F495697
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1786 | 656 | 3572 | 403 |
Family's Representative Sequence
| Representative Sequence | 3300006175|Ga0070712_100002253|Ga0070712_1000022535 |
| Length | 463 |
| Sequence | LLCAGAGAAAGKGGDLKTCSWDQARNLAAHFKIPTSGKTGQRWGTRHPISVHSWVGFKENGLKITDAKVFVTSPGRNFVTLKVYTDEGVYGLGDATLNGRELAVASYLRDHVVPCLIGRDPAQTEDVWQYLYRGAYWRRGPVTMTAIAAVDMALWDIKGKALNTPVYNLLGGKSRTGVLVYGHANGKDIEETVDEVGKYKEQGYLAIRAQSGIPGLASTYGVAKDKMFYEPAEKGLPPENLWSTEKYLLHVPKLFEALRLKFGDDLNLLHDVHHRLTPIEAARLGKSLEPYHLFWLEDAVPAELQEGFRLIRKHTTTPLAVGEVFNSVWDAHILITEQLIDYLRMTVVHSGGLTHLKKIAALAEVYHVRTGSHGATDLSPVAMAAALHFDIAINNFGIQEYMRHTQETDEVFPHAYSFHAGYLYPGDSPGLGVDYNEKLAEKFPYERAYLPVNRKVDGTMFNW |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 2 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 3 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 4 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 5 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 6 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 7 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 8 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 9 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 10 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 11 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 12 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 13 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 14 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 15 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 16 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 17 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 18 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 19 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 20 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 21 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 22 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 23 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 24 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 25 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 26 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 27 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 28 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 29 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 30 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 31 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 32 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 33 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 34 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 39 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 41 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 43 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 45 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 54 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 57 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 64 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 69 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 70 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 71 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 72 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 73 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 74 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 76 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 77 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 78 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 79 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 81 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 85 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 87 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 88 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 89 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 91 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 92 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 93 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 94 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 95 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 96 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 97 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 98 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 99 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 100 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 101 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 102 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 103 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 104 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 105 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 106 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 107 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 108 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 109 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 110 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 111 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 112 | 3300006194 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Metagenome | Rhizosphere |
| 113 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 114 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 116 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 117 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 118 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 119 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 120 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 121 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 122 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 123 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 124 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 125 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 127 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 136 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 137 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 138 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 139 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 140 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 141 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 142 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 143 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 150 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 151 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 152 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 153 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 154 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 155 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 156 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 157 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 158 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 159 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 160 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 161 | 3300015687 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 | Metagenome | Rhizosphere |
| 162 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 163 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 164 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 165 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 166 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 167 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 168 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 169 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 170 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 171 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 172 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 173 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 174 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 175 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 176 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 177 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 178 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 179 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 180 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 181 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 182 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 183 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 184 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 185 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 186 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 187 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 188 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 189 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 190 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 191 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 192 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 193 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 194 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 195 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 196 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 197 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 254 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 255 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 256 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 257 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 258 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 259 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 260 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 261 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 262 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 263 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 264 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 265 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 266 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 267 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 268 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 269 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 270 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 271 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 272 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 273 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 274 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 275 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 276 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 277 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 278 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 279 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 280 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 281 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 282 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 283 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 284 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 285 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 286 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 287 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 288 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 289 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 290 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 291 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 292 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 293 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 294 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 295 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 296 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 297 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 298 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 299 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 300 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 301 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 302 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 303 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 304 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 305 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 306 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 307 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 308 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 309 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 310 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 311 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 312 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 313 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 314 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 315 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 316 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 317 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 318 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 319 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 320 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 321 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 322 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 323 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 324 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 325 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 326 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 327 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 328 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 329 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 330 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 331 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 332 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 333 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 334 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 335 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 336 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 337 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 338 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 339 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 340 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 341 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 342 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 343 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 344 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 345 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 346 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 347 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 348 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 349 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 350 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 351 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 352 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 353 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 354 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 355 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 356 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 357 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 420 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 421 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 422 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 423 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 424 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 425 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 426 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 427 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 428 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 429 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 430 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 431 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 432 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 433 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 434 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 435 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 436 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 437 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 438 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 439 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 440 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 441 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 442 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 443 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 444 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 445 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 446 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 447 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 448 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 449 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 450 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 451 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 452 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 453 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 454 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 455 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 456 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 457 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 458 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 459 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 460 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 461 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 462 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 463 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 464 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 465 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 466 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 467 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 468 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 469 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 470 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 471 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 472 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 473 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 474 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 475 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 476 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 477 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 478 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 479 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 480 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 481 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 482 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 483 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 484 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 485 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 486 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 487 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 488 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 489 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 490 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 491 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 492 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 493 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 494 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 495 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 496 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 497 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 498 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 499 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 500 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 501 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 502 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 503 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 504 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 505 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 506 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 507 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 508 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 509 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 510 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 511 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 512 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 513 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 514 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 515 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 516 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 517 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 518 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 519 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 520 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 521 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 522 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 523 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 524 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 525 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 526 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 527 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 528 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 529 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 530 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 531 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 532 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 533 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 534 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 535 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 536 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 537 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 538 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 539 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 540 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 541 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 542 | 2501025501 | Paraburkholderia silvatlantica PVA5 | Isolate | Unclassified |
