832
109 Ga0070671_100027144 3300005355 Bacteria 4710
110 Ga0070671_100127003 3300005355 Bacteria 2147
111 Ga0070674_100009025 3300005356 Bacteria 5959
112 Ga0070673_100061624 3300005364 Bacteria 2977
113 Ga0070673_100107618 3300005364 Bacteria 2306
114 Ga0070673_100292227 3300005364 Bacteria 1432
115 Ga0070688_100044144 3300005365 Bacteria 2750
116 Ga0070688_100216166 3300005365 Bacteria 1349
117 Ga0070659_100000616 3300005366 Bacteria 26101
118 Ga0070659_100002561 3300005366 Bacteria 12924
119 Ga0070659_100159088 3300005366 Bacteria 1846
120 Ga0070667_100004934 3300005367 Bacteria 11178
121 Ga0070667_100038666 3300005367 Bacteria 4000
122 Ga0070667_100052544 3300005367 Bacteria 3439
123 Ga0070709_10000557 3300005434 Bacteria 21754
124 Ga0070709_10030365 3300005434 Bacteria 3242
125 Ga0070709_10035829 3300005434 Bacteria 3018
126 Ga0070714_100000105 3300005435 Bacteria 70871
127 Ga0070714_100021111 3300005435 Bacteria 5323
128 Ga0070714_100080502 3300005435 Bacteria 2835
129 Ga0070714_100082101 3300005435 Bacteria 2807
130 Ga0070714_100099299 3300005435 Bacteria 2562
131 Ga0070714_100128636 3300005435 Bacteria 2261
132 Ga0070714_100344679 3300005435 Bacteria 1398
133 Ga0070713_100000356 3300005436 Bacteria 29619
134 Ga0070713_100000549 3300005436 Bacteria 23887
135 Ga0070713_100021474 3300005436 Bacteria 4968
136 Ga0070713_100066954 3300005436 Bacteria 3022
137 Ga0070713_100067877 3300005436 Bacteria 3004
138 Ga0070713_100180684 3300005436 Bacteria 1896
139 Ga0070713_100294797 3300005436 Bacteria 1492
140 Ga0070710_10020273 3300005437 Bacteria 3447
141 Ga0070701_10007723 3300005438 Bacteria 4613
142 Ga0070711_100000076 3300005439 Bacteria 55974
143 Ga0070711_100000748 3300005439 Bacteria 16979
144 Ga0070711_100102636 3300005439 Bacteria 2083
145 Ga0070711_100109796 3300005439 Bacteria 2023
146 Ga0070705_100022083 3300005440 Bacteria 3395
147 Ga0070700_100028371 3300005441 Bacteria 3329
148 Ga0070708_100001268 3300005445 Bacteria 19429
149 Ga0070708_100006458 3300005445 Bacteria 9334
150 Ga0070708_100006920 3300005445 Bacteria 9048
151 Ga0070708_100013815 3300005445 Bacteria 6628
152 Ga0070708_100020690 3300005445 Bacteria 5554
153 Ga0070708_100051404 3300005445 Bacteria 3652
154 Ga0070708_100176368 3300005445 Bacteria 1997
155 Ga0070663_100000239 3300005455 Bacteria 27754
156 Ga0070663_100009995 3300005455 Bacteria 5898
157 Ga0070663_100069776 3300005455 Bacteria 2554
158 Ga0070678_100001110 3300005456 Bacteria 14117
159 Ga0070678_100147534 3300005456 Bacteria 1891
160 Ga0070662_100031446 3300005457 Bacteria 3725
161 Ga0070662_100040135 3300005457 Bacteria 3331
162 Ga0070662_100067386 3300005457 Bacteria 2628
163 Ga0070662_100083140 3300005457 Bacteria 2389
164 Ga0070662_100121216 3300005457 Bacteria 2005
165 Ga0070681_10210686 3300005458 Bacteria 1859
166 Ga0070681_10229815 3300005458 Bacteria 1769
167 Ga0070681_10279457 3300005458 Bacteria 1580
168 Ga0068867_100021675 3300005459 Bacteria 4585
169 Ga0068867_100221631 3300005459 Bacteria 1525
170 Ga0070685_10004572 3300005466 Bacteria 7002
171 Ga0070685_10040297 3300005466 Bacteria 2657
172 Ga0070685_10158714 3300005466 Bacteria 1440
173 Ga0070706_100000734 3300005467 Bacteria 37002
174 Ga0070706_100017793 3300005467 Bacteria 6557
175 Ga0070706_100018523 3300005467 Bacteria 6419
176 Ga0070707_100000413 3300005468 Bacteria 42232
177 Ga0070707_100003538 3300005468 Bacteria 14745
178 Ga0070707_100013149 3300005468 Bacteria 7737
179 Ga0070707_100027854 3300005468 Bacteria 5375
180 Ga0070707_100269823 3300005468 Bacteria 1654
181 Ga0070698_100000248 3300005471 Bacteria 54156
182 Ga0070698_100001737 3300005471 Bacteria 24310
183 Ga0070698_100006040 3300005471 Bacteria 13191
184 Ga0070698_100012185 3300005471 Bacteria 9109
185 Ga0070698_100085202 3300005471 Bacteria 3147
186 Ga0070699_100007857 3300005518 Bacteria 9266
187 Ga0070699_100018091 3300005518 Bacteria 6054
188 Ga0070699_100018272 3300005518 Bacteria 6024
189 Ga0070699_100027765 3300005518 Bacteria 4880
190 Ga0070699_100081200 3300005518 Bacteria 2826
191 Ga0070699_100111989 3300005518 Bacteria 2397
192 Ga0070679_100018632 3300005530 Bacteria 6739
193 Ga0070679_100019567 3300005530 Bacteria 6587
194 Ga0070679_100026759 3300005530 Bacteria 5672
195 Ga0070679_100074982 3300005530 Bacteria 3373
196 Ga0070684_100000405 3300005535 Bacteria 29563
197 Ga0070684_100006472 3300005535 Bacteria 9068
198 Ga0070684_100012793 3300005535 Bacteria 6740
199 Ga0070684_100033053 3300005535 Bacteria 4414
200 Ga0070684_100050810 3300005535 Bacteria 3602
201 Ga0070684_100100070 3300005535 Bacteria 2588
202 Ga0070684_100157143 3300005535 Bacteria 2062
203 Ga0070684_100251757 3300005535 Bacteria 1614
204 Ga0070697_100001144 3300005536 Bacteria 20086
205 Ga0070697_100002694 3300005536 Bacteria 13677
206 Ga0070697_100005485 3300005536 Bacteria 9779
207 Ga0070697_100087831 3300005536 Bacteria 2567
208 Ga0068853_100001476 3300005539 Bacteria 17089
209 Ga0068853_100002548 3300005539 Bacteria 13688
210 Ga0068853_100072301 3300005539 Bacteria 3005
211 Ga0068853_100074953 3300005539 Bacteria 2953
212 Ga0068853_100226202 3300005539 Bacteria 1710
213 Ga0068853_100242280 3300005539 Bacteria 1653
214 Ga0068853_100280943 3300005539 Bacteria 1535
215 Ga0070672_100026923 3300005543 Bacteria 4285
216 Ga0070672_100150028 3300005543 Bacteria 1928
217 Ga0070695_100007045 3300005545 Bacteria 6664
218 Ga0070696_100082027 3300005546 Bacteria 2285
219 Ga0070696_100177374 3300005546 Bacteria 1579
220 Ga0070693_100008654 3300005547 Bacteria 5034
221 Ga0070693_100109228 3300005547 Bacteria 1698
222 Ga0070665_100000103 3300005548 Bacteria 158183
223 Ga0070665_100000825 3300005548 Bacteria 40466
224 Ga0070665_100041330 3300005548 Bacteria 4634
225 Ga0070665_100065912 3300005548 Bacteria 3632
226 Ga0070665_100091514 3300005548 Bacteria 3046
227 Ga0070665_100134937 3300005548 Bacteria 2470
228 Ga0068855_100000868 3300005563 Bacteria 37566
229 Ga0068855_100005556 3300005563 Bacteria 15387
230 Ga0068855_100010348 3300005563 Bacteria 11250
231 Ga0068855_100019075 3300005563 Bacteria 8244
232 Ga0068855_100030920 3300005563 Bacteria 6399
233 Ga0068855_100062420 3300005563 Bacteria 4350
234 Ga0068855_100093628 3300005563 Bacteria 3465
235 Ga0068855_100195266 3300005563 Bacteria 2280
236 Ga0070664_100000851 3300005564 Bacteria 23587
237 Ga0070664_100030695 3300005564 Bacteria 4485
238 Ga0070664_100075070 3300005564 Bacteria 2903
239 Ga0070664_100111465 3300005564 Bacteria 2388
240 Ga0070664_100127493 3300005564 Bacteria 2233
241 Ga0068857_100002858 3300005577 Bacteria 14192
242 Ga0068857_100064519 3300005577 Bacteria 3256
243 Ga0068857_100280722 3300005577 Bacteria 1532
244 Ga0068854_100044049 3300005578 Bacteria 3166
245 Ga0068854_100065188 3300005578 Bacteria 2648
246 Ga0068854_100155876 3300005578 Bacteria 1765
247 Ga0068856_100000126 3300005614 Bacteria 76992
248 Ga0068856_100005005 3300005614 Bacteria 13120
249 Ga0068856_100012012 3300005614 Bacteria 8390
250 Ga0068856_100041636 3300005614 Bacteria 4515
251 Ga0068856_100066830 3300005614 Bacteria 3552
252 Ga0068856_100087828 3300005614 Bacteria 3091
253 Ga0068856_100120911 3300005614 Bacteria 2620
254 Ga0068856_100143334 3300005614 Bacteria 2397
255 Ga0068856_100455963 3300005614 Bacteria 1299
256 Ga0070702_100003690 3300005615 Bacteria 6896
257 Ga0070702_100073284 3300005615 Bacteria 2028
258 Ga0068852_100000003 3300005616 Bacteria 246525
259 Ga0068852_100000237 3300005616 Bacteria 37279
260 Ga0068852_100001633 3300005616 Bacteria 15303
261 Ga0068852_100025876 3300005616 Bacteria 4762
262 Ga0068852_100056069 3300005616 Bacteria 3403
263 Ga0068852_100077603 3300005616 Bacteria 2937
264 Ga0068852_100082911 3300005616 Bacteria 2850
265 Ga0068852_100267214 3300005616 Bacteria 1645
266 Ga0068859_100011245 3300005617 Bacteria 9004
267 Ga0068859_100012187 3300005617 Bacteria 8642
268 Ga0068859_100014257 3300005617 Bacteria 7972
269 Ga0068859_100040023 3300005617 Bacteria 4704
270 Ga0068864_100009954 3300005618 Bacteria 7844
271 Ga0068864_100031296 3300005618 Bacteria 4514
272 Ga0068864_100049096 3300005618 Bacteria 3630
273 Ga0068864_100130362 3300005618 Bacteria 2258
274 Ga0068864_100143818 3300005618 Bacteria 2153
275 Ga0068864_100329303 3300005618 Bacteria 1436
276 Ga0068866_10000993 3300005718 Bacteria 12483
277 Ga0068866_10058585 3300005718 Bacteria 1990
278 Ga0068861_100229929 3300005719 Bacteria 1572
279 Ga0068851_10003726 3300005834 Bacteria 6809
280 Ga0068851_10013138 3300005834 Bacteria 3917
281 Ga0068851_10053531 3300005834 Bacteria 2055
282 Ga0068863_100005651 3300005841 Bacteria 12278
283 Ga0068863_100012434 3300005841 Bacteria 8219
284 Ga0068863_100028481 3300005841 Bacteria 5334
285 Ga0068863_100047432 3300005841 Bacteria 4074
286 Ga0068863_100054479 3300005841 Bacteria 3789
287 Ga0068858_100001642 3300005842 Bacteria 22826
288 Ga0068858_100064877 3300005842 Unclassified 3380
289 Ga0068858_100080393 3300005842 Bacteria 3029
290 Ga0068860_100008263 3300005843 Bacteria 10357
291 Ga0068860_100016166 3300005843 Bacteria 7281
292 Ga0068860_100051626 3300005843 Bacteria 3912
293 Ga0068860_100156811 3300005843 Bacteria 2194
294 Ga0068862_100017808 3300005844 Bacteria 5914
295 Ga0068862_100053408 3300005844 Bacteria 3459
296 Ga0068862_100064827 3300005844 Bacteria 3145
297 Ga0081540_1003699 3300005983 Bacteria 11981
298 Ga0081540_1037990 3300005983 Bacteria 2544
299 Ga0081539_10000031 3300005985 Bacteria 313232
300 Ga0081539_10000079 3300005985 Bacteria 223413
301 Ga0070717_10004304 3300006028 Bacteria 10267
302 Ga0070717_10007200 3300006028 Bacteria 8250
303 Ga0070717_10010666 3300006028 Bacteria 6947
304 Ga0070717_10015059 3300006028 Bacteria 5962
305 Ga0070717_10024271 3300006028 Bacteria 4812
306 Ga0070717_10025475 3300006028 Bacteria 4705
307 Ga0070717_10079571 3300006028 Bacteria 2748
308 Ga0070717_10096801 3300006028 Bacteria 2500
309 Ga0070717_10109622 3300006028 Bacteria 2353
310 Ga0070717_10153011 3300006028 Bacteria 1997
311 Ga0075365_10000133 3300006038 Bacteria 22901
312 Ga0075365_10024577 3300006038 Bacteria 3802
313 Ga0075368_10042757 3300006042 Bacteria 1784
314 Ga0075363_100001292 3300006048 Bacteria 9335
315 Ga0075363_100084347 3300006048 Bacteria 1742
316 Ga0075364_10000593 3300006051 Bacteria 18717
317 Ga0075364_10007258 3300006051 Bacteria 6571
318 Ga0075364_10021227 3300006051 Bacteria 4092
319 Ga0075364_10024525 3300006051 Bacteria 3831
320 Ga0075432_10035020 3300006058 Bacteria 1745
321 Ga0070715_10089156 3300006163 Bacteria 1415
322 Ga0070716_100017291 3300006173 Bacteria 3735
323 Ga0070716_100023216 3300006173 Bacteria 3286
324 Ga0070716_100023965 3300006173 Bacteria 3244
325 Ga0070716_100050277 3300006173 Bacteria 2365
326 Ga0070716_100088719 3300006173 Bacteria 1866
327 Ga0070712_100000632 3300006175 Bacteria 20699
328 Ga0070712_100003929 3300006175 Bacteria 9153
329 Ga0070712_100008366 3300006175 Bacteria 6506
330 Ga0070712_100017208 3300006175 Bacteria 4677
331 Ga0070712_100018767 3300006175 Bacteria 4498
332 Ga0070712_100026889 3300006175 Bacteria 3838
333 Ga0075367_10005671 3300006178 Bacteria 6231
334 Ga0075367_10063867 3300006178 Bacteria 2202
335 Ga0075367_10096947 3300006178 Bacteria 1799
336 Ga0075369_10000067 3300006186 Bacteria 27323
337 Ga0075427_10000482 3300006194 Bacteria 4568
338 Ga0075366_10000087 3300006195 Bacteria 36461
339 Ga0075366_10025645 3300006195 Bacteria 3446
340 Ga0075366_10036851 3300006195 Bacteria 2884
341 Ga0075366_10046042 3300006195 Bacteria 2585
342 Ga0097621_100008726 3300006237 Bacteria 7322
343 Ga0097621_100010928 3300006237 Bacteria 6665
344 Ga0097621_100022246 3300006237 Bacteria 4920
345 Ga0097621_100023994 3300006237 Bacteria 4756
346 Ga0075370_10000557 3300006353 Bacteria 14265
347 Ga0075370_10006492 3300006353 Bacteria 5887
348 Ga0075370_10013135 3300006353 Bacteria 4395
349 Ga0075370_10092150 3300006353 Bacteria 1749
350 Ga0068871_100016398 3300006358 Bacteria 5578
351 Ga0068871_100027403 3300006358 Bacteria 4456
352 Ga0068871_100036508 3300006358 Bacteria 3913
353 Ga0068871_100120413 3300006358 Bacteria 2216
354 Ga0068871_100144365 3300006358 Bacteria 2025
355 Ga0075428_100017262 3300006844 Bacteria 7976
356 Ga0075428_100111708 3300006844 Unclassified 2977
357 Ga0075428_100158386 3300006844 Bacteria 2458
358 Ga0075428_100214621 3300006844 Bacteria 2079
359 Ga0075430_100003620 3300006846 Bacteria 12959
360 Ga0075431_100097896 3300006847 Bacteria 3029
361 Ga0075431_100162048 3300006847 Bacteria 2299
362 Ga0075433_10065304 3300006852 Bacteria 3192
363 Ga0075434_100003909 3300006871 Bacteria 13339
364 Ga0075434_100004099 3300006871 Bacteria 13069
365 Ga0075434_100046012 3300006871 Unclassified 4330
366 Ga0075434_100097336 3300006871 Bacteria 2947
367 Ga0075434_100100156 3300006871 Bacteria 2904
368 Ga0075429_100002757 3300006880 Eukaryota 14853
369 Ga0075429_100196148 3300006880 Bacteria 1769
370 Ga0068865_100011355 3300006881 Bacteria 5571
371 Ga0068865_100035946 3300006881 Bacteria 3335
372 Ga0075436_100000291 3300006914 Bacteria 31895
373 Ga0075436_100001688 3300006914 Bacteria 15097
374 Ga0075436_100002329 3300006914 Bacteria 13102
375 Ga0075436_100030559 3300006914 Bacteria 3708
376 Ga0097620_100011246 3300006931 Bacteria 9004
377 Ga0097620_100012188 3300006931 Bacteria 8642
378 Ga0097620_100014257 3300006931 Bacteria 7972
379 Ga0097620_100040020 3300006931 Bacteria 4704
380 Ga0075435_100004630 3300007076 Bacteria 9472
381 Ga0075435_100005310 3300007076 Bacteria 8975
382 Ga0075435_100084219 3300007076 Bacteria 2616
383 Ga0075435_100096730 3300007076 Bacteria 2442
384 Ga0105251_10000051 3300009011 Bacteria 106703
385 Ga0105251_10004145 3300009011 Bacteria 10100
386 Ga0105251_10034101 3300009011 Bacteria 2522
387 Ga0105244_10009335 3300009036 Bacteria 6039
388 Ga0105244_10048534 3300009036 Bacteria 2172
389 Ga0105250_10014976 3300009092 Bacteria 3180
390 Ga0105250_10016346 3300009092 Bacteria 3025
391 Ga0105240_10000001 3300009093 Bacteria 2887840
392 Ga0105240_10000286 3300009093 Bacteria 98493
393 Ga0105240_10001411 3300009093 Bacteria 41214
394 Ga0105240_10003378 3300009093 Bacteria 24818
395 Ga0105240_10004021 3300009093 Bacteria 22639
396 Ga0105240_10007046 3300009093 Bacteria 16398
397 Ga0105240_10015022 3300009093 Bacteria 10542
398 Ga0105240_10015320 3300009093 Bacteria 10429
399 Ga0105240_10015705 3300009093 Bacteria 10275
400 Ga0105240_10025825 3300009093 Bacteria 7713
401 Ga0105240_10027729 3300009093 Bacteria 7412
402 Ga0105240_10031904 3300009093 Bacteria 6826
403 Ga0105240_10067352 3300009093 Bacteria 4438
404 Ga0105240_10183000 3300009093 Bacteria 2471
405 Ga0111539_10000854 3300009094 Bacteria 39754
406 Ga0111539_10000878 3300009094 Bacteria 39274
407 Ga0111539_10034480 3300009094 Bacteria 6136
408 Ga0111539_10061528 3300009094 Bacteria 4448
409 Ga0105245_10002844 3300009098 Bacteria 15567
410 Ga0105245_10011797 3300009098 Bacteria 7602
411 Ga0105245_10014417 3300009098 Bacteria 6887
412 Ga0105245_10038776 3300009098 Bacteria 4239
413 Ga0105245_10039668 3300009098 Bacteria 4191
414 Ga0105245_10086945 3300009098 Bacteria 2868
415 Ga0105245_10175338 3300009098 Bacteria 2044
416 Ga0105245_10257035 3300009098 Bacteria 1699
417 Ga0105245_10302970 3300009098 Bacteria 1569
418 Ga0105247_10006209 3300009101 Bacteria 7412
419 Ga0105247_10059580 3300009101 Bacteria 2364
420 Ga0114129_10005760 3300009147 Bacteria 17559
421 Ga0114129_10019020 3300009147 Bacteria 9785
422 Ga0114129_10081560 3300009147 Bacteria 4496
423 Ga0114129_10104916 3300009147 Bacteria 3906
424 Ga0105243_10002826 3300009148 Bacteria 14404
425 Ga0105243_10186343 3300009148 Bacteria 1809
426 Ga0105241_10000563 3300009174 Bacteria 28046
427 Ga0105241_10002309 3300009174 Bacteria 14324