| 543 | 2501025504 | Paraburkholderia silvatlantica SRMrh-20 | Isolate | Unclassified |
| 544 | 2508501050 | Microvirga lupini Lut6 | Isolate | Nodule |
| 545 | 2508501114 | Microvirga lotononidis WSM3557 | Isolate | Nodule |
| 546 | 2510917014 | Paraburkholderia silvatlantica SRMrh-20 | Isolate | Unclassified |
| 547 | 2510917015 | Paraburkholderia silvatlantica PVA5 | Isolate | Unclassified |
| 548 | 2510917026 | Rhizobium sp. CF80 | Isolate | Rhizosphere |
| 549 | 2510917030 | Rhizobium sp. CF142 | Isolate | Rhizosphere |
| 550 | 2513237166 | Paraburkholderia azotifigens UYPR1.413 | Isolate | Nodule |
| 551 | 2515154189 | Paraburkholderia nodosa DSM 21604 | Isolate | Unclassified |
| 552 | 2522572158 | Azospirillum halopraeferens DSM 3675 | Isolate | Unclassified |
| 553 | 2582580736 | Prauserella sp. Am3 | Isolate | Unclassified |
| 554 | 2582581279 | Caulobacter henricii OK261 | Isolate | Rhizosphere |
| 555 | 2582581294 | Rhizobium sp. CF394 | Isolate | Rhizosphere |
| 556 | 2582581298 | Rhizobium alamii YR540 | Isolate | Rhizosphere |
| 557 | 2585427529 | Rhizobium alamii YR584 | Isolate | Rhizosphere |
| 558 | 2599185240 | Burkholderia sp. NFPP32 | Isolate | Rhizoplane |
| 559 | 2599185355 | Burkholderia sp. NFACC33-1 | Isolate | Rhizoplane |
| 560 | 2599185359 | Sphingomonas sp. NFR04 | Isolate | Rhizoplane |
| 561 | 2600255067 | Paraburkholderia kururiensis thiooxydans NBRC 107107 | Isolate | Unclassified |
| 562 | 2643221545 | Caulobacter sp. Root1455 | Isolate | Unclassified |
| 563 | 2643221560 | Sphingopyxis sp. Root1497 | Isolate | Unclassified |
| 564 | 2643221619 | Agromyces sp. Root81 | Isolate | Unclassified |
| 565 | 2643221629 | Devosia sp. Root105 | Isolate | Unclassified |
| 566 | 2643221634 | Rhizobium sp. Root1203 | Isolate | Unclassified |
| 567 | 2643221662 | Devosia sp. Root413D1 | Isolate | Unclassified |
| 568 | 2643221691 | Caulobacter sp. Root487D2Y | Isolate | Unclassified |
| 569 | 2675903129 | Burkholderia pyrrocinia NFIX32 | Isolate | Rhizoplane |
| 570 | 2690315857 | Rheinheimera sp. EpRS3 | Isolate | Unclassified |
| 571 | 2738541296 | Paraburkholderia sp. GV073 | Isolate | Unclassified |
| 572 | 2738541298 | Paraburkholderia sp. GV068 | Isolate | Unclassified |
| 573 | 2738541306 | Paraburkholderia sp. GV052 | Isolate | Unclassified |
| 574 | 2738543002 | Paraburkholderia sp. GV072 | Isolate | Unclassified |
| 575 | 2738543008 | Paraburkholderia sp. GV060 | Isolate | Unclassified |
| 576 | 2738543034 | Rhodococcus sp. OK269 | Isolate | Unclassified |
| 577 | 2747842501 | Xanthomonas sp. WCS2014-23 | Isolate | Unclassified |
| 578 | 2773857925 | Microvirga vignae BR3299 | Isolate | Unclassified |
| 579 | 2775506735 | Arthrobacter sp. S95 1704 | Isolate | Unclassified |
| 580 | 2775506901 | Microvirga ossetica V5/3m | Isolate | Unclassified |
| 581 | 2791355137 | Paraburkholderia piptadeniae STM7183 | Isolate | Unclassified |
| 582 | 2791355261 | Rhizobium sp. J15 | Isolate | Nodule |
| 583 | 2791355406 | Streptomyces rhizosphaericus NRRL B-24304 | Isolate | Unclassified |
| 584 | 2808606384 | Burkholderia sp. SJZ089 | Isolate | Rhizosphere |
| 585 | 2808606390 | Burkholderia sp. SJZ115 | Isolate | Rhizosphere |
| 586 | 2808606391 | Burkholderia sp. SJZ091 | Isolate | Rhizosphere |
| 587 | 2818991450 | Burkholderia sp. 604 | Isolate | Unclassified |
| 588 | 2821443989 | Inquilinus ginsengisoli 584 | Isolate | Unclassified |
| 589 | 2844533157 | Inquilinus sp. R-72501 v. 2 | Isolate | Unclassified |
| 590 | 2844841374 | Leifsonia soli DSM 23871 | Isolate | Rhizosphere |
| 591 | 2862574272 | Streptomyces sp. AcE210 | Isolate | Nodule |
| 592 | 2866552031 | Saccharopolyspora rhizosphaerae H219 | Isolate | Unclassified |
| 593 | 2870068957 | Burkholderia sp. JP2-270 | Isolate | Unclassified |
| 594 | 2882456835 | Microvirga sp. KLBC 81 | Isolate | Unclassified |
| 595 | 2883087390 | Paraburkholderia guartelaensis CNPSo 3008 | Isolate | Unclassified |
| 596 | 2884763398 | Leifsonia sp. PS1209 | Isolate | Stem Tuber |
| 597 | 2885270888 | Paraburkholderia sp. UYCPa14C | Isolate | Unclassified |
| 598 | 2891554331 | Microbispora sp. CL1-1 | Isolate | Unclassified |
| 599 | 2891670763 | Buttiauxella sp. B2 | Isolate | Rhizosphere |
| 600 | 2894232714 | Microvirga tunisiensis Lmie10 | Isolate | Nodule |
| 601 | 2894414249 | Luteimonas sp. LNNU 24178 | Isolate | Rhizosphere |
| 602 | 2897803580 | Azospirillum doebereinerae GSF71 | Isolate | Unclassified |
| 603 | 2899370129 | Amycolatopsis alkalitolerans SYSUP0005 | Isolate | Stem Tuber |
| 604 | 2900634093 | Paraburkholderia dipogonis ICMP 19430 | Isolate | Unclassified |
| 605 | 2904479285 | Comamonas sediminis 4487 | Isolate | Rhizosphere |
| 606 | 2904483920 | Paraburkholderia caledonica 575 | Isolate | Unclassified |
| 607 | 2904615490 | Paraburkholderia franconis CNPSo 3157 | Isolate | Unclassified |
| 608 | 2904765812 | Rhodococcus fascians 1590 | Isolate | Rhizosphere |
| 609 | 2904770941 | Rhodococcus fascians 1339 | Isolate | Rhizosphere |
| 610 | 2908811453 | Rhodococcus sp. 1R11 | Isolate | Unclassified |
| 611 | 2919171160 | Neorhizobium sp. 2083 | Isolate | Unclassified |
| 612 | 2919420072 | Rhodococcus fascians 3241 | Isolate | Rhizosphere |
| 613 | 2919432681 | Rhodococcus sp. 3258 | Isolate | Rhizosphere |
| 614 | 2919513703 | Luteimonas sp. 3794 | Isolate | Unclassified |
| 615 | 2919523602 | Leifsonia shinshuensis 3821 | Isolate | Unclassified |
| 616 | 2919527303 | Paraburkholderia strydomiana 3827 | Isolate | Unclassified |
| 617 | 2919534386 | Rheinheimera pacifica 3879 | Isolate | Unclassified |
| 618 | 2919675420 | Luteimonas terrae 4099 | Isolate | Unclassified |
| 619 | 2921643360 | Paraburkholderia steynii HC1.1ba | Isolate | Nodule |
| 620 | 2928027323 | Sphingomonas sp. 1185 | Isolate | Unclassified |
| 621 | 2928108538 | Paraburkholderia terricola 1595 | Isolate | Rhizosphere |
| 622 | 2928135762 | Paraburkholderia terricola 1988 | Isolate | Unclassified |
| 623 | 2928153084 | Leifsonia sp. 563 | Isolate | Unclassified |
| 624 | 2928157003 | Burkholderia ambifaria 566 | Isolate | Unclassified |
| 625 | 2928163908 | Burkholderia sp. 567 | Isolate | Unclassified |
| 626 | 2928503688 | Paraburkholderia terricola 1263 | Isolate | Rhizosphere |
| 627 | 2928526807 | Sphingomonas trueperi 1770 | Isolate | Rhizosphere |
| 628 | 2939598168 | Arthrobacter sp. 754 | Isolate | Rhizosphere |
| 629 | 2945934425 | Paraburkholderia graminis W1I13 | Isolate | Rhizosphere |
| 630 | 2946059875 | Arthrobacter sp. SLBN-112 | Isolate | Rhizosphere |
| 631 | 2981990288 | Burkholderia sp. PvR073 | Isolate | Rhizosphere |
| 632 | 2984555340 | Sphingomonas sp. SORGH_AS789 | Isolate | Aerial Root |
| 633 | 2984564862 | Sphingomonas sp. SORGH_AS870 | Isolate | Aerial Root |
| 634 | 2990703756 | Paraburkholderia graminis SLBN-33 | Isolate | Rhizosphere |
| 635 | 2993356040 | Sphingomonas sp. SORGH_AS742 | Isolate | Aerial Root |
| 636 | 2996221748 | Micromonospora veneta CAP181 | Isolate | Unclassified |
| 637 | 3005409236 | Rhizobium sp. P32RR-XVIII | Isolate | Rhizosphere |
| 638 | 3006425503 | Streptomyces zingiberis PLAI1-29 | Isolate | Unclassified |
| 639 | 642555113 | Paraburkholderia phytofirmans PsJN | Isolate | Unclassified |
| 640 | 8003014200 | Lysobacter changpingensis Cm-3-T8 | Isolate | Rhizosphere |
| 641 | 8005382845 | Rhizobium sp. R634 | Isolate | Nodule |
| 642 | 8005395548 | Rhizobium sp. R339 | Isolate | Nodule |
| 643 | 8020938398 | Burkholderia sp. BE12 | Isolate | Rhizosphere |
| 644 | 8020945358 | Burkholderia sp. BE17 | Isolate | Rhizosphere |
| 645 | 8020953355 | Burkholderia sp. BE24 | Isolate | Rhizosphere |
| 646 | 8047710418 | Umezawaea endophytica DSM 103496 | Isolate | Unclassified |
| 647 | 8047893842 | Streptomyces cangkringensis DSM 41769 | Isolate | Rhizosphere |
| 648 | 8048127548 | Streptomyces samsunensis DSM 42010 | Isolate | Rhizosphere |
| 649 | 8048356638 | Streptomyces rhizosphaericus DSM 41760 | Isolate | Rhizosphere |
| 650 | 8048369669 | Streptomyces indonesiensis DSM 41759 | Isolate | Rhizoplane |
| 651 | 8048379754 | Streptomyces asiaticus DSM 41761 | Isolate | Rhizosphere |
| 652 | 8054302542 | Novosphingobium kaempferiae Sx8-5 | Isolate | Rhizosphere |
| 653 | 8054472261 | Pseudonocardia terrae RS11V-5 | Isolate | Rhizosphere |
| 654 | 8055266321 | Paraburkholderia rhynchosiae LMG 27174 | Isolate | Nodule |
| 655 | 8055301274 | Paraburkholderia kirstenboschensis LMG 28727 | Isolate | Nodule |
| 656 | 8056060235 | Nocardiopsis endophytica RSe5-2 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 92.78 |
| Metatranscriptomes | 0.22 |
| Isolates | 7 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.17 |
| Bulb | 0 |
| Endosphere | 11.48 |
| Nodule | 0.62 |
| Rhizoplane | 3.92 |
| Rhizosphere | 75.81 |
| Stem | 0 |
| Stem Tuber | 0.11 |
| Unclassified | 0.78 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070712_100002253 | 3300006175 | Bacteria | 11861 |
| 2 | JGI24740J21852_10002353 | 3300001979 | Bacteria | 8602 |
| 3 | JGI24739J22299_10019871 | 3300001989 | Bacteria | 2402 |
| 4 | JGI24735J21928_10004339 | 3300002067 | Bacteria | 4773 |
| 5 | JGI24735J21928_10015543 | 3300002067 | Bacteria | 2373 |
| 6 | JGI24738J21930_10000419 | 3300002075 | Bacteria | 11982 |
| 7 | JGI25156J39149_1001063 | 3300002705 | Bacteria | 12674 |
| 8 | JGI25156J39149_1003773 | 3300002705 | Bacteria | 4834 |
| 9 | JGI25156J39149_1010843 | 3300002705 | Bacteria | 2109 |
| 10 | JGI25162J39368_1000115 | 3300002737 | Bacteria | 88006 |
| 11 | JGI25162J39368_1000764 | 3300002737 | Bacteria | 21773 |
| 12 | JGI25157J39369_1000132 | 3300002741 | Bacteria | 62647 |
| 13 | JGI25163J39215_1000228 | 3300002771 | Bacteria | 21041 |
| 14 | JGI25164J39214_1000090 | 3300002772 | Bacteria | 90565 |
| 15 | JGI25164J39214_1000376 | 3300002772 | Bacteria | 26529 |
| 16 | JGI25150J39212_1000156 | 3300002774 | Bacteria | 38549 |
| 17 | JGI25150J39212_1002133 | 3300002774 | Bacteria | 5111 |
| 18 | JGI25151J46595_10000133 | 3300003187 | Bacteria | 99030 |
| 19 | JGI25151J46595_10000293 | 3300003187 | Bacteria | 55849 |
| 20 | JGI25151J46595_10017338 | 3300003187 | Bacteria | 3126 |
| 21 | JGI25151J46595_10017984 | 3300003187 | Bacteria | 3049 |
| 22 | JGI25151J46595_10018692 | 3300003187 | Bacteria | 2966 |
| 23 | JGI25406J46586_10002396 | 3300003203 | Bacteria | 8862 |
| 24 | JGI25165J46597_1000014 | 3300003214 | Bacteria | 390383 |
| 25 | JGI25165J46597_1000194 | 3300003214 | Bacteria | 91012 |
| 26 | JGI25165J46597_1000492 | 3300003214 | Bacteria | 38146 |
| 27 | JGI25153J46596_10000058 | 3300003215 | Bacteria | 132614 |
| 28 | JGI25153J46596_10000260 | 3300003215 | Bacteria | 42298 |
| 29 | rootH2_10029369 | 3300003320 | Bacteria | 6864 |
| 30 | JGI25160J50197_1000237 | 3300003354 | Bacteria | 42860 |
| 31 | JGI25160J50197_1004969 | 3300003354 | Bacteria | 5645 |
| 32 | Ga0006562J51391_1133533 | 3300003578 | Bacteria | 9750 |
| 33 | Ga0006562J51391_1133534 | 3300003578 | Bacteria | 9352 |
| 34 | Ga0055538_1001068 | 3300003751 | Bacteria | 6068 |
| 35 | Ga0055539_1000008 | 3300003752 | Bacteria | 537665 |
| 36 | Ga0055533_1000001 | 3300003756 | Bacteria | 1863437 |
| 37 | Ga0055533_1000106 | 3300003756 | Bacteria | 104514 |
| 38 | Ga0055532_1000003 | 3300003758 | Bacteria | 494004 |
| 39 | Ga0055525_1000197 | 3300003759 | Bacteria | 71227 |
| 40 | Ga0055527_1000006 | 3300003760 | Bacteria | 494004 |
| 41 | Ga0055527_1000023 | 3300003760 | Bacteria | 204513 |
| 42 | Ga0055535_1000003 | 3300003761 | Bacteria | 494004 |
| 43 | Ga0055535_1000106 | 3300003761 | Bacteria | 90565 |
| 44 | Ga0055542_1000007 | 3300003762 | Bacteria | 494004 |
| 45 | Ga0055542_1000023 | 3300003762 | Bacteria | 292964 |
| 46 | Ga0055542_1000150 | 3300003762 | Bacteria | 88006 |
| 47 | Ga0055542_1000245 | 3300003762 | Bacteria | 62120 |
| 48 | Ga0055529_1000003 | 3300003763 | Bacteria | 494004 |
| 49 | Ga0055529_1000168 | 3300003763 | Bacteria | 90565 |
| 50 | Ga0055529_1000178 | 3300003763 | Bacteria | 86969 |
| 51 | Ga0055529_1000180 | 3300003763 | Bacteria | 86768 |
| 52 | Ga0055529_1001704 | 3300003763 | Bacteria | 5644 |
| 53 | Ga0055524_1001508 | 3300003775 | Bacteria | 13200 |
| 54 | Ga0055524_1003884 | 3300003775 | Bacteria | 7085 |
| 55 | Ga0055524_1009055 | 3300003775 | Bacteria | 4083 |
| 56 | Ga0055528_1002495 | 3300003790 | Bacteria | 9820 |
| 57 | Ga0055530_10003173 | 3300003791 | Bacteria | 9652 |
| 58 | Ga0055531_10008726 | 3300003794 | Bacteria | 5294 |
| 59 | Ga0055531_10017067 | 3300003794 | Bacteria | 3088 |
| 60 | Ga0058692_1000057 | 3300003856 | Bacteria | 103718 |
| 61 | Ga0058692_1000132 | 3300003856 | Bacteria | 47060 |
| 62 | Ga0065165_1000467 | 3300005262 | Bacteria | 63318 |
| 63 | Ga0070658_10004201 | 3300005327 | Bacteria | 11791 |
| 64 | Ga0070658_10061587 | 3300005327 | Bacteria | 3057 |
| 65 | Ga0070658_10105986 | 3300005327 | Bacteria | 2325 |
| 66 | Ga0070658_10151588 | 3300005327 | Bacteria | 1941 |
| 67 | Ga0070658_10166573 | 3300005327 | Bacteria | 1850 |
| 68 | Ga0070676_10036864 | 3300005328 | Bacteria | 2818 |
| 69 | Ga0070676_10072911 | 3300005328 | Bacteria | 2065 |
| 70 | Ga0070683_100000275 | 3300005329 | Bacteria | 35321 |
| 71 | Ga0070683_100001898 | 3300005329 | Bacteria | 16342 |
| 72 | Ga0070683_100084656 | 3300005329 | Bacteria | 2971 |
| 73 | Ga0070683_100136036 | 3300005329 | Bacteria | 2327 |
| 74 | Ga0070670_100019420 | 3300005331 | Bacteria | 5831 |
| 75 | Ga0070670_100067971 | 3300005331 | Bacteria | 3058 |
| 76 | Ga0068869_100044412 | 3300005334 | Bacteria | 3195 |
| 77 | Ga0070666_10013441 | 3300005335 | Bacteria | 5195 |
| 78 | Ga0070666_10074322 | 3300005335 | Bacteria | 2316 |
| 79 | Ga0070680_100002253 | 3300005336 | Bacteria | 14249 |
| 80 | Ga0070680_100046178 | 3300005336 | Bacteria | 3542 |
| 81 | Ga0070682_100004503 | 3300005337 | Bacteria | 7739 |
| 82 | Ga0070682_100119464 | 3300005337 | Bacteria | 1767 |
| 83 | Ga0070682_100190654 | 3300005337 | Bacteria | 1439 |
| 84 | Ga0068868_100003303 | 3300005338 | Bacteria | 11220 |
| 85 | Ga0068868_100003327 | 3300005338 | Bacteria | 11183 |
| 86 | Ga0068868_100044533 | 3300005338 | Bacteria | 3469 |
| 87 | Ga0068868_100072725 | 3300005338 | Bacteria | 2744 |
| 88 | Ga0068868_100095338 | 3300005338 | Bacteria | 2402 |
| 89 | Ga0068868_100096109 | 3300005338 | Bacteria | 2392 |
| 90 | Ga0068868_100122122 | 3300005338 | Unclassified | 2125 |
| 91 | Ga0070660_100005604 | 3300005339 | Bacteria | 8704 |
| 92 | Ga0070689_100004517 | 3300005340 | Bacteria | 9424 |
| 93 | Ga0070687_100005004 | 3300005343 | Bacteria | 5338 |
| 94 | Ga0070687_100014478 | 3300005343 | Bacteria | 3543 |
| 95 | Ga0070661_100001245 | 3300005344 | Bacteria | 17894 |
| 96 | Ga0070661_100001901 | 3300005344 | Bacteria | 14468 |
| 97 | Ga0070661_100023882 | 3300005344 | Bacteria | 4386 |
| 98 | Ga0070661_100028281 | 3300005344 | Bacteria | 4043 |
| 99 | Ga0070661_100030036 | 3300005344 | Bacteria | 3924 |
| 100 | Ga0070661_100071961 | 3300005344 | Bacteria | 2544 |
| 101 | Ga0070661_100072200 | 3300005344 | Bacteria | 2540 |
| 102 | Ga0070661_100112220 | 3300005344 | Bacteria | 2037 |
| 103 | Ga0070692_10051524 | 3300005345 | Bacteria | 2141 |
| 104 | Ga0070692_10083109 | 3300005345 | Bacteria | 1728 |
| 105 | Ga0070668_100013552 | 3300005347 | Bacteria | 6086 |
| 106 | Ga0070668_100066247 | 3300005347 | Bacteria | 2802 |
| 107 | Ga0070668_100098480 | 3300005347 | Bacteria | 2314 |
| 108 | Ga0070675_100003560 | 3300005354 | Bacteria | 11832 |
| 109 | Ga0070671_100027144 | 3300005355 | Bacteria | 4710 |
| 110 | Ga0070671_100127003 | 3300005355 | Bacteria | 2147 |
| 111 | Ga0070674_100009025 | 3300005356 | Bacteria | 5959 |
| 112 | Ga0070673_100061624 | 3300005364 | Bacteria | 2977 |
| 113 | Ga0070673_100107618 | 3300005364 | Bacteria | 2306 |
| 114 | Ga0070673_100292227 | 3300005364 | Bacteria | 1432 |
| 115 | Ga0070688_100044144 | 3300005365 | Bacteria | 2750 |
| 116 | Ga0070688_100216166 | 3300005365 | Bacteria | 1349 |
| 117 | Ga0070659_100000616 | 3300005366 | Bacteria | 26101 |
| 118 | Ga0070659_100002561 | 3300005366 | Bacteria | 12924 |
| 119 | Ga0070659_100159088 | 3300005366 | Bacteria | 1846 |
| 120 | Ga0070667_100004934 | 3300005367 | Bacteria | 11178 |
| 121 | Ga0070667_100038666 | 3300005367 | Bacteria | 4000 |
| 122 | Ga0070667_100052544 | 3300005367 | Bacteria | 3439 |
| 123 | Ga0070709_10000557 | 3300005434 | Bacteria | 21754 |
| 124 | Ga0070709_10030365 | 3300005434 | Bacteria | 3242 |
| 125 | Ga0070709_10035829 | 3300005434 | Bacteria | 3018 |
| 126 | Ga0070714_100000105 | 3300005435 | Bacteria | 70871 |
| 127 | Ga0070714_100021111 | 3300005435 | Bacteria | 5323 |
| 128 | Ga0070714_100080502 | 3300005435 | Bacteria | 2835 |
| 129 | Ga0070714_100082101 | 3300005435 | Bacteria | 2807 |
| 130 | Ga0070714_100099299 | 3300005435 | Bacteria | 2562 |
| 131 | Ga0070714_100128636 | 3300005435 | Bacteria | 2261 |
| 132 | Ga0070714_100344679 | 3300005435 | Bacteria | 1398 |
| 133 | Ga0070713_100000356 | 3300005436 | Bacteria | 29619 |
| 134 | Ga0070713_100000549 | 3300005436 | Bacteria | 23887 |
| 135 | Ga0070713_100021474 | 3300005436 | Bacteria | 4968 |
| 136 | Ga0070713_100066954 | 3300005436 | Bacteria | 3022 |
| 137 | Ga0070713_100067877 | 3300005436 | Bacteria | 3004 |
| 138 | Ga0070713_100180684 | 3300005436 | Bacteria | 1896 |
| 139 | Ga0070713_100294797 | 3300005436 | Bacteria | 1492 |
| 140 | Ga0070710_10020273 | 3300005437 | Bacteria | 3447 |
| 141 | Ga0070701_10007723 | 3300005438 | Bacteria | 4613 |
| 142 | Ga0070711_100000076 | 3300005439 | Bacteria | 55974 |
| 143 | Ga0070711_100000748 | 3300005439 | Bacteria | 16979 |
| 144 | Ga0070711_100102636 | 3300005439 | Bacteria | 2083 |
| 145 | Ga0070711_100109796 | 3300005439 | Bacteria | 2023 |
| 146 | Ga0070705_100022083 | 3300005440 | Bacteria | 3395 |
| 147 | Ga0070700_100028371 | 3300005441 | Bacteria | 3329 |
| 148 | Ga0070708_100001268 | 3300005445 | Bacteria | 19429 |
| 149 | Ga0070708_100006458 | 3300005445 | Bacteria | 9334 |
| 150 | Ga0070708_100006920 | 3300005445 | Bacteria | 9048 |
| 151 | Ga0070708_100013815 | 3300005445 | Bacteria | 6628 |
| 152 | Ga0070708_100020690 | 3300005445 | Bacteria | 5554 |
| 153 | Ga0070708_100051404 | 3300005445 | Bacteria | 3652 |
| 154 | Ga0070708_100176368 | 3300005445 | Bacteria | 1997 |
| 155 | Ga0070663_100000239 | 3300005455 | Bacteria | 27754 |
| 156 | Ga0070663_100009995 | 3300005455 | Bacteria | 5898 |
| 157 | Ga0070663_100069776 | 3300005455 | Bacteria | 2554 |
| 158 | Ga0070678_100001110 | 3300005456 | Bacteria | 14117 |
| 159 | Ga0070678_100147534 | 3300005456 | Bacteria | 1891 |
| 160 | Ga0070662_100031446 | 3300005457 | Bacteria | 3725 |
| 161 | Ga0070662_100040135 | 3300005457 | Bacteria | 3331 |
| 162 | Ga0070662_100067386 | 3300005457 | Bacteria | 2628 |
| 163 | Ga0070662_100083140 | 3300005457 | Bacteria | 2389 |
| 164 | Ga0070662_100121216 | 3300005457 | Bacteria | 2005 |
| 165 | Ga0070681_10210686 | 3300005458 | Bacteria | 1859 |
| 166 | Ga0070681_10229815 | 3300005458 | Bacteria | 1769 |
| 167 | Ga0070681_10279457 | 3300005458 | Bacteria | 1580 |
| 168 | Ga0068867_100021675 | 3300005459 | Bacteria | 4585 |
| 169 | Ga0068867_100221631 | 3300005459 | Bacteria | 1525 |
| 170 | Ga0070685_10004572 | 3300005466 | Bacteria | 7002 |
| 171 | Ga0070685_10040297 | 3300005466 | Bacteria | 2657 |
| 172 | Ga0070685_10158714 | 3300005466 | Bacteria | 1440 |
| 173 | Ga0070706_100000734 | 3300005467 | Bacteria | 37002 |
| 174 | Ga0070706_100017793 | 3300005467 | Bacteria | 6557 |
| 175 | Ga0070706_100018523 | 3300005467 | Bacteria | 6419 |
| 176 | Ga0070707_100000413 | 3300005468 | Bacteria | 42232 |
| 177 | Ga0070707_100003538 | 3300005468 | Bacteria | 14745 |
| 178 | Ga0070707_100013149 | 3300005468 | Bacteria | 7737 |
| 179 | Ga0070707_100027854 | 3300005468 | Bacteria | 5375 |
| 180 | Ga0070707_100269823 | 3300005468 | Bacteria | 1654 |
| 181 | Ga0070698_100000248 | 3300005471 | Bacteria | 54156 |
| 182 | Ga0070698_100001737 | 3300005471 | Bacteria | 24310 |
| 183 | Ga0070698_100006040 | 3300005471 | Bacteria | 13191 |
| 184 | Ga0070698_100012185 | 3300005471 | Bacteria | 9109 |
| 185 | Ga0070698_100085202 | 3300005471 | Bacteria | 3147 |
| 186 | Ga0070699_100007857 | 3300005518 | Bacteria | 9266 |
| 187 | Ga0070699_100018091 | 3300005518 | Bacteria | 6054 |
| 188 | Ga0070699_100018272 | 3300005518 | Bacteria | 6024 |
| 189 | Ga0070699_100027765 | 3300005518 | Bacteria | 4880 |
| 190 | Ga0070699_100081200 | 3300005518 | Bacteria | 2826 |
| 191 | Ga0070699_100111989 | 3300005518 | Bacteria | 2397 |
| 192 | Ga0070679_100018632 | 3300005530 | Bacteria | 6739 |
| 193 | Ga0070679_100019567 | 3300005530 | Bacteria | 6587 |
| 194 | Ga0070679_100026759 | 3300005530 | Bacteria | 5672 |
| 195 | Ga0070679_100074982 | 3300005530 | Bacteria | 3373 |
| 196 | Ga0070684_100000405 | 3300005535 | Bacteria | 29563 |
| 197 | Ga0070684_100006472 | 3300005535 | Bacteria | 9068 |
| 198 | Ga0070684_100012793 | 3300005535 | Bacteria | 6740 |
| 199 | Ga0070684_100033053 | 3300005535 | Bacteria | 4414 |
| 200 | Ga0070684_100050810 | 3300005535 | Bacteria | 3602 |
| 201 | Ga0070684_100100070 | 3300005535 | Bacteria | 2588 |
| 202 | Ga0070684_100157143 | 3300005535 | Bacteria | 2062 |
| 203 | Ga0070684_100251757 | 3300005535 | Bacteria | 1614 |
| 204 | Ga0070697_100001144 | 3300005536 | Bacteria | 20086 |
| 205 | Ga0070697_100002694 | 3300005536 | Bacteria | 13677 |
| 206 | Ga0070697_100005485 | 3300005536 | Bacteria | 9779 |
| 207 | Ga0070697_100087831 | 3300005536 | Bacteria | 2567 |
| 208 | Ga0068853_100001476 | 3300005539 | Bacteria | 17089 |
| 209 | Ga0068853_100002548 | 3300005539 | Bacteria | 13688 |
| 210 | Ga0068853_100072301 | 3300005539 | Bacteria | 3005 |
| 211 | Ga0068853_100074953 | 3300005539 | Bacteria | 2953 |
| 212 | Ga0068853_100226202 | 3300005539 | Bacteria | 1710 |
| 213 | Ga0068853_100242280 | 3300005539 | Bacteria | 1653 |
| 214 | Ga0068853_100280943 | 3300005539 | Bacteria | 1535 |
| 215 | Ga0070672_100026923 | 3300005543 | Bacteria | 4285 |
| 216 | Ga0070672_100150028 | 3300005543 | Bacteria | 1928 |
| 217 | Ga0070695_100007045 | 3300005545 | Bacteria | 6664 |
| 218 | Ga0070696_100082027 | 3300005546 | Bacteria | 2285 |
| 219 | Ga0070696_100177374 | 3300005546 | Bacteria | 1579 |
| 220 | Ga0070693_100008654 | 3300005547 | Bacteria | 5034 |
| 221 | Ga0070693_100109228 | 3300005547 | Bacteria | 1698 |
| 222 | Ga0070665_100000103 | 3300005548 | Bacteria | 158183 |
| 223 | Ga0070665_100000825 | 3300005548 | Bacteria | 40466 |
| 224 | Ga0070665_100041330 | 3300005548 | Bacteria | 4634 |
| 225 | Ga0070665_100065912 | 3300005548 | Bacteria | 3632 |
| 226 | Ga0070665_100091514 | 3300005548 | Bacteria | 3046 |
| 227 | Ga0070665_100134937 | 3300005548 | Bacteria | 2470 |
| 228 | Ga0068855_100000868 | 3300005563 | Bacteria | 37566 |
| 229 | Ga0068855_100005556 | 3300005563 | Bacteria | 15387 |
| 230 | Ga0068855_100010348 | 3300005563 | Bacteria | 11250 |
| 231 | Ga0068855_100019075 | 3300005563 | Bacteria | 8244 |
| 232 | Ga0068855_100030920 | 3300005563 | Bacteria | 6399 |
| 233 | Ga0068855_100062420 | 3300005563 | Bacteria | 4350 |
| 234 | Ga0068855_100093628 | 3300005563 | Bacteria | 3465 |
| 235 | Ga0068855_100195266 | 3300005563 | Bacteria | 2280 |
| 236 | Ga0070664_100000851 | 3300005564 | Bacteria | 23587 |
| 237 | Ga0070664_100030695 | 3300005564 | Bacteria | 4485 |
| 238 | Ga0070664_100075070 | 3300005564 | Bacteria | 2903 |
| 239 | Ga0070664_100111465 | 3300005564 | Bacteria | 2388 |
| 240 | Ga0070664_100127493 | 3300005564 | Bacteria | 2233 |
| 241 | Ga0068857_100002858 | 3300005577 | Bacteria | 14192 |
| 242 | Ga0068857_100064519 | 3300005577 | Bacteria | 3256 |
| 243 | Ga0068857_100280722 | 3300005577 | Bacteria | 1532 |
| 244 | Ga0068854_100044049 | 3300005578 | Bacteria | 3166 |
| 245 | Ga0068854_100065188 | 3300005578 | Bacteria | 2648 |
| 246 | Ga0068854_100155876 | 3300005578 | Bacteria | 1765 |
| 247 | Ga0068856_100000126 | 3300005614 | Bacteria | 76992 |
| 248 | Ga0068856_100005005 | 3300005614 | Bacteria | 13120 |
| 249 | Ga0068856_100012012 | 3300005614 | Bacteria | 8390 |
| 250 | Ga0068856_100041636 | 3300005614 | Bacteria | 4515 |
| 251 | Ga0068856_100066830 | 3300005614 | Bacteria | 3552 |
| 252 | Ga0068856_100087828 | 3300005614 | Bacteria | 3091 |
| 253 | Ga0068856_100120911 | 3300005614 | Bacteria | 2620 |
| 254 | Ga0068856_100143334 | 3300005614 | Bacteria | 2397 |
| 255 | Ga0068856_100455963 | 3300005614 | Bacteria | 1299 |
| 256 | Ga0070702_100003690 | 3300005615 | Bacteria | 6896 |
| 257 | Ga0070702_100073284 | 3300005615 | Bacteria | 2028 |
| 258 | Ga0068852_100000003 | 3300005616 | Bacteria | 246525 |
| 259 | Ga0068852_100000237 | 3300005616 | Bacteria | 37279 |
| 260 | Ga0068852_100001633 | 3300005616 | Bacteria | 15303 |
| 261 | Ga0068852_100025876 | 3300005616 | Bacteria | 4762 |
| 262 | Ga0068852_100056069 | 3300005616 | Bacteria | 3403 |
| 263 | Ga0068852_100077603 | 3300005616 | Bacteria | 2937 |
| 264 | Ga0068852_100082911 | 3300005616 | Bacteria | 2850 |
| 265 | Ga0068852_100267214 | 3300005616 | Bacteria | 1645 |
| 266 | Ga0068859_100011245 | 3300005617 | Bacteria | 9004 |
| 267 | Ga0068859_100012187 | 3300005617 | Bacteria | 8642 |
| 268 | Ga0068859_100014257 | 3300005617 | Bacteria | 7972 |
| 269 | Ga0068859_100040023 | 3300005617 | Bacteria | 4704 |
| 270 | Ga0068864_100009954 | 3300005618 | Bacteria | 7844 |
| 271 | Ga0068864_100031296 | 3300005618 | Bacteria | 4514 |
| 272 | Ga0068864_100049096 | 3300005618 | Bacteria | 3630 |
| 273 | Ga0068864_100130362 | 3300005618 | Bacteria | 2258 |
| 274 | Ga0068864_100143818 | 3300005618 | Bacteria | 2153 |
| 275 | Ga0068864_100329303 | 3300005618 | Bacteria | 1436 |
| 276 | Ga0068866_10000993 | 3300005718 | Bacteria | 12483 |
| 277 | Ga0068866_10058585 | 3300005718 | Bacteria | 1990 |
| 278 | Ga0068861_100229929 | 3300005719 | Bacteria | 1572 |
| 279 | Ga0068851_10003726 | 3300005834 | Bacteria | 6809 |
| 280 | Ga0068851_10013138 | 3300005834 | Bacteria | 3917 |
| 281 | Ga0068851_10053531 | 3300005834 | Bacteria | 2055 |
| 282 | Ga0068863_100005651 | 3300005841 | Bacteria | 12278 |
| 283 | Ga0068863_100012434 | 3300005841 | Bacteria | 8219 |
| 284 | Ga0068863_100028481 | 3300005841 | Bacteria | 5334 |
| 285 | Ga0068863_100047432 | 3300005841 | Bacteria | 4074 |
| 286 | Ga0068863_100054479 | 3300005841 | Bacteria | 3789 |
| 287 | Ga0068858_100001642 | 3300005842 | Bacteria | 22826 |
| 288 | Ga0068858_100064877 | 3300005842 | Unclassified | 3380 |
| 289 | Ga0068858_100080393 | 3300005842 | Bacteria | 3029 |
| 290 | Ga0068860_100008263 | 3300005843 | Bacteria | 10357 |
| 291 | Ga0068860_100016166 | 3300005843 | Bacteria | 7281 |
| 292 | Ga0068860_100051626 | 3300005843 | Bacteria | 3912 |
| 293 | Ga0068860_100156811 | 3300005843 | Bacteria | 2194 |
| 294 | Ga0068862_100017808 | 3300005844 | Bacteria | 5914 |
| 295 | Ga0068862_100053408 | 3300005844 | Bacteria | 3459 |
| 296 | Ga0068862_100064827 | 3300005844 | Bacteria | 3145 |
| 297 | Ga0081540_1003699 | 3300005983 | Bacteria | 11981 |
| 298 | Ga0081540_1037990 | 3300005983 | Bacteria | 2544 |
| 299 | Ga0081539_10000031 | 3300005985 | Bacteria | 313232 |
| 300 | Ga0081539_10000079 | 3300005985 | Bacteria | 223413 |
| 301 | Ga0070717_10004304 | 3300006028 | Bacteria | 10267 |
| 302 | Ga0070717_10007200 | 3300006028 | Bacteria | 8250 |
| 303 | Ga0070717_10010666 | 3300006028 | Bacteria | 6947 |
| 304 | Ga0070717_10015059 | 3300006028 | Bacteria | 5962 |
| 305 | Ga0070717_10024271 | 3300006028 | Bacteria | 4812 |
| 306 | Ga0070717_10025475 | 3300006028 | Bacteria | 4705 |
| 307 | Ga0070717_10079571 | 3300006028 | Bacteria | 2748 |
| 308 | Ga0070717_10096801 | 3300006028 | Bacteria | 2500 |
| 309 | Ga0070717_10109622 | 3300006028 | Bacteria | 2353 |
| 310 | Ga0070717_10153011 | 3300006028 | Bacteria | 1997 |
| 311 | Ga0075365_10000133 | 3300006038 | Bacteria | 22901 |
| 312 | Ga0075365_10024577 | 3300006038 | Bacteria | 3802 |
| 313 | Ga0075368_10042757 | 3300006042 | Bacteria | 1784 |
| 314 | Ga0075363_100001292 | 3300006048 | Bacteria | 9335 |
| 315 | Ga0075363_100084347 | 3300006048 | Bacteria | 1742 |
| 316 | Ga0075364_10000593 | 3300006051 | Bacteria | 18717 |
| 317 | Ga0075364_10007258 | 3300006051 | Bacteria | 6571 |
| 318 | Ga0075364_10021227 | 3300006051 | Bacteria | 4092 |
| 319 | Ga0075364_10024525 | 3300006051 | Bacteria | 3831 |
| 320 | Ga0075432_10035020 | 3300006058 | Bacteria | 1745 |
| 321 | Ga0070715_10089156 | 3300006163 | Bacteria | 1415 |
| 322 | Ga0070716_100017291 | 3300006173 | Bacteria | 3735 |
| 323 | Ga0070716_100023216 | 3300006173 | Bacteria | 3286 |
| 324 | Ga0070716_100023965 | 3300006173 | Bacteria | 3244 |
| 325 | Ga0070716_100050277 | 3300006173 | Bacteria | 2365 |
| 326 | Ga0070716_100088719 | 3300006173 | Bacteria | 1866 |
| 327 | Ga0070712_100000632 | 3300006175 | Bacteria | 20699 |
| 328 | Ga0070712_100003929 | 3300006175 | Bacteria | 9153 |
| 329 | Ga0070712_100008366 | 3300006175 | Bacteria | 6506 |
| 330 | Ga0070712_100017208 | 3300006175 | Bacteria | 4677 |
| 331 | Ga0070712_100018767 | 3300006175 | Bacteria | 4498 |
| 332 | Ga0070712_100026889 | 3300006175 | Bacteria | 3838 |
| 333 | Ga0075367_10005671 | 3300006178 | Bacteria | 6231 |
| 334 | Ga0075367_10063867 | 3300006178 | Bacteria | 2202 |
| 335 | Ga0075367_10096947 | 3300006178 | Bacteria | 1799 |
| 336 | Ga0075369_10000067 | 3300006186 | Bacteria | 27323 |
| 337 | Ga0075427_10000482 | 3300006194 | Bacteria | 4568 |
| 338 | Ga0075366_10000087 | 3300006195 | Bacteria | 36461 |
| 339 | Ga0075366_10025645 | 3300006195 | Bacteria | 3446 |
| 340 | Ga0075366_10036851 | 3300006195 | Bacteria | 2884 |
| 341 | Ga0075366_10046042 | 3300006195 | Bacteria | 2585 |
| 342 | Ga0097621_100008726 | 3300006237 | Bacteria | 7322 |
| 343 | Ga0097621_100010928 | 3300006237 | Bacteria | 6665 |
| 344 | Ga0097621_100022246 | 3300006237 | Bacteria | 4920 |
| 345 | Ga0097621_100023994 | 3300006237 | Bacteria | 4756 |
| 346 | Ga0075370_10000557 | 3300006353 | Bacteria | 14265 |
| 347 | Ga0075370_10006492 | 3300006353 | Bacteria | 5887 |
| 348 | Ga0075370_10013135 | 3300006353 | Bacteria | 4395 |
| 349 | Ga0075370_10092150 | 3300006353 | Bacteria | 1749 |
| 350 | Ga0068871_100016398 | 3300006358 | Bacteria | 5578 |
| 351 | Ga0068871_100027403 | 3300006358 | Bacteria | 4456 |
| 352 | Ga0068871_100036508 | 3300006358 | Bacteria | 3913 |
| 353 | Ga0068871_100120413 | 3300006358 | Bacteria | 2216 |
| 354 | Ga0068871_100144365 | 3300006358 | Bacteria | 2025 |
| 355 | Ga0075428_100017262 | 3300006844 | Bacteria | 7976 |
| 356 | Ga0075428_100111708 | 3300006844 | Unclassified | 2977 |
| 357 | Ga0075428_100158386 | 3300006844 | Bacteria | 2458 |
| 358 | Ga0075428_100214621 | 3300006844 | Bacteria | 2079 |
| 359 | Ga0075430_100003620 | 3300006846 | Bacteria | 12959 |
| 360 | Ga0075431_100097896 | 3300006847 | Bacteria | 3029 |
| 361 | Ga0075431_100162048 | 3300006847 | Bacteria | 2299 |
| 362 | Ga0075433_10065304 | 3300006852 | Bacteria | 3192 |
| 363 | Ga0075434_100003909 | 3300006871 | Bacteria | 13339 |
| 364 | Ga0075434_100004099 | 3300006871 | Bacteria | 13069 |
| 365 | Ga0075434_100046012 | 3300006871 | Unclassified | 4330 |
| 366 | Ga0075434_100097336 | 3300006871 | Bacteria | 2947 |
| 367 | Ga0075434_100100156 | 3300006871 | Bacteria | 2904 |
| 368 | Ga0075429_100002757 | 3300006880 | Eukaryota | 14853 |
| 369 | Ga0075429_100196148 | 3300006880 | Bacteria | 1769 |
| 370 | Ga0068865_100011355 | 3300006881 | Bacteria | 5571 |
| 371 | Ga0068865_100035946 | 3300006881 | Bacteria | 3335 |
| 372 | Ga0075436_100000291 | 3300006914 | Bacteria | 31895 |
| 373 | Ga0075436_100001688 | 3300006914 | Bacteria | 15097 |
| 374 | Ga0075436_100002329 | 3300006914 | Bacteria | 13102 |
| 375 | Ga0075436_100030559 | 3300006914 | Bacteria | 3708 |
| 376 | Ga0097620_100011246 | 3300006931 | Bacteria | 9004 |
| 377 | Ga0097620_100012188 | 3300006931 | Bacteria | 8642 |
| 378 | Ga0097620_100014257 | 3300006931 | Bacteria | 7972 |
| 379 | Ga0097620_100040020 | 3300006931 | Bacteria | 4704 |
| 380 | Ga0075435_100004630 | 3300007076 | Bacteria | 9472 |
| 381 | Ga0075435_100005310 | 3300007076 | Bacteria | 8975 |
| 382 | Ga0075435_100084219 | 3300007076 | Bacteria | 2616 |
| 383 | Ga0075435_100096730 | 3300007076 | Bacteria | 2442 |
| 384 | Ga0105251_10000051 | 3300009011 | Bacteria | 106703 |
| 385 | Ga0105251_10004145 | 3300009011 | Bacteria | 10100 |
| 386 | Ga0105251_10034101 | 3300009011 | Bacteria | 2522 |
| 387 | Ga0105244_10009335 | 3300009036 | Bacteria | 6039 |
| 388 | Ga0105244_10048534 | 3300009036 | Bacteria | 2172 |
| 389 | Ga0105250_10014976 | 3300009092 | Bacteria | 3180 |
| 390 | Ga0105250_10016346 | 3300009092 | Bacteria | 3025 |
| 391 | Ga0105240_10000001 | 3300009093 | Bacteria | 2887840 |
| 392 | Ga0105240_10000286 | 3300009093 | Bacteria | 98493 |
| 393 | Ga0105240_10001411 | 3300009093 | Bacteria | 41214 |
| 394 | Ga0105240_10003378 | 3300009093 | Bacteria | 24818 |
| 395 | Ga0105240_10004021 | 3300009093 | Bacteria | 22639 |
| 396 | Ga0105240_10007046 | 3300009093 | Bacteria | 16398 |
| 397 | Ga0105240_10015022 | 3300009093 | Bacteria | 10542 |
| 398 | Ga0105240_10015320 | 3300009093 | Bacteria | 10429 |
| 399 | Ga0105240_10015705 | 3300009093 | Bacteria | 10275 |
| 400 | Ga0105240_10025825 | 3300009093 | Bacteria | 7713 |
| 401 | Ga0105240_10027729 | 3300009093 | Bacteria | 7412 |
| 402 | Ga0105240_10031904 | 3300009093 | Bacteria | 6826 |
| 403 | Ga0105240_10067352 | 3300009093 | Bacteria | 4438 |
| 404 | Ga0105240_10183000 | 3300009093 | Bacteria | 2471 |
| 405 | Ga0111539_10000854 | 3300009094 | Bacteria | 39754 |
| 406 | Ga0111539_10000878 | 3300009094 | Bacteria | 39274 |
| 407 | Ga0111539_10034480 | 3300009094 | Bacteria | 6136 |
| 408 | Ga0111539_10061528 | 3300009094 | Bacteria | 4448 |
| 409 | Ga0105245_10002844 | 3300009098 | Bacteria | 15567 |
| 410 | Ga0105245_10011797 | 3300009098 | Bacteria | 7602 |
| 411 | Ga0105245_10014417 | 3300009098 | Bacteria | 6887 |
| 412 | Ga0105245_10038776 | 3300009098 | Bacteria | 4239 |
| 413 | Ga0105245_10039668 | 3300009098 | Bacteria | 4191 |
| 414 | Ga0105245_10086945 | 3300009098 | Bacteria | 2868 |
| 415 | Ga0105245_10175338 | 3300009098 | Bacteria | 2044 |
| 416 | Ga0105245_10257035 | 3300009098 | Bacteria | 1699 |
| 417 | Ga0105245_10302970 | 3300009098 | Bacteria | 1569 |
| 418 | Ga0105247_10006209 | 3300009101 | Bacteria | 7412 |
| 419 | Ga0105247_10059580 | 3300009101 | Bacteria | 2364 |
| 420 | Ga0114129_10005760 | 3300009147 | Bacteria | 17559 |
| 421 | Ga0114129_10019020 | 3300009147 | Bacteria | 9785 |
| 422 | Ga0114129_10081560 | 3300009147 | Bacteria | 4496 |
| 423 | Ga0114129_10104916 | 3300009147 | Bacteria | 3906 |
| 424 | Ga0105243_10002826 | 3300009148 | Bacteria | 14404 |
| 425 | Ga0105243_10186343 | 3300009148 | Bacteria | 1809 |
| 426 | Ga0105241_10000563 | 3300009174 | Bacteria | 28046 |
| 427 | Ga0105241_10002309 | 3300009174 | Bacteria | 14324 |
| 428 | Ga0105241_10004298 | 3300009174 | Bacteria | 10533 |
| 429 | Ga0105241_10021149 | 3300009174 | Bacteria | 4810 |
| 430 | Ga0105241_10033758 | 3300009174 | Bacteria | 3842 |
| 431 | Ga0105241_10079366 | 3300009174 | Bacteria | 2566 |
| 432 | Ga0105241_10120649 | 3300009174 | Bacteria | 2111 |
| 433 | Ga0105241_10136973 | 3300009174 | Bacteria | 1989 |
| 434 | Ga0105241_10150242 | 3300009174 | Bacteria | 1905 |
| 435 | Ga0105248_10009529 | 3300009177 | Bacteria | 10688 |
| 436 | Ga0105248_10023333 | 3300009177 | Bacteria | 6872 |
| 437 | Ga0105248_10028195 | 3300009177 | Bacteria | 6253 |
| 438 | Ga0105248_10028494 | 3300009177 | Bacteria | 6222 |
| 439 | Ga0105248_10065636 | 3300009177 | Bacteria | 4075 |
| 440 | Ga0105248_10203841 | 3300009177 | Bacteria | 2229 |
| 441 | Ga0105248_10207220 | 3300009177 | Bacteria | 2209 |
| 442 | Ga0105248_10256544 | 3300009177 | Bacteria | 1968 |
| 443 | Ga0105248_10314298 | 3300009177 | Bacteria | 1764 |
| 444 | Ga0105248_10330164 | 3300009177 | Bacteria | 1718 |
| 445 | Ga0105237_10001230 | 3300009545 | Bacteria | 34130 |
| 446 | Ga0105237_10002902 | 3300009545 | Bacteria | 20789 |
| 447 | Ga0105237_10006587 | 3300009545 | Bacteria | 12844 |
| 448 | Ga0105237_10007501 | 3300009545 | Bacteria | 11928 |
| 449 | Ga0105237_10010797 | 3300009545 | Bacteria | 9694 |
| 450 | Ga0105237_10010990 | 3300009545 | Bacteria | 9607 |
| 451 | Ga0105237_10065209 | 3300009545 | Bacteria | 3638 |
| 452 | Ga0105237_10065477 | 3300009545 | Bacteria | 3630 |
| 453 | Ga0105237_10127457 | 3300009545 | Unclassified | 2539 |
| 454 | Ga0105237_10192586 | 3300009545 | Bacteria | 2039 |
| 455 | Ga0105238_10000080 | 3300009551 | Bacteria | 109312 |
| 456 | Ga0105238_10001792 | 3300009551 | Bacteria | 21495 |
| 457 | Ga0105238_10003385 | 3300009551 | Bacteria | 15919 |
| 458 | Ga0105238_10007159 | 3300009551 | Bacteria | 11160 |
| 459 | Ga0105238_10022308 | 3300009551 | Bacteria | 6454 |
| 460 | Ga0105238_10058249 | 3300009551 | Bacteria | 3872 |
| 461 | Ga0105238_10067567 | 3300009551 | Bacteria | 3575 |
| 462 | Ga0105238_10070391 | 3300009551 | Bacteria | 3497 |
| 463 | Ga0105238_10071450 | 3300009551 | Bacteria | 3468 |
| 464 | Ga0105249_10026811 | 3300009553 | Bacteria | 5196 |
| 465 | Ga0105249_10043456 | 3300009553 | Bacteria | 4086 |
| 466 | Ga0105239_10001359 | 3300010375 | Bacteria | 32870 |
| 467 | Ga0105239_10003216 | 3300010375 | Bacteria | 20200 |
| 468 | Ga0105239_10005564 | 3300010375 | Bacteria | 14734 |