428 Ga0105241_10004298 3300009174 Bacteria 10533
429 Ga0105241_10021149 3300009174 Bacteria 4810
430 Ga0105241_10033758 3300009174 Bacteria 3842
431 Ga0105241_10079366 3300009174 Bacteria 2566
432 Ga0105241_10120649 3300009174 Bacteria 2111
433 Ga0105241_10136973 3300009174 Bacteria 1989
434 Ga0105241_10150242 3300009174 Bacteria 1905
435 Ga0105248_10009529 3300009177 Bacteria 10688
436 Ga0105248_10023333 3300009177 Bacteria 6872
437 Ga0105248_10028195 3300009177 Bacteria 6253
438 Ga0105248_10028494 3300009177 Bacteria 6222
439 Ga0105248_10065636 3300009177 Bacteria 4075
440 Ga0105248_10203841 3300009177 Bacteria 2229
441 Ga0105248_10207220 3300009177 Bacteria 2209
442 Ga0105248_10256544 3300009177 Bacteria 1968
443 Ga0105248_10314298 3300009177 Bacteria 1764
444 Ga0105248_10330164 3300009177 Bacteria 1718
445 Ga0105237_10001230 3300009545 Bacteria 34130
446 Ga0105237_10002902 3300009545 Bacteria 20789
447 Ga0105237_10006587 3300009545 Bacteria 12844
448 Ga0105237_10007501 3300009545 Bacteria 11928
449 Ga0105237_10010797 3300009545 Bacteria 9694
450 Ga0105237_10010990 3300009545 Bacteria 9607
451 Ga0105237_10065209 3300009545 Bacteria 3638
452 Ga0105237_10065477 3300009545 Bacteria 3630
453 Ga0105237_10127457 3300009545 Unclassified 2539
454 Ga0105237_10192586 3300009545 Bacteria 2039
455 Ga0105238_10000080 3300009551 Bacteria 109312
456 Ga0105238_10001792 3300009551 Bacteria 21495
457 Ga0105238_10003385 3300009551 Bacteria 15919
458 Ga0105238_10007159 3300009551 Bacteria 11160
459 Ga0105238_10022308 3300009551 Bacteria 6454
460 Ga0105238_10058249 3300009551 Bacteria 3872
461 Ga0105238_10067567 3300009551 Bacteria 3575
462 Ga0105238_10070391 3300009551 Bacteria 3497
463 Ga0105238_10071450 3300009551 Bacteria 3468
464 Ga0105249_10026811 3300009553 Bacteria 5196
465 Ga0105249_10043456 3300009553 Bacteria 4086
466 Ga0105239_10001359 3300010375 Bacteria 32870
467 Ga0105239_10003216 3300010375 Bacteria 20200
468 Ga0105239_10005564 3300010375 Bacteria 14734
469 Ga0105239_10027050 3300010375 Bacteria 6315
470 Ga0105239_10039626 3300010375 Bacteria 5161
471 Ga0105239_10051501 3300010375 Bacteria 4513
472 Ga0105239_10052377 3300010375 Bacteria 4476
473 Ga0105246_10008397 3300011119 Bacteria 6346
474 Ga0105246_10011161 3300011119 Bacteria 5568
475 Ga0157373_10002130 3300013100 Bacteria 14997
476 Ga0157373_10009837 3300013100 Bacteria 7050
477 Ga0157373_10027853 3300013100 Bacteria 4076
478 Ga0157373_10145423 3300013100 Bacteria 1667
479 Ga0157371_10057173 3300013102 Bacteria 2766
480 Ga0157371_10082311 3300013102 Bacteria 2279
481 Ga0157371_10168899 3300013102 Bacteria 1563
482 Ga0157370_10000001 3300013104 Bacteria 529517
483 Ga0157370_10004782 3300013104 Bacteria 15404
484 Ga0157370_10006293 3300013104 Bacteria 13128
485 Ga0157370_10043205 3300013104 Bacteria 4338
486 Ga0157370_10128139 3300013104 Bacteria 2368
487 Ga0157370_10136820 3300013104 Bacteria 2283
488 Ga0157369_10000092 3300013105 Bacteria 123849
489 Ga0157369_10000519 3300013105 Bacteria 50731
490 Ga0157369_10003681 3300013105 Bacteria 18215
491 Ga0157369_10005372 3300013105 Bacteria 14914
492 Ga0157369_10010713 3300013105 Bacteria 10433
493 Ga0157369_10011788 3300013105 Bacteria 9926
494 Ga0157369_10013984 3300013105 Bacteria 9070
495 Ga0157369_10015212 3300013105 Bacteria 8684
496 Ga0157369_10018114 3300013105 Bacteria 7899
497 Ga0157369_10045051 3300013105 Bacteria 4799
498 Ga0157369_10055998 3300013105 Bacteria 4255
499 Ga0157369_10114365 3300013105 Bacteria 2866
500 Ga0157369_10227467 3300013105 Bacteria 1951
501 Ga0157369_10427930 3300013105 Bacteria 1372
502 Ga0157374_10000439 3300013296 Bacteria 37672
503 Ga0157374_10003799 3300013296 Bacteria 12700
504 Ga0157374_10062127 3300013296 Bacteria 3500
505 Ga0157374_10073313 3300013296 Bacteria 3232
506 Ga0157374_10087149 3300013296 Bacteria 2971
507 Ga0157378_10004302 3300013297 Bacteria 12541
508 Ga0157378_10005921 3300013297 Bacteria 10712
509 Ga0157378_10044531 3300013297 Bacteria 3941
510 Ga0157378_10080010 3300013297 Bacteria 2951
511 Ga0157378_10116417 3300013297 Bacteria 2458
512 Ga0157378_10317096 3300013297 Bacteria 1513
513 Ga0157378_10348290 3300013297 Bacteria 1446
514 Ga0163162_10032162 3300013306 Bacteria 5208
515 Ga0163162_10082054 3300013306 Bacteria 3296
516 Ga0163162_10158227 3300013306 Bacteria 2386
517 Ga0163162_10261846 3300013306 Bacteria 1861
518 Ga0157372_10000045 3300013307 Bacteria 151277
519 Ga0157372_10000864 3300013307 Bacteria 32870
520 Ga0157372_10001006 3300013307 Bacteria 30802
521 Ga0157372_10009411 3300013307 Bacteria 10393
522 Ga0157372_10021878 3300013307 Bacteria 6912
523 Ga0157372_10042140 3300013307 Bacteria 5047
524 Ga0157372_10045596 3300013307 Bacteria 4864
525 Ga0157372_10051287 3300013307 Bacteria 4591
526 Ga0157372_10081468 3300013307 Bacteria 3663
527 Ga0157372_10083616 3300013307 Bacteria 3616
528 Ga0157372_10117417 3300013307 Bacteria 3051
529 Ga0157372_10248934 3300013307 Bacteria 2062
530 Ga0157372_10484059 3300013307 Bacteria 1443
531 Ga0157375_10002505 3300013308 Bacteria 15923
532 Ga0157375_10009579 3300013308 Bacteria 8506
533 Ga0157375_10016019 3300013308 Bacteria 6724
534 Ga0157375_10167618 3300013308 Bacteria 2342
535 Ga0157375_10187043 3300013308 Bacteria 2225
536 Ga0157375_10224189 3300013308 Unclassified 2039
537 Ga0157375_10291909 3300013308 Bacteria 1794
538 Ga0163163_10000570 3300014325 Bacteria 32431
539 Ga0163163_10008588 3300014325 Bacteria 9083
540 Ga0157380_10234793 3300014326 Bacteria 1649
541 Ga0182008_10022232 3300014497 Bacteria 3248
542 Ga0182008_10030257 3300014497 Bacteria 2730
543 Ga0157377_10006455 3300014745 Bacteria 5598
544 Ga0157377_10112824 3300014745 Bacteria 1636
545 Ga0157379_10029199 3300014968 Bacteria 4904
546 Ga0157379_10042303 3300014968 Bacteria 4067
547 Ga0157379_10043559 3300014968 Bacteria 4007
548 Ga0157379_10079649 3300014968 Bacteria 2934
549 Ga0157379_10125016 3300014968 Bacteria 2314
550 Ga0157379_10166291 3300014968 Bacteria 1991
551 Ga0157379_10178569 3300014968 Bacteria 1918
552 Ga0157376_10000074 3300014969 Bacteria 75822
553 Ga0157376_10002444 3300014969 Bacteria 12557
554 Ga0157376_10017251 3300014969 Bacteria 5500
555 Ga0182006_1015431 3300015261 Bacteria 3274
556 Ga0182007_10000134 3300015262 Bacteria 52119
557 Ga0182007_10003302 3300015262 Bacteria 7647
558 Ga0182005_1011366 3300015265 Bacteria 2539
559 Ga0183368_1002 3300015687 Bacteria 1865598
560 Ga0163161_10003606 3300017792 Bacteria 10859
561 Ga0163161_10042311 3300017792 Bacteria 3276
562 Ga0206353_11000141 3300020082 Bacteria 12004
563 Ga0213872_10000388 3300021361 Bacteria 36574
564 Ga0213872_10059652 3300021361 Bacteria 1726
565 Ga0213876_10009387 3300021384 Bacteria 5269
566 Ga0213876_10011169 3300021384 Bacteria 4801
567 Ga0224712_10001480 3300022467 Bacteria 5426
568 Ga0209760_100548 3300025207 Bacteria 6975
569 Ga0209784_100053 3300025224 Bacteria 182075
570 Ga0209566_100050 3300025225 Bacteria 234653
571 Ga0209566_103958 3300025225 Bacteria 2117
572 Ga0209674_100001 3300025226 Bacteria 4013750
573 Ga0209674_100025 3300025226 Bacteria 515942
574 Ga0209672_100002 3300025228 Bacteria 1733325
575 Ga0209672_100064 3300025228 Bacteria 204609
576 Ga0209672_102577 3300025228 Bacteria 4330
577 Ga0209147_100003 3300025229 Bacteria 1733325
578 Ga0209147_105009 3300025229 Bacteria 2066
579 Ga0209563_100001 3300025230 Bacteria 4013775
580 Ga0209563_101346 3300025230 Bacteria 6695
581 Ga0207427_100041 3300025231 Bacteria 263659
582 Ga0207427_100061 3300025231 Bacteria 182815
583 Ga0207427_100834 3300025231 Bacteria 13770
584 Ga0207427_101099 3300025231 Bacteria 10994
585 Ga0207427_103063 3300025231 Bacteria 3799
586 Ga0209437_100037 3300025233 Bacteria 459730
587 Ga0209437_100267 3300025233 Bacteria 79455
588 Ga0209437_100279 3300025233 Bacteria 75208
589 Ga0209258_100005 3300025242 Bacteria 1087938
590 Ga0209258_100138 3300025242 Bacteria 167495
591 Ga0209258_102763 3300025242 Bacteria 4246
592 Ga0207425_1000011 3300025245 Bacteria 550735
593 Ga0207425_1000072 3300025245 Bacteria 115017
594 Ga0209646_1000351 3300025246 Bacteria 33528
595 Ga0209026_1000104 3300025250 Bacteria 152614
596 Ga0209677_100001 3300025253 Bacteria 4013787
597 Ga0209677_100601 3300025253 Bacteria 19466
598 Ga0209148_1000001 3300025254 Bacteria 2545271
599 Ga0209148_1000002 3300025254 Bacteria 2399500
600 Ga0209148_1000006 3300025254 Bacteria 1733325
601 Ga0209148_1000108 3300025254 Bacteria 204609
602 Ga0209759_1000006 3300025256 Bacteria 492407
603 Ga0209759_1000052 3300025256 Bacteria 213964
604 Ga0209759_1000220 3300025256 Bacteria 87504
605 Ga0209759_1003685 3300025256 Bacteria 6010
606 Ga0209129_1000031 3300025258 Bacteria 383039
607 Ga0209129_1000737 3300025258 Bacteria 21008
608 Ga0209129_1005223 3300025258 Bacteria 4701
609 Ga0209233_1000002 3300025261 Bacteria 2501366
610 Ga0209233_1000014 3300025261 Bacteria 996641
611 Ga0209233_1000018 3300025261 Bacteria 886857
612 Ga0209233_1000545 3300025261 Bacteria 21104
613 Ga0209233_1002368 3300025261 Bacteria 7005
614 Ga0209233_1008622 3300025261 Bacteria 3140
615 Ga0209455_1000003 3300025272 Bacteria 1471893
616 Ga0209455_1000079 3300025272 Bacteria 268778
617 Ga0209455_1000102 3300025272 Bacteria 204609
618 Ga0209455_1001023 3300025272 Bacteria 13979
619 Ga0209455_1002782 3300025272 Bacteria 6536
620 Ga0209673_1005552 3300025273 Bacteria 6310
621 Ga0209130_1000693 3300025284 Bacteria 30142
622 Ga0209676_1000100 3300025292 Bacteria 229621
623 Ga0209676_1001455 3300025292 Bacteria 22206
624 Ga0209676_1004470 3300025292 Bacteria 7771
625 Ga0209676_1007055 3300025292 Bacteria 5386
626 Ga0209025_1000012 3300025294 Bacteria 924362
627 Ga0209025_1000473 3300025294 Bacteria 78078
628 Ga0209025_1000509 3300025294 Bacteria 74336
629 Ga0209025_1000721 3300025294 Bacteria 56094
630 Ga0209025_1000802 3300025294 Bacteria 50981
631 Ga0209025_1031800 3300025294 Bacteria 2485
632 Ga0209564_1006514 3300025295 Bacteria 6278
633 Ga0209564_1015451 3300025295 Bacteria 3102
634 Ga0209758_1000009 3300025297 Bacteria 1123483
635 Ga0209758_1000143 3300025297 Bacteria 171093
636 Ga0209758_1000853 3300025297 Bacteria 42429
637 Ga0209758_1002491 3300025297 Bacteria 18714
638 Ga0209758_1031122 3300025297 Bacteria 2195
639 Ga0209758_1036152 3300025297 Bacteria 1934
640 Ga0209050_1000005 3300025298 Bacteria 1557793
641 Ga0209050_1008322 3300025298 Bacteria 5578
642 Ga0209256_1000752 3300025299 Bacteria 42238
643 Ga0209256_1001211 3300025299 Bacteria 28793
644 Ga0209256_1001259 3300025299 Bacteria 27751
645 Ga0207426_1000020 3300025302 Bacteria 558084
646 Ga0207426_1000080 3300025302 Bacteria 304917
647 Ga0207426_1001406 3300025302 Bacteria 20221
648 Ga0207426_1024668 3300025302 Bacteria 2037
649 Ga0209051_1000507 3300025303 Bacteria 49396
650 Ga0209051_1001813 3300025303 Bacteria 16915
651 Ga0209051_1024235 3300025303 Bacteria 2500
652 Ga0209257_1000712 3300025304 Bacteria 51443
653 Ga0209257_1000822 3300025304 Bacteria 45027
654 Ga0209257_1001291 3300025304 Bacteria 30556
655 Ga0209257_1001585 3300025304 Bacteria 26112
656 Ga0209257_1005469 3300025304 Bacteria 8909
657 Ga0209257_1008420 3300025304 Bacteria 5870
658 Ga0209257_1019269 3300025304 Bacteria 2578
659 Ga0207697_10042039 3300025315 Bacteria 1877
660 Ga0207656_10018669 3300025321 Bacteria 2733
661 Ga0207656_10022080 3300025321 Bacteria 2550
662 Ga0207696_1011511 3300025711 Bacteria 3179
663 Ga0207655_1022025 3300025728 Bacteria 3209
664 Ga0207713_1000462 3300025735 Bacteria 42616
665 Ga0207653_10052439 3300025885 Bacteria 1360
666 Ga0207710_10002756 3300025900 Bacteria 8038
667 Ga0207710_10074409 3300025900 Bacteria 1564
668 Ga0207688_10000304 3300025901 Bacteria 22575
669 Ga0207680_10084806 3300025903 Bacteria 2000
670 Ga0207647_10000278 3300025904 Bacteria 41658
671 Ga0207647_10005308 3300025904 Bacteria 9469
672 Ga0207647_10012431 3300025904 Bacteria 5925
673 Ga0207647_10030452 3300025904 Bacteria 3481
674 Ga0207699_10008403 3300025906 Bacteria 5094
675 Ga0207699_10033589 3300025906 Bacteria 2901
676 Ga0207645_10023338 3300025907 Bacteria 4021
677 Ga0207645_10041363 3300025907 Bacteria 2951
678 Ga0207645_10069247 3300025907 Bacteria 2257
679 Ga0207645_10108041 3300025907 Bacteria 1800
680 Ga0207643_10013673 3300025908 Bacteria 4400
681 Ga0207705_10020989 3300025909 Bacteria 4660
682 Ga0207705_10217003 3300025909 Bacteria 1452
683 Ga0207684_10000389 3300025910 Bacteria 59084
684 Ga0207684_10004583 3300025910 Bacteria 12986
685 Ga0207684_10046578 3300025910 Bacteria 3679
686 Ga0207654_10000023 3300025911 Bacteria 161401
687 Ga0207654_10004886 3300025911 Bacteria 6782
688 Ga0207654_10005075 3300025911 Bacteria 6642
689 Ga0207654_10021511 3300025911 Bacteria 3431
690 Ga0207654_10041420 3300025911 Bacteria 2600
691 Ga0207654_10160223 3300025911 Bacteria 1453
692 Ga0207707_10021868 3300025912 Bacteria 5591
693 Ga0207707_10028260 3300025912 Bacteria 4903
694 Ga0207707_10044183 3300025912 Bacteria 3884
695 Ga0207707_10080650 3300025912 Bacteria 2841
696 Ga0207695_10000001 3300025913 Bacteria 2888630
697 Ga0207695_10000026 3300025913 Bacteria 624558
698 Ga0207695_10000096 3300025913 Bacteria 265048
699 Ga0207695_10000144 3300025913 Bacteria 211125
700 Ga0207695_10000624 3300025913 Bacteria 71152
701 Ga0207695_10002958 3300025913 Bacteria 24505
702 Ga0207695_10008025 3300025913 Bacteria 13287
703 Ga0207695_10008849 3300025913 Bacteria 12536
704 Ga0207695_10010412 3300025913 Bacteria 11378
705 Ga0207695_10032685 3300025913 Bacteria 5690
706 Ga0207695_10070881 3300025913 Bacteria 3561
707 Ga0207695_10072943 3300025913 Bacteria 3500
708 Ga0207695_10078805 3300025913 Bacteria 3342
709 Ga0207695_10204021 3300025913 Bacteria 1890
710 Ga0207695_10226624 3300025913 Bacteria 1775
711 Ga0207671_10000890 3300025914 Bacteria 37829
712 Ga0207671_10003428 3300025914 Bacteria 15826
713 Ga0207671_10004998 3300025914 Bacteria 12413
714 Ga0207671_10007898 3300025914 Bacteria 9135
715 Ga0207671_10031185 3300025914 Bacteria 3972
716 Ga0207671_10049004 3300025914 Bacteria 3126
717 Ga0207671_10082288 3300025914 Unclassified 2415
718 Ga0207671_10093025 3300025914 Unclassified 2274
719 Ga0207671_10121419 3300025914 Bacteria 1997
720 Ga0207693_10000016 3300025915 Bacteria 145892
721 Ga0207693_10000067 3300025915 Bacteria 91025
722 Ga0207693_10000415 3300025915 Bacteria 38698
723 Ga0207693_10009303 3300025915 Bacteria 8016
724 Ga0207693_10010555 3300025915 Bacteria 7495
725 Ga0207693_10024245 3300025915 Bacteria 4816
726 Ga0207693_10081768 3300025915 Bacteria 2529
727 Ga0207663_10000608 3300025916 Bacteria 15863
728 Ga0207663_10151620 3300025916 Bacteria 1627
729 Ga0207660_10080862 3300025917 Bacteria 2387
730 Ga0207660_10240824 3300025917 Bacteria 1425
731 Ga0207662_10008567 3300025918 Bacteria 5606
732 Ga0207662_10024528 3300025918 Bacteria 3469
733 Ga0207657_10000003 3300025919 Bacteria 263148
734 Ga0207657_10006444 3300025919 Bacteria 12163
735 Ga0207657_10007051 3300025919 Bacteria 11546
736 Ga0207657_10013752 3300025919 Bacteria 7923
737 Ga0207657_10015794 3300025919 Bacteria 7297
738 Ga0207657_10017961 3300025919 Bacteria 6769
739 Ga0207657_10092158 3300025919 Bacteria 2526
740 Ga0207649_10002972 3300025920 Bacteria 9340
741 Ga0207649_10012549 3300025920 Bacteria 4706
742 Ga0207649_10015414 3300025920 Bacteria 4294
743 Ga0207649_10023379 3300025920 Bacteria 3579
744 Ga0207649_10026449 3300025920 Bacteria 3394
745 Ga0207649_10058379 3300025920 Bacteria 2416
746 Ga0207652_10005130 3300025921 Bacteria 10630
747 Ga0207652_10061707 3300025921 Bacteria 3238
748 Ga0207652_10078988 3300025921 Bacteria 2874
749 Ga0207646_10001021 3300025922 Bacteria 35814
750 Ga0207646_10003890 3300025922 Bacteria 16570