| 469 | Ga0105239_10027050 | 3300010375 | Bacteria | 6315 |
| 470 | Ga0105239_10039626 | 3300010375 | Bacteria | 5161 |
| 471 | Ga0105239_10051501 | 3300010375 | Bacteria | 4513 |
| 472 | Ga0105239_10052377 | 3300010375 | Bacteria | 4476 |
| 473 | Ga0105246_10008397 | 3300011119 | Bacteria | 6346 |
| 474 | Ga0105246_10011161 | 3300011119 | Bacteria | 5568 |
| 475 | Ga0157373_10002130 | 3300013100 | Bacteria | 14997 |
| 476 | Ga0157373_10009837 | 3300013100 | Bacteria | 7050 |
| 477 | Ga0157373_10027853 | 3300013100 | Bacteria | 4076 |
| 478 | Ga0157373_10145423 | 3300013100 | Bacteria | 1667 |
| 479 | Ga0157371_10057173 | 3300013102 | Bacteria | 2766 |
| 480 | Ga0157371_10082311 | 3300013102 | Bacteria | 2279 |
| 481 | Ga0157371_10168899 | 3300013102 | Bacteria | 1563 |
| 482 | Ga0157370_10000001 | 3300013104 | Bacteria | 529517 |
| 483 | Ga0157370_10004782 | 3300013104 | Bacteria | 15404 |
| 484 | Ga0157370_10006293 | 3300013104 | Bacteria | 13128 |
| 485 | Ga0157370_10043205 | 3300013104 | Bacteria | 4338 |
| 486 | Ga0157370_10128139 | 3300013104 | Bacteria | 2368 |
| 487 | Ga0157370_10136820 | 3300013104 | Bacteria | 2283 |
| 488 | Ga0157369_10000092 | 3300013105 | Bacteria | 123849 |
| 489 | Ga0157369_10000519 | 3300013105 | Bacteria | 50731 |
| 490 | Ga0157369_10003681 | 3300013105 | Bacteria | 18215 |
| 491 | Ga0157369_10005372 | 3300013105 | Bacteria | 14914 |
| 492 | Ga0157369_10010713 | 3300013105 | Bacteria | 10433 |
| 493 | Ga0157369_10011788 | 3300013105 | Bacteria | 9926 |
| 494 | Ga0157369_10013984 | 3300013105 | Bacteria | 9070 |
| 495 | Ga0157369_10015212 | 3300013105 | Bacteria | 8684 |
| 496 | Ga0157369_10018114 | 3300013105 | Bacteria | 7899 |
| 497 | Ga0157369_10045051 | 3300013105 | Bacteria | 4799 |
| 498 | Ga0157369_10055998 | 3300013105 | Bacteria | 4255 |
| 499 | Ga0157369_10114365 | 3300013105 | Bacteria | 2866 |
| 500 | Ga0157369_10227467 | 3300013105 | Bacteria | 1951 |
| 501 | Ga0157369_10427930 | 3300013105 | Bacteria | 1372 |
| 502 | Ga0157374_10000439 | 3300013296 | Bacteria | 37672 |
| 503 | Ga0157374_10003799 | 3300013296 | Bacteria | 12700 |
| 504 | Ga0157374_10062127 | 3300013296 | Bacteria | 3500 |
| 505 | Ga0157374_10073313 | 3300013296 | Bacteria | 3232 |
| 506 | Ga0157374_10087149 | 3300013296 | Bacteria | 2971 |
| 507 | Ga0157378_10004302 | 3300013297 | Bacteria | 12541 |
| 508 | Ga0157378_10005921 | 3300013297 | Bacteria | 10712 |
| 509 | Ga0157378_10044531 | 3300013297 | Bacteria | 3941 |
| 510 | Ga0157378_10080010 | 3300013297 | Bacteria | 2951 |
| 511 | Ga0157378_10116417 | 3300013297 | Bacteria | 2458 |
| 512 | Ga0157378_10317096 | 3300013297 | Bacteria | 1513 |
| 513 | Ga0157378_10348290 | 3300013297 | Bacteria | 1446 |
| 514 | Ga0163162_10032162 | 3300013306 | Bacteria | 5208 |
| 515 | Ga0163162_10082054 | 3300013306 | Bacteria | 3296 |
| 516 | Ga0163162_10158227 | 3300013306 | Bacteria | 2386 |
| 517 | Ga0163162_10261846 | 3300013306 | Bacteria | 1861 |
| 518 | Ga0157372_10000045 | 3300013307 | Bacteria | 151277 |
| 519 | Ga0157372_10000864 | 3300013307 | Bacteria | 32870 |
| 520 | Ga0157372_10001006 | 3300013307 | Bacteria | 30802 |
| 521 | Ga0157372_10009411 | 3300013307 | Bacteria | 10393 |
| 522 | Ga0157372_10021878 | 3300013307 | Bacteria | 6912 |
| 523 | Ga0157372_10042140 | 3300013307 | Bacteria | 5047 |
| 524 | Ga0157372_10045596 | 3300013307 | Bacteria | 4864 |
| 525 | Ga0157372_10051287 | 3300013307 | Bacteria | 4591 |
| 526 | Ga0157372_10081468 | 3300013307 | Bacteria | 3663 |
| 527 | Ga0157372_10083616 | 3300013307 | Bacteria | 3616 |
| 528 | Ga0157372_10117417 | 3300013307 | Bacteria | 3051 |
| 529 | Ga0157372_10248934 | 3300013307 | Bacteria | 2062 |
| 530 | Ga0157372_10484059 | 3300013307 | Bacteria | 1443 |
| 531 | Ga0157375_10002505 | 3300013308 | Bacteria | 15923 |
| 532 | Ga0157375_10009579 | 3300013308 | Bacteria | 8506 |
| 533 | Ga0157375_10016019 | 3300013308 | Bacteria | 6724 |
| 534 | Ga0157375_10167618 | 3300013308 | Bacteria | 2342 |
| 535 | Ga0157375_10187043 | 3300013308 | Bacteria | 2225 |
| 536 | Ga0157375_10224189 | 3300013308 | Unclassified | 2039 |
| 537 | Ga0157375_10291909 | 3300013308 | Bacteria | 1794 |
| 538 | Ga0163163_10000570 | 3300014325 | Bacteria | 32431 |
| 539 | Ga0163163_10008588 | 3300014325 | Bacteria | 9083 |
| 540 | Ga0157380_10234793 | 3300014326 | Bacteria | 1649 |
| 541 | Ga0182008_10022232 | 3300014497 | Bacteria | 3248 |
| 542 | Ga0182008_10030257 | 3300014497 | Bacteria | 2730 |
| 543 | Ga0157377_10006455 | 3300014745 | Bacteria | 5598 |
| 544 | Ga0157377_10112824 | 3300014745 | Bacteria | 1636 |
| 545 | Ga0157379_10029199 | 3300014968 | Bacteria | 4904 |
| 546 | Ga0157379_10042303 | 3300014968 | Bacteria | 4067 |
| 547 | Ga0157379_10043559 | 3300014968 | Bacteria | 4007 |
| 548 | Ga0157379_10079649 | 3300014968 | Bacteria | 2934 |
| 549 | Ga0157379_10125016 | 3300014968 | Bacteria | 2314 |
| 550 | Ga0157379_10166291 | 3300014968 | Bacteria | 1991 |
| 551 | Ga0157379_10178569 | 3300014968 | Bacteria | 1918 |
| 552 | Ga0157376_10000074 | 3300014969 | Bacteria | 75822 |
| 553 | Ga0157376_10002444 | 3300014969 | Bacteria | 12557 |
| 554 | Ga0157376_10017251 | 3300014969 | Bacteria | 5500 |
| 555 | Ga0182006_1015431 | 3300015261 | Bacteria | 3274 |
| 556 | Ga0182007_10000134 | 3300015262 | Bacteria | 52119 |
| 557 | Ga0182007_10003302 | 3300015262 | Bacteria | 7647 |
| 558 | Ga0182005_1011366 | 3300015265 | Bacteria | 2539 |
| 559 | Ga0183368_1002 | 3300015687 | Bacteria | 1865598 |
| 560 | Ga0163161_10003606 | 3300017792 | Bacteria | 10859 |
| 561 | Ga0163161_10042311 | 3300017792 | Bacteria | 3276 |
| 562 | Ga0206353_11000141 | 3300020082 | Bacteria | 12004 |
| 563 | Ga0213872_10000388 | 3300021361 | Bacteria | 36574 |
| 564 | Ga0213872_10059652 | 3300021361 | Bacteria | 1726 |
| 565 | Ga0213876_10009387 | 3300021384 | Bacteria | 5269 |
| 566 | Ga0213876_10011169 | 3300021384 | Bacteria | 4801 |
| 567 | Ga0224712_10001480 | 3300022467 | Bacteria | 5426 |
| 568 | Ga0209760_100548 | 3300025207 | Bacteria | 6975 |
| 569 | Ga0209784_100053 | 3300025224 | Bacteria | 182075 |
| 570 | Ga0209566_100050 | 3300025225 | Bacteria | 234653 |
| 571 | Ga0209566_103958 | 3300025225 | Bacteria | 2117 |
| 572 | Ga0209674_100001 | 3300025226 | Bacteria | 4013750 |
| 573 | Ga0209674_100025 | 3300025226 | Bacteria | 515942 |
| 574 | Ga0209672_100002 | 3300025228 | Bacteria | 1733325 |
| 575 | Ga0209672_100064 | 3300025228 | Bacteria | 204609 |
| 576 | Ga0209672_102577 | 3300025228 | Bacteria | 4330 |
| 577 | Ga0209147_100003 | 3300025229 | Bacteria | 1733325 |
| 578 | Ga0209147_105009 | 3300025229 | Bacteria | 2066 |
| 579 | Ga0209563_100001 | 3300025230 | Bacteria | 4013775 |
| 580 | Ga0209563_101346 | 3300025230 | Bacteria | 6695 |
| 581 | Ga0207427_100041 | 3300025231 | Bacteria | 263659 |
| 582 | Ga0207427_100061 | 3300025231 | Bacteria | 182815 |
| 583 | Ga0207427_100834 | 3300025231 | Bacteria | 13770 |
| 584 | Ga0207427_101099 | 3300025231 | Bacteria | 10994 |
| 585 | Ga0207427_103063 | 3300025231 | Bacteria | 3799 |
| 586 | Ga0209437_100037 | 3300025233 | Bacteria | 459730 |
| 587 | Ga0209437_100267 | 3300025233 | Bacteria | 79455 |
| 588 | Ga0209437_100279 | 3300025233 | Bacteria | 75208 |
| 589 | Ga0209258_100005 | 3300025242 | Bacteria | 1087938 |
| 590 | Ga0209258_100138 | 3300025242 | Bacteria | 167495 |
| 591 | Ga0209258_102763 | 3300025242 | Bacteria | 4246 |
| 592 | Ga0207425_1000011 | 3300025245 | Bacteria | 550735 |
| 593 | Ga0207425_1000072 | 3300025245 | Bacteria | 115017 |
| 594 | Ga0209646_1000351 | 3300025246 | Bacteria | 33528 |
| 595 | Ga0209026_1000104 | 3300025250 | Bacteria | 152614 |
| 596 | Ga0209677_100001 | 3300025253 | Bacteria | 4013787 |
| 597 | Ga0209677_100601 | 3300025253 | Bacteria | 19466 |
| 598 | Ga0209148_1000001 | 3300025254 | Bacteria | 2545271 |
| 599 | Ga0209148_1000002 | 3300025254 | Bacteria | 2399500 |
| 600 | Ga0209148_1000006 | 3300025254 | Bacteria | 1733325 |
| 601 | Ga0209148_1000108 | 3300025254 | Bacteria | 204609 |
| 602 | Ga0209759_1000006 | 3300025256 | Bacteria | 492407 |
| 603 | Ga0209759_1000052 | 3300025256 | Bacteria | 213964 |
| 604 | Ga0209759_1000220 | 3300025256 | Bacteria | 87504 |
| 605 | Ga0209759_1003685 | 3300025256 | Bacteria | 6010 |
| 606 | Ga0209129_1000031 | 3300025258 | Bacteria | 383039 |
| 607 | Ga0209129_1000737 | 3300025258 | Bacteria | 21008 |
| 608 | Ga0209129_1005223 | 3300025258 | Bacteria | 4701 |
| 609 | Ga0209233_1000002 | 3300025261 | Bacteria | 2501366 |
| 610 | Ga0209233_1000014 | 3300025261 | Bacteria | 996641 |
| 611 | Ga0209233_1000018 | 3300025261 | Bacteria | 886857 |
| 612 | Ga0209233_1000545 | 3300025261 | Bacteria | 21104 |
| 613 | Ga0209233_1002368 | 3300025261 | Bacteria | 7005 |
| 614 | Ga0209233_1008622 | 3300025261 | Bacteria | 3140 |
| 615 | Ga0209455_1000003 | 3300025272 | Bacteria | 1471893 |
| 616 | Ga0209455_1000079 | 3300025272 | Bacteria | 268778 |
| 617 | Ga0209455_1000102 | 3300025272 | Bacteria | 204609 |
| 618 | Ga0209455_1001023 | 3300025272 | Bacteria | 13979 |
| 619 | Ga0209455_1002782 | 3300025272 | Bacteria | 6536 |
| 620 | Ga0209673_1005552 | 3300025273 | Bacteria | 6310 |
| 621 | Ga0209130_1000693 | 3300025284 | Bacteria | 30142 |
| 622 | Ga0209676_1000100 | 3300025292 | Bacteria | 229621 |
| 623 | Ga0209676_1001455 | 3300025292 | Bacteria | 22206 |
| 624 | Ga0209676_1004470 | 3300025292 | Bacteria | 7771 |
| 625 | Ga0209676_1007055 | 3300025292 | Bacteria | 5386 |
| 626 | Ga0209025_1000012 | 3300025294 | Bacteria | 924362 |
| 627 | Ga0209025_1000473 | 3300025294 | Bacteria | 78078 |
| 628 | Ga0209025_1000509 | 3300025294 | Bacteria | 74336 |
| 629 | Ga0209025_1000721 | 3300025294 | Bacteria | 56094 |
| 630 | Ga0209025_1000802 | 3300025294 | Bacteria | 50981 |
| 631 | Ga0209025_1031800 | 3300025294 | Bacteria | 2485 |
| 632 | Ga0209564_1006514 | 3300025295 | Bacteria | 6278 |
| 633 | Ga0209564_1015451 | 3300025295 | Bacteria | 3102 |
| 634 | Ga0209758_1000009 | 3300025297 | Bacteria | 1123483 |
| 635 | Ga0209758_1000143 | 3300025297 | Bacteria | 171093 |
| 636 | Ga0209758_1000853 | 3300025297 | Bacteria | 42429 |
| 637 | Ga0209758_1002491 | 3300025297 | Bacteria | 18714 |
| 638 | Ga0209758_1031122 | 3300025297 | Bacteria | 2195 |
| 639 | Ga0209758_1036152 | 3300025297 | Bacteria | 1934 |
| 640 | Ga0209050_1000005 | 3300025298 | Bacteria | 1557793 |
| 641 | Ga0209050_1008322 | 3300025298 | Bacteria | 5578 |
| 642 | Ga0209256_1000752 | 3300025299 | Bacteria | 42238 |
| 643 | Ga0209256_1001211 | 3300025299 | Bacteria | 28793 |
| 644 | Ga0209256_1001259 | 3300025299 | Bacteria | 27751 |
| 645 | Ga0207426_1000020 | 3300025302 | Bacteria | 558084 |
| 646 | Ga0207426_1000080 | 3300025302 | Bacteria | 304917 |
| 647 | Ga0207426_1001406 | 3300025302 | Bacteria | 20221 |
| 648 | Ga0207426_1024668 | 3300025302 | Bacteria | 2037 |
| 649 | Ga0209051_1000507 | 3300025303 | Bacteria | 49396 |
| 650 | Ga0209051_1001813 | 3300025303 | Bacteria | 16915 |
| 651 | Ga0209051_1024235 | 3300025303 | Bacteria | 2500 |
| 652 | Ga0209257_1000712 | 3300025304 | Bacteria | 51443 |
| 653 | Ga0209257_1000822 | 3300025304 | Bacteria | 45027 |
| 654 | Ga0209257_1001291 | 3300025304 | Bacteria | 30556 |
| 655 | Ga0209257_1001585 | 3300025304 | Bacteria | 26112 |
| 656 | Ga0209257_1005469 | 3300025304 | Bacteria | 8909 |
| 657 | Ga0209257_1008420 | 3300025304 | Bacteria | 5870 |
| 658 | Ga0209257_1019269 | 3300025304 | Bacteria | 2578 |
| 659 | Ga0207697_10042039 | 3300025315 | Bacteria | 1877 |
| 660 | Ga0207656_10018669 | 3300025321 | Bacteria | 2733 |
| 661 | Ga0207656_10022080 | 3300025321 | Bacteria | 2550 |
| 662 | Ga0207696_1011511 | 3300025711 | Bacteria | 3179 |
| 663 | Ga0207655_1022025 | 3300025728 | Bacteria | 3209 |
| 664 | Ga0207713_1000462 | 3300025735 | Bacteria | 42616 |
| 665 | Ga0207653_10052439 | 3300025885 | Bacteria | 1360 |
| 666 | Ga0207710_10002756 | 3300025900 | Bacteria | 8038 |
| 667 | Ga0207710_10074409 | 3300025900 | Bacteria | 1564 |
| 668 | Ga0207688_10000304 | 3300025901 | Bacteria | 22575 |
| 669 | Ga0207680_10084806 | 3300025903 | Bacteria | 2000 |
| 670 | Ga0207647_10000278 | 3300025904 | Bacteria | 41658 |
| 671 | Ga0207647_10005308 | 3300025904 | Bacteria | 9469 |
| 672 | Ga0207647_10012431 | 3300025904 | Bacteria | 5925 |
| 673 | Ga0207647_10030452 | 3300025904 | Bacteria | 3481 |
| 674 | Ga0207699_10008403 | 3300025906 | Bacteria | 5094 |
| 675 | Ga0207699_10033589 | 3300025906 | Bacteria | 2901 |
| 676 | Ga0207645_10023338 | 3300025907 | Bacteria | 4021 |
| 677 | Ga0207645_10041363 | 3300025907 | Bacteria | 2951 |
| 678 | Ga0207645_10069247 | 3300025907 | Bacteria | 2257 |
| 679 | Ga0207645_10108041 | 3300025907 | Bacteria | 1800 |
| 680 | Ga0207643_10013673 | 3300025908 | Bacteria | 4400 |
| 681 | Ga0207705_10020989 | 3300025909 | Bacteria | 4660 |
| 682 | Ga0207705_10217003 | 3300025909 | Bacteria | 1452 |
| 683 | Ga0207684_10000389 | 3300025910 | Bacteria | 59084 |
| 684 | Ga0207684_10004583 | 3300025910 | Bacteria | 12986 |
| 685 | Ga0207684_10046578 | 3300025910 | Bacteria | 3679 |
| 686 | Ga0207654_10000023 | 3300025911 | Bacteria | 161401 |
| 687 | Ga0207654_10004886 | 3300025911 | Bacteria | 6782 |
| 688 | Ga0207654_10005075 | 3300025911 | Bacteria | 6642 |
| 689 | Ga0207654_10021511 | 3300025911 | Bacteria | 3431 |
| 690 | Ga0207654_10041420 | 3300025911 | Bacteria | 2600 |
| 691 | Ga0207654_10160223 | 3300025911 | Bacteria | 1453 |
| 692 | Ga0207707_10021868 | 3300025912 | Bacteria | 5591 |
| 693 | Ga0207707_10028260 | 3300025912 | Bacteria | 4903 |
| 694 | Ga0207707_10044183 | 3300025912 | Bacteria | 3884 |
| 695 | Ga0207707_10080650 | 3300025912 | Bacteria | 2841 |
| 696 | Ga0207695_10000001 | 3300025913 | Bacteria | 2888630 |
| 697 | Ga0207695_10000026 | 3300025913 | Bacteria | 624558 |
| 698 | Ga0207695_10000096 | 3300025913 | Bacteria | 265048 |
| 699 | Ga0207695_10000144 | 3300025913 | Bacteria | 211125 |
| 700 | Ga0207695_10000624 | 3300025913 | Bacteria | 71152 |
| 701 | Ga0207695_10002958 | 3300025913 | Bacteria | 24505 |
| 702 | Ga0207695_10008025 | 3300025913 | Bacteria | 13287 |
| 703 | Ga0207695_10008849 | 3300025913 | Bacteria | 12536 |
| 704 | Ga0207695_10010412 | 3300025913 | Bacteria | 11378 |
| 705 | Ga0207695_10032685 | 3300025913 | Bacteria | 5690 |
| 706 | Ga0207695_10070881 | 3300025913 | Bacteria | 3561 |
| 707 | Ga0207695_10072943 | 3300025913 | Bacteria | 3500 |
| 708 | Ga0207695_10078805 | 3300025913 | Bacteria | 3342 |
| 709 | Ga0207695_10204021 | 3300025913 | Bacteria | 1890 |
| 710 | Ga0207695_10226624 | 3300025913 | Bacteria | 1775 |
| 711 | Ga0207671_10000890 | 3300025914 | Bacteria | 37829 |
| 712 | Ga0207671_10003428 | 3300025914 | Bacteria | 15826 |
| 713 | Ga0207671_10004998 | 3300025914 | Bacteria | 12413 |
| 714 | Ga0207671_10007898 | 3300025914 | Bacteria | 9135 |
| 715 | Ga0207671_10031185 | 3300025914 | Bacteria | 3972 |
| 716 | Ga0207671_10049004 | 3300025914 | Bacteria | 3126 |
| 717 | Ga0207671_10082288 | 3300025914 | Unclassified | 2415 |
| 718 | Ga0207671_10093025 | 3300025914 | Unclassified | 2274 |
| 719 | Ga0207671_10121419 | 3300025914 | Bacteria | 1997 |
| 720 | Ga0207693_10000016 | 3300025915 | Bacteria | 145892 |
| 721 | Ga0207693_10000067 | 3300025915 | Bacteria | 91025 |
| 722 | Ga0207693_10000415 | 3300025915 | Bacteria | 38698 |
| 723 | Ga0207693_10009303 | 3300025915 | Bacteria | 8016 |
| 724 | Ga0207693_10010555 | 3300025915 | Bacteria | 7495 |
| 725 | Ga0207693_10024245 | 3300025915 | Bacteria | 4816 |
| 726 | Ga0207693_10081768 | 3300025915 | Bacteria | 2529 |
| 727 | Ga0207663_10000608 | 3300025916 | Bacteria | 15863 |
| 728 | Ga0207663_10151620 | 3300025916 | Bacteria | 1627 |
| 729 | Ga0207660_10080862 | 3300025917 | Bacteria | 2387 |
| 730 | Ga0207660_10240824 | 3300025917 | Bacteria | 1425 |
| 731 | Ga0207662_10008567 | 3300025918 | Bacteria | 5606 |
| 732 | Ga0207662_10024528 | 3300025918 | Bacteria | 3469 |
| 733 | Ga0207657_10000003 | 3300025919 | Bacteria | 263148 |
| 734 | Ga0207657_10006444 | 3300025919 | Bacteria | 12163 |
| 735 | Ga0207657_10007051 | 3300025919 | Bacteria | 11546 |
| 736 | Ga0207657_10013752 | 3300025919 | Bacteria | 7923 |
| 737 | Ga0207657_10015794 | 3300025919 | Bacteria | 7297 |
| 738 | Ga0207657_10017961 | 3300025919 | Bacteria | 6769 |
| 739 | Ga0207657_10092158 | 3300025919 | Bacteria | 2526 |
| 740 | Ga0207649_10002972 | 3300025920 | Bacteria | 9340 |
| 741 | Ga0207649_10012549 | 3300025920 | Bacteria | 4706 |
| 742 | Ga0207649_10015414 | 3300025920 | Bacteria | 4294 |
| 743 | Ga0207649_10023379 | 3300025920 | Bacteria | 3579 |
| 744 | Ga0207649_10026449 | 3300025920 | Bacteria | 3394 |
| 745 | Ga0207649_10058379 | 3300025920 | Bacteria | 2416 |
| 746 | Ga0207652_10005130 | 3300025921 | Bacteria | 10630 |
| 747 | Ga0207652_10061707 | 3300025921 | Bacteria | 3238 |
| 748 | Ga0207652_10078988 | 3300025921 | Bacteria | 2874 |
| 749 | Ga0207646_10001021 | 3300025922 | Bacteria | 35814 |
| 750 | Ga0207646_10003890 | 3300025922 | Bacteria | 16570 |
| 751 | Ga0207646_10004869 | 3300025922 | Bacteria | 14386 |
| 752 | Ga0207646_10129302 | 3300025922 | Bacteria | 2272 |
| 753 | Ga0207694_10000028 | 3300025924 | Bacteria | 242395 |
| 754 | Ga0207694_10000205 | 3300025924 | Bacteria | 58152 |
| 755 | Ga0207694_10002229 | 3300025924 | Bacteria | 15910 |
| 756 | Ga0207694_10011031 | 3300025924 | Bacteria | 6825 |
| 757 | Ga0207694_10013189 | 3300025924 | Bacteria | 6222 |
| 758 | Ga0207694_10015901 | 3300025924 | Bacteria | 5677 |
| 759 | Ga0207694_10022150 | 3300025924 | Bacteria | 4818 |
| 760 | Ga0207694_10026135 | 3300025924 | Bacteria | 4438 |
| 761 | Ga0207694_10069923 | 3300025924 | Bacteria | 2743 |
| 762 | Ga0207694_10221002 | 3300025924 | Bacteria | 1545 |
| 763 | Ga0207650_10004541 | 3300025925 | Bacteria | 9492 |
| 764 | Ga0207650_10162687 | 3300025925 | Bacteria | 1769 |
| 765 | Ga0207659_10021238 | 3300025926 | Bacteria | 4305 |
| 766 | Ga0207659_10037951 | 3300025926 | Bacteria | 3348 |
| 767 | Ga0207687_10004132 | 3300025927 | Bacteria | 9722 |
| 768 | Ga0207687_10212691 | 3300025927 | Bacteria | 1518 |
| 769 | Ga0207700_10001225 | 3300025928 | Bacteria | 14669 |
| 770 | Ga0207700_10008306 | 3300025928 | Bacteria | 6421 |
| 771 | Ga0207700_10015420 | 3300025928 | Bacteria | 5042 |
| 772 | Ga0207700_10017810 | 3300025928 | Bacteria | 4754 |
| 773 | Ga0207700_10086091 | 3300025928 | Bacteria | 2469 |
| 774 | Ga0207700_10088453 | 3300025928 | Bacteria | 2439 |
| 775 | Ga0207664_10000158 | 3300025929 | Bacteria | 54104 |
| 776 | Ga0207664_10030837 | 3300025929 | Bacteria | 4098 |
| 777 | Ga0207664_10079271 | 3300025929 | Bacteria | 2666 |
| 778 | Ga0207664_10109095 | 3300025929 | Bacteria | 2299 |
| 779 | Ga0207664_10138572 | 3300025929 | Bacteria | 2055 |
| 780 | Ga0207644_10033148 | 3300025931 | Bacteria | 3607 |
| 781 | Ga0207690_10000007 | 3300025932 | Bacteria | 388533 |
| 782 | Ga0207690_10001066 | 3300025932 | Bacteria | 17554 |
| 783 | Ga0207690_10058000 | 3300025932 | Bacteria | 2617 |
| 784 | Ga0207706_10002117 | 3300025933 | Bacteria | 19438 |
| 785 | Ga0207706_10006147 | 3300025933 | Bacteria | 11151 |
| 786 | Ga0207706_10035048 | 3300025933 | Bacteria | 4464 |
| 787 | Ga0207706_10043245 | 3300025933 | Bacteria | 3993 |
| 788 | Ga0207706_10052579 | 3300025933 | Bacteria | 3596 |
| 789 | Ga0207706_10057290 | 3300025933 | Bacteria | 3433 |
| 790 | Ga0207706_10063372 | 3300025933 | Bacteria | 3255 |
| 791 | Ga0207686_10003543 | 3300025934 | Bacteria | 8375 |
| 792 | Ga0207709_10005564 | 3300025935 | Bacteria | 7135 |
| 793 | Ga0207669_10058280 | 3300025937 | Bacteria | 2355 |
| 794 | Ga0207669_10131933 | 3300025937 | Bacteria | 1718 |
| 795 | Ga0207704_10061262 | 3300025938 | Bacteria | 2333 |
| 796 | Ga0207704_10155020 | 3300025938 | Bacteria | 1622 |
| 797 | Ga0207704_10237209 | 3300025938 | Bacteria | 1360 |
| 798 | Ga0207665_10004770 | 3300025939 | Bacteria | 9019 |
| 799 | Ga0207665_10009285 | 3300025939 | Bacteria | 6458 |
| 800 | Ga0207665_10012890 | 3300025939 | Bacteria | 5497 |
| 801 | Ga0207665_10049135 | 3300025939 | Bacteria | 2834 |
| 802 | Ga0207665_10061216 | 3300025939 | Bacteria | 2551 |
| 803 | Ga0207665_10064816 | 3300025939 | Bacteria | 2483 |
| 804 | Ga0207691_10006717 | 3300025940 | Bacteria | 11092 |
| 805 | Ga0207691_10021448 | 3300025940 | Bacteria | 6098 |
| 806 | Ga0207691_10029915 | 3300025940 | Bacteria | 5093 |
| 807 | Ga0207711_10001182 | 3300025941 | Bacteria | 24848 |
| 808 | Ga0207711_10021006 | 3300025941 | Bacteria | 5451 |
| 809 | Ga0207711_10026400 | 3300025941 | Bacteria | 4873 |
| 810 | Ga0207711_10099740 | 3300025941 | Bacteria | 2568 |
| 811 | Ga0207711_10183800 | 3300025941 | Bacteria | 1902 |
| 812 | Ga0207711_10205833 | 3300025941 | Bacteria | 1797 |
| 813 | Ga0207711_10281436 | 3300025941 | Bacteria | 1532 |
| 814 | Ga0207689_10003366 | 3300025942 | Bacteria | 14638 |
| 815 | Ga0207689_10004289 | 3300025942 | Bacteria | 12981 |
| 816 | Ga0207689_10279551 | 3300025942 | Bacteria | 1382 |
| 817 | Ga0207661_10000250 | 3300025944 | Bacteria | 35030 |
| 818 | Ga0207661_10002410 | 3300025944 | Bacteria | 12877 |
| 819 | Ga0207661_10042036 | 3300025944 | Bacteria | 3602 |
| 820 | Ga0207661_10042551 | 3300025944 | Bacteria | 3582 |
| 821 | Ga0207661_10156626 | 3300025944 | Bacteria | 1974 |
| 822 | Ga0207679_10087239 | 3300025945 | Bacteria | 2402 |
| 823 | Ga0207679_10352683 | 3300025945 | Bacteria | 1283 |
| 824 | Ga0207667_10000923 | 3300025949 | Bacteria | 37509 |
| 825 | Ga0207667_10004811 | 3300025949 | Bacteria | 16518 |
| 826 | Ga0207667_10005817 | 3300025949 | Bacteria | 15032 |
| 827 | Ga0207667_10006129 | 3300025949 | Bacteria | 14608 |
| 828 | Ga0207667_10011767 | 3300025949 | Bacteria | 10141 |
| 829 | Ga0207667_10017454 | 3300025949 | Bacteria | 8075 |
| 830 | Ga0207667_10028348 | 3300025949 | Bacteria | 6082 |
| 831 | Ga0207667_10148399 | 3300025949 | Bacteria | 2414 |
| 832 | Ga0207651_10033047 | 3300025960 | Bacteria | 3331 |
| 833 | Ga0207712_10017716 | 3300025961 | Bacteria | 4630 |
| 834 | Ga0207712_10091636 | 3300025961 | Bacteria | 2239 |
| 835 | Ga0207712_10200051 | 3300025961 | Bacteria | 1584 |
| 836 | Ga0207668_10056129 | 3300025972 | Bacteria | 2742 |
| 837 | Ga0207668_10076056 | 3300025972 | Bacteria | 2416 |
| 838 | Ga0207640_10149197 | 3300025981 | Bacteria | 1716 |
| 839 | Ga0207640_10213416 | 3300025981 | Bacteria | 1472 |
| 840 | Ga0207658_10001989 | 3300025986 | Bacteria | 15250 |
| 841 | Ga0207658_10078736 | 3300025986 | Bacteria | 2519 |
| 842 | Ga0207677_10000275 | 3300026023 | Bacteria | 38579 |
| 843 | Ga0207677_10000439 | 3300026023 | Bacteria | 28110 |
| 844 | Ga0207677_10013304 | 3300026023 | Bacteria | 4763 |
| 845 | Ga0207677_10064994 | 3300026023 | Bacteria | 2543 |
| 846 | Ga0207677_10187755 | 3300026023 | Bacteria | 1632 |
| 847 | Ga0207677_10205067 | 3300026023 | Bacteria | 1570 |
| 848 | Ga0207703_10000742 | 3300026035 | Bacteria | 32170 |
| 849 | Ga0207703_10002465 | 3300026035 | Bacteria | 16049 |
| 850 | Ga0207703_10022130 | 3300026035 | Bacteria | 4983 |
| 851 | Ga0207639_10000105 | 3300026041 | Bacteria | 68111 |
| 852 | Ga0207639_10014892 | 3300026041 | Bacteria | 5478 |
| 853 | Ga0207639_10027591 | 3300026041 | Bacteria | 4138 |
| 854 | Ga0207639_10070662 | 3300026041 | Bacteria | 2727 |
| 855 | Ga0207639_10290576 | 3300026041 | Bacteria | 1441 |
| 856 | Ga0207639_10374246 | 3300026041 | Bacteria | 1278 |
| 857 | Ga0207678_10011557 | 3300026067 | Bacteria | 7753 |
| 858 | Ga0207678_10030250 | 3300026067 | Bacteria | 4727 |
| 859 | Ga0207678_10165117 | 3300026067 | Bacteria | 1891 |
| 860 | Ga0207708_10008754 | 3300026075 | Bacteria | 7489 |
| 861 | Ga0207708_10021493 | 3300026075 | Bacteria | 4866 |
| 862 | Ga0207708_10071994 | 3300026075 | Bacteria | 2649 |
| 863 | Ga0207708_10127174 | 3300026075 | Bacteria | 1990 |
| 864 | Ga0207702_10000599 | 3300026078 | Bacteria | 39855 |
| 865 | Ga0207702_10004059 | 3300026078 | Bacteria | 13135 |
| 866 | Ga0207702_10046810 | 3300026078 | Bacteria | 3642 |
| 867 | Ga0207702_10048079 | 3300026078 | Bacteria | 3597 |
| 868 | Ga0207702_10061824 | 3300026078 | Bacteria | 3196 |
| 869 | Ga0207702_10074126 | 3300026078 | Bacteria | 2937 |
| 870 | Ga0207702_10113742 | 3300026078 | Bacteria | 2411 |
| 871 | Ga0207702_10121003 | 3300026078 | Bacteria | 2343 |
| 872 | Ga0207702_10148586 | 3300026078 | Bacteria | 2129 |
| 873 | Ga0207641_10010365 | 3300026088 | Bacteria | 7659 |
| 874 | Ga0207641_10021490 | 3300026088 | Bacteria | 5303 |
| 875 | Ga0207641_10029594 | 3300026088 | Bacteria | 4530 |
| 876 | Ga0207641_10039723 | 3300026088 | Bacteria | 3936 |
| 877 | Ga0207641_10047107 | 3300026088 | Bacteria | 3635 |
| 878 | Ga0207641_10191931 | 3300026088 | Bacteria | 1878 |
| 879 | Ga0207648_10006249 | 3300026089 | Bacteria | 11862 |
| 880 | Ga0207648_10040593 | 3300026089 | Bacteria | 4089 |
| 881 | Ga0207648_10188307 | 3300026089 | Bacteria | 1828 |
| 882 | Ga0207676_10000524 | 3300026095 | Bacteria | 32178 |
| 883 | Ga0207676_10005412 | 3300026095 | Bacteria | 9040 |
| 884 | Ga0207676_10012101 | 3300026095 | Bacteria | 6175 |
| 885 | Ga0207674_10002407 | 3300026116 | Bacteria | 23606 |
| 886 | Ga0207674_10003429 | 3300026116 | Bacteria | 19404 |
| 887 | Ga0207674_10014153 | 3300026116 | Bacteria | 8816 |
| 888 | Ga0207674_10017603 | 3300026116 | Bacteria | 7795 |
| 889 | Ga0207674_10024955 | 3300026116 | Bacteria | 6380 |
| 890 | Ga0207674_10032964 | 3300026116 | Bacteria | 5428 |
| 891 | Ga0207674_10044065 | 3300026116 | Bacteria | 4598 |
| 892 | Ga0207674_10099978 | 3300026116 | Bacteria | 2882 |
| 893 | Ga0207674_10119966 | 3300026116 | Bacteria | 2598 |
| 894 | Ga0207674_10215337 | 3300026116 | Bacteria | 1869 |
| 895 | Ga0207675_100019174 | 3300026118 | Bacteria | 6383 |
| 896 | Ga0207675_100180147 | 3300026118 | Bacteria | 2023 |
| 897 | Ga0207675_100238965 | 3300026118 | Bacteria | 1755 |
| 898 | Ga0207683_10000235 | 3300026121 | Bacteria | 49040 |
| 899 | Ga0207683_10004790 | 3300026121 | Bacteria | 11653 |
| 900 | Ga0207683_10039387 | 3300026121 | Bacteria | 4123 |
| 901 | Ga0207683_10099965 | 3300026121 | Bacteria | 2589 |
| 902 | Ga0207683_10111306 | 3300026121 | Bacteria | 2452 |
| 903 | Ga0207683_10133697 | 3300026121 | Bacteria | 2232 |
| 904 | Ga0207698_10000118 | 3300026142 | Bacteria | 49342 |
| 905 | Ga0207698_10000128 | 3300026142 | Bacteria | 47261 |
| 906 | Ga0207698_10000713 | 3300026142 | Bacteria | 19233 |
| 907 | Ga0207698_10019726 | 3300026142 | Bacteria | 4623 |
| 908 | Ga0207698_10048292 | 3300026142 | Bacteria | 3230 |
| 909 | Ga0207698_10291069 | 3300026142 | Bacteria | 1516 |
| 910 | Ga0209371_1000064 | 3300027312 | Bacteria | 218637 |
| 911 | Ga0209371_1000156 | 3300027312 | Bacteria | 106826 |
| 912 | Ga0209371_1000163 | 3300027312 | Bacteria | 100853 |
| 913 | Ga0209371_1009505 | 3300027312 | Bacteria | 3084 |
| 914 | Ga0209813_10002733 | 3300027866 | Bacteria | 4067 |
| 915 | Ga0209813_10025731 | 3300027866 | Bacteria | 1695 |
| 916 | Ga0209974_10029906 | 3300027876 | Bacteria | 1805 |
| 917 | Ga0207428_10000139 | 3300027907 | Bacteria | 98277 |
| 918 | Ga0207428_10083545 | 3300027907 | Bacteria | 2490 |
| 919 | Ga0268266_10000001 | 3300028379 | Bacteria | 4040580 |
| 920 | Ga0268266_10000002 | 3300028379 | Bacteria | 3059047 |
| 921 | Ga0268266_10002024 | 3300028379 | Bacteria | 22580 |
| 922 | Ga0268266_10063972 | 3300028379 | Bacteria | 3177 |
| 923 | Ga0268266_10088318 | 3300028379 | Bacteria | 2713 |
| 924 | Ga0268266_10123909 | 3300028379 | Bacteria | 2303 |
| 925 | Ga0268266_10162313 | 3300028379 | Bacteria | 2023 |
| 926 | Ga0268265_10041251 | 3300028380 | Bacteria | 3414 |
| 927 | Ga0268265_10095534 | 3300028380 | Bacteria | 2387 |
| 928 | Ga0268265_10101642 | 3300028380 | Bacteria | 2323 |
| 929 | Ga0268264_10013801 | 3300028381 | Bacteria | 6644 |
| 930 | Ga0268264_10029579 | 3300028381 | Bacteria | 4488 |
| 931 | Ga0268264_10052154 | 3300028381 | Bacteria | 3410 |
| 932 | Ga0268264_10059118 | 3300028381 | Bacteria | 3211 |
| 933 | Ga0265334_10005063 | 3300028573 | Bacteria | 5781 |
| 934 | Ga0265318_10005296 | 3300028577 | Bacteria | 6066 |
| 935 | Ga0307517_10101037 | 3300028786 | Bacteria | 2274 |
| 936 | Ga0307515_10000382 | 3300028794 | Bacteria | 107907 |
| 937 | Ga0307515_10012279 | 3300028794 | Bacteria | 16129 |
| 938 | Ga0307515_10019915 | 3300028794 | Bacteria | 12025 |
| 939 | Ga0307515_10030579 | 3300028794 | Bacteria | 9030 |
| 940 | Ga0307515_10074648 | 3300028794 | Bacteria | 4531 |
| 941 | Ga0307515_10172322 | 3300028794 | Bacteria | 2151 |
| 942 | Ga0265338_10001393 | 3300028800 | Bacteria | 39373 |
| 943 | Ga0265338_10002714 | 3300028800 | Bacteria | 25974 |
| 944 | Ga0265338_10007466 | 3300028800 | Bacteria | 13556 |
| 945 | Ga0265338_10014811 | 3300028800 | Bacteria | 8630 |
| 946 | Ga0265338_10017582 | 3300028800 | Bacteria | 7700 |
| 947 | Ga0265338_10090147 | 3300028800 | Bacteria | 2538 |
| 948 | Ga0265338_10144124 | 3300028800 | Bacteria | 1861 |
| 949 | Ga0268256_1000028 | 3300030500 | Bacteria | 433179 |
| 950 | Ga0268256_1000130 | 3300030500 | Bacteria | 106825 |
| 951 | Ga0268256_1010223 | 3300030500 | Bacteria | 3054 |
| 952 | Ga0307512_10007391 | 3300030522 | Bacteria | 10904 |
| 953 | Ga0307512_10008127 | 3300030522 | Bacteria | 10274 |
| 954 | Ga0307512_10034426 | 3300030522 | Bacteria | 4333 |
| 955 | Ga0265330_10008769 | 3300031235 | Bacteria | 4845 |
| 956 | Ga0265332_10003860 | 3300031238 | Bacteria | 7155 |
| 957 | Ga0265332_10069791 | 3300031238 | Bacteria | 1497 |
| 958 | Ga0265328_10002208 | 3300031239 | Bacteria | 8772 |
| 959 | Ga0265328_10039329 | 3300031239 | Bacteria | 1745 |
| 960 | Ga0265320_10000855 | 3300031240 | Bacteria | 22981 |
| 961 | Ga0265320_10001597 | 3300031240 | Bacteria | 16255 |
| 962 | Ga0265325_10003448 | 3300031241 | Bacteria | 10317 |
| 963 | Ga0265329_10028998 | 3300031242 | Bacteria | 1812 |
| 964 | Ga0265340_10000265 | 3300031247 | Bacteria | 27074 |
| 965 | Ga0265340_10004766 | 3300031247 | Bacteria | 7542 |
| 966 | Ga0265340_10007005 | 3300031247 | Bacteria | 6151 |
| 967 | Ga0265339_10000040 | 3300031249 | Bacteria | 120556 |
| 968 | Ga0265339_10002741 | 3300031249 | Bacteria | 12511 |
| 969 | Ga0265339_10025292 | 3300031249 | Bacteria | 3408 |
| 970 | Ga0265339_10030108 | 3300031249 | Bacteria | 3075 |
| 971 | Ga0265331_10036190 | 3300031250 | Bacteria | 2425 |
| 972 | Ga0265316_10010021 | 3300031344 | Bacteria | 8667 |
| 973 | Ga0265316_10011815 | 3300031344 | Bacteria | 7855 |
| 974 | Ga0265316_10076669 | 3300031344 | Bacteria | 2568 |
| 975 | Ga0307513_10002543 | 3300031456 | Bacteria | 25210 |
| 976 | Ga0307513_10014673 | 3300031456 | Bacteria | 9537 |
| 977 | Ga0307513_10177374 | 3300031456 | Bacteria | 1999 |
| 978 | Ga0307513_10228258 | 3300031456 | Bacteria | 1676 |
| 979 | Ga0307509_10001893 | 3300031507 | Bacteria | 34561 |
| 980 | Ga0307408_100036836 | 3300031548 | Bacteria | 3441 |
| 981 | Ga0307408_100077198 | 3300031548 | Unclassified | 2480 |
| 982 | Ga0265313_10004931 | 3300031595 | Bacteria | 9996 |
| 983 | Ga0307508_10004834 | 3300031616 | Bacteria | 12990 |
| 984 | Ga0307508_10111009 | 3300031616 | Bacteria | 2341 |
| 985 | Ga0307508_10147031 | 3300031616 | Bacteria | 1961 |
| 986 | Ga0307514_10012978 | 3300031649 | Bacteria | 6917 |
| 987 | Ga0307514_10045789 | 3300031649 | Bacteria | 3420 |
| 988 | Ga0265314_10002539 | 3300031711 | Bacteria | 18572 |
| 989 | Ga0265314_10009578 | 3300031711 | Bacteria | 8160 |
| 990 | Ga0265342_10000423 | 3300031712 | Bacteria | 46377 |
| 991 | Ga0265342_10003774 | 3300031712 | Bacteria | 12222 |
| 992 | Ga0265342_10006771 | 3300031712 | Bacteria | 8488 |
| 993 | Ga0265342_10016092 | 3300031712 | Bacteria | 4898 |
| 994 | Ga0265342_10066307 | 3300031712 | Bacteria | 2114 |
| 995 | Ga0307516_10004216 | 3300031730 | Bacteria | 17907 |
| 996 | Ga0307516_10014805 | 3300031730 | Bacteria | 8234 |
| 997 | Ga0307516_10105861 | 3300031730 | Bacteria | 2624 |
| 998 | Ga0307516_10211993 | 3300031730 | Bacteria | 1651 |
| 999 | Ga0307405_10001559 | 3300031731 | Bacteria | 9716 |
| 1000 | Ga0307405_10026348 | 3300031731 | Unclassified | 3353 |
| 1001 | Ga0307410_10010347 | 3300031852 | Bacteria | 5279 |
| 1002 | Ga0307410_10027063 | 3300031852 | Bacteria | 3620 |
| 1003 | Ga0307410_10121053 | 3300031852 | Bacteria | 1908 |
| 1004 | Ga0307406_10009321 | 3300031901 | Bacteria | 5501 |
| 1005 | Ga0307407_10047162 | 3300031903 | Bacteria | 2443 |
| 1006 | Ga0307412_10000002 | 3300031911 | Bacteria | 743446 |
| 1007 | Ga0307409_100000035 | 3300031995 | Bacteria | 47580 |
| 1008 | Ga0307409_100025384 | 3300031995 | Unclassified | 4155 |
| 1009 | Ga0307409_100234346 | 3300031995 | Bacteria | 1666 |
| 1010 | Ga0307416_100000287 | 3300032002 | Bacteria | 26496 |
| 1011 | Ga0307416_100014506 | 3300032002 | Bacteria | 5405 |
| 1012 | Ga0307416_100238705 | 3300032002 | Bacteria | 1759 |
| 1013 | Ga0307416_100308438 | 3300032002 | Bacteria | 1578 |
| 1014 | Ga0307411_10016202 | 3300032005 | Bacteria | 4215 |
| 1015 | Ga0307415_100000003 | 3300032126 | Bacteria | 116928 |
| 1016 | Ga0307415_100003349 | 3300032126 | Bacteria | 8139 |
| 1017 | Ga0307415_100088003 | 3300032126 | Bacteria | 2240 |
| 1018 | Ga0307415_100156918 | 3300032126 | Bacteria | 1758 |
| 1019 | Ga0307507_10058129 | 3300033179 | Bacteria | 3634 |
| 1020 | Ga0307510_10024598 | 3300033180 | Bacteria | 6956 |
| 1021 | Ga0307510_10152346 | 3300033180 | Bacteria | 1927 |
| 1022 | Ga0307510_10160483 | 3300033180 | Bacteria | 1846 |
| 1023 | Ga0373936_0001387 | 3300035113 | Bacteria | 8790 |
| 1024 | Ga0373936_0004339 | 3300035113 | Bacteria | 5361 |
| 1025 | Ga0373954_0001393 | 3300035118 | Bacteria | 9795 |
| 1026 | Ga0373954_0036677 | 3300035118 | Bacteria | 2276 |
| 1027 | Ga0373954_0069570 | 3300035118 | Bacteria | 1671 |
| 1028 | Ga0373956_0010264 | 3300035119 | Bacteria | 3833 |
| 1029 | Ga0373957_0008634 | 3300035120 | Bacteria | 3310 |
| 1030 | Ga0373957_0067817 | 3300035120 | Bacteria | 1391 |
| 1031 | Ga0373943_0002644 | 3300035170 | Bacteria | 8152 |
| 1032 | Ga0373943_0014875 | 3300035170 | Bacteria | 3531 |
| 1033 | Ga0373946_0021681 | 3300035171 | Bacteria | 2493 |
| 1034 | Ga0373946_0042168 | 3300035171 | Bacteria | 1875 |
| 1035 | Ga0373955_0000268 | 3300035172 | Bacteria | 21698 |
| 1036 | Ga0373955_0010254 | 3300035172 | Bacteria | 4418 |
| 1037 | Ga0373955_0026620 | 3300035172 | Bacteria | 2981 |
| 1038 | Ga0373955_0081872 | 3300035172 | Bacteria | 1826 |
| 1039 | Ga0373955_0105566 | 3300035172 | Bacteria | 1623 |
| 1040 | Ga0316574_0020405 | 3300035398 | Bacteria | 3922 |
| 1041 | Ga0373924_0012004 | 3300035410 | Bacteria | 3228 |
| 1042 | Ga0373924_0053057 | 3300035410 | Bacteria | 1684 |
| 1043 | Ga0373924_0061963 | 3300035410 | Bacteria | 1566 |
| 1044 | Ga0373935_0003009 | 3300035692 | Bacteria | 9724 |
| 1045 | Ga0373935_0032408 | 3300035692 | Bacteria | 3248 |
| 1046 | Ga0373927_0001212 | 3300035695 | Bacteria | 19563 |
| 1047 | Ga0373933_0000815 | 3300035724 | Bacteria | 19016 |
| 1048 | Ga0373933_0062042 | 3300035724 | Bacteria | 2256 |
| 1049 | Ga0373933_0119161 | 3300035724 | Bacteria | 1652 |
| 1050 | Ga0373933_0119972 | 3300035724 | Bacteria | 1646 |
| 1051 | Ga0373933_0195479 | 3300035724 | Bacteria | 1293 |
| 1052 | Ga0373947_0000576 | 3300035725 | Bacteria | 21462 |
| 1053 | Ga0373947_0017352 | 3300035725 | Bacteria | 4140 |
| 1054 | Ga0373947_0020634 | 3300035725 | Unclassified | 3806 |
| 1055 | Ga0373947_0021702 | 3300035725 | Bacteria | 3718 |
| 1056 | Ga0373937_0001164 | 3300036401 | Bacteria | 22086 |
| 1057 | Ga0373937_0018449 | 3300036401 | Bacteria | 6231 |
| 1058 | Ga0373937_0039520 | 3300036401 | Bacteria | 4299 |
| 1059 | Ga0373937_0041709 | 3300036401 | Bacteria | 4187 |
| 1060 | Ga0373937_0061892 | 3300036401 | Bacteria | 3440 |
| 1061 | Ga0373937_0112477 | 3300036401 | Bacteria | 2533 |
| 1062 | Ga0373937_0114659 | 3300036401 | Bacteria | 2509 |
| 1063 | Ga0373937_0120279 | 3300036401 | Bacteria | 2447 |
| 1064 | Ga0373925_0000695 | 3300037068 | Bacteria | 31483 |
| 1065 | Ga0373925_0022538 | 3300037068 | Bacteria | 4594 |
| 1066 | Ga0373925_0028721 | 3300037068 | Bacteria | 4076 |
| 1067 | Ga0373925_0044235 | 3300037068 | Bacteria | 3306 |
| 1068 | Ga0373925_0048469 | 3300037068 | Bacteria | 3165 |
| 1069 | Ga0373925_0191266 | 3300037068 | Bacteria | 1624 |
| 1070 | Ga0395899_0000007 | 3300037312 | Bacteria | 629129 |
| 1071 | Ga0395899_0008149 | 3300037312 | Bacteria | 8074 |
| 1072 | Ga0395899_0027370 | 3300037312 | Bacteria | 4299 |
| 1073 | Ga0395900_0000178 | 3300037418 | Bacteria | 102491 |
| 1074 | Ga0395900_0008538 | 3300037418 | Bacteria | 10529 |
| 1075 | Ga0395900_0010740 | 3300037418 | Bacteria | 9367 |
| 1076 | Ga0395900_0021731 | 3300037418 | Bacteria | 6560 |
| 1077 | Ga0395900_0021936 | 3300037418 | Bacteria | 6529 |
| 1078 | Ga0395900_0122854 | 3300037418 | Bacteria | 2663 |
| 1079 | Ga0395900_0347418 | 3300037418 | Bacteria | 1457 |
| 1080 | Ga0395898_0000015 | 3300037466 | Bacteria | 439819 |
| 1081 | Ga0395898_0000276 | 3300037466 | Bacteria | 124774 |
| 1082 | Ga0395898_0003978 | 3300037466 | Bacteria | 16270 |
| 1083 | Ga0395898_0006320 | 3300037466 | Bacteria | 12656 |
| 1084 | Ga0395898_0012063 | 3300037466 | Bacteria | 8945 |
| 1085 | Ga0395898_0093924 | 3300037466 | Bacteria | 2882 |
| 1086 | Ga0395898_0330453 | 3300037466 | Bacteria | 1453 |
| 1087 | Ga0395905_0101233 | 3300037471 | Bacteria | 2705 |
| 1088 | Ga0395901_0004706 | 3300038443 | Bacteria | 13773 |
| 1089 | Ga0395901_0058868 | 3300038443 | Bacteria | 3997 |
| 1090 | Ga0395901_0205286 | 3300038443 | Bacteria | 2065 |
| 1091 | Ga0237819_00091 | 3300038705 | Bacteria | 32900 |
| 1092 | Ga0436365_1038204 | 3300039437 | Bacteria | 5779 |
| 1093 | Ga0436365_1103987 | 3300039437 | Bacteria | 2406 |
| 1094 | Ga0436365_1795729 | 3300039437 | Bacteria | 11162 |
| 1095 | Ga0436360_0019322 | 3300039438 | Bacteria | 2487 |
| 1096 | Ga0436360_1187113 | 3300039438 | Bacteria | 4771 |
| 1097 | Ga0436360_1316174 | 3300039438 | Bacteria | 3364 |
| 1098 | Ga0436361_0179379 | 3300039447 | Bacteria | 1617 |
| 1099 | Ga0436361_0251474 | 3300039447 | Bacteria | 2269 |
| 1100 | Ga0436361_0644146 | 3300039447 | Bacteria | 21611 |
| 1101 | Ga0436361_1155064 | 3300039447 | Bacteria | 3399 |
| 1102 | Ga0439436_0004743 | 3300041404 | Bacteria | 4169 |
| 1103 | Ga0439439_0004386 | 3300041406 | Bacteria | 3175 |
| 1104 | Ga0439461_0001590 | 3300041410 | Bacteria | 3521 |
| 1105 | Ga0439466_0010665 | 3300041411 | Bacteria | 3415 |
| 1106 | Ga0439465_0001613 | 3300041413 | Bacteria | 7338 |
| 1107 | Ga0439465_0002800 | 3300041413 | Bacteria | 5715 |
| 1108 | Ga0451798_0507020 | 3300041458 | Bacteria | 1587 |
| 1109 | Ga0451837_0067998 | 3300041494 | Bacteria | 1782 |
| 1110 | Ga0451843_1584175 | 3300041509 | Bacteria | 1720 |
| 1111 | Ga0439443_008533 | 3300042003 | Bacteria | 1449 |
| 1112 | Ga0439445_0000750 | 3300042004 | Bacteria | 6796 |
| 1113 | Ga0439448_0000101 | 3300042005 | Bacteria | 15366 |
| 1114 | Ga0439449_0000569 | 3300042007 | Bacteria | 13837 |
| 1115 | Ga0439457_008621 | 3300042014 | Bacteria | 2398 |
| 1116 | Ga0439446_0011920 | 3300042156 | Bacteria | 2368 |
| 1117 | Ga0439458_0000316 | 3300042157 | Bacteria | 12059 |
| 1118 | Ga0439434_0003556 | 3300042435 | Bacteria | 4548 |
| 1119 | Ga0439435_0003112 | 3300042436 | Bacteria | 3405 |
| 1120 | Ga0439435_0021646 | 3300042436 | Bacteria | 1671 |
| 1121 | Ga0466972_0043225 | 3300044658 | Bacteria | 2189 |
| 1122 | Ga0466965_0000624 | 3300044683 | Bacteria | 12902 |
| 1123 | Ga0466965_0072603 | 3300044683 | Bacteria | 1732 |
| 1124 | Ga0466961_0016023 | 3300044693 | Bacteria | 4812 |
| 1125 | Ga0466961_0025946 | 3300044693 | Bacteria | 3767 |
| 1126 | Ga0466961_0035759 | 3300044693 | Bacteria | 3189 |
| 1127 | Ga0466971_0038881 | 3300044719 | Bacteria | 2135 |
| 1128 | Ga0466971_0045234 | 3300044719 | Bacteria | 1977 |