751 Ga0207646_10004869 3300025922 Bacteria 14386
752 Ga0207646_10129302 3300025922 Bacteria 2272
753 Ga0207694_10000028 3300025924 Bacteria 242395
754 Ga0207694_10000205 3300025924 Bacteria 58152
755 Ga0207694_10002229 3300025924 Bacteria 15910
756 Ga0207694_10011031 3300025924 Bacteria 6825
757 Ga0207694_10013189 3300025924 Bacteria 6222
758 Ga0207694_10015901 3300025924 Bacteria 5677
759 Ga0207694_10022150 3300025924 Bacteria 4818
760 Ga0207694_10026135 3300025924 Bacteria 4438
761 Ga0207694_10069923 3300025924 Bacteria 2743
762 Ga0207694_10221002 3300025924 Bacteria 1545
763 Ga0207650_10004541 3300025925 Bacteria 9492
764 Ga0207650_10162687 3300025925 Bacteria 1769
765 Ga0207659_10021238 3300025926 Bacteria 4305
766 Ga0207659_10037951 3300025926 Bacteria 3348
767 Ga0207687_10004132 3300025927 Bacteria 9722
768 Ga0207687_10212691 3300025927 Bacteria 1518
769 Ga0207700_10001225 3300025928 Bacteria 14669
770 Ga0207700_10008306 3300025928 Bacteria 6421
771 Ga0207700_10015420 3300025928 Bacteria 5042
772 Ga0207700_10017810 3300025928 Bacteria 4754
773 Ga0207700_10086091 3300025928 Bacteria 2469
774 Ga0207700_10088453 3300025928 Bacteria 2439
775 Ga0207664_10000158 3300025929 Bacteria 54104
776 Ga0207664_10030837 3300025929 Bacteria 4098
777 Ga0207664_10079271 3300025929 Bacteria 2666
778 Ga0207664_10109095 3300025929 Bacteria 2299
779 Ga0207664_10138572 3300025929 Bacteria 2055
780 Ga0207644_10033148 3300025931 Bacteria 3607
781 Ga0207690_10000007 3300025932 Bacteria 388533
782 Ga0207690_10001066 3300025932 Bacteria 17554
783 Ga0207690_10058000 3300025932 Bacteria 2617
784 Ga0207706_10002117 3300025933 Bacteria 19438
785 Ga0207706_10006147 3300025933 Bacteria 11151
786 Ga0207706_10035048 3300025933 Bacteria 4464
787 Ga0207706_10043245 3300025933 Bacteria 3993
788 Ga0207706_10052579 3300025933 Bacteria 3596
789 Ga0207706_10057290 3300025933 Bacteria 3433
790 Ga0207706_10063372 3300025933 Bacteria 3255
791 Ga0207686_10003543 3300025934 Bacteria 8375
792 Ga0207709_10005564 3300025935 Bacteria 7135
793 Ga0207669_10058280 3300025937 Bacteria 2355
794 Ga0207669_10131933 3300025937 Bacteria 1718
795 Ga0207704_10061262 3300025938 Bacteria 2333
796 Ga0207704_10155020 3300025938 Bacteria 1622
797 Ga0207704_10237209 3300025938 Bacteria 1360
798 Ga0207665_10004770 3300025939 Bacteria 9019
799 Ga0207665_10009285 3300025939 Bacteria 6458
800 Ga0207665_10012890 3300025939 Bacteria 5497
801 Ga0207665_10049135 3300025939 Bacteria 2834
802 Ga0207665_10061216 3300025939 Bacteria 2551
803 Ga0207665_10064816 3300025939 Bacteria 2483
804 Ga0207691_10006717 3300025940 Bacteria 11092
805 Ga0207691_10021448 3300025940 Bacteria 6098
806 Ga0207691_10029915 3300025940 Bacteria 5093
807 Ga0207711_10001182 3300025941 Bacteria 24848
808 Ga0207711_10021006 3300025941 Bacteria 5451
809 Ga0207711_10026400 3300025941 Bacteria 4873
810 Ga0207711_10099740 3300025941 Bacteria 2568
811 Ga0207711_10183800 3300025941 Bacteria 1902
812 Ga0207711_10205833 3300025941 Bacteria 1797
813 Ga0207711_10281436 3300025941 Bacteria 1532
814 Ga0207689_10003366 3300025942 Bacteria 14638
815 Ga0207689_10004289 3300025942 Bacteria 12981
816 Ga0207689_10279551 3300025942 Bacteria 1382
817 Ga0207661_10000250 3300025944 Bacteria 35030
818 Ga0207661_10002410 3300025944 Bacteria 12877
819 Ga0207661_10042036 3300025944 Bacteria 3602
820 Ga0207661_10042551 3300025944 Bacteria 3582
821 Ga0207661_10156626 3300025944 Bacteria 1974
822 Ga0207679_10087239 3300025945 Bacteria 2402
823 Ga0207679_10352683 3300025945 Bacteria 1283
824 Ga0207667_10000923 3300025949 Bacteria 37509
825 Ga0207667_10004811 3300025949 Bacteria 16518
826 Ga0207667_10005817 3300025949 Bacteria 15032
827 Ga0207667_10006129 3300025949 Bacteria 14608
828 Ga0207667_10011767 3300025949 Bacteria 10141
829 Ga0207667_10017454 3300025949 Bacteria 8075
830 Ga0207667_10028348 3300025949 Bacteria 6082
831 Ga0207667_10148399 3300025949 Bacteria 2414
832 Ga0207651_10033047 3300025960 Bacteria 3331
833 Ga0207712_10017716 3300025961 Bacteria 4630
834 Ga0207712_10091636 3300025961 Bacteria 2239
835 Ga0207712_10200051 3300025961 Bacteria 1584
836 Ga0207668_10056129 3300025972 Bacteria 2742
837 Ga0207668_10076056 3300025972 Bacteria 2416
838 Ga0207640_10149197 3300025981 Bacteria 1716
839 Ga0207640_10213416 3300025981 Bacteria 1472
840 Ga0207658_10001989 3300025986 Bacteria 15250
841 Ga0207658_10078736 3300025986 Bacteria 2519
842 Ga0207677_10000275 3300026023 Bacteria 38579
843 Ga0207677_10000439 3300026023 Bacteria 28110
844 Ga0207677_10013304 3300026023 Bacteria 4763
845 Ga0207677_10064994 3300026023 Bacteria 2543
846 Ga0207677_10187755 3300026023 Bacteria 1632
847 Ga0207677_10205067 3300026023 Bacteria 1570
848 Ga0207703_10000742 3300026035 Bacteria 32170
849 Ga0207703_10002465 3300026035 Bacteria 16049
850 Ga0207703_10022130 3300026035 Bacteria 4983
851 Ga0207639_10000105 3300026041 Bacteria 68111
852 Ga0207639_10014892 3300026041 Bacteria 5478
853 Ga0207639_10027591 3300026041 Bacteria 4138
854 Ga0207639_10070662 3300026041 Bacteria 2727
855 Ga0207639_10290576 3300026041 Bacteria 1441
856 Ga0207639_10374246 3300026041 Bacteria 1278
857 Ga0207678_10011557 3300026067 Bacteria 7753
858 Ga0207678_10030250 3300026067 Bacteria 4727
859 Ga0207678_10165117 3300026067 Bacteria 1891
860 Ga0207708_10008754 3300026075 Bacteria 7489
861 Ga0207708_10021493 3300026075 Bacteria 4866
862 Ga0207708_10071994 3300026075 Bacteria 2649
863 Ga0207708_10127174 3300026075 Bacteria 1990
864 Ga0207702_10000599 3300026078 Bacteria 39855
865 Ga0207702_10004059 3300026078 Bacteria 13135
866 Ga0207702_10046810 3300026078 Bacteria 3642
867 Ga0207702_10048079 3300026078 Bacteria 3597
868 Ga0207702_10061824 3300026078 Bacteria 3196
869 Ga0207702_10074126 3300026078 Bacteria 2937
870 Ga0207702_10113742 3300026078 Bacteria 2411
871 Ga0207702_10121003 3300026078 Bacteria 2343
872 Ga0207702_10148586 3300026078 Bacteria 2129
873 Ga0207641_10010365 3300026088 Bacteria 7659
874 Ga0207641_10021490 3300026088 Bacteria 5303
875 Ga0207641_10029594 3300026088 Bacteria 4530
876 Ga0207641_10039723 3300026088 Bacteria 3936
877 Ga0207641_10047107 3300026088 Bacteria 3635
878 Ga0207641_10191931 3300026088 Bacteria 1878
879 Ga0207648_10006249 3300026089 Bacteria 11862
880 Ga0207648_10040593 3300026089 Bacteria 4089
881 Ga0207648_10188307 3300026089 Bacteria 1828
882 Ga0207676_10000524 3300026095 Bacteria 32178
883 Ga0207676_10005412 3300026095 Bacteria 9040
884 Ga0207676_10012101 3300026095 Bacteria 6175
885 Ga0207674_10002407 3300026116 Bacteria 23606
886 Ga0207674_10003429 3300026116 Bacteria 19404
887 Ga0207674_10014153 3300026116 Bacteria 8816
888 Ga0207674_10017603 3300026116 Bacteria 7795
889 Ga0207674_10024955 3300026116 Bacteria 6380
890 Ga0207674_10032964 3300026116 Bacteria 5428
891 Ga0207674_10044065 3300026116 Bacteria 4598
892 Ga0207674_10099978 3300026116 Bacteria 2882
893 Ga0207674_10119966 3300026116 Bacteria 2598
894 Ga0207674_10215337 3300026116 Bacteria 1869
895 Ga0207675_100019174 3300026118 Bacteria 6383
896 Ga0207675_100180147 3300026118 Bacteria 2023
897 Ga0207675_100238965 3300026118 Bacteria 1755
898 Ga0207683_10000235 3300026121 Bacteria 49040
899 Ga0207683_10004790 3300026121 Bacteria 11653
900 Ga0207683_10039387 3300026121 Bacteria 4123
901 Ga0207683_10099965 3300026121 Bacteria 2589
902 Ga0207683_10111306 3300026121 Bacteria 2452
903 Ga0207683_10133697 3300026121 Bacteria 2232
904 Ga0207698_10000118 3300026142 Bacteria 49342
905 Ga0207698_10000128 3300026142 Bacteria 47261
906 Ga0207698_10000713 3300026142 Bacteria 19233
907 Ga0207698_10019726 3300026142 Bacteria 4623
908 Ga0207698_10048292 3300026142 Bacteria 3230
909 Ga0207698_10291069 3300026142 Bacteria 1516
910 Ga0209371_1000064 3300027312 Bacteria 218637
911 Ga0209371_1000156 3300027312 Bacteria 106826
912 Ga0209371_1000163 3300027312 Bacteria 100853
913 Ga0209371_1009505 3300027312 Bacteria 3084
914 Ga0209813_10002733 3300027866 Bacteria 4067
915 Ga0209813_10025731 3300027866 Bacteria 1695
916 Ga0209974_10029906 3300027876 Bacteria 1805
917 Ga0207428_10000139 3300027907 Bacteria 98277
918 Ga0207428_10083545 3300027907 Bacteria 2490
919 Ga0268266_10000001 3300028379 Bacteria 4040580
920 Ga0268266_10000002 3300028379 Bacteria 3059047
921 Ga0268266_10002024 3300028379 Bacteria 22580
922 Ga0268266_10063972 3300028379 Bacteria 3177
923 Ga0268266_10088318 3300028379 Bacteria 2713
924 Ga0268266_10123909 3300028379 Bacteria 2303
925 Ga0268266_10162313 3300028379 Bacteria 2023
926 Ga0268265_10041251 3300028380 Bacteria 3414
927 Ga0268265_10095534 3300028380 Bacteria 2387
928 Ga0268265_10101642 3300028380 Bacteria 2323
929 Ga0268264_10013801 3300028381 Bacteria 6644
930 Ga0268264_10029579 3300028381 Bacteria 4488
931 Ga0268264_10052154 3300028381 Bacteria 3410
932 Ga0268264_10059118 3300028381 Bacteria 3211
933 Ga0265334_10005063 3300028573 Bacteria 5781
934 Ga0265318_10005296 3300028577 Bacteria 6066
935 Ga0307517_10101037 3300028786 Bacteria 2274
936 Ga0307515_10000382 3300028794 Bacteria 107907
937 Ga0307515_10012279 3300028794 Bacteria 16129
938 Ga0307515_10019915 3300028794 Bacteria 12025
939 Ga0307515_10030579 3300028794 Bacteria 9030
940 Ga0307515_10074648 3300028794 Bacteria 4531
941 Ga0307515_10172322 3300028794 Bacteria 2151
942 Ga0265338_10001393 3300028800 Bacteria 39373
943 Ga0265338_10002714 3300028800 Bacteria 25974
944 Ga0265338_10007466 3300028800 Bacteria 13556
945 Ga0265338_10014811 3300028800 Bacteria 8630
946 Ga0265338_10017582 3300028800 Bacteria 7700
947 Ga0265338_10090147 3300028800 Bacteria 2538
948 Ga0265338_10144124 3300028800 Bacteria 1861
949 Ga0268256_1000028 3300030500 Bacteria 433179
950 Ga0268256_1000130 3300030500 Bacteria 106825
951 Ga0268256_1010223 3300030500 Bacteria 3054
952 Ga0307512_10007391 3300030522 Bacteria 10904
953 Ga0307512_10008127 3300030522 Bacteria 10274
954 Ga0307512_10034426 3300030522 Bacteria 4333
955 Ga0265330_10008769 3300031235 Bacteria 4845
956 Ga0265332_10003860 3300031238 Bacteria 7155
957 Ga0265332_10069791 3300031238 Bacteria 1497
958 Ga0265328_10002208 3300031239 Bacteria 8772
959 Ga0265328_10039329 3300031239 Bacteria 1745
960 Ga0265320_10000855 3300031240 Bacteria 22981
961 Ga0265320_10001597 3300031240 Bacteria 16255
962 Ga0265325_10003448 3300031241 Bacteria 10317
963 Ga0265329_10028998 3300031242 Bacteria 1812
964 Ga0265340_10000265 3300031247 Bacteria 27074
965 Ga0265340_10004766 3300031247 Bacteria 7542
966 Ga0265340_10007005 3300031247 Bacteria 6151
967 Ga0265339_10000040 3300031249 Bacteria 120556
968 Ga0265339_10002741 3300031249 Bacteria 12511
969 Ga0265339_10025292 3300031249 Bacteria 3408
970 Ga0265339_10030108 3300031249 Bacteria 3075
971 Ga0265331_10036190 3300031250 Bacteria 2425
972 Ga0265316_10010021 3300031344 Bacteria 8667
973 Ga0265316_10011815 3300031344 Bacteria 7855
974 Ga0265316_10076669 3300031344 Bacteria 2568
975 Ga0307513_10002543 3300031456 Bacteria 25210
976 Ga0307513_10014673 3300031456 Bacteria 9537
977 Ga0307513_10177374 3300031456 Bacteria 1999
978 Ga0307513_10228258 3300031456 Bacteria 1676
979 Ga0307509_10001893 3300031507 Bacteria 34561
980 Ga0307408_100036836 3300031548 Bacteria 3441
981 Ga0307408_100077198 3300031548 Unclassified 2480
982 Ga0265313_10004931 3300031595 Bacteria 9996
983 Ga0307508_10004834 3300031616 Bacteria 12990
984 Ga0307508_10111009 3300031616 Bacteria 2341
985 Ga0307508_10147031 3300031616 Bacteria 1961
986 Ga0307514_10012978 3300031649 Bacteria 6917
987 Ga0307514_10045789 3300031649 Bacteria 3420
988 Ga0265314_10002539 3300031711 Bacteria 18572
989 Ga0265314_10009578 3300031711 Bacteria 8160
990 Ga0265342_10000423 3300031712 Bacteria 46377
991 Ga0265342_10003774 3300031712 Bacteria 12222
992 Ga0265342_10006771 3300031712 Bacteria 8488
993 Ga0265342_10016092 3300031712 Bacteria 4898
994 Ga0265342_10066307 3300031712 Bacteria 2114
995 Ga0307516_10004216 3300031730 Bacteria 17907
996 Ga0307516_10014805 3300031730 Bacteria 8234
997 Ga0307516_10105861 3300031730 Bacteria 2624
998 Ga0307516_10211993 3300031730 Bacteria 1651
999 Ga0307405_10001559 3300031731 Bacteria 9716
1000 Ga0307405_10026348 3300031731 Unclassified 3353
1001 Ga0307410_10010347 3300031852 Bacteria 5279
1002 Ga0307410_10027063 3300031852 Bacteria 3620
1003 Ga0307410_10121053 3300031852 Bacteria 1908
1004 Ga0307406_10009321 3300031901 Bacteria 5501
1005 Ga0307407_10047162 3300031903 Bacteria 2443
1006 Ga0307412_10000002 3300031911 Bacteria 743446
1007 Ga0307409_100000035 3300031995 Bacteria 47580
1008 Ga0307409_100025384 3300031995 Unclassified 4155
1009 Ga0307409_100234346 3300031995 Bacteria 1666
1010 Ga0307416_100000287 3300032002 Bacteria 26496
1011 Ga0307416_100014506 3300032002 Bacteria 5405
1012 Ga0307416_100238705 3300032002 Bacteria 1759
1013 Ga0307416_100308438 3300032002 Bacteria 1578
1014 Ga0307411_10016202 3300032005 Bacteria 4215
1015 Ga0307415_100000003 3300032126 Bacteria 116928
1016 Ga0307415_100003349 3300032126 Bacteria 8139
1017 Ga0307415_100088003 3300032126 Bacteria 2240
1018 Ga0307415_100156918 3300032126 Bacteria 1758
1019 Ga0307507_10058129 3300033179 Bacteria 3634
1020 Ga0307510_10024598 3300033180 Bacteria 6956
1021 Ga0307510_10152346 3300033180 Bacteria 1927
1022 Ga0307510_10160483 3300033180 Bacteria 1846
1023 Ga0373936_0001387 3300035113 Bacteria 8790
1024 Ga0373936_0004339 3300035113 Bacteria 5361
1025 Ga0373954_0001393 3300035118 Bacteria 9795
1026 Ga0373954_0036677 3300035118 Bacteria 2276
1027 Ga0373954_0069570 3300035118 Bacteria 1671
1028 Ga0373956_0010264 3300035119 Bacteria 3833
1029 Ga0373957_0008634 3300035120 Bacteria 3310
1030 Ga0373957_0067817 3300035120 Bacteria 1391
1031 Ga0373943_0002644 3300035170 Bacteria 8152
1032 Ga0373943_0014875 3300035170 Bacteria 3531
1033 Ga0373946_0021681 3300035171 Bacteria 2493
1034 Ga0373946_0042168 3300035171 Bacteria 1875
1035 Ga0373955_0000268 3300035172 Bacteria 21698
1036 Ga0373955_0010254 3300035172 Bacteria 4418
1037 Ga0373955_0026620 3300035172 Bacteria 2981
1038 Ga0373955_0081872 3300035172 Bacteria 1826
1039 Ga0373955_0105566 3300035172 Bacteria 1623
1040 Ga0316574_0020405 3300035398 Bacteria 3922
1041 Ga0373924_0012004 3300035410 Bacteria 3228
1042 Ga0373924_0053057 3300035410 Bacteria 1684
1043 Ga0373924_0061963 3300035410 Bacteria 1566
1044 Ga0373935_0003009 3300035692 Bacteria 9724
1045 Ga0373935_0032408 3300035692 Bacteria 3248
1046 Ga0373927_0001212 3300035695 Bacteria 19563
1047 Ga0373933_0000815 3300035724 Bacteria 19016
1048 Ga0373933_0062042 3300035724 Bacteria 2256
1049 Ga0373933_0119161 3300035724 Bacteria 1652
1050 Ga0373933_0119972 3300035724 Bacteria 1646
1051 Ga0373933_0195479 3300035724 Bacteria 1293
1052 Ga0373947_0000576 3300035725 Bacteria 21462
1053 Ga0373947_0017352 3300035725 Bacteria 4140
1054 Ga0373947_0020634 3300035725 Unclassified 3806
1055 Ga0373947_0021702 3300035725 Bacteria 3718
1056 Ga0373937_0001164 3300036401 Bacteria 22086
1057 Ga0373937_0018449 3300036401 Bacteria 6231
1058 Ga0373937_0039520 3300036401 Bacteria 4299
1059 Ga0373937_0041709 3300036401 Bacteria 4187
1060 Ga0373937_0061892 3300036401 Bacteria 3440
1061 Ga0373937_0112477 3300036401 Bacteria 2533
1062 Ga0373937_0114659 3300036401 Bacteria 2509
1063 Ga0373937_0120279 3300036401 Bacteria 2447
1064 Ga0373925_0000695 3300037068 Bacteria 31483
1065 Ga0373925_0022538 3300037068 Bacteria 4594
1066 Ga0373925_0028721 3300037068 Bacteria 4076
1067 Ga0373925_0044235 3300037068 Bacteria 3306
1068 Ga0373925_0048469 3300037068 Bacteria 3165
1069 Ga0373925_0191266 3300037068 Bacteria 1624
1070 Ga0395899_0000007 3300037312 Bacteria 629129
1071 Ga0395899_0008149 3300037312 Bacteria 8074
1072 Ga0395899_0027370 3300037312 Bacteria 4299
1073 Ga0395900_0000178 3300037418 Bacteria 102491
1074 Ga0395900_0008538 3300037418 Bacteria 10529
1075 Ga0395900_0010740 3300037418 Bacteria 9367
1076 Ga0395900_0021731 3300037418 Bacteria 6560
1077 Ga0395900_0021936 3300037418 Bacteria 6529
1078 Ga0395900_0122854 3300037418 Bacteria 2663
1079 Ga0395900_0347418 3300037418 Bacteria 1457
1080 Ga0395898_0000015 3300037466 Bacteria 439819
1081 Ga0395898_0000276 3300037466 Bacteria 124774
1082 Ga0395898_0003978 3300037466 Bacteria 16270
1083 Ga0395898_0006320 3300037466 Bacteria 12656
1084 Ga0395898_0012063 3300037466 Bacteria 8945
1085 Ga0395898_0093924 3300037466 Bacteria 2882
1086 Ga0395898_0330453 3300037466 Bacteria 1453
1087 Ga0395905_0101233 3300037471 Bacteria 2705
1088 Ga0395901_0004706 3300038443 Bacteria 13773
1089 Ga0395901_0058868 3300038443 Bacteria 3997
1090 Ga0395901_0205286 3300038443 Bacteria 2065
1091 Ga0237819_00091 3300038705 Bacteria 32900
1092 Ga0436365_1038204 3300039437 Bacteria 5779
1093 Ga0436365_1103987 3300039437 Bacteria 2406
1094 Ga0436365_1795729 3300039437 Bacteria 11162
1095 Ga0436360_0019322 3300039438 Bacteria 2487
1096 Ga0436360_1187113 3300039438 Bacteria 4771
1097 Ga0436360_1316174 3300039438 Bacteria 3364
1098 Ga0436361_0179379 3300039447 Bacteria 1617
1099 Ga0436361_0251474 3300039447 Bacteria 2269
1100 Ga0436361_0644146 3300039447 Bacteria 21611
1101 Ga0436361_1155064 3300039447 Bacteria 3399
1102 Ga0439436_0004743 3300041404 Bacteria 4169
1103 Ga0439439_0004386 3300041406 Bacteria 3175
1104 Ga0439461_0001590 3300041410 Bacteria 3521
1105 Ga0439466_0010665 3300041411 Bacteria 3415
1106 Ga0439465_0001613 3300041413 Bacteria 7338
1107 Ga0439465_0002800 3300041413 Bacteria 5715
1108 Ga0451798_0507020 3300041458 Bacteria 1587
1109 Ga0451837_0067998 3300041494 Bacteria 1782
1110 Ga0451843_1584175 3300041509 Bacteria 1720
1111 Ga0439443_008533 3300042003 Bacteria 1449
1112 Ga0439445_0000750 3300042004 Bacteria 6796
1113 Ga0439448_0000101 3300042005 Bacteria 15366
1114 Ga0439449_0000569 3300042007 Bacteria 13837
1115 Ga0439457_008621 3300042014 Bacteria 2398
1116 Ga0439446_0011920 3300042156 Bacteria 2368
1117 Ga0439458_0000316 3300042157 Bacteria 12059
1118 Ga0439434_0003556 3300042435 Bacteria 4548
1119 Ga0439435_0003112 3300042436 Bacteria 3405
1120 Ga0439435_0021646 3300042436 Bacteria 1671
1121 Ga0466972_0043225 3300044658 Bacteria 2189
1122 Ga0466965_0000624 3300044683 Bacteria 12902
1123 Ga0466965_0072603 3300044683 Bacteria 1732
1124 Ga0466961_0016023 3300044693 Bacteria 4812
1125 Ga0466961_0025946 3300044693 Bacteria 3767
1126 Ga0466961_0035759 3300044693 Bacteria 3189
1127 Ga0466971_0038881 3300044719 Bacteria 2135
1128 Ga0466971_0045234 3300044719 Bacteria 1977
1129 Ga0466970_0042424 3300044765 Bacteria 2419
1130 Ga0466957_0005735 3300044842 Bacteria 6980
1131 Ga0466957_0007465 3300044842 Bacteria 6175
1132 Ga0466957_0074006 3300044842 Bacteria 2112
1133 Ga0466960_0011664 3300044901 Bacteria 3686
1134 Ga0466960_0102830 3300044901 Bacteria 1474
1135 Ga0466960_0120629 3300044901 Bacteria 1373
1136 Ga0466959_0100912 3300045049 Bacteria 2065
1137 Ga0466959_0112636 3300045049 Bacteria 1940
1138 Ga0466958_0044976 3300045836 Bacteria 2662
1139 Ga0466958_0083084 3300045836 Bacteria 1973
1140 Ga0466967_0023808 3300045976 Bacteria 5024
1141 Ga0466967_0039729 3300045976 Bacteria 4047
1142 Ga0466967_0142380 3300045976 Bacteria 2234
1143 Ga0466967_0278625 3300045976 Bacteria 1604
1144 Ga0495592_0002012 3300046454 Bacteria 14324
1145 Ga0495592_0030843 3300046454 Bacteria 4055
1146 Ga0495592_0093548 3300046454 Bacteria 2153
1147 Ga0495592_0162248 3300046454 Bacteria 1537
1148 Ga0495603_0020105 3300046455 Bacteria 4046
1149 Ga0495590_0005946 3300046457 Bacteria 4784
1150 Ga0495590_0012541 3300046457 Bacteria 3144
1151 Ga0495591_007498 3300046458 Bacteria 4628
1152 Ga0495629_0002803 3300046459 Bacteria 13292
1153 Ga0495629_0008252 3300046459 Bacteria 7658
1154 Ga0495629_0018703 3300046459 Bacteria 4952
1155 Ga0495629_0036598 3300046459 Bacteria 3463
1156 Ga0495629_0047179 3300046459 Bacteria 3021
1157 Ga0495629_0060195 3300046459 Bacteria 2654
1158 Ga0495638_0000524 3300046460 Bacteria 44781
1159 Ga0495638_0000660 3300046460 Bacteria 37623
1160 Ga0495638_0000771 3300046460 Bacteria 34027
1161 Ga0495638_0115939 3300046460 Bacteria 1587
1162 Ga0495641_0018334 3300046461 Bacteria 3615
1163 Ga0495641_0044696 3300046461 Bacteria 2042
1164 Ga0495641_0062336 3300046461 Bacteria 1682
1165 Ga0495651_0016841 3300046462 Bacteria 5660
1166 Ga0495651_0059266 3300046462 Bacteria 2936
1167 Ga0495651_0063761 3300046462 Bacteria 2816
1168 Ga0495653_0022294 3300046463 Bacteria 5126
1169 Ga0495653_0059574 3300046463 Bacteria 2896
1170 Ga0495650_0000010 3300046471 Bacteria 645599
1171 Ga0495650_0002608 3300046471 Bacteria 14136
1172 Ga0495650_0006223 3300046471 Bacteria 7481
1173 Ga0495650_0006684 3300046471 Bacteria 7141
1174 Ga0495650_0008172 3300046471 Bacteria 6153
1175 Ga0495650_0029271 3300046471 Bacteria 2512
1176 Ga0495580_0001025 3300046472 Bacteria 24517
1177 Ga0495580_0002243 3300046472 Bacteria 16884
1178 Ga0495580_0008623 3300046472 Bacteria 8085
1179 Ga0495580_0013994 3300046472 Bacteria 6102
1180 Ga0495580_0019567 3300046472 Bacteria 5030
1181 Ga0495580_0026937 3300046472 Bacteria 4186
1182 Ga0495580_0027927 3300046472 Bacteria 4104
1183 Ga0495580_0089287 3300046472 Bacteria 2145
1184 Ga0495580_0181247 3300046472 Bacteria 1454
1185 Ga0495580_0196376 3300046472 Bacteria 1391
1186 Ga0495582_0000629 3300046473 Bacteria 19423
1187 Ga0495582_0003241 3300046473 Bacteria 9139
1188 Ga0495582_0004552 3300046473 Bacteria 7788
1189 Ga0495582_0010551 3300046473 Bacteria 5082
1190 Ga0495582_0122311 3300046473 Bacteria 1467
1191 Ga0495605_0015098 3300046474 Bacteria 4212
1192 Ga0495605_0074168 3300046474 Bacteria 1602
1193 Ga0495639_0007177 3300046475 Bacteria 4783
1194 Ga0495662_0012591 3300046476 Bacteria 4126
1195 Ga0495664_0004527 3300046477 Bacteria 7603
1196 Ga0495664_0014620 3300046477 Bacteria 4451
1197 Ga0495664_0029425 3300046477 Bacteria 3212
1198 Ga0495585_0011113 3300046492 Bacteria 5340
1199 Ga0495585_0036929 3300046492 Bacteria 2753
1200 Ga0495594_0005454 3300046499 Bacteria 6538
1201 Ga0495594_0007680 3300046499 Bacteria 5548
1202 Ga0495594_0012425 3300046499 Bacteria 4435
1203 Ga0495594_0048432 3300046499 Bacteria 2335
1204 Ga0495596_0008596 3300046500 Bacteria 4536
1205 Ga0495596_0017058 3300046500 Bacteria 3011
1206 Ga0495596_0022158 3300046500 Bacteria 2588
1207 Ga0495596_0039457 3300046500 Bacteria 1865
1208 Ga0495583_0007667 3300046506 Bacteria 6727
1209 Ga0495583_0039414 3300046506 Bacteria 2226
1210 Ga0495606_0016529 3300046507 Bacteria 5619
1211 Ga0495606_0055453 3300046507 Bacteria 2563
1212 Ga0495606_0067888 3300046507 Bacteria 2257
1213 Ga0495608_0040078 3300046511 Bacteria 3138
1214 Ga0495608_0052888 3300046511 Bacteria 2687
1215 Ga0495610_0002377 3300046512 Bacteria 15870
1216 Ga0495610_0003137 3300046512 Bacteria 13134
1217 Ga0495610_0032046 3300046512 Bacteria 2736
1218 Ga0495618_0019115 3300046514 Bacteria 4213
1219 Ga0495618_0031243 3300046514 Bacteria 3330
1220 Ga0495620_0024001 3300046515 Bacteria 2906
1221 Ga0495628_0002174 3300046516 Bacteria 17736
1222 Ga0495628_0031291 3300046516 Bacteria 4304
1223 Ga0495630_0006260 3300046517 Bacteria 8449
1224 Ga0495630_0020419 3300046517 Bacteria 4884
1225 Ga0495630_0044220 3300046517 Bacteria 3328
1226 Ga0495630_0058861 3300046517 Bacteria 2881
1227 Ga0495630_0059577 3300046517 Bacteria 2864
1228 Ga0495630_0085528 3300046517 Bacteria 2381
1229 Ga0495644_0003181 3300046523 Bacteria 6490
1230 Ga0495648_0000066 3300046524 Bacteria 140767
1231 Ga0495648_0014966 3300046524 Bacteria 5651
1232 Ga0495648_0030098 3300046524 Bacteria 3595
1233 Ga0495666_0010385 3300046526 Bacteria 4641
1234 Ga0495666_0022651 3300046526 Bacteria 3111
1235 Ga0495642_0014115 3300046528 Bacteria 3095
1236 Ga0495642_0040154 3300046528 Bacteria 1900
1237 Ga0495652_0013301 3300046529 Bacteria 7406
1238 Ga0495654_0000456 3300046530 Bacteria 34412
1239 Ga0495654_0044656 3300046530 Bacteria 2191
1240 Ga0495654_0046961 3300046530 Bacteria 2124
1241 Ga0495665_0005960 3300046531 Bacteria 6564
1242 Ga0495665_0008376 3300046531 Bacteria 5608
1243 Ga0495665_0028815 3300046531 Bacteria 2975
1244 Ga0495665_0046416 3300046531 Bacteria 2306
1245 Ga0495665_0061496 3300046531 Bacteria 1983
1246 Ga0495640_0004522 3300046533 Bacteria 11090
1247 Ga0495640_0008292 3300046533 Bacteria 8147
1248 Ga0495640_0202713 3300046533 Bacteria 1257
1249 Ga0495586_0073522 3300046535 Bacteria 1870
1250 Ga0495587_0001737 3300046536 Bacteria 14543
1251 Ga0495598_0002267 3300046537 Bacteria 3957
1252 Ga0495598_0003753 3300046537 Bacteria 3247
1253 Ga0495609_0010673 3300046538 Bacteria 4397
1254 Ga0495621_0000085 3300046539 Bacteria 19299
1255 Ga0495645_0000331 3300046543 Bacteria 33651
1256 Ga0495645_0002552 3300046543 Bacteria 12362
1257 Ga0495645_0025130 3300046543 Bacteria 4322
1258 Ga0495645_0044754 3300046543 Bacteria 3228
1259 Ga0495645_0081479 3300046543 Bacteria 2322
1260 Ga0495645_0115443 3300046543 Bacteria 1896
1261 Ga0495622_0039273 3300046557 Bacteria 2204
1262 Ga0495622_0041595 3300046557 Bacteria 2137
1263 Ga0495633_0030748 3300046558 Bacteria 2607
1264 Ga0495633_0102686 3300046558 Bacteria 1327
1265 Ga0495667_0038447 3300046559 Bacteria 3186
1266 Ga0495667_0046163 3300046559 Bacteria 2881
1267 Ga0495656_0026282 3300046615 Bacteria 2316
1268 Ga0495668_0002861 3300046616 Bacteria 13687
1269 Ga0495668_0004855 3300046616 Bacteria 9344
1270 Ga0495668_0024560 3300046616 Bacteria 3428
1271 Ga0495634_0107911 3300046642 Bacteria 1792
1272 Ga0495625_0067523 3300046660 Bacteria 2516
1273 Ga0495625_0094896 3300046660 Bacteria 2057
1274 Ga0495635_0000993 3300046663 Bacteria 18702
1275 Ga0495635_0008216 3300046663 Bacteria 7288
1276 Ga0495635_0032291 3300046663 Bacteria 3632
1277 Ga0495635_0081248 3300046663 Bacteria 2218
1278 Ga0495635_0155215 3300046663 Bacteria 1558
1279 Ga0495659_0050810 3300046664 Bacteria 1509
1280 Ga0495661_0001703 3300046665 Bacteria 17820
1281 Ga0495588_0008882 3300046674 Bacteria 4625
1282 Ga0495657_0004997 3300046675 Bacteria 10538
1283 Ga0495657_0025873 3300046675 Bacteria 4163
1284 Ga0495657_0218651 3300046675 Bacteria 1156
1285 Ga0495599_0079861 3300046678 Bacteria 2043
1286 Ga0495623_0048362 3300046679 Bacteria 2698
1287 Ga0495646_0000924 3300046680 Bacteria 16694
1288 Ga0495646_0029020 3300046680 Bacteria 3460
1289 Ga0495646_0066861 3300046680 Bacteria 2125
1290 Ga0495669_0012480 3300046684 Bacteria 3617
1291 Ga0495613_0003805 3300046689 Bacteria 11315
1292 Ga0495613_0009065 3300046689 Bacteria 7381
1293 Ga0495613_0016936 3300046689 Bacteria 5427
1294 Ga0495613_0028018 3300046689 Bacteria 4192
1295 Ga0495613_0074840 3300046689 Bacteria 2466
1296 Ga0495624_0001188 3300046690 Bacteria 20585
1297 Ga0495624_0016621 3300046690 Bacteria 4951
1298 Ga0495624_0078015 3300046690 Bacteria 2054
1299 Ga0495624_0152955 3300046690 Bacteria 1411
1300 Ga0495670_0000012 3300046691 Bacteria 170426
1301 Ga0495670_0004038 3300046691 Bacteria 7199
1302 Ga0495670_0069207 3300046691 Bacteria 1784
1303 Ga0495671_0013693 3300046692 Bacteria 4383
1304 Ga0495649_0016355 3300046694 Bacteria 4204
1305 Ga0495589_0022210 3300046794 Bacteria 3239
1306 Ga0495589_0059478 3300046794 Bacteria 1878
1307 Ga0495589_0067180 3300046794 Bacteria 1755
1308 Ga0495600_0002361 3300046809 Bacteria 10782
1309 Ga0495600_0014475 3300046809 Bacteria 4970
1310 Ga0495600_0049867 3300046809 Bacteria 2731
1311 Ga0495600_0126510 3300046809 Bacteria 1662
1312 Ga0495581_0002516 3300047315 Bacteria 10405
1313 Ga0495581_0005826 3300047315 Bacteria 7143
1314 Ga0495581_0006324 3300047315 Bacteria 6871
1315 Ga0495581_0007107 3300047315 Bacteria 6484
1316 Ga0495581_0024403 3300047315 Bacteria 3504
1317 Ga0495604_0000171 3300047317 Bacteria 57216
1318 Ga0495636_0016396 3300047318 Bacteria 2958
1319 Ga0495674_0001885 3300047319 Bacteria 20656
1320 Ga0495674_0003055 3300047319 Bacteria 16277
1321 Ga0495674_0004949 3300047319 Bacteria 12814
1322 Ga0495674_0029631 3300047319 Bacteria 4982
1323 Ga0495674_0064294 3300047319 Bacteria 3189
1324 Ga0495674_0078474 3300047319 Bacteria 2837
1325 Ga0495674_0106062 3300047319 Bacteria 2387
1326 Ga0495674_0271867 3300047319 Bacteria 1390
1327 Ga0495672_0005687 3300047320 Bacteria 9824
1328 Ga0495672_0011070 3300047320 Bacteria 6386
1329 Ga0495672_0104019 3300047320 Bacteria 1535
1330 Ga0495676_0031826 3300047321 Bacteria 4457
1331 Ga0495676_0055285 3300047321 Bacteria 3148
1332 Ga0495680_0036344 3300047322 Bacteria 3955
1333 Ga0495680_0081120 3300047322 Bacteria 2450
1334 Ga0495680_0097822 3300047322 Bacteria 2190
1335 Ga0495683_0002900 3300047323 Bacteria 10141
1336 Ga0495683_0003522 3300047323 Bacteria 9110
1337 Ga0495683_0011841 3300047323 Bacteria 4585
1338 Ga0495683_0021022 3300047323 Bacteria 3364
1339 Ga0495687_005145 3300047443 Bacteria 8465
1340 Ga0495687_006290 3300047443 Bacteria 7320
1341 Ga0495675_0016288 3300047444 Bacteria 4702
1342 Ga0495675_0019550 3300047444 Bacteria 4302
1343 Ga0495675_0123453 3300047444 Bacteria 1612
1344 Ga0495679_000273 3300047446 Bacteria 43168
1345 Ga0495679_000939 3300047446 Bacteria 18147
1346 Ga0495679_034080 3300047446 Bacteria 1623
1347 Ga0495673_0000333 3300047469 Bacteria 60696
1348 Ga0495673_0022148 3300047469 Bacteria 3119
1349 Ga0495684_0185286 3300047471 Bacteria 1541
1350 Ga0495686_0001315 3300047472 Bacteria 27861
1351 Ga0495686_0027530 3300047472 Bacteria 3710
1352 Ga0495593_0017631 3300047673 Bacteria 4019
1353 Ga0495593_0025352 3300047673 Bacteria 3282
1354 Ga0495593_0081482 3300047673 Bacteria 1673
1355 Ga0495602_0002240 3300048088 Bacteria 19517
1356 Ga0495602_0025467 3300048088 Bacteria 5725
1357 Ga0495602_0109752 3300048088 Bacteria 2244
1358 Ga0495602_0241556 3300048088 Bacteria 1351
1359 Ga0495614_0001803 3300048089 Bacteria 9373
1360 Ga0495614_0006770 3300048089 Bacteria 5127
1361 Ga0495626_0004431 3300048091 Bacteria 8624
1362 Ga0495626_0006020 3300048091 Bacteria 6973
1363 Ga0495626_0046631 3300048091 Bacteria 2018
1364 Ga0496100_0000329 3300048903 Bacteria 23294
1365 Ga0496100_0047202 3300048903 Bacteria 2773
1366 Ga0496100_0109795 3300048903 Bacteria 1914
1367 Ga0496100_0187490 3300048903 Bacteria 1499
1368 Ga0496101_0000240 3300048904 Bacteria 40657
1369 Ga0496101_0021193 3300048904 Bacteria 4462
1370 Ga0496101_0158394 3300048904 Bacteria 1735
1371 Ga0496101_0224304 3300048904 Bacteria 1459
1372 Ga0496102_0000431 3300048905 Bacteria 48474
1373 Ga0496102_0061300 3300048905 Bacteria 3443
1374 Ga0496102_0066063 3300048905 Bacteria 3315
1375 Ga0496102_0141287 3300048905 Bacteria 2258
1376 Ga0496102_0193590 3300048905 Bacteria 1916
1377 Ga0496103_0000536 3300048906 Bacteria 30559
1378 Ga0496103_0030896 3300048906 Bacteria 3261
1379 Ga0496103_0093199 3300048906 Bacteria 1902
1380 Ga0496103_0107035 3300048906 Bacteria 1774
1381 Ga0496103_0128347 3300048906 Bacteria 1618
1382 Ga0496104_0000520 3300048907 Bacteria 32906
1383 Ga0496104_0001700 3300048907 Bacteria 19007
1384 Ga0496104_0025723 3300048907 Bacteria 5428
1385 Ga0496104_0065529 3300048907 Bacteria 3447
1386 Ga0496104_0161793 3300048907 Bacteria 2147
1387 Ga0496104_0323625 3300048907 Bacteria 1455
1388 Ga0496105_0004098 3300048908 Bacteria 10922
1389 Ga0496105_0060506 3300048908 Bacteria 3125
1390 Ga0496105_0061918 3300048908 Bacteria 3088
1391 Ga0496105_0189970 3300048908 Bacteria 1680
1392 Ga0496106_0000494 3300048909 Bacteria 27913
1393 Ga0496106_0058812 3300048909 Bacteria 2911
1394 Ga0496106_0118051 3300048909 Bacteria 2071
1395 Ga0496107_0025599 3300048910 Bacteria 4178
1396 Ga0496107_0031807 3300048910 Bacteria 3768