| 1129 | Ga0466970_0042424 | 3300044765 | Bacteria | 2419 |
| 1130 | Ga0466957_0005735 | 3300044842 | Bacteria | 6980 |
| 1131 | Ga0466957_0007465 | 3300044842 | Bacteria | 6175 |
| 1132 | Ga0466957_0074006 | 3300044842 | Bacteria | 2112 |
| 1133 | Ga0466960_0011664 | 3300044901 | Bacteria | 3686 |
| 1134 | Ga0466960_0102830 | 3300044901 | Bacteria | 1474 |
| 1135 | Ga0466960_0120629 | 3300044901 | Bacteria | 1373 |
| 1136 | Ga0466959_0100912 | 3300045049 | Bacteria | 2065 |
| 1137 | Ga0466959_0112636 | 3300045049 | Bacteria | 1940 |
| 1138 | Ga0466958_0044976 | 3300045836 | Bacteria | 2662 |
| 1139 | Ga0466958_0083084 | 3300045836 | Bacteria | 1973 |
| 1140 | Ga0466967_0023808 | 3300045976 | Bacteria | 5024 |
| 1141 | Ga0466967_0039729 | 3300045976 | Bacteria | 4047 |
| 1142 | Ga0466967_0142380 | 3300045976 | Bacteria | 2234 |
| 1143 | Ga0466967_0278625 | 3300045976 | Bacteria | 1604 |
| 1144 | Ga0495592_0002012 | 3300046454 | Bacteria | 14324 |
| 1145 | Ga0495592_0030843 | 3300046454 | Bacteria | 4055 |
| 1146 | Ga0495592_0093548 | 3300046454 | Bacteria | 2153 |
| 1147 | Ga0495592_0162248 | 3300046454 | Bacteria | 1537 |
| 1148 | Ga0495603_0020105 | 3300046455 | Bacteria | 4046 |
| 1149 | Ga0495590_0005946 | 3300046457 | Bacteria | 4784 |
| 1150 | Ga0495590_0012541 | 3300046457 | Bacteria | 3144 |
| 1151 | Ga0495591_007498 | 3300046458 | Bacteria | 4628 |
| 1152 | Ga0495629_0002803 | 3300046459 | Bacteria | 13292 |
| 1153 | Ga0495629_0008252 | 3300046459 | Bacteria | 7658 |
| 1154 | Ga0495629_0018703 | 3300046459 | Bacteria | 4952 |
| 1155 | Ga0495629_0036598 | 3300046459 | Bacteria | 3463 |
| 1156 | Ga0495629_0047179 | 3300046459 | Bacteria | 3021 |
| 1157 | Ga0495629_0060195 | 3300046459 | Bacteria | 2654 |
| 1158 | Ga0495638_0000524 | 3300046460 | Bacteria | 44781 |
| 1159 | Ga0495638_0000660 | 3300046460 | Bacteria | 37623 |
| 1160 | Ga0495638_0000771 | 3300046460 | Bacteria | 34027 |
| 1161 | Ga0495638_0115939 | 3300046460 | Bacteria | 1587 |
| 1162 | Ga0495641_0018334 | 3300046461 | Bacteria | 3615 |
| 1163 | Ga0495641_0044696 | 3300046461 | Bacteria | 2042 |
| 1164 | Ga0495641_0062336 | 3300046461 | Bacteria | 1682 |
| 1165 | Ga0495651_0016841 | 3300046462 | Bacteria | 5660 |
| 1166 | Ga0495651_0059266 | 3300046462 | Bacteria | 2936 |
| 1167 | Ga0495651_0063761 | 3300046462 | Bacteria | 2816 |
| 1168 | Ga0495653_0022294 | 3300046463 | Bacteria | 5126 |
| 1169 | Ga0495653_0059574 | 3300046463 | Bacteria | 2896 |
| 1170 | Ga0495650_0000010 | 3300046471 | Bacteria | 645599 |
| 1171 | Ga0495650_0002608 | 3300046471 | Bacteria | 14136 |
| 1172 | Ga0495650_0006223 | 3300046471 | Bacteria | 7481 |
| 1173 | Ga0495650_0006684 | 3300046471 | Bacteria | 7141 |
| 1174 | Ga0495650_0008172 | 3300046471 | Bacteria | 6153 |
| 1175 | Ga0495650_0029271 | 3300046471 | Bacteria | 2512 |
| 1176 | Ga0495580_0001025 | 3300046472 | Bacteria | 24517 |
| 1177 | Ga0495580_0002243 | 3300046472 | Bacteria | 16884 |
| 1178 | Ga0495580_0008623 | 3300046472 | Bacteria | 8085 |
| 1179 | Ga0495580_0013994 | 3300046472 | Bacteria | 6102 |
| 1180 | Ga0495580_0019567 | 3300046472 | Bacteria | 5030 |
| 1181 | Ga0495580_0026937 | 3300046472 | Bacteria | 4186 |
| 1182 | Ga0495580_0027927 | 3300046472 | Bacteria | 4104 |
| 1183 | Ga0495580_0089287 | 3300046472 | Bacteria | 2145 |
| 1184 | Ga0495580_0181247 | 3300046472 | Bacteria | 1454 |
| 1185 | Ga0495580_0196376 | 3300046472 | Bacteria | 1391 |
| 1186 | Ga0495582_0000629 | 3300046473 | Bacteria | 19423 |
| 1187 | Ga0495582_0003241 | 3300046473 | Bacteria | 9139 |
| 1188 | Ga0495582_0004552 | 3300046473 | Bacteria | 7788 |
| 1189 | Ga0495582_0010551 | 3300046473 | Bacteria | 5082 |
| 1190 | Ga0495582_0122311 | 3300046473 | Bacteria | 1467 |
| 1191 | Ga0495605_0015098 | 3300046474 | Bacteria | 4212 |
| 1192 | Ga0495605_0074168 | 3300046474 | Bacteria | 1602 |
| 1193 | Ga0495639_0007177 | 3300046475 | Bacteria | 4783 |
| 1194 | Ga0495662_0012591 | 3300046476 | Bacteria | 4126 |
| 1195 | Ga0495664_0004527 | 3300046477 | Bacteria | 7603 |
| 1196 | Ga0495664_0014620 | 3300046477 | Bacteria | 4451 |
| 1197 | Ga0495664_0029425 | 3300046477 | Bacteria | 3212 |
| 1198 | Ga0495585_0011113 | 3300046492 | Bacteria | 5340 |
| 1199 | Ga0495585_0036929 | 3300046492 | Bacteria | 2753 |
| 1200 | Ga0495594_0005454 | 3300046499 | Bacteria | 6538 |
| 1201 | Ga0495594_0007680 | 3300046499 | Bacteria | 5548 |
| 1202 | Ga0495594_0012425 | 3300046499 | Bacteria | 4435 |
| 1203 | Ga0495594_0048432 | 3300046499 | Bacteria | 2335 |
| 1204 | Ga0495596_0008596 | 3300046500 | Bacteria | 4536 |
| 1205 | Ga0495596_0017058 | 3300046500 | Bacteria | 3011 |
| 1206 | Ga0495596_0022158 | 3300046500 | Bacteria | 2588 |
| 1207 | Ga0495596_0039457 | 3300046500 | Bacteria | 1865 |
| 1208 | Ga0495583_0007667 | 3300046506 | Bacteria | 6727 |
| 1209 | Ga0495583_0039414 | 3300046506 | Bacteria | 2226 |
| 1210 | Ga0495606_0016529 | 3300046507 | Bacteria | 5619 |
| 1211 | Ga0495606_0055453 | 3300046507 | Bacteria | 2563 |
| 1212 | Ga0495606_0067888 | 3300046507 | Bacteria | 2257 |
| 1213 | Ga0495608_0040078 | 3300046511 | Bacteria | 3138 |
| 1214 | Ga0495608_0052888 | 3300046511 | Bacteria | 2687 |
| 1215 | Ga0495610_0002377 | 3300046512 | Bacteria | 15870 |
| 1216 | Ga0495610_0003137 | 3300046512 | Bacteria | 13134 |
| 1217 | Ga0495610_0032046 | 3300046512 | Bacteria | 2736 |
| 1218 | Ga0495618_0019115 | 3300046514 | Bacteria | 4213 |
| 1219 | Ga0495618_0031243 | 3300046514 | Bacteria | 3330 |
| 1220 | Ga0495620_0024001 | 3300046515 | Bacteria | 2906 |
| 1221 | Ga0495628_0002174 | 3300046516 | Bacteria | 17736 |
| 1222 | Ga0495628_0031291 | 3300046516 | Bacteria | 4304 |
| 1223 | Ga0495630_0006260 | 3300046517 | Bacteria | 8449 |
| 1224 | Ga0495630_0020419 | 3300046517 | Bacteria | 4884 |
| 1225 | Ga0495630_0044220 | 3300046517 | Bacteria | 3328 |
| 1226 | Ga0495630_0058861 | 3300046517 | Bacteria | 2881 |
| 1227 | Ga0495630_0059577 | 3300046517 | Bacteria | 2864 |
| 1228 | Ga0495630_0085528 | 3300046517 | Bacteria | 2381 |
| 1229 | Ga0495644_0003181 | 3300046523 | Bacteria | 6490 |
| 1230 | Ga0495648_0000066 | 3300046524 | Bacteria | 140767 |
| 1231 | Ga0495648_0014966 | 3300046524 | Bacteria | 5651 |
| 1232 | Ga0495648_0030098 | 3300046524 | Bacteria | 3595 |
| 1233 | Ga0495666_0010385 | 3300046526 | Bacteria | 4641 |
| 1234 | Ga0495666_0022651 | 3300046526 | Bacteria | 3111 |
| 1235 | Ga0495642_0014115 | 3300046528 | Bacteria | 3095 |
| 1236 | Ga0495642_0040154 | 3300046528 | Bacteria | 1900 |
| 1237 | Ga0495652_0013301 | 3300046529 | Bacteria | 7406 |
| 1238 | Ga0495654_0000456 | 3300046530 | Bacteria | 34412 |
| 1239 | Ga0495654_0044656 | 3300046530 | Bacteria | 2191 |
| 1240 | Ga0495654_0046961 | 3300046530 | Bacteria | 2124 |
| 1241 | Ga0495665_0005960 | 3300046531 | Bacteria | 6564 |
| 1242 | Ga0495665_0008376 | 3300046531 | Bacteria | 5608 |
| 1243 | Ga0495665_0028815 | 3300046531 | Bacteria | 2975 |
| 1244 | Ga0495665_0046416 | 3300046531 | Bacteria | 2306 |
| 1245 | Ga0495665_0061496 | 3300046531 | Bacteria | 1983 |
| 1246 | Ga0495640_0004522 | 3300046533 | Bacteria | 11090 |
| 1247 | Ga0495640_0008292 | 3300046533 | Bacteria | 8147 |
| 1248 | Ga0495640_0202713 | 3300046533 | Bacteria | 1257 |
| 1249 | Ga0495586_0073522 | 3300046535 | Bacteria | 1870 |
| 1250 | Ga0495587_0001737 | 3300046536 | Bacteria | 14543 |
| 1251 | Ga0495598_0002267 | 3300046537 | Bacteria | 3957 |
| 1252 | Ga0495598_0003753 | 3300046537 | Bacteria | 3247 |
| 1253 | Ga0495609_0010673 | 3300046538 | Bacteria | 4397 |
| 1254 | Ga0495621_0000085 | 3300046539 | Bacteria | 19299 |
| 1255 | Ga0495645_0000331 | 3300046543 | Bacteria | 33651 |
| 1256 | Ga0495645_0002552 | 3300046543 | Bacteria | 12362 |
| 1257 | Ga0495645_0025130 | 3300046543 | Bacteria | 4322 |
| 1258 | Ga0495645_0044754 | 3300046543 | Bacteria | 3228 |
| 1259 | Ga0495645_0081479 | 3300046543 | Bacteria | 2322 |
| 1260 | Ga0495645_0115443 | 3300046543 | Bacteria | 1896 |
| 1261 | Ga0495622_0039273 | 3300046557 | Bacteria | 2204 |
| 1262 | Ga0495622_0041595 | 3300046557 | Bacteria | 2137 |
| 1263 | Ga0495633_0030748 | 3300046558 | Bacteria | 2607 |
| 1264 | Ga0495633_0102686 | 3300046558 | Bacteria | 1327 |
| 1265 | Ga0495667_0038447 | 3300046559 | Bacteria | 3186 |
| 1266 | Ga0495667_0046163 | 3300046559 | Bacteria | 2881 |
| 1267 | Ga0495656_0026282 | 3300046615 | Bacteria | 2316 |
| 1268 | Ga0495668_0002861 | 3300046616 | Bacteria | 13687 |
| 1269 | Ga0495668_0004855 | 3300046616 | Bacteria | 9344 |
| 1270 | Ga0495668_0024560 | 3300046616 | Bacteria | 3428 |
| 1271 | Ga0495634_0107911 | 3300046642 | Bacteria | 1792 |
| 1272 | Ga0495625_0067523 | 3300046660 | Bacteria | 2516 |
| 1273 | Ga0495625_0094896 | 3300046660 | Bacteria | 2057 |
| 1274 | Ga0495635_0000993 | 3300046663 | Bacteria | 18702 |
| 1275 | Ga0495635_0008216 | 3300046663 | Bacteria | 7288 |
| 1276 | Ga0495635_0032291 | 3300046663 | Bacteria | 3632 |
| 1277 | Ga0495635_0081248 | 3300046663 | Bacteria | 2218 |
| 1278 | Ga0495635_0155215 | 3300046663 | Bacteria | 1558 |
| 1279 | Ga0495659_0050810 | 3300046664 | Bacteria | 1509 |
| 1280 | Ga0495661_0001703 | 3300046665 | Bacteria | 17820 |
| 1281 | Ga0495588_0008882 | 3300046674 | Bacteria | 4625 |
| 1282 | Ga0495657_0004997 | 3300046675 | Bacteria | 10538 |
| 1283 | Ga0495657_0025873 | 3300046675 | Bacteria | 4163 |
| 1284 | Ga0495657_0218651 | 3300046675 | Bacteria | 1156 |
| 1285 | Ga0495599_0079861 | 3300046678 | Bacteria | 2043 |
| 1286 | Ga0495623_0048362 | 3300046679 | Bacteria | 2698 |
| 1287 | Ga0495646_0000924 | 3300046680 | Bacteria | 16694 |
| 1288 | Ga0495646_0029020 | 3300046680 | Bacteria | 3460 |
| 1289 | Ga0495646_0066861 | 3300046680 | Bacteria | 2125 |
| 1290 | Ga0495669_0012480 | 3300046684 | Bacteria | 3617 |
| 1291 | Ga0495613_0003805 | 3300046689 | Bacteria | 11315 |
| 1292 | Ga0495613_0009065 | 3300046689 | Bacteria | 7381 |
| 1293 | Ga0495613_0016936 | 3300046689 | Bacteria | 5427 |
| 1294 | Ga0495613_0028018 | 3300046689 | Bacteria | 4192 |
| 1295 | Ga0495613_0074840 | 3300046689 | Bacteria | 2466 |
| 1296 | Ga0495624_0001188 | 3300046690 | Bacteria | 20585 |
| 1297 | Ga0495624_0016621 | 3300046690 | Bacteria | 4951 |
| 1298 | Ga0495624_0078015 | 3300046690 | Bacteria | 2054 |
| 1299 | Ga0495624_0152955 | 3300046690 | Bacteria | 1411 |
| 1300 | Ga0495670_0000012 | 3300046691 | Bacteria | 170426 |
| 1301 | Ga0495670_0004038 | 3300046691 | Bacteria | 7199 |
| 1302 | Ga0495670_0069207 | 3300046691 | Bacteria | 1784 |
| 1303 | Ga0495671_0013693 | 3300046692 | Bacteria | 4383 |
| 1304 | Ga0495649_0016355 | 3300046694 | Bacteria | 4204 |
| 1305 | Ga0495589_0022210 | 3300046794 | Bacteria | 3239 |
| 1306 | Ga0495589_0059478 | 3300046794 | Bacteria | 1878 |
| 1307 | Ga0495589_0067180 | 3300046794 | Bacteria | 1755 |
| 1308 | Ga0495600_0002361 | 3300046809 | Bacteria | 10782 |
| 1309 | Ga0495600_0014475 | 3300046809 | Bacteria | 4970 |
| 1310 | Ga0495600_0049867 | 3300046809 | Bacteria | 2731 |
| 1311 | Ga0495600_0126510 | 3300046809 | Bacteria | 1662 |
| 1312 | Ga0495581_0002516 | 3300047315 | Bacteria | 10405 |
| 1313 | Ga0495581_0005826 | 3300047315 | Bacteria | 7143 |
| 1314 | Ga0495581_0006324 | 3300047315 | Bacteria | 6871 |
| 1315 | Ga0495581_0007107 | 3300047315 | Bacteria | 6484 |
| 1316 | Ga0495581_0024403 | 3300047315 | Bacteria | 3504 |
| 1317 | Ga0495604_0000171 | 3300047317 | Bacteria | 57216 |
| 1318 | Ga0495636_0016396 | 3300047318 | Bacteria | 2958 |
| 1319 | Ga0495674_0001885 | 3300047319 | Bacteria | 20656 |
| 1320 | Ga0495674_0003055 | 3300047319 | Bacteria | 16277 |
| 1321 | Ga0495674_0004949 | 3300047319 | Bacteria | 12814 |
| 1322 | Ga0495674_0029631 | 3300047319 | Bacteria | 4982 |
| 1323 | Ga0495674_0064294 | 3300047319 | Bacteria | 3189 |
| 1324 | Ga0495674_0078474 | 3300047319 | Bacteria | 2837 |
| 1325 | Ga0495674_0106062 | 3300047319 | Bacteria | 2387 |
| 1326 | Ga0495674_0271867 | 3300047319 | Bacteria | 1390 |
| 1327 | Ga0495672_0005687 | 3300047320 | Bacteria | 9824 |
| 1328 | Ga0495672_0011070 | 3300047320 | Bacteria | 6386 |
| 1329 | Ga0495672_0104019 | 3300047320 | Bacteria | 1535 |
| 1330 | Ga0495676_0031826 | 3300047321 | Bacteria | 4457 |
| 1331 | Ga0495676_0055285 | 3300047321 | Bacteria | 3148 |
| 1332 | Ga0495680_0036344 | 3300047322 | Bacteria | 3955 |
| 1333 | Ga0495680_0081120 | 3300047322 | Bacteria | 2450 |
| 1334 | Ga0495680_0097822 | 3300047322 | Bacteria | 2190 |
| 1335 | Ga0495683_0002900 | 3300047323 | Bacteria | 10141 |
| 1336 | Ga0495683_0003522 | 3300047323 | Bacteria | 9110 |
| 1337 | Ga0495683_0011841 | 3300047323 | Bacteria | 4585 |
| 1338 | Ga0495683_0021022 | 3300047323 | Bacteria | 3364 |
| 1339 | Ga0495687_005145 | 3300047443 | Bacteria | 8465 |
| 1340 | Ga0495687_006290 | 3300047443 | Bacteria | 7320 |
| 1341 | Ga0495675_0016288 | 3300047444 | Bacteria | 4702 |
| 1342 | Ga0495675_0019550 | 3300047444 | Bacteria | 4302 |
| 1343 | Ga0495675_0123453 | 3300047444 | Bacteria | 1612 |
| 1344 | Ga0495679_000273 | 3300047446 | Bacteria | 43168 |
| 1345 | Ga0495679_000939 | 3300047446 | Bacteria | 18147 |
| 1346 | Ga0495679_034080 | 3300047446 | Bacteria | 1623 |
| 1347 | Ga0495673_0000333 | 3300047469 | Bacteria | 60696 |
| 1348 | Ga0495673_0022148 | 3300047469 | Bacteria | 3119 |
| 1349 | Ga0495684_0185286 | 3300047471 | Bacteria | 1541 |
| 1350 | Ga0495686_0001315 | 3300047472 | Bacteria | 27861 |
| 1351 | Ga0495686_0027530 | 3300047472 | Bacteria | 3710 |
| 1352 | Ga0495593_0017631 | 3300047673 | Bacteria | 4019 |
| 1353 | Ga0495593_0025352 | 3300047673 | Bacteria | 3282 |
| 1354 | Ga0495593_0081482 | 3300047673 | Bacteria | 1673 |
| 1355 | Ga0495602_0002240 | 3300048088 | Bacteria | 19517 |
| 1356 | Ga0495602_0025467 | 3300048088 | Bacteria | 5725 |
| 1357 | Ga0495602_0109752 | 3300048088 | Bacteria | 2244 |
| 1358 | Ga0495602_0241556 | 3300048088 | Bacteria | 1351 |
| 1359 | Ga0495614_0001803 | 3300048089 | Bacteria | 9373 |
| 1360 | Ga0495614_0006770 | 3300048089 | Bacteria | 5127 |
| 1361 | Ga0495626_0004431 | 3300048091 | Bacteria | 8624 |
| 1362 | Ga0495626_0006020 | 3300048091 | Bacteria | 6973 |
| 1363 | Ga0495626_0046631 | 3300048091 | Bacteria | 2018 |
| 1364 | Ga0496100_0000329 | 3300048903 | Bacteria | 23294 |
| 1365 | Ga0496100_0047202 | 3300048903 | Bacteria | 2773 |
| 1366 | Ga0496100_0109795 | 3300048903 | Bacteria | 1914 |
| 1367 | Ga0496100_0187490 | 3300048903 | Bacteria | 1499 |
| 1368 | Ga0496101_0000240 | 3300048904 | Bacteria | 40657 |
| 1369 | Ga0496101_0021193 | 3300048904 | Bacteria | 4462 |
| 1370 | Ga0496101_0158394 | 3300048904 | Bacteria | 1735 |
| 1371 | Ga0496101_0224304 | 3300048904 | Bacteria | 1459 |
| 1372 | Ga0496102_0000431 | 3300048905 | Bacteria | 48474 |
| 1373 | Ga0496102_0061300 | 3300048905 | Bacteria | 3443 |
| 1374 | Ga0496102_0066063 | 3300048905 | Bacteria | 3315 |
| 1375 | Ga0496102_0141287 | 3300048905 | Bacteria | 2258 |
| 1376 | Ga0496102_0193590 | 3300048905 | Bacteria | 1916 |
| 1377 | Ga0496103_0000536 | 3300048906 | Bacteria | 30559 |
| 1378 | Ga0496103_0030896 | 3300048906 | Bacteria | 3261 |
| 1379 | Ga0496103_0093199 | 3300048906 | Bacteria | 1902 |
| 1380 | Ga0496103_0107035 | 3300048906 | Bacteria | 1774 |
| 1381 | Ga0496103_0128347 | 3300048906 | Bacteria | 1618 |
| 1382 | Ga0496104_0000520 | 3300048907 | Bacteria | 32906 |
| 1383 | Ga0496104_0001700 | 3300048907 | Bacteria | 19007 |
| 1384 | Ga0496104_0025723 | 3300048907 | Bacteria | 5428 |
| 1385 | Ga0496104_0065529 | 3300048907 | Bacteria | 3447 |
| 1386 | Ga0496104_0161793 | 3300048907 | Bacteria | 2147 |
| 1387 | Ga0496104_0323625 | 3300048907 | Bacteria | 1455 |
| 1388 | Ga0496105_0004098 | 3300048908 | Bacteria | 10922 |
| 1389 | Ga0496105_0060506 | 3300048908 | Bacteria | 3125 |
| 1390 | Ga0496105_0061918 | 3300048908 | Bacteria | 3088 |
| 1391 | Ga0496105_0189970 | 3300048908 | Bacteria | 1680 |
| 1392 | Ga0496106_0000494 | 3300048909 | Bacteria | 27913 |
| 1393 | Ga0496106_0058812 | 3300048909 | Bacteria | 2911 |
| 1394 | Ga0496106_0118051 | 3300048909 | Bacteria | 2071 |
| 1395 | Ga0496107_0025599 | 3300048910 | Bacteria | 4178 |
| 1396 | Ga0496107_0031807 | 3300048910 | Bacteria | 3768 |
| 1397 | Ga0496108_0031402 | 3300048911 | Bacteria | 4408 |
| 1398 | Ga0496108_0067322 | 3300048911 | Bacteria | 3021 |
| 1399 | Ga0496109_0015425 | 3300048912 | Bacteria | 6659 |
| 1400 | Ga0496110_0388483 | 3300048913 | Bacteria | 1272 |
| 1401 | Ga0496111_0003474 | 3300048914 | Bacteria | 9757 |
| 1402 | Ga0496111_0010345 | 3300048914 | Bacteria | 6257 |
| 1403 | Ga0496111_0022644 | 3300048914 | Bacteria | 4401 |
| 1404 | Ga0496112_0015283 | 3300048915 | Bacteria | 7157 |
| 1405 | Ga0496112_0041087 | 3300048915 | Bacteria | 4524 |
| 1406 | Ga0496112_0110468 | 3300048915 | Bacteria | 2719 |
| 1407 | Ga0496112_0160144 | 3300048915 | Bacteria | 2217 |
| 1408 | Ga0496112_0347368 | 3300048915 | Unclassified | 1426 |
| 1409 | Ga0496113_0003971 | 3300048916 | Bacteria | 8988 |
| 1410 | Ga0496114_0009894 | 3300048917 | Bacteria | 7579 |
| 1411 | Ga0496114_0013881 | 3300048917 | Bacteria | 6457 |
| 1412 | Ga0496114_0022844 | 3300048917 | Bacteria | 5098 |
| 1413 | Ga0496114_0024150 | 3300048917 | Bacteria | 4961 |
| 1414 | Ga0496114_0083014 | 3300048917 | Bacteria | 2710 |
| 1415 | Ga0496114_0086916 | 3300048917 | Bacteria | 2650 |
| 1416 | Ga0496114_0265627 | 3300048917 | Bacteria | 1512 |
| 1417 | Ga0496115_0000095 | 3300048918 | Bacteria | 82835 |
| 1418 | Ga0496115_0000418 | 3300048918 | Bacteria | 34681 |
| 1419 | Ga0496115_0007083 | 3300048918 | Bacteria | 8238 |
| 1420 | Ga0496115_0007701 | 3300048918 | Bacteria | 7942 |
| 1421 | Ga0496115_0021039 | 3300048918 | Bacteria | 5035 |
| 1422 | Ga0496115_0039979 | 3300048918 | Bacteria | 3726 |
| 1423 | Ga0496115_0072207 | 3300048918 | Bacteria | 2800 |
| 1424 | Ga0496115_0090722 | 3300048918 | Bacteria | 2496 |
| 1425 | Ga0496115_0155710 | 3300048918 | Bacteria | 1888 |
| 1426 | Ga0496115_0356621 | 3300048918 | Bacteria | 1192 |
| 1427 | Ga0496116_0044250 | 3300048919 | Bacteria | 3026 |
| 1428 | Ga0496116_0070464 | 3300048919 | Bacteria | 2218 |
| 1429 | Ga0496117_0000660 | 3300048920 | Bacteria | 55175 |
| 1430 | Ga0496117_0001545 | 3300048920 | Bacteria | 32728 |
| 1431 | Ga0496117_0001713 | 3300048920 | Bacteria | 30347 |
| 1432 | Ga0496117_0005687 | 3300048920 | Bacteria | 12987 |
| 1433 | Ga0496117_0013332 | 3300048920 | Bacteria | 7179 |
| 1434 | Ga0496117_0123880 | 3300048920 | Bacteria | 1582 |
| 1435 | Ga0496118_0000489 | 3300048921 | Bacteria | 65595 |
| 1436 | Ga0496118_0000553 | 3300048921 | Bacteria | 61663 |
| 1437 | Ga0496118_0002148 | 3300048921 | Bacteria | 27514 |
| 1438 | Ga0496118_0003048 | 3300048921 | Bacteria | 21570 |
| 1439 | Ga0496118_0021171 | 3300048921 | Bacteria | 5734 |
| 1440 | Ga0496118_0026330 | 3300048921 | Bacteria | 4957 |
| 1441 | Ga0496118_0028675 | 3300048921 | Bacteria | 4683 |
| 1442 | Ga0496118_0056819 | 3300048921 | Bacteria | 2938 |
| 1443 | Ga0496118_0136068 | 3300048921 | Bacteria | 1568 |
| 1444 | Ga0496120_0013641 | 3300048923 | Bacteria | 5461 |
| 1445 | Ga0496121_0001288 | 3300048924 | Bacteria | 43215 |
| 1446 | Ga0496121_0012333 | 3300048924 | Bacteria | 9345 |
| 1447 | Ga0496122_0031846 | 3300048925 | Bacteria | 4375 |
| 1448 | Ga0496123_0038126 | 3300048926 | Bacteria | 3383 |
| 1449 | Ga0496124_0005515 | 3300048927 | Bacteria | 14203 |
| 1450 | Ga0496124_0006356 | 3300048927 | Bacteria | 12894 |
| 1451 | Ga0496124_0009191 | 3300048927 | Bacteria | 10199 |
| 1452 | Ga0496124_0037489 | 3300048927 | Bacteria | 4216 |
| 1453 | Ga0496124_0049123 | 3300048927 | Bacteria | 3600 |
| 1454 | Ga0496125_0009204 | 3300048928 | Bacteria | 10203 |
| 1455 | Ga0496125_0034981 | 3300048928 | Bacteria | 4418 |
| 1456 | Ga0496126_0000004 | 3300048929 | Bacteria | 925026 |
| 1457 | Ga0496126_0000012 | 3300048929 | Bacteria | 727789 |
| 1458 | Ga0496126_0000164 | 3300048929 | Bacteria | 152791 |
| 1459 | Ga0496126_0001766 | 3300048929 | Bacteria | 31999 |
| 1460 | Ga0496126_0005504 | 3300048929 | Bacteria | 14433 |