1397 Ga0496108_0031402 3300048911 Bacteria 4408
1398 Ga0496108_0067322 3300048911 Bacteria 3021
1399 Ga0496109_0015425 3300048912 Bacteria 6659
1400 Ga0496110_0388483 3300048913 Bacteria 1272
1401 Ga0496111_0003474 3300048914 Bacteria 9757
1402 Ga0496111_0010345 3300048914 Bacteria 6257
1403 Ga0496111_0022644 3300048914 Bacteria 4401
1404 Ga0496112_0015283 3300048915 Bacteria 7157
1405 Ga0496112_0041087 3300048915 Bacteria 4524
1406 Ga0496112_0110468 3300048915 Bacteria 2719
1407 Ga0496112_0160144 3300048915 Bacteria 2217
1408 Ga0496112_0347368 3300048915 Unclassified 1426
1409 Ga0496113_0003971 3300048916 Bacteria 8988
1410 Ga0496114_0009894 3300048917 Bacteria 7579
1411 Ga0496114_0013881 3300048917 Bacteria 6457
1412 Ga0496114_0022844 3300048917 Bacteria 5098
1413 Ga0496114_0024150 3300048917 Bacteria 4961
1414 Ga0496114_0083014 3300048917 Bacteria 2710
1415 Ga0496114_0086916 3300048917 Bacteria 2650
1416 Ga0496114_0265627 3300048917 Bacteria 1512
1417 Ga0496115_0000095 3300048918 Bacteria 82835
1418 Ga0496115_0000418 3300048918 Bacteria 34681
1419 Ga0496115_0007083 3300048918 Bacteria 8238
1420 Ga0496115_0007701 3300048918 Bacteria 7942
1421 Ga0496115_0021039 3300048918 Bacteria 5035
1422 Ga0496115_0039979 3300048918 Bacteria 3726
1423 Ga0496115_0072207 3300048918 Bacteria 2800
1424 Ga0496115_0090722 3300048918 Bacteria 2496
1425 Ga0496115_0155710 3300048918 Bacteria 1888
1426 Ga0496115_0356621 3300048918 Bacteria 1192
1427 Ga0496116_0044250 3300048919 Bacteria 3026
1428 Ga0496116_0070464 3300048919 Bacteria 2218
1429 Ga0496117_0000660 3300048920 Bacteria 55175
1430 Ga0496117_0001545 3300048920 Bacteria 32728
1431 Ga0496117_0001713 3300048920 Bacteria 30347
1432 Ga0496117_0005687 3300048920 Bacteria 12987
1433 Ga0496117_0013332 3300048920 Bacteria 7179
1434 Ga0496117_0123880 3300048920 Bacteria 1582
1435 Ga0496118_0000489 3300048921 Bacteria 65595
1436 Ga0496118_0000553 3300048921 Bacteria 61663
1437 Ga0496118_0002148 3300048921 Bacteria 27514
1438 Ga0496118_0003048 3300048921 Bacteria 21570
1439 Ga0496118_0021171 3300048921 Bacteria 5734
1440 Ga0496118_0026330 3300048921 Bacteria 4957
1441 Ga0496118_0028675 3300048921 Bacteria 4683
1442 Ga0496118_0056819 3300048921 Bacteria 2938
1443 Ga0496118_0136068 3300048921 Bacteria 1568
1444 Ga0496120_0013641 3300048923 Bacteria 5461
1445 Ga0496121_0001288 3300048924 Bacteria 43215
1446 Ga0496121_0012333 3300048924 Bacteria 9345
1447 Ga0496122_0031846 3300048925 Bacteria 4375
1448 Ga0496123_0038126 3300048926 Bacteria 3383
1449 Ga0496124_0005515 3300048927 Bacteria 14203
1450 Ga0496124_0006356 3300048927 Bacteria 12894
1451 Ga0496124_0009191 3300048927 Bacteria 10199
1452 Ga0496124_0037489 3300048927 Bacteria 4216
1453 Ga0496124_0049123 3300048927 Bacteria 3600
1454 Ga0496125_0009204 3300048928 Bacteria 10203
1455 Ga0496125_0034981 3300048928 Bacteria 4418
1456 Ga0496126_0000004 3300048929 Bacteria 925026
1457 Ga0496126_0000012 3300048929 Bacteria 727789
1458 Ga0496126_0000164 3300048929 Bacteria 152791
1459 Ga0496126_0001766 3300048929 Bacteria 31999
1460 Ga0496126_0005504 3300048929 Bacteria 14433
1461 Ga0495678_000685 3300049459 Bacteria 31121
1462 Ga0495678_002606 3300049459 Bacteria 12046
1463 Ga0495678_010935 3300049459 Bacteria 4373
1464 Ga0495678_023431 3300049459 Bacteria 2682
1465 Ga0495682_0011546 3300049460 Bacteria 3398
1466 Ga0495682_0033312 3300049460 Bacteria 1902
1467 Ga0501031_0000677 3300049568 Bacteria 20289
1468 Ga0501032_0022260 3300049569 Bacteria 4394
1469 Ga0501032_0022667 3300049569 Bacteria 4351
1470 Ga0501032_0037277 3300049569 Bacteria 3315
1471 Ga0501033_0005905 3300049570 Bacteria 9614
1472 Ga0501033_0052034 3300049570 Bacteria 3035
1473 Ga0501033_0109883 3300049570 Bacteria 2007
1474 Ga0501034_0000134 3300049571 Bacteria 137745
1475 Ga0501034_0029789 3300049571 Bacteria 5548
1476 Ga0501034_0031233 3300049571 Bacteria 5411
1477 Ga0501034_0034281 3300049571 Bacteria 5146
1478 Ga0501034_0039420 3300049571 Bacteria 4785
1479 Ga0501034_0061238 3300049571 Bacteria 3780
1480 Ga0501034_0067155 3300049571 Bacteria 3599
1481 Ga0501034_0070685 3300049571 Bacteria 3501
1482 Ga0501034_0117618 3300049571 Bacteria 2645
1483 Ga0501034_0131338 3300049571 Bacteria 2487
1484 Ga0501034_0265814 3300049571 Bacteria 1657
1485 Ga0501036_0023597 3300049572 Bacteria 5183
1486 Ga0501036_0059637 3300049572 Bacteria 3233
1487 Ga0501036_0379981 3300049572 Bacteria 1179
1488 Ga0501036_0398219 3300049572 Bacteria 1149
1489 Ga0501037_0010071 3300049573 Bacteria 6935
1490 Ga0501037_0016093 3300049573 Bacteria 5503
1491 Ga0501037_0017926 3300049573 Bacteria 5212
1492 Ga0501038_0015713 3300049574 Bacteria 6879
1493 Ga0501038_0021058 3300049574 Bacteria 5858
1494 Ga0501038_0028912 3300049574 Bacteria 4919
1495 Ga0501038_0047993 3300049574 Bacteria 3696
1496 Ga0501038_0051473 3300049574 Bacteria 3553
1497 Ga0501038_0196683 3300049574 Bacteria 1620
1498 Ga0501038_0272372 3300049574 Bacteria 1334
1499 Ga0501039_0000155 3300049575 Bacteria 47199
1500 Ga0501039_0003043 3300049575 Bacteria 12546
1501 Ga0501039_0011983 3300049575 Bacteria 6609
1502 Ga0501039_0018373 3300049575 Bacteria 5366
1503 Ga0501039_0023094 3300049575 Bacteria 4771
1504 Ga0501039_0064657 3300049575 Bacteria 2836
1505 Ga0501043_0002350 3300049579 Bacteria 16037
1506 Ga0501043_0005289 3300049579 Bacteria 10436
1507 Ga0501043_0008249 3300049579 Bacteria 8205
1508 Ga0501043_0104806 3300049579 Bacteria 2222
1509 Ga0501046_0063205 3300049580 Bacteria 2891
1510 Ga0501046_0077634 3300049580 Bacteria 2570
1511 Ga0501046_0106977 3300049580 Bacteria 2140
1512 Ga0501047_0002497 3300049581 Bacteria 17538
1513 Ga0501047_0003483 3300049581 Bacteria 14876
1514 Ga0501047_0012111 3300049581 Bacteria 8164
1515 Ga0501047_0036175 3300049581 Bacteria 4770
1516 Ga0501047_0052550 3300049581 Bacteria 3938
1517 Ga0501047_0107039 3300049581 Bacteria 2677
1518 Ga0501047_0139688 3300049581 Bacteria 2301
1519 Ga0501047_0189711 3300049581 Bacteria 1919
1520 Ga0501047_0222039 3300049581 Bacteria 1745
1521 Ga0501048_0020590 3300049582 Bacteria 4833
1522 Ga0501048_0137840 3300049582 Bacteria 1724
1523 Ga0501067_0002848 3300049583 Bacteria 9521
1524 Ga0501067_0005996 3300049583 Bacteria 6736
1525 Ga0501068_0016921 3300049584 Bacteria 4210
1526 Ga0501068_0113478 3300049584 Bacteria 1686
1527 Ga0501069_0000376 3300049585 Bacteria 20152
1528 Ga0501070_0000063 3300049586 Bacteria 92104
1529 Ga0501070_0005955 3300049586 Bacteria 10392
1530 Ga0501070_0100445 3300049586 Bacteria 2393
1531 Ga0501070_0280618 3300049586 Bacteria 1359
1532 Ga0501071_0136805 3300049587 Bacteria 1823
1533 Ga0501072_0070637 3300049588 Bacteria 2758
1534 Ga0501073_0019811 3300049589 Bacteria 4854
1535 Ga0501073_0049499 3300049589 Bacteria 2947
1536 Ga0501073_0051797 3300049589 Bacteria 2875
1537 Ga0501073_0077001 3300049589 Bacteria 2321
1538 Ga0501074_0013722 3300049590 Bacteria 5889
1539 Ga0501076_0243888 3300049592 Bacteria 1470
1540 Ga0501079_0013523 3300049741 Bacteria 6224
1541 Ga0501079_0017576 3300049741 Bacteria 5462
1542 Ga0501080_0016216 3300049742 Bacteria 6878
1543 Ga0501080_0056304 3300049742 Bacteria 3662
1544 Ga0501080_0110619 3300049742 Bacteria 2546
1545 Ga0501080_0151692 3300049742 Bacteria 2142
1546 Ga0501083_0000253 3300049744 Bacteria 34060
1547 Ga0501083_0000698 3300049744 Bacteria 21865
1548 Ga0501083_0008100 3300049744 Bacteria 7432
1549 Ga0501083_0010189 3300049744 Bacteria 6624
1550 Ga0501083_0016677 3300049744 Bacteria 5133
1551 Ga0501035_0002824 3300049822 Bacteria 16799
1552 Ga0501035_0006275 3300049822 Bacteria 11180
1553 Ga0501035_0022787 3300049822 Bacteria 5751
1554 Ga0501035_0070383 3300049822 Bacteria 3099
1555 Ga0501035_0168215 3300049822 Bacteria 1895
1556 Ga0501035_0289115 3300049822 Bacteria 1384
1557 Ga0501044_0000231 3300049823 Bacteria 70134
1558 Ga0501044_0003105 3300049823 Bacteria 18814
1559 Ga0501044_0005924 3300049823 Bacteria 13543
1560 Ga0501044_0146748 3300049823 Bacteria 2344
1561 Ga0501044_0232059 3300049823 Bacteria 1792
1562 nmdc:mga03683_104830_c1 3300050489 Bacteria 1245
1563 nmdc:mga03n38_21227_c1 3300050490 Bacteria 2610
1564 nmdc:mga00v17_1482_c1 3300050491 Eukaryota 12279
1565 nmdc:mga00v17_24033_c1 3300050491 Bacteria 3531
1566 nmdc:mga00v17_49158_c1 3300050491 Bacteria 2558
1567 nmdc:mga00v17_5440_c1 3300050491 Eukaryota 6706
1568 nmdc:mga00v17_678_c1 3300050491 Bacteria 18717
1569 nmdc:mga00v17_83159_c1 3300050491 Bacteria 2002
1570 nmdc:mga0yw44_159_c1 3300050492 Bacteria 23304
1571 nmdc:mga0yw44_9052_c1 3300050492 Bacteria 5006
1572 nmdc:mga0k408_1287_c1 3300050493 Bacteria 13598
1573 nmdc:mga0k408_255_c1 3300050493 Bacteria 29002
1574 nmdc:mga0k408_42255_c1 3300050493 Bacteria 2625
1575 nmdc:mga06z11_2047_c1 3300050494 Eukaryota 7651
1576 nmdc:mga06z11_2323_c1 3300050494 Bacteria 7236
1577 nmdc:mga04h51_1684_c1 3300050495 Bacteria 5154
1578 nmdc:mga04h51_25807_c1 3300050495 Bacteria 1812
1579 nmdc:mga07m45_115875_c1 3300050496 Bacteria 1545
1580 nmdc:mga07m45_125_c1 3300050496 Bacteria 30481
1581 nmdc:mga07m45_4932_c1 3300050496 Bacteria 6575
1582 nmdc:mga05p37_1061_c1 3300050507 Bacteria 31431
1583 nmdc:mga05p37_127307_c1 3300050507 Bacteria 3127
1584 nmdc:mga05p37_26887_c1 3300050507 Bacteria 7001
1585 nmdc:mga05p37_94457_c1 3300050507 Bacteria 3684
1586 nmdc:mga09592_331305_c1 3300050508 Bacteria 1318
1587 nmdc:mga09592_3415_c1 3300050508 Bacteria 12836
1588 nmdc:mga0qj67_62723_c1 3300050509 Bacteria 2954
1589 nmdc:mga06r32_302370_c1 3300050510 Bacteria 1586
1590 nmdc:mga08y16_2005_c1 3300050511 Bacteria 20820
1591 nmdc:mga08y16_30259_c1 3300050511 Bacteria 5699
1592 nmdc:mga08y16_365477_c1 3300050511 Bacteria 1481
1593 nmdc:mga08y16_75174_c1 3300050511 Bacteria 3522
1594 nmdc:mga0n895_111855_c1 3300050512 Unclassified 2748
1595 nmdc:mga0n895_123797_c1 3300050512 Bacteria 2608
1596 nmdc:mga0n895_125788_c1 3300050512 Bacteria 2587
1597 nmdc:mga0n895_148550_c1 3300050512 Bacteria 2373
1598 nmdc:mga0n895_218486_c1 3300050512 Bacteria 1935
1599 nmdc:mga0n895_400_c1 3300050512 Bacteria 29183
1600 nmdc:mga0n895_95343_c1 3300050512 Bacteria 2980
1601 nmdc:mga0rr50_153234_c1 3300050513 Bacteria 1865
1602 nmdc:mga0rr50_3425_c1 3300050513 Bacteria 9122
1603 nmdc:mga0rr50_64788_c1 3300050513 Bacteria 2766
1604 nmdc:mga08x19_11861_c1 3300050514 Bacteria 5240
1605 nmdc:mga08x19_15973_c1 3300050514 Bacteria 4574
1606 nmdc:mga08x19_62163_c1 3300050514 Bacteria 2421
1607 nmdc:mga08x19_812_c1 3300050514 Bacteria 19830
1608 nmdc:mga08x19_8318_c1 3300050514 Bacteria 6174
1609 nmdc:mga08x19_97023_c1 3300050514 Bacteria 1951
1610 nmdc:mga0a205_267631_c1 3300050515 Bacteria 1586
1611 nmdc:mga0a205_38681_c1 3300050515 Bacteria 4590
1612 nmdc:mga0a205_76833_c1 3300050515 Bacteria 3227
1613 nmdc:mga0sz30_21_c2 3300050516 Bacteria 37875
1614 Ga0495601_0002820 3300053077 Bacteria 9864
1615 Ga0495601_0030486 3300053077 Bacteria 3349
1616 Ga0495601_0045594 3300053077 Bacteria 2758
1617 Ga0495612_0046140 3300053078 Bacteria 1784
1618 Ga0500635_0000075 3300053080 Bacteria 64005
1619 Ga0495595_0026468 3300053084 Bacteria 2578
1620 Ga0495619_0013014 3300053085 Bacteria 5242
1621 Ga0495619_0025834 3300053085 Bacteria 3775
1622 Ga0495619_0032276 3300053085 Bacteria 3397
1623 Ga0495619_0050085 3300053085 Bacteria 2756
1624 Ga0500578_0000082 3300053086 Bacteria 105580
1625 Ga0500578_0000385 3300053086 Bacteria 54183
1626 Ga0500643_011668 3300053087 Bacteria 3191
1627 Ga0500644_0000109 3300053088 Bacteria 52262
1628 Ga0500646_0000459 3300053090 Bacteria 12065
1629 Ga0500566_0009372 3300053094 Bacteria 5788
1630 Ga0500566_0029192 3300053094 Bacteria 3222
1631 Ga0500640_004532 3300053095 Bacteria 5059
1632 Ga0500562_058560 3300053108 Bacteria 1034
1633 Ga0500572_001651 3300053111 Bacteria 5843
1634 Ga0500595_000803 3300053119 Bacteria 18206
1635 Ga0500614_000873 3300053123 Bacteria 7610
1636 Ga0500658_0006658 3300053134 Bacteria 4282
1637 Ga0500559_0009950 3300053136 Bacteria 4097
1638 Ga0500568_0002365 3300053139 Bacteria 11162
1639 Ga0500573_0041144 3300053140 Bacteria 2668
1640 Ga0500577_0001382 3300053142 Bacteria 6200
1641 Ga0500603_005912 3300053150 Bacteria 2649
1642 Ga0500616_0000175 3300053153 Bacteria 106718
1643 Ga0500616_0000304 3300053153 Bacteria 71131
1644 Ga0500616_0007478 3300053153 Bacteria 6930
1645 Ga0500619_039615 3300053154 Bacteria 1482
1646 Ga0500622_0006457 3300053156 Bacteria 6788
1647 Ga0500622_0022484 3300053156 Bacteria 3343
1648 Ga0500622_0043262 3300053156 Bacteria 2336
1649 Ga0500624_000010 3300053157 Bacteria 172530
1650 Ga0500633_0003207 3300053160 Bacteria 3522
1651 Ga0500636_0001018 3300053177 Bacteria 15023
1652 Ga0500601_001174 3300053737 Bacteria 2922
1653 Ga0501084_0023017 3300054114 Bacteria 5200
1654 Ga0501084_0113137 3300054114 Bacteria 2281
1655 Ga0501084_0220502 3300054114 Bacteria 1600
1656 Ga0501082_0008535 3300060353 Bacteria 8835
1657 Ga0501082_0008939 3300060353 Bacteria 8645
1658 Ga0501082_0015864 3300060353 Bacteria 6477
1659 Ga0501082_0149744 3300060353 Bacteria 2026
1660 Ga0501082_0318212 3300060353 Bacteria 1355
1661 Ga0466962_0011986 3300061719 Bacteria 4170
1662 2501071596 2501025501 Bacteria 7768574
1663 2501406993 2501025504 Bacteria 8008976
1664 2508735020 2508501050 Bacteria 9633614
1665 2509075644 2508501114 Bacteria 7082538
1666 2511097894 2510917014 Bacteria 8296963
1667 2511108080 2510917015 Bacteria 7950052
1668 2511171181 2510917026 Bacteria 7046020
1669 2511196915 2510917030 Bacteria 7460662
1670 2514046995 2513237166 Bacteria 10373764
1671 2516021920 2515154189 Bacteria 9629850
1672 2523105081 2522572158 Bacteria 6514390
1673 2583150147 2582580736 Bacteria 5325865
1674 2585147618 2582581279 Bacteria 4980720
1675 2585147965 2582581279 Bacteria 4980720
1676 2585205182 2582581294 Bacteria 6626667
1677 2585226398 2582581298 Bacteria 7315509
1678 2585548682 2585427529 Bacteria 7395659
1679 2599748274 2599185240 Bacteria 7968121
1680 2600210186 2599185355 Bacteria 7968906
1681 2600224762 2599185359 Bacteria 4772316
1682 2600812328 2600255067 Bacteria 6795583
1683 2643748312 2643221545 Bacteria 5083237
1684 2643822235 2643221560 Bacteria 4801179
1685 2644113688 2643221619 Bacteria 4158469
1686 2644164351 2643221629 Bacteria 5850260
1687 2644195736 2643221634 Bacteria 6705461
1688 2644346378 2643221662 Bacteria 5851492
1689 2644508165 2643221691 Bacteria 5093099
1690 2676745676 2675903129 Bacteria 7964495
1691 2691330082 2690315857 Bacteria 4396207
1692 2738822118 2738541296 Bacteria 7285013
1693 2738834600 2738541298 Bacteria 7286732
1694 2738875804 2738541306 Bacteria 7284992
1695 2739187756 2738543002 Bacteria 7284546
1696 2739222402 2738543008 Bacteria 7282815
1697 2739364161 2738543034 Bacteria 6084756
1698 2748017801 2747842501 Bacteria 5293829
1699 2774868766 2773857925 Bacteria 6472445
1700 2775658118 2775506735 Bacteria 4556596
1701 2776259943 2775506901 Bacteria 9631051
1702 2792833666 2791355137 Bacteria 9654227
1703 2793331656 2791355261 Bacteria 6661293
1704 2793982534 2791355406 Bacteria 11364898
1705 2808968865 2808606384 Bacteria 8474373
1706 2809003696 2808606390 Bacteria 8476311
1707 2809010973 2808606391 Bacteria 8308166
1708 2819620445 2818991450 Bacteria 6962147
1709 2821444784 2821443989 Bacteria 7658172
1710 2844535182 2844533157 Bacteria 7517899
1711 2844842987 2844841374 Bacteria 3917147
1712 2862580343 2862574272 Bacteria 10567477
1713 2866556077 2866552031 Bacteria 5824618
1714 2870073679 2870068957 Bacteria 8925310
1715 2882461803 2882456835 Bacteria 6863978
1716 2883091828 2883087390 Bacteria 9532701
1717 2884763828 2884763398 Bacteria 4091164
1718 2885279411 2885270888 Bacteria 9831543
1719 2891560362 2891554331 Bacteria 8812224
1720 2891672537 2891670763 Bacteria 4967099
1721 2894239613 2894232714 Bacteria 8834183
1722 2894416919 2894414249 Bacteria 4405451
1723 2897804475 2897803580 Bacteria 7000062
1724 2899376802 2899370129 Bacteria 6781179
1725 2900641679 2900634093 Bacteria 10263517
1726 2904480616 2904479285 Bacteria 5073931
1727 2904486756 2904483920 Bacteria 7545285
1728 2904622837 2904615490 Bacteria 10047340
1729 2904769089 2904765812 Bacteria 5369154
1730 2904769650 2904765812 Bacteria 5369154
1731 2904773216 2904770941 Bacteria 5580202
1732 2904774119 2904770941 Bacteria 5580202
1733 2908813950 2908811453 Bacteria 5478616
1734 2919175511 2919171160 Bacteria 6499771
1735 2919420204 2919420072 Bacteria 5390363
1736 2919422421 2919420072 Bacteria 5390363
1737 2919434037 2919432681 Bacteria 5390474
1738 2919435326 2919432681 Bacteria 5390474
1739 2919515779 2919513703 Bacteria 3844312
1740 2919525086 2919523602 Bacteria 3788128
1741 2919528087 2919527303 Bacteria 7718827
1742 2919537687 2919534386 Bacteria 4577686
1743 2919675500 2919675420 Bacteria 3969095
1744 2921648255 2921643360 Bacteria 11448031
1745 2928027868 2928027323 Bacteria 4382488
1746 2928108953 2928108538 Bacteria 7360024
1747 2928136177 2928135762 Bacteria 7259641
1748 2928156713 2928153084 Bacteria 4020257
1749 2928158255 2928157003 Bacteria 7522202
1750 2928167526 2928163908 Bacteria 7561269
1751 2928504042 2928503688 Bacteria 7268108
1752 2928527493 2928526807 Bacteria 4760224
1753 2939600523 2939598168 Bacteria 4687164
1754 2945938430 2945934425 Bacteria 7444609
1755 2946062943 2946059875 Bacteria 4386623
1756 2981996646 2981990288 Bacteria 7590678
1757 2984558755 2984555340 Bacteria 4247089
1758 2984566739 2984564862 Bacteria 4339992
1759 2990708432 2990703756 Bacteria 7715990
1760 2993357927 2993356040 Bacteria 4247105
1761 2996224566 2996221748 Bacteria 6799777
1762 3005411816 3005409236 Bacteria 7188837
1763 3006429796 3006425503 Bacteria 6491253
1764 642615805 642555113 Bacteria 8214658
1765 8003015422 8003014200 Bacteria 4059994
1766 8005387414 8005382845 Bacteria 6732062
1767 8005400006 8005395548 Bacteria 6806915
1768 8020942445 8020938398 Bacteria 7472757
1769 8020952786 8020945358 Bacteria 8467355
1770 8020954605 8020953355 Bacteria 7439080
1771 8047719033 8047710418 Bacteria 11023148
1772 8047893907 8047893842 Bacteria 11723082
1773 8047901290 8047893842 Bacteria 11723082
1774 8048135099 8048127548 Bacteria 11053136
1775 8048357609 8048356638 Bacteria 11044339
1776 8048364924 8048356638 Bacteria 11044339
1777 8048370924 8048369669 Bacteria 11666822
1778 8048378231 8048369669 Bacteria 11666822
1779 8048387329 8048379754 Bacteria 11877923
1780 8048388498 8048379754 Bacteria 11877923
1781 8054304135 8054302542 Bacteria 5698134
1782 8054473778 8054472261 Bacteria 7464355
1783 8054478176 8054472261 Bacteria 7464355
1784 8055268674 8055266321 Bacteria 7999742
1785 8055304737 8055301274 Bacteria 8587385
1786 8056063235 8056060235 Bacteria 7259403
1787 Ga0070712_100002253
1788 JGI24740J21852_10002353
1789 JGI24739J22299_10019871
1790 JGI24735J21928_10004339
1791 JGI24735J21928_10015543
1792 JGI24738J21930_10000419
1793 JGI25156J39149_1001063
1794 JGI25156J39149_1003773
1795 JGI25156J39149_1010843
1796 JGI25162J39368_1000115
1797 JGI25162J39368_1000764
1798 JGI25157J39369_1000132
1799 JGI25163J39215_1000228
1800 JGI25164J39214_1000090
1801 JGI25164J39214_1000376
1802 JGI25150J39212_1000156
1803 JGI25150J39212_1002133
1804 JGI25151J46595_10000133
1805 JGI25151J46595_10000293
1806 JGI25151J46595_10017338
1807 JGI25151J46595_10017984
1808 JGI25151J46595_10018692
1809 JGI25406J46586_10002396
1810 JGI25165J46597_1000014
1811 JGI25165J46597_1000194
1812 JGI25165J46597_1000492
1813 JGI25153J46596_10000058
1814 JGI25153J46596_10000260
1815 rootH2_10029369
1816 JGI25160J50197_1000237
1817 JGI25160J50197_1004969
1818 Ga0006562J51391_1133533
1819 Ga0006562J51391_1133534
1820 Ga0055538_1001068
1821 Ga0055539_1000008
1822 Ga0055533_1000001
1823 Ga0055533_1000106
1824 Ga0055532_1000003
1825 Ga0055525_1000197
1826 Ga0055527_1000006
1827 Ga0055527_1000023
1828 Ga0055535_1000003
1829 Ga0055535_1000106
1830 Ga0055542_1000007
1831 Ga0055542_1000023
1832 Ga0055542_1000150
1833 Ga0055542_1000245
1834 Ga0055529_1000003
1835 Ga0055529_1000168
1836 Ga0055529_1000178
1837 Ga0055529_1000180
1838 Ga0055529_1001704
1839 Ga0055524_1001508
1840 Ga0055524_1003884
1841 Ga0055524_1009055
1842 Ga0055528_1002495
1843 Ga0055530_10003173
1844 Ga0055531_10008726
1845 Ga0055531_10017067
1846 Ga0058692_1000057
1847 Ga0058692_1000132
1848 Ga0065165_1000467
1849 Ga0070658_10004201
1850 Ga0070658_10061587
1851 Ga0070658_10105986
1852 Ga0070658_10151588
1853 Ga0070658_10166573
1854 Ga0070676_10036864
1855 Ga0070676_10072911
1856 Ga0070683_100000275
1857 Ga0070683_100001898
1858 Ga0070683_100084656
1859 Ga0070683_100136036
1860 Ga0070670_100019420
1861 Ga0070670_100067971
1862 Ga0068869_100044412
1863 Ga0070666_10013441
1864 Ga0070666_10074322
1865 Ga0070680_100002253
1866 Ga0070680_100046178
1867 Ga0070682_100004503
1868 Ga0070682_100119464
1869 Ga0070682_100190654
1870 Ga0068868_100003303
1871 Ga0068868_100003327
1872 Ga0068868_100044533
1873 Ga0068868_100072725
1874 Ga0068868_100095338
1875 Ga0068868_100096109
1876 Ga0068868_100122122
1877 Ga0070660_100005604
1878 Ga0070689_100004517
1879 Ga0070687_100005004
1880 Ga0070687_100014478
1881 Ga0070661_100001245
1882 Ga0070661_100001901
1883 Ga0070661_100023882
1884 Ga0070661_100028281
1885 Ga0070661_100030036
1886 Ga0070661_100071961
1887 Ga0070661_100072200
1888 Ga0070661_100112220
1889 Ga0070692_10051524
1890 Ga0070692_10083109
1891 Ga0070668_100013552
1892 Ga0070668_100066247
1893 Ga0070668_100098480
1894 Ga0070675_100003560
1895 Ga0070671_100027144
1896 Ga0070671_100127003
1897 Ga0070674_100009025
1898 Ga0070673_100061624
1899 Ga0070673_100107618
1900 Ga0070673_100292227
1901 Ga0070688_100044144
1902 Ga0070688_100216166
1903 Ga0070659_100000616
1904 Ga0070659_100002561
1905 Ga0070659_100159088
1906 Ga0070667_100004934
1907 Ga0070667_100038666
1908 Ga0070667_100052544
1909 Ga0070709_10000557
1910 Ga0070709_10030365
1911 Ga0070709_10035829
1912 Ga0070714_100000105
1913 Ga0070714_100021111
1914 Ga0070714_100080502
1915 Ga0070714_100082101
1916 Ga0070714_100099299
1917 Ga0070714_100128636
1918 Ga0070714_100344679
1919 Ga0070713_100000356
1920 Ga0070713_100000549
1921 Ga0070713_100021474
1922 Ga0070713_100066954
1923 Ga0070713_100067877
1924 Ga0070713_100180684
1925 Ga0070713_100294797
1926 Ga0070710_10020273
1927 Ga0070701_10007723
1928 Ga0070711_100000076
1929 Ga0070711_100000748
1930 Ga0070711_100102636
1931 Ga0070711_100109796
1932 Ga0070705_100022083
1933 Ga0070700_100028371
1934 Ga0070708_100001268
1935 Ga0070708_100006458
1936 Ga0070708_100006920
1937 Ga0070708_100013815
1938 Ga0070708_100020690
1939 Ga0070708_100051404
1940 Ga0070708_100176368
1941 Ga0070663_100000239
1942 Ga0070663_100009995
1943 Ga0070663_100069776
1944 Ga0070678_100001110
1945 Ga0070678_100147534
1946 Ga0070662_100031446
1947 Ga0070662_100040135
1948 Ga0070662_100067386
1949 Ga0070662_100083140
1950 Ga0070662_100121216
1951 Ga0070681_10210686
1952 Ga0070681_10229815
1953 Ga0070681_10279457
1954 Ga0068867_100021675
1955 Ga0068867_100221631
1956 Ga0070685_10004572
1957 Ga0070685_10040297
1958 Ga0070685_10158714
1959 Ga0070706_100000734
1960 Ga0070706_100017793
1961 Ga0070706_100018523
1962 Ga0070707_100000413
1963 Ga0070707_100003538
1964 Ga0070707_100013149
1965 Ga0070707_100027854
1966 Ga0070707_100269823
1967 Ga0070698_100000248
1968 Ga0070698_100001737
1969 Ga0070698_100006040
1970 Ga0070698_100012185
1971 Ga0070698_100085202
1972 Ga0070699_100007857
1973 Ga0070699_100018091
1974 Ga0070699_100018272
1975 Ga0070699_100027765
1976 Ga0070699_100081200
1977 Ga0070699_100111989
1978 Ga0070679_100018632
1979 Ga0070679_100019567
1980 Ga0070679_100026759
1981 Ga0070679_100074982
1982 Ga0070684_100000405
1983 Ga0070684_100006472
1984 Ga0070684_100012793
1985 Ga0070684_100033053
1986 Ga0070684_100050810
1987 Ga0070684_100100070
1988 Ga0070684_100157143
1989 Ga0070684_100251757
1990 Ga0070697_100001144
1991 Ga0070697_100002694
1992 Ga0070697_100005485
1993 Ga0070697_100087831
1994 Ga0068853_100001476
1995 Ga0068853_100002548
1996 Ga0068853_100072301
1997 Ga0068853_100074953
1998 Ga0068853_100226202
1999 Ga0068853_100242280
2000 Ga0068853_100280943
2001 Ga0070672_100026923
2002 Ga0070672_100150028
2003 Ga0070695_100007045
2004 Ga0070696_100082027
2005 Ga0070696_100177374
2006 Ga0070693_100008654
2007 Ga0070693_100109228
2008 Ga0070665_100000103
2009 Ga0070665_100000825
2010 Ga0070665_100041330
2011 Ga0070665_100065912
2012 Ga0070665_100091514
2013 Ga0070665_100134937
2014 Ga0068855_100000868
2015 Ga0068855_100005556
2016 Ga0068855_100010348
2017 Ga0068855_100019075
2018 Ga0068855_100030920
2019 Ga0068855_100062420
2020 Ga0068855_100093628
2021 Ga0068855_100195266
2022 Ga0070664_100000851
2023 Ga0070664_100030695
2024 Ga0070664_100075070
2025 Ga0070664_100111465
2026 Ga0070664_100127493
2027 Ga0068857_100002858
2028 Ga0068857_100064519
2029 Ga0068857_100280722
2030 Ga0068854_100044049
2031 Ga0068854_100065188
2032 Ga0068854_100155876
2033 Ga0068856_100000126
2034 Ga0068856_100005005
2035 Ga0068856_100012012
2036 Ga0068856_100041636
2037 Ga0068856_100066830
2038 Ga0068856_100087828
2039 Ga0068856_100120911
2040 Ga0068856_100143334
2041 Ga0068856_100455963
2042 Ga0070702_100003690
2043 Ga0070702_100073284
2044 Ga0068852_100000003
2045 Ga0068852_100000237
2046 Ga0068852_100001633
2047 Ga0068852_100025876
2048 Ga0068852_100056069
2049 Ga0068852_100077603
2050 Ga0068852_100082911
2051 Ga0068852_100267214
2052 Ga0068859_100011245
2053 Ga0068859_100012187
2054 Ga0068859_100014257
2055 Ga0068859_100040023
2056 Ga0068864_100009954
2057 Ga0068864_100031296
2058 Ga0068864_100049096
2059 Ga0068864_100130362
2060 Ga0068864_100143818
2061 Ga0068864_100329303
2062 Ga0068866_10000993
2063 Ga0068866_10058585
2064 Ga0068861_100229929
2065 Ga0068851_10003726
2066 Ga0068851_10013138
2067 Ga0068851_10053531
2068 Ga0068863_100005651
2069 Ga0068863_100012434
2070 Ga0068863_100028481
2071 Ga0068863_100047432
2072 Ga0068863_100054479
2073 Ga0068858_100001642
2074 Ga0068858_100064877
2075 Ga0068858_100080393
2076 Ga0068860_100008263
2077 Ga0068860_100016166
2078 Ga0068860_100051626
2079 Ga0068860_100156811
2080 Ga0068862_100017808
2081 Ga0068862_100053408
2082 Ga0068862_100064827
2083 Ga0081540_1003699
2084 Ga0081540_1037990
2085 Ga0081539_10000031
2086 Ga0081539_10000079
2087 Ga0070717_10004304
2088 Ga0070717_10007200
2089 Ga0070717_10010666
2090 Ga0070717_10015059
2091 Ga0070717_10024271
2092 Ga0070717_10025475
2093 Ga0070717_10079571
2094 Ga0070717_10096801
2095 Ga0070717_10109622
2096 Ga0070717_10153011
2097 Ga0075365_10000133
2098 Ga0075365_10024577
2099 Ga0075368_10042757
2100 Ga0075363_100001292
2101 Ga0075363_100084347
2102 Ga0075364_10000593
2103 Ga0075364_10007258
2104 Ga0075364_10021227
2105 Ga0075364_10024525
2106 Ga0075432_10035020
2107 Ga0070715_10089156
2108 Ga0070716_100017291
2109 Ga0070716_100023216
2110 Ga0070716_100023965
2111 Ga0070716_100050277
2112 Ga0070716_100088719
2113 Ga0070712_100000632
2114 Ga0070712_100003929
2115 Ga0070712_100008366
2116 Ga0070712_100017208
2117 Ga0070712_100018767
2118 Ga0070712_100026889
2119 Ga0075367_10005671
2120 Ga0075367_10063867
2121 Ga0075367_10096947
2122 Ga0075369_10000067
2123 Ga0075427_10000482
2124 Ga0075366_10000087
2125 Ga0075366_10025645
2126 Ga0075366_10036851
2127 Ga0075366_10046042
2128 Ga0097621_100008726
2129 Ga0097621_100010928
2130 Ga0097621_100022246
2131 Ga0097621_100023994
2132 Ga0075370_10000557
2133 Ga0075370_10006492
2134 Ga0075370_10013135
2135 Ga0075370_10092150
2136 Ga0068871_100016398
2137 Ga0068871_100027403
2138 Ga0068871_100036508
2139 Ga0068871_100120413
2140 Ga0068871_100144365
2141 Ga0075428_100017262
2142 Ga0075428_100111708
2143 Ga0075428_100158386
2144 Ga0075428_100214621
2145 Ga0075430_100003620
2146 Ga0075431_100097896
2147 Ga0075431_100162048
2148 Ga0075433_10065304
2149 Ga0075434_100003909
2150 Ga0075434_100004099
2151 Ga0075434_100046012
2152 Ga0075434_100097336
2153 Ga0075434_100100156
2154 Ga0075429_100002757
2155 Ga0075429_100196148
2156 Ga0068865_100011355
2157 Ga0068865_100035946
2158 Ga0075436_100000291
2159 Ga0075436_100001688
2160 Ga0075436_100002329
2161 Ga0075436_100030559
2162 Ga0097620_100011246
2163 Ga0097620_100012188
2164 Ga0097620_100014257
2165 Ga0097620_100040020
2166 Ga0075435_100004630
2167 Ga0075435_100005310
2168 Ga0075435_100084219
2169 Ga0075435_100096730
2170 Ga0105251_10000051
2171 Ga0105251_10004145
2172 Ga0105251_10034101
2173 Ga0105244_10009335
2174 Ga0105244_10048534
2175 Ga0105250_10014976
2176 Ga0105250_10016346
2177 Ga0105240_10000001
2178 Ga0105240_10000286
2179 Ga0105240_10001411
2180 Ga0105240_10003378
2181 Ga0105240_10004021
2182 Ga0105240_10007046
2183 Ga0105240_10015022
2184 Ga0105240_10015320
2185 Ga0105240_10015705
2186 Ga0105240_10025825
2187 Ga0105240_10027729
2188 Ga0105240_10031904
2189 Ga0105240_10067352
2190 Ga0105240_10183000
2191 Ga0111539_10000854
2192 Ga0111539_10000878
2193 Ga0111539_10034480
2194 Ga0111539_10061528
2195 Ga0105245_10002844
2196 Ga0105245_10011797
2197 Ga0105245_10014417
2198 Ga0105245_10038776
2199 Ga0105245_10039668
2200 Ga0105245_10086945
2201 Ga0105245_10175338
2202 Ga0105245_10257035
2203 Ga0105245_10302970
2204 Ga0105247_10006209
2205 Ga0105247_10059580
2206 Ga0114129_10005760
2207 Ga0114129_10019020
2208 Ga0114129_10081560
2209 Ga0114129_10104916
2210 Ga0105243_10002826
2211 Ga0105243_10186343
2212 Ga0105241_10000563
2213 Ga0105241_10002309
2214 Ga0105241_10004298
2215 Ga0105241_10021149
2216 Ga0105241_10033758
2217 Ga0105241_10079366
2218 Ga0105241_10120649
2219 Ga0105241_10136973
2220 Ga0105241_10150242
2221 Ga0105248_10009529
2222 Ga0105248_10023333
2223 Ga0105248_10028195
2224 Ga0105248_10028494
2225 Ga0105248_10065636
2226 Ga0105248_10203841
2227 Ga0105248_10207220
2228 Ga0105248_10256544
2229 Ga0105248_10314298
2230 Ga0105248_10330164
2231 Ga0105237_10001230
2232 Ga0105237_10002902
2233 Ga0105237_10006587
2234 Ga0105237_10007501
2235 Ga0105237_10010797
2236 Ga0105237_10010990
2237 Ga0105237_10065209
2238 Ga0105237_10065477
2239 Ga0105237_10127457
2240 Ga0105237_10192586
2241 Ga0105238_10000080
2242 Ga0105238_10001792
2243 Ga0105238_10003385
2244 Ga0105238_10007159
2245 Ga0105238_10022308
2246 Ga0105238_10058249
2247 Ga0105238_10067567
2248 Ga0105238_10070391
2249 Ga0105238_10071450
2250 Ga0105249_10026811
2251 Ga0105249_10043456
2252 Ga0105239_10001359
2253 Ga0105239_10003216
2254 Ga0105239_10005564
2255 Ga0105239_10027050
2256 Ga0105239_10039626
2257 Ga0105239_10051501
2258 Ga0105239_10052377
2259 Ga0105246_10008397
2260 Ga0105246_10011161
2261 Ga0157373_10002130
2262 Ga0157373_10009837
2263 Ga0157373_10027853
2264 Ga0157373_10145423
2265 Ga0157371_10057173
2266 Ga0157371_10082311
2267 Ga0157371_10168899
2268 Ga0157370_10000001
2269 Ga0157370_10004782
2270 Ga0157370_10006293
2271 Ga0157370_10043205
2272 Ga0157370_10128139
2273 Ga0157370_10136820
2274 Ga0157369_10000092
2275 Ga0157369_10000519
2276 Ga0157369_10003681
2277 Ga0157369_10005372
2278 Ga0157369_10010713
2279 Ga0157369_10011788
2280 Ga0157369_10013984
2281 Ga0157369_10015212
2282 Ga0157369_10018114
2283 Ga0157369_10045051
2284 Ga0157369_10055998
2285 Ga0157369_10114365
2286 Ga0157369_10227467
2287 Ga0157369_10427930
2288 Ga0157374_10000439
2289 Ga0157374_10003799
2290 Ga0157374_10062127
2291 Ga0157374_10073313
2292 Ga0157374_10087149
2293 Ga0157378_10004302
2294 Ga0157378_10005921
2295 Ga0157378_10044531
2296 Ga0157378_10080010
2297 Ga0157378_10116417
2298 Ga0157378_10317096
2299 Ga0157378_10348290
2300 Ga0163162_10032162