| 1461 | Ga0495678_000685 | 3300049459 | Bacteria | 31121 |
| 1462 | Ga0495678_002606 | 3300049459 | Bacteria | 12046 |
| 1463 | Ga0495678_010935 | 3300049459 | Bacteria | 4373 |
| 1464 | Ga0495678_023431 | 3300049459 | Bacteria | 2682 |
| 1465 | Ga0495682_0011546 | 3300049460 | Bacteria | 3398 |
| 1466 | Ga0495682_0033312 | 3300049460 | Bacteria | 1902 |
| 1467 | Ga0501031_0000677 | 3300049568 | Bacteria | 20289 |
| 1468 | Ga0501032_0022260 | 3300049569 | Bacteria | 4394 |
| 1469 | Ga0501032_0022667 | 3300049569 | Bacteria | 4351 |
| 1470 | Ga0501032_0037277 | 3300049569 | Bacteria | 3315 |
| 1471 | Ga0501033_0005905 | 3300049570 | Bacteria | 9614 |
| 1472 | Ga0501033_0052034 | 3300049570 | Bacteria | 3035 |
| 1473 | Ga0501033_0109883 | 3300049570 | Bacteria | 2007 |
| 1474 | Ga0501034_0000134 | 3300049571 | Bacteria | 137745 |
| 1475 | Ga0501034_0029789 | 3300049571 | Bacteria | 5548 |
| 1476 | Ga0501034_0031233 | 3300049571 | Bacteria | 5411 |
| 1477 | Ga0501034_0034281 | 3300049571 | Bacteria | 5146 |
| 1478 | Ga0501034_0039420 | 3300049571 | Bacteria | 4785 |
| 1479 | Ga0501034_0061238 | 3300049571 | Bacteria | 3780 |
| 1480 | Ga0501034_0067155 | 3300049571 | Bacteria | 3599 |
| 1481 | Ga0501034_0070685 | 3300049571 | Bacteria | 3501 |
| 1482 | Ga0501034_0117618 | 3300049571 | Bacteria | 2645 |
| 1483 | Ga0501034_0131338 | 3300049571 | Bacteria | 2487 |
| 1484 | Ga0501034_0265814 | 3300049571 | Bacteria | 1657 |
| 1485 | Ga0501036_0023597 | 3300049572 | Bacteria | 5183 |
| 1486 | Ga0501036_0059637 | 3300049572 | Bacteria | 3233 |
| 1487 | Ga0501036_0379981 | 3300049572 | Bacteria | 1179 |
| 1488 | Ga0501036_0398219 | 3300049572 | Bacteria | 1149 |
| 1489 | Ga0501037_0010071 | 3300049573 | Bacteria | 6935 |
| 1490 | Ga0501037_0016093 | 3300049573 | Bacteria | 5503 |
| 1491 | Ga0501037_0017926 | 3300049573 | Bacteria | 5212 |
| 1492 | Ga0501038_0015713 | 3300049574 | Bacteria | 6879 |
| 1493 | Ga0501038_0021058 | 3300049574 | Bacteria | 5858 |
| 1494 | Ga0501038_0028912 | 3300049574 | Bacteria | 4919 |
| 1495 | Ga0501038_0047993 | 3300049574 | Bacteria | 3696 |
| 1496 | Ga0501038_0051473 | 3300049574 | Bacteria | 3553 |
| 1497 | Ga0501038_0196683 | 3300049574 | Bacteria | 1620 |
| 1498 | Ga0501038_0272372 | 3300049574 | Bacteria | 1334 |
| 1499 | Ga0501039_0000155 | 3300049575 | Bacteria | 47199 |
| 1500 | Ga0501039_0003043 | 3300049575 | Bacteria | 12546 |
| 1501 | Ga0501039_0011983 | 3300049575 | Bacteria | 6609 |
| 1502 | Ga0501039_0018373 | 3300049575 | Bacteria | 5366 |
| 1503 | Ga0501039_0023094 | 3300049575 | Bacteria | 4771 |
| 1504 | Ga0501039_0064657 | 3300049575 | Bacteria | 2836 |
| 1505 | Ga0501043_0002350 | 3300049579 | Bacteria | 16037 |
| 1506 | Ga0501043_0005289 | 3300049579 | Bacteria | 10436 |
| 1507 | Ga0501043_0008249 | 3300049579 | Bacteria | 8205 |
| 1508 | Ga0501043_0104806 | 3300049579 | Bacteria | 2222 |
| 1509 | Ga0501046_0063205 | 3300049580 | Bacteria | 2891 |
| 1510 | Ga0501046_0077634 | 3300049580 | Bacteria | 2570 |
| 1511 | Ga0501046_0106977 | 3300049580 | Bacteria | 2140 |
| 1512 | Ga0501047_0002497 | 3300049581 | Bacteria | 17538 |
| 1513 | Ga0501047_0003483 | 3300049581 | Bacteria | 14876 |
| 1514 | Ga0501047_0012111 | 3300049581 | Bacteria | 8164 |
| 1515 | Ga0501047_0036175 | 3300049581 | Bacteria | 4770 |
| 1516 | Ga0501047_0052550 | 3300049581 | Bacteria | 3938 |
| 1517 | Ga0501047_0107039 | 3300049581 | Bacteria | 2677 |
| 1518 | Ga0501047_0139688 | 3300049581 | Bacteria | 2301 |
| 1519 | Ga0501047_0189711 | 3300049581 | Bacteria | 1919 |
| 1520 | Ga0501047_0222039 | 3300049581 | Bacteria | 1745 |
| 1521 | Ga0501048_0020590 | 3300049582 | Bacteria | 4833 |
| 1522 | Ga0501048_0137840 | 3300049582 | Bacteria | 1724 |
| 1523 | Ga0501067_0002848 | 3300049583 | Bacteria | 9521 |
| 1524 | Ga0501067_0005996 | 3300049583 | Bacteria | 6736 |
| 1525 | Ga0501068_0016921 | 3300049584 | Bacteria | 4210 |
| 1526 | Ga0501068_0113478 | 3300049584 | Bacteria | 1686 |
| 1527 | Ga0501069_0000376 | 3300049585 | Bacteria | 20152 |
| 1528 | Ga0501070_0000063 | 3300049586 | Bacteria | 92104 |
| 1529 | Ga0501070_0005955 | 3300049586 | Bacteria | 10392 |
| 1530 | Ga0501070_0100445 | 3300049586 | Bacteria | 2393 |
| 1531 | Ga0501070_0280618 | 3300049586 | Bacteria | 1359 |
| 1532 | Ga0501071_0136805 | 3300049587 | Bacteria | 1823 |
| 1533 | Ga0501072_0070637 | 3300049588 | Bacteria | 2758 |
| 1534 | Ga0501073_0019811 | 3300049589 | Bacteria | 4854 |
| 1535 | Ga0501073_0049499 | 3300049589 | Bacteria | 2947 |
| 1536 | Ga0501073_0051797 | 3300049589 | Bacteria | 2875 |
| 1537 | Ga0501073_0077001 | 3300049589 | Bacteria | 2321 |
| 1538 | Ga0501074_0013722 | 3300049590 | Bacteria | 5889 |
| 1539 | Ga0501076_0243888 | 3300049592 | Bacteria | 1470 |
| 1540 | Ga0501079_0013523 | 3300049741 | Bacteria | 6224 |
| 1541 | Ga0501079_0017576 | 3300049741 | Bacteria | 5462 |
| 1542 | Ga0501080_0016216 | 3300049742 | Bacteria | 6878 |
| 1543 | Ga0501080_0056304 | 3300049742 | Bacteria | 3662 |
| 1544 | Ga0501080_0110619 | 3300049742 | Bacteria | 2546 |
| 1545 | Ga0501080_0151692 | 3300049742 | Bacteria | 2142 |
| 1546 | Ga0501083_0000253 | 3300049744 | Bacteria | 34060 |
| 1547 | Ga0501083_0000698 | 3300049744 | Bacteria | 21865 |
| 1548 | Ga0501083_0008100 | 3300049744 | Bacteria | 7432 |
| 1549 | Ga0501083_0010189 | 3300049744 | Bacteria | 6624 |
| 1550 | Ga0501083_0016677 | 3300049744 | Bacteria | 5133 |
| 1551 | Ga0501035_0002824 | 3300049822 | Bacteria | 16799 |
| 1552 | Ga0501035_0006275 | 3300049822 | Bacteria | 11180 |
| 1553 | Ga0501035_0022787 | 3300049822 | Bacteria | 5751 |
| 1554 | Ga0501035_0070383 | 3300049822 | Bacteria | 3099 |
| 1555 | Ga0501035_0168215 | 3300049822 | Bacteria | 1895 |
| 1556 | Ga0501035_0289115 | 3300049822 | Bacteria | 1384 |
| 1557 | Ga0501044_0000231 | 3300049823 | Bacteria | 70134 |
| 1558 | Ga0501044_0003105 | 3300049823 | Bacteria | 18814 |
| 1559 | Ga0501044_0005924 | 3300049823 | Bacteria | 13543 |
| 1560 | Ga0501044_0146748 | 3300049823 | Bacteria | 2344 |
| 1561 | Ga0501044_0232059 | 3300049823 | Bacteria | 1792 |
| 1562 | nmdc:mga03683_104830_c1 | 3300050489 | Bacteria | 1245 |
| 1563 | nmdc:mga03n38_21227_c1 | 3300050490 | Bacteria | 2610 |
| 1564 | nmdc:mga00v17_1482_c1 | 3300050491 | Eukaryota | 12279 |
| 1565 | nmdc:mga00v17_24033_c1 | 3300050491 | Bacteria | 3531 |
| 1566 | nmdc:mga00v17_49158_c1 | 3300050491 | Bacteria | 2558 |
| 1567 | nmdc:mga00v17_5440_c1 | 3300050491 | Eukaryota | 6706 |
| 1568 | nmdc:mga00v17_678_c1 | 3300050491 | Bacteria | 18717 |
| 1569 | nmdc:mga00v17_83159_c1 | 3300050491 | Bacteria | 2002 |
| 1570 | nmdc:mga0yw44_159_c1 | 3300050492 | Bacteria | 23304 |
| 1571 | nmdc:mga0yw44_9052_c1 | 3300050492 | Bacteria | 5006 |
| 1572 | nmdc:mga0k408_1287_c1 | 3300050493 | Bacteria | 13598 |
| 1573 | nmdc:mga0k408_255_c1 | 3300050493 | Bacteria | 29002 |
| 1574 | nmdc:mga0k408_42255_c1 | 3300050493 | Bacteria | 2625 |
| 1575 | nmdc:mga06z11_2047_c1 | 3300050494 | Eukaryota | 7651 |
| 1576 | nmdc:mga06z11_2323_c1 | 3300050494 | Bacteria | 7236 |
| 1577 | nmdc:mga04h51_1684_c1 | 3300050495 | Bacteria | 5154 |
| 1578 | nmdc:mga04h51_25807_c1 | 3300050495 | Bacteria | 1812 |
| 1579 | nmdc:mga07m45_115875_c1 | 3300050496 | Bacteria | 1545 |
| 1580 | nmdc:mga07m45_125_c1 | 3300050496 | Bacteria | 30481 |
| 1581 | nmdc:mga07m45_4932_c1 | 3300050496 | Bacteria | 6575 |
| 1582 | nmdc:mga05p37_1061_c1 | 3300050507 | Bacteria | 31431 |
| 1583 | nmdc:mga05p37_127307_c1 | 3300050507 | Bacteria | 3127 |
| 1584 | nmdc:mga05p37_26887_c1 | 3300050507 | Bacteria | 7001 |
| 1585 | nmdc:mga05p37_94457_c1 | 3300050507 | Bacteria | 3684 |
| 1586 | nmdc:mga09592_331305_c1 | 3300050508 | Bacteria | 1318 |
| 1587 | nmdc:mga09592_3415_c1 | 3300050508 | Bacteria | 12836 |
| 1588 | nmdc:mga0qj67_62723_c1 | 3300050509 | Bacteria | 2954 |
| 1589 | nmdc:mga06r32_302370_c1 | 3300050510 | Bacteria | 1586 |
| 1590 | nmdc:mga08y16_2005_c1 | 3300050511 | Bacteria | 20820 |
| 1591 | nmdc:mga08y16_30259_c1 | 3300050511 | Bacteria | 5699 |
| 1592 | nmdc:mga08y16_365477_c1 | 3300050511 | Bacteria | 1481 |
| 1593 | nmdc:mga08y16_75174_c1 | 3300050511 | Bacteria | 3522 |
| 1594 | nmdc:mga0n895_111855_c1 | 3300050512 | Unclassified | 2748 |
| 1595 | nmdc:mga0n895_123797_c1 | 3300050512 | Bacteria | 2608 |
| 1596 | nmdc:mga0n895_125788_c1 | 3300050512 | Bacteria | 2587 |
| 1597 | nmdc:mga0n895_148550_c1 | 3300050512 | Bacteria | 2373 |
| 1598 | nmdc:mga0n895_218486_c1 | 3300050512 | Bacteria | 1935 |
| 1599 | nmdc:mga0n895_400_c1 | 3300050512 | Bacteria | 29183 |
| 1600 | nmdc:mga0n895_95343_c1 | 3300050512 | Bacteria | 2980 |
| 1601 | nmdc:mga0rr50_153234_c1 | 3300050513 | Bacteria | 1865 |
| 1602 | nmdc:mga0rr50_3425_c1 | 3300050513 | Bacteria | 9122 |
| 1603 | nmdc:mga0rr50_64788_c1 | 3300050513 | Bacteria | 2766 |
| 1604 | nmdc:mga08x19_11861_c1 | 3300050514 | Bacteria | 5240 |
| 1605 | nmdc:mga08x19_15973_c1 | 3300050514 | Bacteria | 4574 |
| 1606 | nmdc:mga08x19_62163_c1 | 3300050514 | Bacteria | 2421 |
| 1607 | nmdc:mga08x19_812_c1 | 3300050514 | Bacteria | 19830 |
| 1608 | nmdc:mga08x19_8318_c1 | 3300050514 | Bacteria | 6174 |
| 1609 | nmdc:mga08x19_97023_c1 | 3300050514 | Bacteria | 1951 |
| 1610 | nmdc:mga0a205_267631_c1 | 3300050515 | Bacteria | 1586 |
| 1611 | nmdc:mga0a205_38681_c1 | 3300050515 | Bacteria | 4590 |
| 1612 | nmdc:mga0a205_76833_c1 | 3300050515 | Bacteria | 3227 |
| 1613 | nmdc:mga0sz30_21_c2 | 3300050516 | Bacteria | 37875 |
| 1614 | Ga0495601_0002820 | 3300053077 | Bacteria | 9864 |
| 1615 | Ga0495601_0030486 | 3300053077 | Bacteria | 3349 |
| 1616 | Ga0495601_0045594 | 3300053077 | Bacteria | 2758 |
| 1617 | Ga0495612_0046140 | 3300053078 | Bacteria | 1784 |
| 1618 | Ga0500635_0000075 | 3300053080 | Bacteria | 64005 |
| 1619 | Ga0495595_0026468 | 3300053084 | Bacteria | 2578 |
| 1620 | Ga0495619_0013014 | 3300053085 | Bacteria | 5242 |
| 1621 | Ga0495619_0025834 | 3300053085 | Bacteria | 3775 |
| 1622 | Ga0495619_0032276 | 3300053085 | Bacteria | 3397 |
| 1623 | Ga0495619_0050085 | 3300053085 | Bacteria | 2756 |
| 1624 | Ga0500578_0000082 | 3300053086 | Bacteria | 105580 |
| 1625 | Ga0500578_0000385 | 3300053086 | Bacteria | 54183 |
| 1626 | Ga0500643_011668 | 3300053087 | Bacteria | 3191 |
| 1627 | Ga0500644_0000109 | 3300053088 | Bacteria | 52262 |
| 1628 | Ga0500646_0000459 | 3300053090 | Bacteria | 12065 |
| 1629 | Ga0500566_0009372 | 3300053094 | Bacteria | 5788 |
| 1630 | Ga0500566_0029192 | 3300053094 | Bacteria | 3222 |
| 1631 | Ga0500640_004532 | 3300053095 | Bacteria | 5059 |
| 1632 | Ga0500562_058560 | 3300053108 | Bacteria | 1034 |
| 1633 | Ga0500572_001651 | 3300053111 | Bacteria | 5843 |
| 1634 | Ga0500595_000803 | 3300053119 | Bacteria | 18206 |
| 1635 | Ga0500614_000873 | 3300053123 | Bacteria | 7610 |
| 1636 | Ga0500658_0006658 | 3300053134 | Bacteria | 4282 |
| 1637 | Ga0500559_0009950 | 3300053136 | Bacteria | 4097 |
| 1638 | Ga0500568_0002365 | 3300053139 | Bacteria | 11162 |
| 1639 | Ga0500573_0041144 | 3300053140 | Bacteria | 2668 |
| 1640 | Ga0500577_0001382 | 3300053142 | Bacteria | 6200 |
| 1641 | Ga0500603_005912 | 3300053150 | Bacteria | 2649 |
| 1642 | Ga0500616_0000175 | 3300053153 | Bacteria | 106718 |
| 1643 | Ga0500616_0000304 | 3300053153 | Bacteria | 71131 |
| 1644 | Ga0500616_0007478 | 3300053153 | Bacteria | 6930 |
| 1645 | Ga0500619_039615 | 3300053154 | Bacteria | 1482 |
| 1646 | Ga0500622_0006457 | 3300053156 | Bacteria | 6788 |
| 1647 | Ga0500622_0022484 | 3300053156 | Bacteria | 3343 |
| 1648 | Ga0500622_0043262 | 3300053156 | Bacteria | 2336 |
| 1649 | Ga0500624_000010 | 3300053157 | Bacteria | 172530 |
| 1650 | Ga0500633_0003207 | 3300053160 | Bacteria | 3522 |
| 1651 | Ga0500636_0001018 | 3300053177 | Bacteria | 15023 |
| 1652 | Ga0500601_001174 | 3300053737 | Bacteria | 2922 |
| 1653 | Ga0501084_0023017 | 3300054114 | Bacteria | 5200 |
| 1654 | Ga0501084_0113137 | 3300054114 | Bacteria | 2281 |
| 1655 | Ga0501084_0220502 | 3300054114 | Bacteria | 1600 |
| 1656 | Ga0501082_0008535 | 3300060353 | Bacteria | 8835 |
| 1657 | Ga0501082_0008939 | 3300060353 | Bacteria | 8645 |
| 1658 | Ga0501082_0015864 | 3300060353 | Bacteria | 6477 |
| 1659 | Ga0501082_0149744 | 3300060353 | Bacteria | 2026 |
| 1660 | Ga0501082_0318212 | 3300060353 | Bacteria | 1355 |
| 1661 | Ga0466962_0011986 | 3300061719 | Bacteria | 4170 |
| 1662 | 2501071596 | 2501025501 | Bacteria | 7768574 |
| 1663 | 2501406993 | 2501025504 | Bacteria | 8008976 |
| 1664 | 2508735020 | 2508501050 | Bacteria | 9633614 |
| 1665 | 2509075644 | 2508501114 | Bacteria | 7082538 |
| 1666 | 2511097894 | 2510917014 | Bacteria | 8296963 |
| 1667 | 2511108080 | 2510917015 | Bacteria | 7950052 |
| 1668 | 2511171181 | 2510917026 | Bacteria | 7046020 |
| 1669 | 2511196915 | 2510917030 | Bacteria | 7460662 |
| 1670 | 2514046995 | 2513237166 | Bacteria | 10373764 |
| 1671 | 2516021920 | 2515154189 | Bacteria | 9629850 |
| 1672 | 2523105081 | 2522572158 | Bacteria | 6514390 |
| 1673 | 2583150147 | 2582580736 | Bacteria | 5325865 |
| 1674 | 2585147618 | 2582581279 | Bacteria | 4980720 |
| 1675 | 2585147965 | 2582581279 | Bacteria | 4980720 |
| 1676 | 2585205182 | 2582581294 | Bacteria | 6626667 |
| 1677 | 2585226398 | 2582581298 | Bacteria | 7315509 |
| 1678 | 2585548682 | 2585427529 | Bacteria | 7395659 |
| 1679 | 2599748274 | 2599185240 | Bacteria | 7968121 |
| 1680 | 2600210186 | 2599185355 | Bacteria | 7968906 |
| 1681 | 2600224762 | 2599185359 | Bacteria | 4772316 |
| 1682 | 2600812328 | 2600255067 | Bacteria | 6795583 |
| 1683 | 2643748312 | 2643221545 | Bacteria | 5083237 |
| 1684 | 2643822235 | 2643221560 | Bacteria | 4801179 |
| 1685 | 2644113688 | 2643221619 | Bacteria | 4158469 |
| 1686 | 2644164351 | 2643221629 | Bacteria | 5850260 |
| 1687 | 2644195736 | 2643221634 | Bacteria | 6705461 |
| 1688 | 2644346378 | 2643221662 | Bacteria | 5851492 |
| 1689 | 2644508165 | 2643221691 | Bacteria | 5093099 |
| 1690 | 2676745676 | 2675903129 | Bacteria | 7964495 |
| 1691 | 2691330082 | 2690315857 | Bacteria | 4396207 |
| 1692 | 2738822118 | 2738541296 | Bacteria | 7285013 |
| 1693 | 2738834600 | 2738541298 | Bacteria | 7286732 |
| 1694 | 2738875804 | 2738541306 | Bacteria | 7284992 |
| 1695 | 2739187756 | 2738543002 | Bacteria | 7284546 |
| 1696 | 2739222402 | 2738543008 | Bacteria | 7282815 |
| 1697 | 2739364161 | 2738543034 | Bacteria | 6084756 |
| 1698 | 2748017801 | 2747842501 | Bacteria | 5293829 |
| 1699 | 2774868766 | 2773857925 | Bacteria | 6472445 |
| 1700 | 2775658118 | 2775506735 | Bacteria | 4556596 |
| 1701 | 2776259943 | 2775506901 | Bacteria | 9631051 |
| 1702 | 2792833666 | 2791355137 | Bacteria | 9654227 |
| 1703 | 2793331656 | 2791355261 | Bacteria | 6661293 |
| 1704 | 2793982534 | 2791355406 | Bacteria | 11364898 |
| 1705 | 2808968865 | 2808606384 | Bacteria | 8474373 |
| 1706 | 2809003696 | 2808606390 | Bacteria | 8476311 |
| 1707 | 2809010973 | 2808606391 | Bacteria | 8308166 |
| 1708 | 2819620445 | 2818991450 | Bacteria | 6962147 |
| 1709 | 2821444784 | 2821443989 | Bacteria | 7658172 |
| 1710 | 2844535182 | 2844533157 | Bacteria | 7517899 |
| 1711 | 2844842987 | 2844841374 | Bacteria | 3917147 |
| 1712 | 2862580343 | 2862574272 | Bacteria | 10567477 |
| 1713 | 2866556077 | 2866552031 | Bacteria | 5824618 |
| 1714 | 2870073679 | 2870068957 | Bacteria | 8925310 |
| 1715 | 2882461803 | 2882456835 | Bacteria | 6863978 |
| 1716 | 2883091828 | 2883087390 | Bacteria | 9532701 |
| 1717 | 2884763828 | 2884763398 | Bacteria | 4091164 |
| 1718 | 2885279411 | 2885270888 | Bacteria | 9831543 |
| 1719 | 2891560362 | 2891554331 | Bacteria | 8812224 |
| 1720 | 2891672537 | 2891670763 | Bacteria | 4967099 |
| 1721 | 2894239613 | 2894232714 | Bacteria | 8834183 |
| 1722 | 2894416919 | 2894414249 | Bacteria | 4405451 |
| 1723 | 2897804475 | 2897803580 | Bacteria | 7000062 |
| 1724 | 2899376802 | 2899370129 | Bacteria | 6781179 |
| 1725 | 2900641679 | 2900634093 | Bacteria | 10263517 |
| 1726 | 2904480616 | 2904479285 | Bacteria | 5073931 |
| 1727 | 2904486756 | 2904483920 | Bacteria | 7545285 |
| 1728 | 2904622837 | 2904615490 | Bacteria | 10047340 |
| 1729 | 2904769089 | 2904765812 | Bacteria | 5369154 |
| 1730 | 2904769650 | 2904765812 | Bacteria | 5369154 |
| 1731 | 2904773216 | 2904770941 | Bacteria | 5580202 |
| 1732 | 2904774119 | 2904770941 | Bacteria | 5580202 |
| 1733 | 2908813950 | 2908811453 | Bacteria | 5478616 |
| 1734 | 2919175511 | 2919171160 | Bacteria | 6499771 |
| 1735 | 2919420204 | 2919420072 | Bacteria | 5390363 |
| 1736 | 2919422421 | 2919420072 | Bacteria | 5390363 |
| 1737 | 2919434037 | 2919432681 | Bacteria | 5390474 |
| 1738 | 2919435326 | 2919432681 | Bacteria | 5390474 |
| 1739 | 2919515779 | 2919513703 | Bacteria | 3844312 |
| 1740 | 2919525086 | 2919523602 | Bacteria | 3788128 |
| 1741 | 2919528087 | 2919527303 | Bacteria | 7718827 |
| 1742 | 2919537687 | 2919534386 | Bacteria | 4577686 |
| 1743 | 2919675500 | 2919675420 | Bacteria | 3969095 |
| 1744 | 2921648255 | 2921643360 | Bacteria | 11448031 |
| 1745 | 2928027868 | 2928027323 | Bacteria | 4382488 |
| 1746 | 2928108953 | 2928108538 | Bacteria | 7360024 |
| 1747 | 2928136177 | 2928135762 | Bacteria | 7259641 |
| 1748 | 2928156713 | 2928153084 | Bacteria | 4020257 |
| 1749 | 2928158255 | 2928157003 | Bacteria | 7522202 |
| 1750 | 2928167526 | 2928163908 | Bacteria | 7561269 |
| 1751 | 2928504042 | 2928503688 | Bacteria | 7268108 |
| 1752 | 2928527493 | 2928526807 | Bacteria | 4760224 |
| 1753 | 2939600523 | 2939598168 | Bacteria | 4687164 |
| 1754 | 2945938430 | 2945934425 | Bacteria | 7444609 |
| 1755 | 2946062943 | 2946059875 | Bacteria | 4386623 |
| 1756 | 2981996646 | 2981990288 | Bacteria | 7590678 |
| 1757 | 2984558755 | 2984555340 | Bacteria | 4247089 |
| 1758 | 2984566739 | 2984564862 | Bacteria | 4339992 |
| 1759 | 2990708432 | 2990703756 | Bacteria | 7715990 |
| 1760 | 2993357927 | 2993356040 | Bacteria | 4247105 |
| 1761 | 2996224566 | 2996221748 | Bacteria | 6799777 |
| 1762 | 3005411816 | 3005409236 | Bacteria | 7188837 |
| 1763 | 3006429796 | 3006425503 | Bacteria | 6491253 |
| 1764 | 642615805 | 642555113 | Bacteria | 8214658 |
| 1765 | 8003015422 | 8003014200 | Bacteria | 4059994 |
| 1766 | 8005387414 | 8005382845 | Bacteria | 6732062 |
| 1767 | 8005400006 | 8005395548 | Bacteria | 6806915 |
| 1768 | 8020942445 | 8020938398 | Bacteria | 7472757 |
| 1769 | 8020952786 | 8020945358 | Bacteria | 8467355 |
| 1770 | 8020954605 | 8020953355 | Bacteria | 7439080 |
| 1771 | 8047719033 | 8047710418 | Bacteria | 11023148 |
| 1772 | 8047893907 | 8047893842 | Bacteria | 11723082 |
| 1773 | 8047901290 | 8047893842 | Bacteria | 11723082 |
| 1774 | 8048135099 | 8048127548 | Bacteria | 11053136 |
| 1775 | 8048357609 | 8048356638 | Bacteria | 11044339 |
| 1776 | 8048364924 | 8048356638 | Bacteria | 11044339 |
| 1777 | 8048370924 | 8048369669 | Bacteria | 11666822 |
| 1778 | 8048378231 | 8048369669 | Bacteria | 11666822 |
| 1779 | 8048387329 | 8048379754 | Bacteria | 11877923 |
| 1780 | 8048388498 | 8048379754 | Bacteria | 11877923 |
| 1781 | 8054304135 | 8054302542 | Bacteria | 5698134 |
| 1782 | 8054473778 | 8054472261 | Bacteria | 7464355 |
| 1783 | 8054478176 | 8054472261 | Bacteria | 7464355 |
| 1784 | 8055268674 | 8055266321 | Bacteria | 7999742 |
| 1785 | 8055304737 | 8055301274 | Bacteria | 8587385 |
| 1786 | 8056063235 | 8056060235 | Bacteria | 7259403 |
| 1787 | Ga0070712_100002253 | |||
| 1788 | JGI24740J21852_10002353 | |||
| 1789 | JGI24739J22299_10019871 | |||
| 1790 | JGI24735J21928_10004339 | |||
| 1791 | JGI24735J21928_10015543 | |||
| 1792 | JGI24738J21930_10000419 | |||
| 1793 | JGI25156J39149_1001063 | |||
| 1794 | JGI25156J39149_1003773 | |||
| 1795 | JGI25156J39149_1010843 | |||
| 1796 | JGI25162J39368_1000115 | |||
| 1797 | JGI25162J39368_1000764 | |||
| 1798 | JGI25157J39369_1000132 | |||
| 1799 | JGI25163J39215_1000228 | |||
| 1800 | JGI25164J39214_1000090 | |||