2301 Ga0163162_10082054
2302 Ga0163162_10158227
2303 Ga0163162_10261846
2304 Ga0157372_10000045
2305 Ga0157372_10000864
2306 Ga0157372_10001006
2307 Ga0157372_10009411
2308 Ga0157372_10021878
2309 Ga0157372_10042140
2310 Ga0157372_10045596
2311 Ga0157372_10051287
2312 Ga0157372_10081468
2313 Ga0157372_10083616
2314 Ga0157372_10117417
2315 Ga0157372_10248934
2316 Ga0157372_10484059
2317 Ga0157375_10002505
2318 Ga0157375_10009579
2319 Ga0157375_10016019
2320 Ga0157375_10167618
2321 Ga0157375_10187043
2322 Ga0157375_10224189
2323 Ga0157375_10291909
2324 Ga0163163_10000570
2325 Ga0163163_10008588
2326 Ga0157380_10234793
2327 Ga0182008_10022232
2328 Ga0182008_10030257
2329 Ga0157377_10006455
2330 Ga0157377_10112824
2331 Ga0157379_10029199
2332 Ga0157379_10042303
2333 Ga0157379_10043559
2334 Ga0157379_10079649
2335 Ga0157379_10125016
2336 Ga0157379_10166291
2337 Ga0157379_10178569
2338 Ga0157376_10000074
2339 Ga0157376_10002444
2340 Ga0157376_10017251
2341 Ga0182006_1015431
2342 Ga0182007_10000134
2343 Ga0182007_10003302
2344 Ga0182005_1011366
2345 Ga0183368_1002
2346 Ga0163161_10003606
2347 Ga0163161_10042311
2348 Ga0206353_11000141
2349 Ga0213872_10000388
2350 Ga0213872_10059652
2351 Ga0213876_10009387
2352 Ga0213876_10011169
2353 Ga0224712_10001480
2354 Ga0209760_100548
2355 Ga0209784_100053
2356 Ga0209566_100050
2357 Ga0209566_103958
2358 Ga0209674_100001
2359 Ga0209674_100025
2360 Ga0209672_100002
2361 Ga0209672_100064
2362 Ga0209672_102577
2363 Ga0209147_100003
2364 Ga0209147_105009
2365 Ga0209563_100001
2366 Ga0209563_101346
2367 Ga0207427_100041
2368 Ga0207427_100061
2369 Ga0207427_100834
2370 Ga0207427_101099
2371 Ga0207427_103063
2372 Ga0209437_100037
2373 Ga0209437_100267
2374 Ga0209437_100279
2375 Ga0209258_100005
2376 Ga0209258_100138
2377 Ga0209258_102763
2378 Ga0207425_1000011
2379 Ga0207425_1000072
2380 Ga0209646_1000351
2381 Ga0209026_1000104
2382 Ga0209677_100001
2383 Ga0209677_100601
2384 Ga0209148_1000001
2385 Ga0209148_1000002
2386 Ga0209148_1000006
2387 Ga0209148_1000108
2388 Ga0209759_1000006
2389 Ga0209759_1000052
2390 Ga0209759_1000220
2391 Ga0209759_1003685
2392 Ga0209129_1000031
2393 Ga0209129_1000737
2394 Ga0209129_1005223
2395 Ga0209233_1000002
2396 Ga0209233_1000014
2397 Ga0209233_1000018
2398 Ga0209233_1000545
2399 Ga0209233_1002368
2400 Ga0209233_1008622
2401 Ga0209455_1000003
2402 Ga0209455_1000079
2403 Ga0209455_1000102
2404 Ga0209455_1001023
2405 Ga0209455_1002782
2406 Ga0209673_1005552
2407 Ga0209130_1000693
2408 Ga0209676_1000100
2409 Ga0209676_1001455
2410 Ga0209676_1004470
2411 Ga0209676_1007055
2412 Ga0209025_1000012
2413 Ga0209025_1000473
2414 Ga0209025_1000509
2415 Ga0209025_1000721
2416 Ga0209025_1000802
2417 Ga0209025_1031800
2418 Ga0209564_1006514
2419 Ga0209564_1015451
2420 Ga0209758_1000009
2421 Ga0209758_1000143
2422 Ga0209758_1000853
2423 Ga0209758_1002491
2424 Ga0209758_1031122
2425 Ga0209758_1036152
2426 Ga0209050_1000005
2427 Ga0209050_1008322
2428 Ga0209256_1000752
2429 Ga0209256_1001211
2430 Ga0209256_1001259
2431 Ga0207426_1000020
2432 Ga0207426_1000080
2433 Ga0207426_1001406
2434 Ga0207426_1024668
2435 Ga0209051_1000507
2436 Ga0209051_1001813
2437 Ga0209051_1024235
2438 Ga0209257_1000712
2439 Ga0209257_1000822
2440 Ga0209257_1001291
2441 Ga0209257_1001585
2442 Ga0209257_1005469
2443 Ga0209257_1008420
2444 Ga0209257_1019269
2445 Ga0207697_10042039
2446 Ga0207656_10018669
2447 Ga0207656_10022080
2448 Ga0207696_1011511
2449 Ga0207655_1022025
2450 Ga0207713_1000462
2451 Ga0207653_10052439
2452 Ga0207710_10002756
2453 Ga0207710_10074409
2454 Ga0207688_10000304
2455 Ga0207680_10084806
2456 Ga0207647_10000278
2457 Ga0207647_10005308
2458 Ga0207647_10012431
2459 Ga0207647_10030452
2460 Ga0207699_10008403
2461 Ga0207699_10033589
2462 Ga0207645_10023338
2463 Ga0207645_10041363
2464 Ga0207645_10069247
2465 Ga0207645_10108041
2466 Ga0207643_10013673
2467 Ga0207705_10020989
2468 Ga0207705_10217003
2469 Ga0207684_10000389
2470 Ga0207684_10004583
2471 Ga0207684_10046578
2472 Ga0207654_10000023
2473 Ga0207654_10004886
2474 Ga0207654_10005075
2475 Ga0207654_10021511
2476 Ga0207654_10041420
2477 Ga0207654_10160223
2478 Ga0207707_10021868
2479 Ga0207707_10028260
2480 Ga0207707_10044183
2481 Ga0207707_10080650
2482 Ga0207695_10000001
2483 Ga0207695_10000026
2484 Ga0207695_10000096
2485 Ga0207695_10000144
2486 Ga0207695_10000624
2487 Ga0207695_10002958
2488 Ga0207695_10008025
2489 Ga0207695_10008849
2490 Ga0207695_10010412
2491 Ga0207695_10032685
2492 Ga0207695_10070881
2493 Ga0207695_10072943
2494 Ga0207695_10078805
2495 Ga0207695_10204021
2496 Ga0207695_10226624
2497 Ga0207671_10000890
2498 Ga0207671_10003428
2499 Ga0207671_10004998
2500 Ga0207671_10007898
2501 Ga0207671_10031185
2502 Ga0207671_10049004
2503 Ga0207671_10082288
2504 Ga0207671_10093025
2505 Ga0207671_10121419
2506 Ga0207693_10000016
2507 Ga0207693_10000067
2508 Ga0207693_10000415
2509 Ga0207693_10009303
2510 Ga0207693_10010555
2511 Ga0207693_10024245
2512 Ga0207693_10081768
2513 Ga0207663_10000608
2514 Ga0207663_10151620
2515 Ga0207660_10080862
2516 Ga0207660_10240824
2517 Ga0207662_10008567
2518 Ga0207662_10024528
2519 Ga0207657_10000003
2520 Ga0207657_10006444
2521 Ga0207657_10007051
2522 Ga0207657_10013752
2523 Ga0207657_10015794
2524 Ga0207657_10017961
2525 Ga0207657_10092158
2526 Ga0207649_10002972
2527 Ga0207649_10012549
2528 Ga0207649_10015414
2529 Ga0207649_10023379
2530 Ga0207649_10026449
2531 Ga0207649_10058379
2532 Ga0207652_10005130
2533 Ga0207652_10061707
2534 Ga0207652_10078988
2535 Ga0207646_10001021
2536 Ga0207646_10003890
2537 Ga0207646_10004869
2538 Ga0207646_10129302
2539 Ga0207694_10000028
2540 Ga0207694_10000205
2541 Ga0207694_10002229
2542 Ga0207694_10011031
2543 Ga0207694_10013189
2544 Ga0207694_10015901
2545 Ga0207694_10022150
2546 Ga0207694_10026135
2547 Ga0207694_10069923
2548 Ga0207694_10221002
2549 Ga0207650_10004541
2550 Ga0207650_10162687
2551 Ga0207659_10021238
2552 Ga0207659_10037951
2553 Ga0207687_10004132
2554 Ga0207687_10212691
2555 Ga0207700_10001225
2556 Ga0207700_10008306
2557 Ga0207700_10015420
2558 Ga0207700_10017810
2559 Ga0207700_10086091
2560 Ga0207700_10088453
2561 Ga0207664_10000158
2562 Ga0207664_10030837
2563 Ga0207664_10079271
2564 Ga0207664_10109095
2565 Ga0207664_10138572
2566 Ga0207644_10033148
2567 Ga0207690_10000007
2568 Ga0207690_10001066
2569 Ga0207690_10058000
2570 Ga0207706_10002117
2571 Ga0207706_10006147
2572 Ga0207706_10035048
2573 Ga0207706_10043245
2574 Ga0207706_10052579
2575 Ga0207706_10057290
2576 Ga0207706_10063372
2577 Ga0207686_10003543
2578 Ga0207709_10005564
2579 Ga0207669_10058280
2580 Ga0207669_10131933
2581 Ga0207704_10061262
2582 Ga0207704_10155020
2583 Ga0207704_10237209
2584 Ga0207665_10004770
2585 Ga0207665_10009285
2586 Ga0207665_10012890
2587 Ga0207665_10049135
2588 Ga0207665_10061216
2589 Ga0207665_10064816
2590 Ga0207691_10006717
2591 Ga0207691_10021448
2592 Ga0207691_10029915
2593 Ga0207711_10001182
2594 Ga0207711_10021006
2595 Ga0207711_10026400
2596 Ga0207711_10099740
2597 Ga0207711_10183800
2598 Ga0207711_10205833
2599 Ga0207711_10281436
2600 Ga0207689_10003366
2601 Ga0207689_10004289
2602 Ga0207689_10279551
2603 Ga0207661_10000250
2604 Ga0207661_10002410
2605 Ga0207661_10042036
2606 Ga0207661_10042551
2607 Ga0207661_10156626
2608 Ga0207679_10087239
2609 Ga0207679_10352683
2610 Ga0207667_10000923
2611 Ga0207667_10004811
2612 Ga0207667_10005817
2613 Ga0207667_10006129
2614 Ga0207667_10011767
2615 Ga0207667_10017454
2616 Ga0207667_10028348
2617 Ga0207667_10148399
2618 Ga0207651_10033047
2619 Ga0207712_10017716
2620 Ga0207712_10091636
2621 Ga0207712_10200051
2622 Ga0207668_10056129
2623 Ga0207668_10076056
2624 Ga0207640_10149197
2625 Ga0207640_10213416
2626 Ga0207658_10001989
2627 Ga0207658_10078736
2628 Ga0207677_10000275
2629 Ga0207677_10000439
2630 Ga0207677_10013304
2631 Ga0207677_10064994
2632 Ga0207677_10187755
2633 Ga0207677_10205067
2634 Ga0207703_10000742
2635 Ga0207703_10002465
2636 Ga0207703_10022130
2637 Ga0207639_10000105
2638 Ga0207639_10014892
2639 Ga0207639_10027591
2640 Ga0207639_10070662
2641 Ga0207639_10290576
2642 Ga0207639_10374246
2643 Ga0207678_10011557
2644 Ga0207678_10030250
2645 Ga0207678_10165117
2646 Ga0207708_10008754
2647 Ga0207708_10021493
2648 Ga0207708_10071994
2649 Ga0207708_10127174
2650 Ga0207702_10000599
2651 Ga0207702_10004059
2652 Ga0207702_10046810
2653 Ga0207702_10048079
2654 Ga0207702_10061824
2655 Ga0207702_10074126
2656 Ga0207702_10113742
2657 Ga0207702_10121003
2658 Ga0207702_10148586
2659 Ga0207641_10010365
2660 Ga0207641_10021490
2661 Ga0207641_10029594
2662 Ga0207641_10039723
2663 Ga0207641_10047107
2664 Ga0207641_10191931
2665 Ga0207648_10006249
2666 Ga0207648_10040593
2667 Ga0207648_10188307
2668 Ga0207676_10000524
2669 Ga0207676_10005412
2670 Ga0207676_10012101
2671 Ga0207674_10002407
2672 Ga0207674_10003429
2673 Ga0207674_10014153
2674 Ga0207674_10017603
2675 Ga0207674_10024955
2676 Ga0207674_10032964
2677 Ga0207674_10044065
2678 Ga0207674_10099978
2679 Ga0207674_10119966
2680 Ga0207674_10215337
2681 Ga0207675_100019174
2682 Ga0207675_100180147
2683 Ga0207675_100238965
2684 Ga0207683_10000235
2685 Ga0207683_10004790
2686 Ga0207683_10039387
2687 Ga0207683_10099965
2688 Ga0207683_10111306
2689 Ga0207683_10133697
2690 Ga0207698_10000118
2691 Ga0207698_10000128
2692 Ga0207698_10000713
2693 Ga0207698_10019726
2694 Ga0207698_10048292
2695 Ga0207698_10291069
2696 Ga0209371_1000064
2697 Ga0209371_1000156
2698 Ga0209371_1000163
2699 Ga0209371_1009505
2700 Ga0209813_10002733
2701 Ga0209813_10025731
2702 Ga0209974_10029906
2703 Ga0207428_10000139
2704 Ga0207428_10083545
2705 Ga0268266_10000001
2706 Ga0268266_10000002
2707 Ga0268266_10002024
2708 Ga0268266_10063972
2709 Ga0268266_10088318
2710 Ga0268266_10123909
2711 Ga0268266_10162313
2712 Ga0268265_10041251
2713 Ga0268265_10095534
2714 Ga0268265_10101642
2715 Ga0268264_10013801
2716 Ga0268264_10029579
2717 Ga0268264_10052154
2718 Ga0268264_10059118
2719 Ga0265334_10005063
2720 Ga0265318_10005296
2721 Ga0307517_10101037
2722 Ga0307515_10000382
2723 Ga0307515_10012279
2724 Ga0307515_10019915
2725 Ga0307515_10030579
2726 Ga0307515_10074648
2727 Ga0307515_10172322
2728 Ga0265338_10001393
2729 Ga0265338_10002714
2730 Ga0265338_10007466
2731 Ga0265338_10014811
2732 Ga0265338_10017582
2733 Ga0265338_10090147
2734 Ga0265338_10144124
2735 Ga0268256_1000028
2736 Ga0268256_1000130
2737 Ga0268256_1010223
2738 Ga0307512_10007391
2739 Ga0307512_10008127
2740 Ga0307512_10034426
2741 Ga0265330_10008769
2742 Ga0265332_10003860
2743 Ga0265332_10069791
2744 Ga0265328_10002208
2745 Ga0265328_10039329
2746 Ga0265320_10000855
2747 Ga0265320_10001597
2748 Ga0265325_10003448
2749 Ga0265329_10028998
2750 Ga0265340_10000265
2751 Ga0265340_10004766
2752 Ga0265340_10007005
2753 Ga0265339_10000040
2754 Ga0265339_10002741
2755 Ga0265339_10025292
2756 Ga0265339_10030108
2757 Ga0265331_10036190
2758 Ga0265316_10010021
2759 Ga0265316_10011815
2760 Ga0265316_10076669
2761 Ga0307513_10002543
2762 Ga0307513_10014673
2763 Ga0307513_10177374
2764 Ga0307513_10228258
2765 Ga0307509_10001893
2766 Ga0307408_100036836
2767 Ga0307408_100077198
2768 Ga0265313_10004931
2769 Ga0307508_10004834
2770 Ga0307508_10111009
2771 Ga0307508_10147031
2772 Ga0307514_10012978
2773 Ga0307514_10045789
2774 Ga0265314_10002539
2775 Ga0265314_10009578
2776 Ga0265342_10000423
2777 Ga0265342_10003774
2778 Ga0265342_10006771
2779 Ga0265342_10016092
2780 Ga0265342_10066307
2781 Ga0307516_10004216
2782 Ga0307516_10014805
2783 Ga0307516_10105861
2784 Ga0307516_10211993
2785 Ga0307405_10001559
2786 Ga0307405_10026348
2787 Ga0307410_10010347
2788 Ga0307410_10027063
2789 Ga0307410_10121053
2790 Ga0307406_10009321
2791 Ga0307407_10047162
2792 Ga0307412_10000002
2793 Ga0307409_100000035
2794 Ga0307409_100025384
2795 Ga0307409_100234346
2796 Ga0307416_100000287
2797 Ga0307416_100014506
2798 Ga0307416_100238705
2799 Ga0307416_100308438
2800 Ga0307411_10016202
2801 Ga0307415_100000003
2802 Ga0307415_100003349
2803 Ga0307415_100088003
2804 Ga0307415_100156918
2805 Ga0307507_10058129
2806 Ga0307510_10024598
2807 Ga0307510_10152346
2808 Ga0307510_10160483
2809 Ga0373936_0001387
2810 Ga0373936_0004339
2811 Ga0373954_0001393
2812 Ga0373954_0036677
2813 Ga0373954_0069570
2814 Ga0373956_0010264
2815 Ga0373957_0008634
2816 Ga0373957_0067817
2817 Ga0373943_0002644
2818 Ga0373943_0014875
2819 Ga0373946_0021681
2820 Ga0373946_0042168
2821 Ga0373955_0000268
2822 Ga0373955_0010254
2823 Ga0373955_0026620
2824 Ga0373955_0081872
2825 Ga0373955_0105566
2826 Ga0316574_0020405
2827 Ga0373924_0012004
2828 Ga0373924_0053057
2829 Ga0373924_0061963
2830 Ga0373935_0003009
2831 Ga0373935_0032408
2832 Ga0373927_0001212
2833 Ga0373933_0000815
2834 Ga0373933_0062042
2835 Ga0373933_0119161
2836 Ga0373933_0119972
2837 Ga0373933_0195479
2838 Ga0373947_0000576
2839 Ga0373947_0017352
2840 Ga0373947_0020634
2841 Ga0373947_0021702
2842 Ga0373937_0001164
2843 Ga0373937_0018449
2844 Ga0373937_0039520
2845 Ga0373937_0041709
2846 Ga0373937_0061892
2847 Ga0373937_0112477
2848 Ga0373937_0114659
2849 Ga0373937_0120279
2850 Ga0373925_0000695
2851 Ga0373925_0022538
2852 Ga0373925_0028721
2853 Ga0373925_0044235
2854 Ga0373925_0048469
2855 Ga0373925_0191266
2856 Ga0395899_0000007
2857 Ga0395899_0008149
2858 Ga0395899_0027370
2859 Ga0395900_0000178
2860 Ga0395900_0008538
2861 Ga0395900_0010740
2862 Ga0395900_0021731
2863 Ga0395900_0021936
2864 Ga0395900_0122854
2865 Ga0395900_0347418
2866 Ga0395898_0000015
2867 Ga0395898_0000276
2868 Ga0395898_0003978
2869 Ga0395898_0006320
2870 Ga0395898_0012063
2871 Ga0395898_0093924
2872 Ga0395898_0330453
2873 Ga0395905_0101233
2874 Ga0395901_0004706
2875 Ga0395901_0058868
2876 Ga0395901_0205286
2877 Ga0237819_00091
2878 Ga0436365_1038204
2879 Ga0436365_1103987
2880 Ga0436365_1795729
2881 Ga0436360_0019322
2882 Ga0436360_1187113
2883 Ga0436360_1316174
2884 Ga0436361_0179379
2885 Ga0436361_0251474
2886 Ga0436361_0644146
2887 Ga0436361_1155064
2888 Ga0439436_0004743
2889 Ga0439439_0004386
2890 Ga0439461_0001590
2891 Ga0439466_0010665
2892 Ga0439465_0001613
2893 Ga0439465_0002800
2894 Ga0451798_0507020
2895 Ga0451837_0067998
2896 Ga0451843_1584175
2897 Ga0439443_008533
2898 Ga0439445_0000750
2899 Ga0439448_0000101
2900 Ga0439449_0000569
2901 Ga0439457_008621
2902 Ga0439446_0011920
2903 Ga0439458_0000316
2904 Ga0439434_0003556
2905 Ga0439435_0003112
2906 Ga0439435_0021646
2907 Ga0466972_0043225
2908 Ga0466965_0000624
2909 Ga0466965_0072603
2910 Ga0466961_0016023
2911 Ga0466961_0025946
2912 Ga0466961_0035759
2913 Ga0466971_0038881
2914 Ga0466971_0045234
2915 Ga0466970_0042424
2916 Ga0466957_0005735
2917 Ga0466957_0007465
2918 Ga0466957_0074006
2919 Ga0466960_0011664
2920 Ga0466960_0102830
2921 Ga0466960_0120629
2922 Ga0466959_0100912
2923 Ga0466959_0112636
2924 Ga0466958_0044976
2925 Ga0466958_0083084
2926 Ga0466967_0023808
2927 Ga0466967_0039729
2928 Ga0466967_0142380
2929 Ga0466967_0278625
2930 Ga0495592_0002012
2931 Ga0495592_0030843
2932 Ga0495592_0093548
2933 Ga0495592_0162248
2934 Ga0495603_0020105
2935 Ga0495590_0005946
2936 Ga0495590_0012541
2937 Ga0495591_007498
2938 Ga0495629_0002803
2939 Ga0495629_0008252
2940 Ga0495629_0018703
2941 Ga0495629_0036598
2942 Ga0495629_0047179
2943 Ga0495629_0060195
2944 Ga0495638_0000524
2945 Ga0495638_0000660
2946 Ga0495638_0000771
2947 Ga0495638_0115939
2948 Ga0495641_0018334
2949 Ga0495641_0044696
2950 Ga0495641_0062336
2951 Ga0495651_0016841
2952 Ga0495651_0059266
2953 Ga0495651_0063761
2954 Ga0495653_0022294
2955 Ga0495653_0059574
2956 Ga0495650_0000010
2957 Ga0495650_0002608
2958 Ga0495650_0006223
2959 Ga0495650_0006684
2960 Ga0495650_0008172
2961 Ga0495650_0029271
2962 Ga0495580_0001025
2963 Ga0495580_0002243
2964 Ga0495580_0008623
2965 Ga0495580_0013994
2966 Ga0495580_0019567
2967 Ga0495580_0026937
2968 Ga0495580_0027927
2969 Ga0495580_0089287
2970 Ga0495580_0181247
2971 Ga0495580_0196376
2972 Ga0495582_0000629
2973 Ga0495582_0003241
2974 Ga0495582_0004552
2975 Ga0495582_0010551
2976 Ga0495582_0122311
2977 Ga0495605_0015098
2978 Ga0495605_0074168
2979 Ga0495639_0007177
2980 Ga0495662_0012591
2981 Ga0495664_0004527
2982 Ga0495664_0014620
2983 Ga0495664_0029425
2984 Ga0495585_0011113
2985 Ga0495585_0036929
2986 Ga0495594_0005454
2987 Ga0495594_0007680
2988 Ga0495594_0012425
2989 Ga0495594_0048432
2990 Ga0495596_0008596
2991 Ga0495596_0017058
2992 Ga0495596_0022158
2993 Ga0495596_0039457
2994 Ga0495583_0007667
2995 Ga0495583_0039414
2996 Ga0495606_0016529
2997 Ga0495606_0055453
2998 Ga0495606_0067888
2999 Ga0495608_0040078
3000 Ga0495608_0052888
3001 Ga0495610_0002377
3002 Ga0495610_0003137
3003 Ga0495610_0032046
3004 Ga0495618_0019115
3005 Ga0495618_0031243
3006 Ga0495620_0024001
3007 Ga0495628_0002174
3008 Ga0495628_0031291
3009 Ga0495630_0006260
3010 Ga0495630_0020419
3011 Ga0495630_0044220
3012 Ga0495630_0058861
3013 Ga0495630_0059577
3014 Ga0495630_0085528
3015 Ga0495644_0003181
3016 Ga0495648_0000066
3017 Ga0495648_0014966
3018 Ga0495648_0030098
3019 Ga0495666_0010385
3020 Ga0495666_0022651
3021 Ga0495642_0014115
3022 Ga0495642_0040154
3023 Ga0495652_0013301
3024 Ga0495654_0000456
3025 Ga0495654_0044656
3026 Ga0495654_0046961
3027 Ga0495665_0005960
3028 Ga0495665_0008376
3029 Ga0495665_0028815
3030 Ga0495665_0046416
3031 Ga0495665_0061496
3032 Ga0495640_0004522
3033 Ga0495640_0008292
3034 Ga0495640_0202713
3035 Ga0495586_0073522
3036 Ga0495587_0001737
3037 Ga0495598_0002267
3038 Ga0495598_0003753
3039 Ga0495609_0010673
3040 Ga0495621_0000085
3041 Ga0495645_0000331
3042 Ga0495645_0002552
3043 Ga0495645_0025130
3044 Ga0495645_0044754
3045 Ga0495645_0081479
3046 Ga0495645_0115443
3047 Ga0495622_0039273
3048 Ga0495622_0041595
3049 Ga0495633_0030748
3050 Ga0495633_0102686
3051 Ga0495667_0038447
3052 Ga0495667_0046163
3053 Ga0495656_0026282
3054 Ga0495668_0002861
3055 Ga0495668_0004855
3056 Ga0495668_0024560
3057 Ga0495634_0107911
3058 Ga0495625_0067523
3059 Ga0495625_0094896
3060 Ga0495635_0000993
3061 Ga0495635_0008216
3062 Ga0495635_0032291
3063 Ga0495635_0081248
3064 Ga0495635_0155215
3065 Ga0495659_0050810
3066 Ga0495661_0001703
3067 Ga0495588_0008882
3068 Ga0495657_0004997
3069 Ga0495657_0025873
3070 Ga0495657_0218651
3071 Ga0495599_0079861
3072 Ga0495623_0048362
3073 Ga0495646_0000924
3074 Ga0495646_0029020
3075 Ga0495646_0066861
3076 Ga0495669_0012480
3077 Ga0495613_0003805
3078 Ga0495613_0009065
3079 Ga0495613_0016936
3080 Ga0495613_0028018
3081 Ga0495613_0074840
3082 Ga0495624_0001188
3083 Ga0495624_0016621
3084 Ga0495624_0078015
3085 Ga0495624_0152955
3086 Ga0495670_0000012
3087 Ga0495670_0004038
3088 Ga0495670_0069207
3089 Ga0495671_0013693
3090 Ga0495649_0016355
3091 Ga0495589_0022210
3092 Ga0495589_0059478
3093 Ga0495589_0067180
3094 Ga0495600_0002361
3095 Ga0495600_0014475
3096 Ga0495600_0049867
3097 Ga0495600_0126510
3098 Ga0495581_0002516
3099 Ga0495581_0005826
3100 Ga0495581_0006324
3101 Ga0495581_0007107
3102 Ga0495581_0024403
3103 Ga0495604_0000171
3104 Ga0495636_0016396
3105 Ga0495674_0001885
3106 Ga0495674_0003055
3107 Ga0495674_0004949
3108 Ga0495674_0029631
3109 Ga0495674_0064294
3110 Ga0495674_0078474
3111 Ga0495674_0106062
3112 Ga0495674_0271867
3113 Ga0495672_0005687
3114 Ga0495672_0011070
3115 Ga0495672_0104019
3116 Ga0495676_0031826
3117 Ga0495676_0055285
3118 Ga0495680_0036344
3119 Ga0495680_0081120
3120 Ga0495680_0097822
3121 Ga0495683_0002900
3122 Ga0495683_0003522
3123 Ga0495683_0011841
3124 Ga0495683_0021022
3125 Ga0495687_005145
3126 Ga0495687_006290
3127 Ga0495675_0016288
3128 Ga0495675_0019550
3129 Ga0495675_0123453
3130 Ga0495679_000273
3131 Ga0495679_000939
3132 Ga0495679_034080
3133 Ga0495673_0000333
3134 Ga0495673_0022148
3135 Ga0495684_0185286
3136 Ga0495686_0001315
3137 Ga0495686_0027530
3138 Ga0495593_0017631
3139 Ga0495593_0025352
3140 Ga0495593_0081482
3141 Ga0495602_0002240
3142 Ga0495602_0025467
3143 Ga0495602_0109752
3144 Ga0495602_0241556
3145 Ga0495614_0001803
3146 Ga0495614_0006770
3147 Ga0495626_0004431
3148 Ga0495626_0006020
3149 Ga0495626_0046631
3150 Ga0496100_0000329
3151 Ga0496100_0047202
3152 Ga0496100_0109795
3153 Ga0496100_0187490
3154 Ga0496101_0000240
3155 Ga0496101_0021193
3156 Ga0496101_0158394
3157 Ga0496101_0224304
3158 Ga0496102_0000431
3159 Ga0496102_0061300
3160 Ga0496102_0066063
3161 Ga0496102_0141287
3162 Ga0496102_0193590
3163 Ga0496103_0000536
3164 Ga0496103_0030896
3165 Ga0496103_0093199
3166 Ga0496103_0107035
3167 Ga0496103_0128347
3168 Ga0496104_0000520
3169 Ga0496104_0001700
3170 Ga0496104_0025723
3171 Ga0496104_0065529
3172 Ga0496104_0161793
3173 Ga0496104_0323625
3174 Ga0496105_0004098
3175 Ga0496105_0060506
3176 Ga0496105_0061918
3177 Ga0496105_0189970
3178 Ga0496106_0000494
3179 Ga0496106_0058812
3180 Ga0496106_0118051
3181 Ga0496107_0025599
3182 Ga0496107_0031807
3183 Ga0496108_0031402
3184 Ga0496108_0067322
3185 Ga0496109_0015425
3186 Ga0496110_0388483
3187 Ga0496111_0003474
3188 Ga0496111_0010345
3189 Ga0496111_0022644
3190 Ga0496112_0015283
3191 Ga0496112_0041087
3192 Ga0496112_0110468
3193 Ga0496112_0160144
3194 Ga0496112_0347368
3195 Ga0496113_0003971
3196 Ga0496114_0009894
3197 Ga0496114_0013881
3198 Ga0496114_0022844
3199 Ga0496114_0024150
3200 Ga0496114_0083014
3201 Ga0496114_0086916
3202 Ga0496114_0265627
3203 Ga0496115_0000095
3204 Ga0496115_0000418
3205 Ga0496115_0007083
3206 Ga0496115_0007701
3207 Ga0496115_0021039
3208 Ga0496115_0039979
3209 Ga0496115_0072207
3210 Ga0496115_0090722
3211 Ga0496115_0155710
3212 Ga0496115_0356621
3213 Ga0496116_0044250
3214 Ga0496116_0070464
3215 Ga0496117_0000660
3216 Ga0496117_0001545
3217 Ga0496117_0001713
3218 Ga0496117_0005687
3219 Ga0496117_0013332
3220 Ga0496117_0123880
3221 Ga0496118_0000489
3222 Ga0496118_0000553
3223 Ga0496118_0002148
3224 Ga0496118_0003048
3225 Ga0496118_0021171
3226 Ga0496118_0026330
3227 Ga0496118_0028675
3228 Ga0496118_0056819
3229 Ga0496118_0136068
3230 Ga0496120_0013641
3231 Ga0496121_0001288
3232 Ga0496121_0012333
3233 Ga0496122_0031846
3234 Ga0496123_0038126
3235 Ga0496124_0005515
3236 Ga0496124_0006356
3237 Ga0496124_0009191
3238 Ga0496124_0037489
3239 Ga0496124_0049123
3240 Ga0496125_0009204
3241 Ga0496125_0034981
3242 Ga0496126_0000004
3243 Ga0496126_0000012
3244 Ga0496126_0000164
3245 Ga0496126_0001766
3246 Ga0496126_0005504
3247 Ga0495678_000685
3248 Ga0495678_002606
3249 Ga0495678_010935
3250 Ga0495678_023431
3251 Ga0495682_0011546
3252 Ga0495682_0033312
3253 Ga0501031_0000677
3254 Ga0501032_0022260
3255 Ga0501032_0022667
3256 Ga0501032_0037277
3257 Ga0501033_0005905
3258 Ga0501033_0052034
3259 Ga0501033_0109883
3260 Ga0501034_0000134
3261 Ga0501034_0029789
3262 Ga0501034_0031233
3263 Ga0501034_0034281
3264 Ga0501034_0039420
3265 Ga0501034_0061238
3266 Ga0501034_0067155
3267 Ga0501034_0070685
3268 Ga0501034_0117618
3269 Ga0501034_0131338
3270 Ga0501034_0265814
3271 Ga0501036_0023597
3272 Ga0501036_0059637
3273 Ga0501036_0379981
3274 Ga0501036_0398219
3275 Ga0501037_0010071
3276 Ga0501037_0016093
3277 Ga0501037_0017926
3278 Ga0501038_0015713
3279 Ga0501038_0021058
3280 Ga0501038_0028912
3281 Ga0501038_0047993
3282 Ga0501038_0051473
3283 Ga0501038_0196683
3284 Ga0501038_0272372
3285 Ga0501039_0000155
3286 Ga0501039_0003043
3287 Ga0501039_0011983
3288 Ga0501039_0018373
3289 Ga0501039_0023094
3290 Ga0501039_0064657
3291 Ga0501043_0002350
3292 Ga0501043_0005289
3293 Ga0501043_0008249
3294 Ga0501043_0104806
3295 Ga0501046_0063205
3296 Ga0501046_0077634
3297 Ga0501046_0106977
3298 Ga0501047_0002497
3299 Ga0501047_0003483
3300 Ga0501047_0012111
3301 Ga0501047_0036175
3302 Ga0501047_0052550
3303 Ga0501047_0107039
3304 Ga0501047_0139688
3305 Ga0501047_0189711
3306 Ga0501047_0222039
3307 Ga0501048_0020590
3308 Ga0501048_0137840
3309 Ga0501067_0002848
3310 Ga0501067_0005996
3311 Ga0501068_0016921
3312 Ga0501068_0113478
3313 Ga0501069_0000376
3314 Ga0501070_0000063
3315 Ga0501070_0005955
3316 Ga0501070_0100445
3317 Ga0501070_0280618
3318 Ga0501071_0136805
3319 Ga0501072_0070637
3320 Ga0501073_0019811
3321 Ga0501073_0049499
3322 Ga0501073_0051797
3323 Ga0501073_0077001
3324 Ga0501074_0013722
3325 Ga0501076_0243888
3326 Ga0501079_0013523
3327 Ga0501079_0017576
3328 Ga0501080_0016216
3329 Ga0501080_0056304
3330 Ga0501080_0110619
3331 Ga0501080_0151692
3332 Ga0501083_0000253
3333 Ga0501083_0000698
3334 Ga0501083_0008100
3335 Ga0501083_0010189
3336 Ga0501083_0016677
3337 Ga0501035_0002824
3338 Ga0501035_0006275
3339 Ga0501035_0022787
3340 Ga0501035_0070383
3341 Ga0501035_0168215
3342 Ga0501035_0289115
3343 Ga0501044_0000231
3344 Ga0501044_0003105
3345 Ga0501044_0005924
3346 Ga0501044_0146748
3347 Ga0501044_0232059
3348 nmdc:mga03683_104830_c1
3349 nmdc:mga03n38_21227_c1
3350 nmdc:mga00v17_1482_c1
3351 nmdc:mga00v17_24033_c1
3352 nmdc:mga00v17_49158_c1
3353 nmdc:mga00v17_5440_c1
3354 nmdc:mga00v17_678_c1
3355 nmdc:mga00v17_83159_c1
3356 nmdc:mga0yw44_159_c1
3357 nmdc:mga0yw44_9052_c1
3358 nmdc:mga0k408_1287_c1
3359 nmdc:mga0k408_255_c1
3360 nmdc:mga0k408_42255_c1
3361 nmdc:mga06z11_2047_c1
3362 nmdc:mga06z11_2323_c1
3363 nmdc:mga04h51_1684_c1
3364 nmdc:mga04h51_25807_c1
3365 nmdc:mga07m45_115875_c1
3366 nmdc:mga07m45_125_c1
3367 nmdc:mga07m45_4932_c1
3368 nmdc:mga05p37_1061_c1
3369 nmdc:mga05p37_127307_c1
3370 nmdc:mga05p37_26887_c1
3371 nmdc:mga05p37_94457_c1
3372 nmdc:mga09592_331305_c1
3373 nmdc:mga09592_3415_c1
3374 nmdc:mga0qj67_62723_c1
3375 nmdc:mga06r32_302370_c1
3376 nmdc:mga08y16_2005_c1
3377 nmdc:mga08y16_30259_c1
3378 nmdc:mga08y16_365477_c1
3379 nmdc:mga08y16_75174_c1
3380 nmdc:mga0n895_111855_c1
3381 nmdc:mga0n895_123797_c1
3382 nmdc:mga0n895_125788_c1
3383 nmdc:mga0n895_148550_c1
3384 nmdc:mga0n895_218486_c1
3385 nmdc:mga0n895_400_c1
3386 nmdc:mga0n895_95343_c1
3387 nmdc:mga0rr50_153234_c1
3388 nmdc:mga0rr50_3425_c1
3389 nmdc:mga0rr50_64788_c1
3390 nmdc:mga08x19_11861_c1
3391 nmdc:mga08x19_15973_c1
3392 nmdc:mga08x19_62163_c1
3393 nmdc:mga08x19_812_c1
3394 nmdc:mga08x19_8318_c1
3395 nmdc:mga08x19_97023_c1
3396 nmdc:mga0a205_267631_c1
3397 nmdc:mga0a205_38681_c1
3398 nmdc:mga0a205_76833_c1
3399 nmdc:mga0sz30_21_c2
3400 Ga0495601_0002820
3401 Ga0495601_0030486
3402 Ga0495601_0045594
3403 Ga0495612_0046140
3404 Ga0500635_0000075
3405 Ga0495595_0026468
3406 Ga0495619_0013014
3407 Ga0495619_0025834
3408 Ga0495619_0032276
3409 Ga0495619_0050085
3410 Ga0500578_0000082
3411 Ga0500578_0000385
3412 Ga0500643_011668
3413 Ga0500644_0000109
3414 Ga0500646_0000459
3415 Ga0500566_0009372
3416 Ga0500566_0029192
3417 Ga0500640_004532
3418 Ga0500562_058560
3419 Ga0500572_001651
3420 Ga0500595_000803
3421 Ga0500614_000873
3422 Ga0500658_0006658
3423 Ga0500559_0009950
3424 Ga0500568_0002365
3425 Ga0500573_0041144
3426 Ga0500577_0001382
3427 Ga0500603_005912
3428 Ga0500616_0000175
3429 Ga0500616_0000304
3430 Ga0500616_0007478
3431 Ga0500619_039615
3432 Ga0500622_0006457
3433 Ga0500622_0022484
3434 Ga0500622_0043262
3435 Ga0500624_000010
3436 Ga0500633_0003207
3437 Ga0500636_0001018
3438 Ga0500601_001174
3439 Ga0501084_0023017
3440 Ga0501084_0113137
3441 Ga0501084_0220502
3442 Ga0501082_0008535
3443 Ga0501082_0008939
3444 Ga0501082_0015864
3445 Ga0501082_0149744
3446 Ga0501082_0318212
3447 Ga0466962_0011986
3448 2501071596
3449 2501406993
3450 2508735020
3451 2509075644
3452 2511097894
3453 2511108080
3454 2511171181
3455 2511196915
3456 2514046995
3457 2516021920
3458 2523105081
3459 2583150147
3460 2585147618
3461 2585147965
3462 2585205182
3463 2585226398
3464 2585548682
3465 2599748274
3466 2600210186
3467 2600224762
3468 2600812328
3469 2643748312
3470 2643822235
3471 2644113688
3472 2644164351
3473 2644195736
3474 2644346378
3475 2644508165
3476 2676745676
3477 2691330082
3478 2738822118
3479 2738834600
3480 2738875804
3481 2739187756
3482 2739222402
3483 2739364161
3484 2748017801
3485 2774868766
3486 2775658118
3487 2776259943
3488 2792833666
3489 2793331656
3490 2793982534
3491 2808968865
3492 2809003696
3493 2809010973
3494 2819620445
3495 2821444784
3496 2844535182
3497 2844842987
3498 2862580343
3499 2866556077
3500 2870073679
3501 2882461803
3502 2883091828
3503 2884763828
3504 2885279411
3505 2891560362
3506 2891672537
3507 2894239613
3508 2894416919
3509 2897804475
3510 2899376802
3511 2900641679
3512 2904480616
3513 2904486756
3514 2904622837
3515 2904769089
3516 2904769650
3517 2904773216
3518 2904774119
3519 2908813950
3520 2919175511
3521 2919420204
3522 2919422421
3523 2919434037
3524 2919435326
3525 2919515779
3526 2919525086
3527 2919528087
3528 2919537687
3529 2919675500
3530 2921648255
3531 2928027868
3532 2928108953
3533 2928136177
3534 2928156713
3535 2928158255
3536 2928167526
3537 2928504042
3538 2928527493
3539 2939600523
3540 2945938430
3541 2946062943
3542 2981996646
3543 2984558755
3544 2984566739
3545 2990708432
3546 2993357927
3547 2996224566
3548 3005411816
3549 3006429796
3550 642615805
3551 8003015422
3552 8005387414
3553 8005400006
3554 8020942445
3555 8020952786
3556 8020954605
3557 8047719033
3558 8047893907
3559 8047901290
3560 8048135099
3561 8048357609
3562 8048364924
3563 8048370924
3564 8048378231
3565 8048387329
3566 8048388498
3567 8054304135
3568 8054473778
3569 8054478176
3570 8055268674
3571 8055304737
3572 8056063235

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02746

MR_MLE_N

Mandelate racemase / muconate lactonizing enzyme, N-terminal domain

66

171

0.96

PF13378

MR_MLE_C

Enolase C-terminal domain-like

232

439

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ow1-assembly5.cif.gz_G crystal structure of d-mannonate dehydratase from chromohalobacter salexigens complexed with mg 0.9968 1 402
4kpl-assembly1.cif.gz_E crystal structure of d-mannonate dehydratase from chromohalobacter salexigens complexed with mg,d-mannonate and 2-keto-3-deoxy-d-gluconate 0.9965 1 402
3ow1-assembly3.cif.gz_E crystal structure of d-mannonate dehydratase from chromohalobacter salexigens complexed with mg 0.9964 1 402
3rgt-assembly2.cif.gz_B crystal structure of d-mannonate dehydratase from chromohalobacter salexigens complexed with d-arabinohydroxamate 0.9962 1 402
4k2s-assembly3.cif.gz_H crystal structure of the mutant p317a of d-mannonate dehydratase from chromohalobacter salexigens complexed with mg and d-gluconate 0.9962 2 402
ID Description Score Start End Superfamily
af_P38104_1_104_3.30.390.10 Alpha Beta;2-Layer Sandwich;Enolase-like; domain 1;Enolase-like, N-terminal domain 0.9993 1 101 3.30.390.10
4k1wA01 Alpha Beta;2-Layer Sandwich;Enolase-like; domain 1;Enolase-like, N-terminal domain 0.9993 2 102 3.30.390.10
3bsmB02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Enolase-like C-terminal domain 0.9953 106 365 3.20.20.120
4f4rA02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Enolase-like C-terminal domain 0.9936 106 365 3.20.20.120
3bsmB01 Alpha Beta;2-Layer Sandwich;Enolase-like; domain 1;Enolase-like, N-terminal domain 0.9862 1 102 3.30.390.10
ID Description Score Start End GO Terms
AF-A0A447U3M1-F1-model_v4 Starvation sensing protein RspA 0.9996 1 109
AF-H1SGP0-F1-model_v4 Bifunctional D-altronate/D-mannonate dehydratase 0.9964 235 402
AF-A0A838S228-F1-model_v4 Bifunctional D-altronate/D-mannonate dehydratase 0.9958 221 402
AF-A0A7Y9GTP0-F1-model_v4 Mannonate dehydratase (EC 4.2.1.8) 0.9954 2 402 GO:0000287
GO:0008927
GO:0009063
GO:0016052
AF-A0A2V5L7C7-F1-model_v4 Bifunctional D-altronate/D-mannonate dehydratase 0.9952 2 402 GO:0000287
GO:0008927
GO:0009063
GO:0016052

Map