| 1801 | JGI25164J39214_1000376 | |||
| 1802 | JGI25150J39212_1000156 | |||
| 1803 | JGI25150J39212_1002133 | |||
| 1804 | JGI25151J46595_10000133 | |||
| 1805 | JGI25151J46595_10000293 | |||
| 1806 | JGI25151J46595_10017338 | |||
| 1807 | JGI25151J46595_10017984 | |||
| 1808 | JGI25151J46595_10018692 | |||
| 1809 | JGI25406J46586_10002396 | |||
| 1810 | JGI25165J46597_1000014 | |||
| 1811 | JGI25165J46597_1000194 | |||
| 1812 | JGI25165J46597_1000492 | |||
| 1813 | JGI25153J46596_10000058 | |||
| 1814 | JGI25153J46596_10000260 | |||
| 1815 | rootH2_10029369 | |||
| 1816 | JGI25160J50197_1000237 | |||
| 1817 | JGI25160J50197_1004969 | |||
| 1818 | Ga0006562J51391_1133533 | |||
| 1819 | Ga0006562J51391_1133534 | |||
| 1820 | Ga0055538_1001068 | |||
| 1821 | Ga0055539_1000008 | |||
| 1822 | Ga0055533_1000001 | |||
| 1823 | Ga0055533_1000106 | |||
| 1824 | Ga0055532_1000003 | |||
| 1825 | Ga0055525_1000197 | |||
| 1826 | Ga0055527_1000006 | |||
| 1827 | Ga0055527_1000023 | |||
| 1828 | Ga0055535_1000003 | |||
| 1829 | Ga0055535_1000106 | |||
| 1830 | Ga0055542_1000007 | |||
| 1831 | Ga0055542_1000023 | |||
| 1832 | Ga0055542_1000150 | |||
| 1833 | Ga0055542_1000245 | |||
| 1834 | Ga0055529_1000003 | |||
| 1835 | Ga0055529_1000168 | |||
| 1836 | Ga0055529_1000178 | |||
| 1837 | Ga0055529_1000180 | |||
| 1838 | Ga0055529_1001704 | |||
| 1839 | Ga0055524_1001508 | |||
| 1840 | Ga0055524_1003884 | |||
| 1841 | Ga0055524_1009055 | |||
| 1842 | Ga0055528_1002495 | |||
| 1843 | Ga0055530_10003173 | |||
| 1844 | Ga0055531_10008726 | |||
| 1845 | Ga0055531_10017067 | |||
| 1846 | Ga0058692_1000057 | |||
| 1847 | Ga0058692_1000132 | |||
| 1848 | Ga0065165_1000467 | |||
| 1849 | Ga0070658_10004201 | |||
| 1850 | Ga0070658_10061587 | |||
| 1851 | Ga0070658_10105986 | |||
| 1852 | Ga0070658_10151588 | |||
| 1853 | Ga0070658_10166573 | |||
| 1854 | Ga0070676_10036864 | |||
| 1855 | Ga0070676_10072911 | |||
| 1856 | Ga0070683_100000275 | |||
| 1857 | Ga0070683_100001898 | |||
| 1858 | Ga0070683_100084656 | |||
| 1859 | Ga0070683_100136036 | |||
| 1860 | Ga0070670_100019420 | |||
| 1861 | Ga0070670_100067971 | |||
| 1862 | Ga0068869_100044412 | |||
| 1863 | Ga0070666_10013441 | |||
| 1864 | Ga0070666_10074322 | |||
| 1865 | Ga0070680_100002253 | |||
| 1866 | Ga0070680_100046178 | |||
| 1867 | Ga0070682_100004503 | |||
| 1868 | Ga0070682_100119464 | |||
| 1869 | Ga0070682_100190654 | |||
| 1870 | Ga0068868_100003303 | |||
| 1871 | Ga0068868_100003327 | |||
| 1872 | Ga0068868_100044533 | |||
| 1873 | Ga0068868_100072725 | |||
| 1874 | Ga0068868_100095338 | |||
| 1875 | Ga0068868_100096109 | |||
| 1876 | Ga0068868_100122122 | |||
| 1877 | Ga0070660_100005604 | |||
| 1878 | Ga0070689_100004517 | |||
| 1879 | Ga0070687_100005004 | |||
| 1880 | Ga0070687_100014478 | |||
| 1881 | Ga0070661_100001245 | |||
| 1882 | Ga0070661_100001901 | |||
| 1883 | Ga0070661_100023882 | |||
| 1884 | Ga0070661_100028281 | |||
| 1885 | Ga0070661_100030036 | |||
| 1886 | Ga0070661_100071961 | |||
| 1887 | Ga0070661_100072200 | |||
| 1888 | Ga0070661_100112220 | |||
| 1889 | Ga0070692_10051524 | |||
| 1890 | Ga0070692_10083109 | |||
| 1891 | Ga0070668_100013552 | |||
| 1892 | Ga0070668_100066247 | |||
| 1893 | Ga0070668_100098480 | |||
| 1894 | Ga0070675_100003560 | |||
| 1895 | Ga0070671_100027144 | |||
| 1896 | Ga0070671_100127003 | |||
| 1897 | Ga0070674_100009025 | |||
| 1898 | Ga0070673_100061624 | |||
| 1899 | Ga0070673_100107618 | |||
| 1900 | Ga0070673_100292227 | |||
| 1901 | Ga0070688_100044144 | |||
| 1902 | Ga0070688_100216166 | |||
| 1903 | Ga0070659_100000616 | |||
| 1904 | Ga0070659_100002561 | |||
| 1905 | Ga0070659_100159088 | |||
| 1906 | Ga0070667_100004934 | |||
| 1907 | Ga0070667_100038666 | |||
| 1908 | Ga0070667_100052544 | |||
| 1909 | Ga0070709_10000557 | |||
| 1910 | Ga0070709_10030365 | |||
| 1911 | Ga0070709_10035829 | |||
| 1912 | Ga0070714_100000105 | |||
| 1913 | Ga0070714_100021111 | |||
| 1914 | Ga0070714_100080502 | |||
| 1915 | Ga0070714_100082101 | |||
| 1916 | Ga0070714_100099299 | |||
| 1917 | Ga0070714_100128636 | |||
| 1918 | Ga0070714_100344679 | |||
| 1919 | Ga0070713_100000356 | |||
| 1920 | Ga0070713_100000549 | |||
| 1921 | Ga0070713_100021474 | |||
| 1922 | Ga0070713_100066954 | |||
| 1923 | Ga0070713_100067877 | |||
| 1924 | Ga0070713_100180684 | |||
| 1925 | Ga0070713_100294797 | |||
| 1926 | Ga0070710_10020273 | |||
| 1927 | Ga0070701_10007723 | |||
| 1928 | Ga0070711_100000076 | |||
| 1929 | Ga0070711_100000748 | |||
| 1930 | Ga0070711_100102636 | |||
| 1931 | Ga0070711_100109796 | |||
| 1932 | Ga0070705_100022083 | |||
| 1933 | Ga0070700_100028371 | |||
| 1934 | Ga0070708_100001268 | |||
| 1935 | Ga0070708_100006458 | |||
| 1936 | Ga0070708_100006920 | |||
| 1937 | Ga0070708_100013815 | |||
| 1938 | Ga0070708_100020690 | |||
| 1939 | Ga0070708_100051404 | |||
| 1940 | Ga0070708_100176368 | |||
| 1941 | Ga0070663_100000239 | |||
| 1942 | Ga0070663_100009995 | |||
| 1943 | Ga0070663_100069776 | |||
| 1944 | Ga0070678_100001110 | |||
| 1945 | Ga0070678_100147534 | |||
| 1946 | Ga0070662_100031446 | |||
| 1947 | Ga0070662_100040135 | |||
| 1948 | Ga0070662_100067386 | |||
| 1949 | Ga0070662_100083140 | |||
| 1950 | Ga0070662_100121216 | |||
| 1951 | Ga0070681_10210686 | |||
| 1952 | Ga0070681_10229815 | |||
| 1953 | Ga0070681_10279457 | |||
| 1954 | Ga0068867_100021675 | |||
| 1955 | Ga0068867_100221631 | |||
| 1956 | Ga0070685_10004572 | |||
| 1957 | Ga0070685_10040297 | |||
| 1958 | Ga0070685_10158714 | |||
| 1959 | Ga0070706_100000734 | |||
| 1960 | Ga0070706_100017793 | |||
| 1961 | Ga0070706_100018523 | |||
| 1962 | Ga0070707_100000413 | |||
| 1963 | Ga0070707_100003538 | |||
| 1964 | Ga0070707_100013149 | |||
| 1965 | Ga0070707_100027854 | |||
| 1966 | Ga0070707_100269823 | |||
| 1967 | Ga0070698_100000248 | |||
| 1968 | Ga0070698_100001737 | |||
| 1969 | Ga0070698_100006040 | |||
| 1970 | Ga0070698_100012185 | |||
| 1971 | Ga0070698_100085202 | |||
| 1972 | Ga0070699_100007857 | |||
| 1973 | Ga0070699_100018091 | |||
| 1974 | Ga0070699_100018272 | |||
| 1975 | Ga0070699_100027765 | |||
| 1976 | Ga0070699_100081200 | |||
| 1977 | Ga0070699_100111989 | |||
| 1978 | Ga0070679_100018632 | |||
| 1979 | Ga0070679_100019567 | |||
| 1980 | Ga0070679_100026759 | |||
| 1981 | Ga0070679_100074982 | |||
| 1982 | Ga0070684_100000405 | |||
| 1983 | Ga0070684_100006472 | |||
| 1984 | Ga0070684_100012793 | |||
| 1985 | Ga0070684_100033053 | |||
| 1986 | Ga0070684_100050810 | |||
| 1987 | Ga0070684_100100070 | |||
| 1988 | Ga0070684_100157143 | |||
| 1989 | Ga0070684_100251757 | |||
| 1990 | Ga0070697_100001144 | |||
| 1991 | Ga0070697_100002694 | |||
| 1992 | Ga0070697_100005485 | |||
| 1993 | Ga0070697_100087831 | |||
| 1994 | Ga0068853_100001476 | |||
| 1995 | Ga0068853_100002548 | |||
| 1996 | Ga0068853_100072301 | |||
| 1997 | Ga0068853_100074953 | |||
| 1998 | Ga0068853_100226202 | |||
| 1999 | Ga0068853_100242280 | |||
| 2000 | Ga0068853_100280943 | |||
| 2001 | Ga0070672_100026923 | |||
| 2002 | Ga0070672_100150028 | |||
| 2003 | Ga0070695_100007045 | |||
| 2004 | Ga0070696_100082027 | |||
| 2005 | Ga0070696_100177374 | |||
| 2006 | Ga0070693_100008654 | |||
| 2007 | Ga0070693_100109228 | |||
| 2008 | Ga0070665_100000103 | |||
| 2009 | Ga0070665_100000825 | |||
| 2010 | Ga0070665_100041330 | |||
| 2011 | Ga0070665_100065912 | |||
| 2012 | Ga0070665_100091514 | |||
| 2013 | Ga0070665_100134937 | |||
| 2014 | Ga0068855_100000868 | |||
| 2015 | Ga0068855_100005556 | |||
| 2016 | Ga0068855_100010348 | |||
| 2017 | Ga0068855_100019075 | |||
| 2018 | Ga0068855_100030920 | |||
| 2019 | Ga0068855_100062420 | |||
| 2020 | Ga0068855_100093628 | |||
| 2021 | Ga0068855_100195266 | |||
| 2022 | Ga0070664_100000851 | |||
| 2023 | Ga0070664_100030695 | |||
| 2024 | Ga0070664_100075070 | |||
| 2025 | Ga0070664_100111465 | |||
| 2026 | Ga0070664_100127493 | |||
| 2027 | Ga0068857_100002858 | |||
| 2028 | Ga0068857_100064519 | |||
| 2029 | Ga0068857_100280722 | |||
| 2030 | Ga0068854_100044049 | |||
| 2031 | Ga0068854_100065188 | |||
| 2032 | Ga0068854_100155876 | |||
| 2033 | Ga0068856_100000126 | |||
| 2034 | Ga0068856_100005005 | |||
| 2035 | Ga0068856_100012012 | |||
| 2036 | Ga0068856_100041636 | |||
| 2037 | Ga0068856_100066830 | |||
| 2038 | Ga0068856_100087828 | |||
| 2039 | Ga0068856_100120911 | |||
| 2040 | Ga0068856_100143334 | |||
| 2041 | Ga0068856_100455963 | |||
| 2042 | Ga0070702_100003690 | |||
| 2043 | Ga0070702_100073284 | |||
| 2044 | Ga0068852_100000003 | |||
| 2045 | Ga0068852_100000237 | |||
| 2046 | Ga0068852_100001633 | |||
| 2047 | Ga0068852_100025876 | |||
| 2048 | Ga0068852_100056069 | |||
| 2049 | Ga0068852_100077603 | |||
| 2050 | Ga0068852_100082911 | |||
| 2051 | Ga0068852_100267214 | |||
| 2052 | Ga0068859_100011245 | |||
| 2053 | Ga0068859_100012187 | |||
| 2054 | Ga0068859_100014257 | |||
| 2055 | Ga0068859_100040023 | |||
| 2056 | Ga0068864_100009954 | |||
| 2057 | Ga0068864_100031296 | |||
| 2058 | Ga0068864_100049096 | |||
| 2059 | Ga0068864_100130362 | |||
| 2060 | Ga0068864_100143818 | |||
| 2061 | Ga0068864_100329303 | |||
| 2062 | Ga0068866_10000993 | |||
| 2063 | Ga0068866_10058585 | |||
| 2064 | Ga0068861_100229929 | |||
| 2065 | Ga0068851_10003726 | |||
| 2066 | Ga0068851_10013138 | |||
| 2067 | Ga0068851_10053531 | |||
| 2068 | Ga0068863_100005651 | |||
| 2069 | Ga0068863_100012434 | |||
| 2070 | Ga0068863_100028481 | |||
| 2071 | Ga0068863_100047432 | |||
| 2072 | Ga0068863_100054479 | |||
| 2073 | Ga0068858_100001642 | |||
| 2074 | Ga0068858_100064877 | |||
| 2075 | Ga0068858_100080393 | |||
| 2076 | Ga0068860_100008263 | |||
| 2077 | Ga0068860_100016166 | |||
| 2078 | Ga0068860_100051626 | |||
| 2079 | Ga0068860_100156811 | |||
| 2080 | Ga0068862_100017808 | |||
| 2081 | Ga0068862_100053408 | |||
| 2082 | Ga0068862_100064827 | |||
| 2083 | Ga0081540_1003699 | |||
| 2084 | Ga0081540_1037990 | |||
| 2085 | Ga0081539_10000031 | |||
| 2086 | Ga0081539_10000079 | |||
| 2087 | Ga0070717_10004304 | |||
| 2088 | Ga0070717_10007200 | |||
| 2089 | Ga0070717_10010666 | |||
| 2090 | Ga0070717_10015059 | |||
| 2091 | Ga0070717_10024271 | |||
| 2092 | Ga0070717_10025475 | |||
| 2093 | Ga0070717_10079571 | |||
| 2094 | Ga0070717_10096801 | |||
| 2095 | Ga0070717_10109622 | |||
| 2096 | Ga0070717_10153011 | |||
| 2097 | Ga0075365_10000133 | |||
| 2098 | Ga0075365_10024577 | |||
| 2099 | Ga0075368_10042757 | |||
| 2100 | Ga0075363_100001292 | |||
| 2101 | Ga0075363_100084347 | |||
| 2102 | Ga0075364_10000593 | |||
| 2103 | Ga0075364_10007258 | |||
| 2104 | Ga0075364_10021227 | |||
| 2105 | Ga0075364_10024525 | |||
| 2106 | Ga0075432_10035020 | |||
| 2107 | Ga0070715_10089156 | |||
| 2108 | Ga0070716_100017291 | |||
| 2109 | Ga0070716_100023216 | |||
| 2110 | Ga0070716_100023965 | |||
| 2111 | Ga0070716_100050277 | |||
| 2112 | Ga0070716_100088719 | |||
| 2113 | Ga0070712_100000632 | |||
| 2114 | Ga0070712_100003929 | |||
| 2115 | Ga0070712_100008366 | |||
| 2116 | Ga0070712_100017208 | |||
| 2117 | Ga0070712_100018767 | |||
| 2118 | Ga0070712_100026889 | |||
| 2119 | Ga0075367_10005671 | |||
| 2120 | Ga0075367_10063867 | |||
| 2121 | Ga0075367_10096947 | |||
| 2122 | Ga0075369_10000067 | |||
| 2123 | Ga0075427_10000482 | |||
| 2124 | Ga0075366_10000087 | |||
| 2125 | Ga0075366_10025645 | |||
| 2126 | Ga0075366_10036851 | |||
| 2127 | Ga0075366_10046042 | |||
| 2128 | Ga0097621_100008726 | |||
| 2129 | Ga0097621_100010928 | |||
| 2130 | Ga0097621_100022246 | |||
| 2131 | Ga0097621_100023994 | |||
| 2132 | Ga0075370_10000557 | |||
| 2133 | Ga0075370_10006492 | |||
| 2134 | Ga0075370_10013135 | |||
| 2135 | Ga0075370_10092150 | |||
| 2136 | Ga0068871_100016398 | |||
| 2137 | Ga0068871_100027403 | |||
| 2138 | Ga0068871_100036508 | |||
| 2139 | Ga0068871_100120413 | |||
| 2140 | Ga0068871_100144365 | |||
| 2141 | Ga0075428_100017262 | |||
| 2142 | Ga0075428_100111708 | |||
| 2143 | Ga0075428_100158386 | |||
| 2144 | Ga0075428_100214621 | |||
| 2145 | Ga0075430_100003620 | |||
| 2146 | Ga0075431_100097896 | |||
| 2147 | Ga0075431_100162048 | |||
| 2148 | Ga0075433_10065304 | |||
| 2149 | Ga0075434_100003909 | |||
| 2150 | Ga0075434_100004099 | |||
| 2151 | Ga0075434_100046012 | |||
| 2152 | Ga0075434_100097336 | |||
| 2153 | Ga0075434_100100156 | |||
| 2154 | Ga0075429_100002757 | |||
| 2155 | Ga0075429_100196148 | |||
| 2156 | Ga0068865_100011355 | |||
| 2157 | Ga0068865_100035946 | |||
| 2158 | Ga0075436_100000291 | |||
| 2159 | Ga0075436_100001688 | |||
| 2160 | Ga0075436_100002329 | |||
| 2161 | Ga0075436_100030559 | |||
| 2162 | Ga0097620_100011246 | |||
| 2163 | Ga0097620_100012188 | |||
| 2164 | Ga0097620_100014257 | |||
| 2165 | Ga0097620_100040020 | |||
| 2166 | Ga0075435_100004630 | |||
| 2167 | Ga0075435_100005310 | |||
| 2168 | Ga0075435_100084219 | |||
| 2169 | Ga0075435_100096730 | |||
| 2170 | Ga0105251_10000051 | |||
| 2171 | Ga0105251_10004145 | |||
| 2172 | Ga0105251_10034101 | |||
| 2173 | Ga0105244_10009335 | |||
| 2174 | Ga0105244_10048534 | |||
| 2175 | Ga0105250_10014976 | |||
| 2176 | Ga0105250_10016346 | |||
| 2177 | Ga0105240_10000001 | |||
| 2178 | Ga0105240_10000286 | |||
| 2179 | Ga0105240_10001411 | |||
| 2180 | Ga0105240_10003378 | |||
| 2181 | Ga0105240_10004021 | |||
| 2182 | Ga0105240_10007046 | |||
| 2183 | Ga0105240_10015022 | |||
| 2184 | Ga0105240_10015320 | |||
| 2185 | Ga0105240_10015705 | |||
| 2186 | Ga0105240_10025825 | |||
| 2187 | Ga0105240_10027729 | |||
| 2188 | Ga0105240_10031904 | |||
| 2189 | Ga0105240_10067352 | |||
| 2190 | Ga0105240_10183000 | |||
| 2191 | Ga0111539_10000854 | |||
| 2192 | Ga0111539_10000878 | |||
| 2193 | Ga0111539_10034480 | |||
| 2194 | Ga0111539_10061528 | |||
| 2195 | Ga0105245_10002844 | |||
| 2196 | Ga0105245_10011797 | |||
| 2197 | Ga0105245_10014417 | |||
| 2198 | Ga0105245_10038776 | |||
| 2199 | Ga0105245_10039668 | |||
| 2200 | Ga0105245_10086945 | |||
| 2201 | Ga0105245_10175338 | |||
| 2202 | Ga0105245_10257035 | |||
| 2203 | Ga0105245_10302970 | |||
| 2204 | Ga0105247_10006209 | |||
| 2205 | Ga0105247_10059580 | |||
| 2206 | Ga0114129_10005760 | |||
| 2207 | Ga0114129_10019020 | |||
| 2208 | Ga0114129_10081560 | |||
| 2209 | Ga0114129_10104916 | |||
| 2210 | Ga0105243_10002826 | |||
| 2211 | Ga0105243_10186343 | |||
| 2212 | Ga0105241_10000563 | |||
| 2213 | Ga0105241_10002309 | |||
| 2214 | Ga0105241_10004298 | |||
| 2215 | Ga0105241_10021149 | |||
| 2216 | Ga0105241_10033758 | |||
| 2217 | Ga0105241_10079366 | |||
| 2218 | Ga0105241_10120649 | |||
| 2219 | Ga0105241_10136973 | |||
| 2220 | Ga0105241_10150242 | |||
| 2221 | Ga0105248_10009529 | |||
| 2222 | Ga0105248_10023333 | |||
| 2223 | Ga0105248_10028195 | |||
| 2224 | Ga0105248_10028494 | |||
| 2225 | Ga0105248_10065636 | |||
| 2226 | Ga0105248_10203841 | |||
| 2227 | Ga0105248_10207220 | |||
| 2228 | Ga0105248_10256544 | |||
| 2229 | Ga0105248_10314298 | |||
| 2230 | Ga0105248_10330164 | |||
| 2231 | Ga0105237_10001230 | |||
| 2232 | Ga0105237_10002902 | |||
| 2233 | Ga0105237_10006587 | |||
| 2234 | Ga0105237_10007501 | |||
| 2235 | Ga0105237_10010797 | |||
| 2236 | Ga0105237_10010990 | |||
| 2237 | Ga0105237_10065209 | |||
| 2238 | Ga0105237_10065477 | |||
| 2239 | Ga0105237_10127457 | |||
| 2240 | Ga0105237_10192586 | |||
| 2241 | Ga0105238_10000080 | |||
| 2242 | Ga0105238_10001792 | |||
| 2243 | Ga0105238_10003385 | |||
| 2244 | Ga0105238_10007159 | |||
| 2245 | Ga0105238_10022308 | |||
| 2246 | Ga0105238_10058249 | |||
| 2247 | Ga0105238_10067567 | |||
| 2248 | Ga0105238_10070391 | |||
| 2249 | Ga0105238_10071450 | |||
| 2250 | Ga0105249_10026811 | |||
| 2251 | Ga0105249_10043456 | |||
| 2252 | Ga0105239_10001359 | |||
| 2253 | Ga0105239_10003216 | |||
| 2254 | Ga0105239_10005564 | |||
| 2255 | Ga0105239_10027050 | |||
| 2256 | Ga0105239_10039626 | |||
| 2257 | Ga0105239_10051501 | |||
| 2258 | Ga0105239_10052377 | |||
| 2259 | Ga0105246_10008397 | |||
| 2260 | Ga0105246_10011161 | |||
| 2261 | Ga0157373_10002130 | |||
| 2262 | Ga0157373_10009837 | |||
| 2263 | Ga0157373_10027853 | |||
| 2264 | Ga0157373_10145423 | |||
| 2265 | Ga0157371_10057173 | |||
| 2266 | Ga0157371_10082311 | |||
| 2267 | Ga0157371_10168899 | |||
| 2268 | Ga0157370_10000001 | |||
| 2269 | Ga0157370_10004782 | |||
| 2270 | Ga0157370_10006293 | |||
| 2271 | Ga0157370_10043205 | |||
| 2272 | Ga0157370_10128139 | |||
| 2273 | Ga0157370_10136820 | |||
| 2274 | Ga0157369_10000092 | |||
| 2275 | Ga0157369_10000519 | |||
| 2276 | Ga0157369_10003681 | |||
| 2277 | Ga0157369_10005372 | |||
| 2278 | Ga0157369_10010713 | |||
| 2279 | Ga0157369_10011788 | |||
| 2280 | Ga0157369_10013984 | |||
| 2281 | Ga0157369_10015212 | |||
| 2282 | Ga0157369_10018114 | |||
| 2283 | Ga0157369_10045051 | |||
| 2284 | Ga0157369_10055998 | |||
| 2285 | Ga0157369_10114365 | |||
| 2286 | Ga0157369_10227467 | |||
| 2287 | Ga0157369_10427930 | |||
| 2288 | Ga0157374_10000439 | |||
| 2289 | Ga0157374_10003799 | |||
| 2290 | Ga0157374_10062127 | |||
| 2291 | Ga0157374_10073313 | |||
| 2292 | Ga0157374_10087149 | |||
| 2293 | Ga0157378_10004302 | |||
| 2294 | Ga0157378_10005921 | |||
| 2295 | Ga0157378_10044531 | |||
| 2296 | Ga0157378_10080010 | |||
| 2297 | Ga0157378_10116417 | |||
| 2298 | Ga0157378_10317096 | |||
| 2299 | Ga0157378_10348290 | |||
| 2300 | Ga0163162_10032162 | |||
| 2301 | Ga0163162_10082054 | |||
| 2302 | Ga0163162_10158227 | |||
| 2303 | Ga0163162_10261846 | |||
| 2304 | Ga0157372_10000045 | |||
| 2305 | Ga0157372_10000864 | |||
| 2306 | Ga0157372_10001006 | |||
| 2307 | Ga0157372_10009411 | |||
| 2308 | Ga0157372_10021878 | |||
| 2309 | Ga0157372_10042140 | |||
| 2310 | Ga0157372_10045596 | |||
| 2311 | Ga0157372_10051287 | |||
| 2312 | Ga0157372_10081468 | |||
| 2313 | Ga0157372_10083616 | |||
| 2314 | Ga0157372_10117417 | |||
| 2315 | Ga0157372_10248934 | |||
| 2316 | Ga0157372_10484059 | |||
| 2317 | Ga0157375_10002505 | |||
| 2318 | Ga0157375_10009579 | |||
| 2319 | Ga0157375_10016019 | |||
| 2320 | Ga0157375_10167618 | |||
| 2321 | Ga0157375_10187043 | |||
| 2322 | Ga0157375_10224189 | |||
| 2323 | Ga0157375_10291909 | |||
| 2324 | Ga0163163_10000570 | |||
| 2325 | Ga0163163_10008588 | |||
| 2326 | Ga0157380_10234793 | |||
| 2327 | Ga0182008_10022232 | |||
| 2328 | Ga0182008_10030257 | |||
| 2329 | Ga0157377_10006455 | |||
| 2330 | Ga0157377_10112824 | |||
| 2331 | Ga0157379_10029199 | |||
| 2332 | Ga0157379_10042303 | |||
| 2333 | Ga0157379_10043559 | |||
| 2334 | Ga0157379_10079649 | |||
| 2335 | Ga0157379_10125016 | |||
| 2336 | Ga0157379_10166291 | |||
| 2337 | Ga0157379_10178569 | |||
| 2338 | Ga0157376_10000074 | |||
| 2339 | Ga0157376_10002444 | |||
| 2340 | Ga0157376_10017251 | |||
| 2341 | Ga0182006_1015431 | |||
| 2342 | Ga0182007_10000134 | |||
| 2343 | Ga0182007_10003302 | |||
| 2344 | Ga0182005_1011366 | |||
| 2345 | Ga0183368_1002 | |||
| 2346 | Ga0163161_10003606 | |||
| 2347 | Ga0163161_10042311 | |||
| 2348 | Ga0206353_11000141 | |||
| 2349 | Ga0213872_10000388 | |||
| 2350 | Ga0213872_10059652 | |||
| 2351 | Ga0213876_10009387 | |||
| 2352 | Ga0213876_10011169 | |||
| 2353 | Ga0224712_10001480 | |||
| 2354 | Ga0209760_100548 | |||
| 2355 | Ga0209784_100053 | |||
| 2356 | Ga0209566_100050 | |||
| 2357 | Ga0209566_103958 | |||
| 2358 | Ga0209674_100001 | |||
| 2359 | Ga0209674_100025 | |||
| 2360 | Ga0209672_100002 | |||
| 2361 | Ga0209672_100064 | |||
| 2362 | Ga0209672_102577 | |||
| 2363 | Ga0209147_100003 | |||
| 2364 | Ga0209147_105009 | |||
| 2365 | Ga0209563_100001 | |||
| 2366 | Ga0209563_101346 | |||
| 2367 | Ga0207427_100041 | |||
| 2368 | Ga0207427_100061 | |||
| 2369 | Ga0207427_100834 | |||
| 2370 | Ga0207427_101099 | |||
| 2371 | Ga0207427_103063 | |||
| 2372 | Ga0209437_100037 | |||
| 2373 | Ga0209437_100267 | |||
| 2374 | Ga0209437_100279 | |||
| 2375 | Ga0209258_100005 | |||
| 2376 | Ga0209258_100138 | |||
| 2377 | Ga0209258_102763 | |||
| 2378 | Ga0207425_1000011 | |||
| 2379 | Ga0207425_1000072 | |||
| 2380 | Ga0209646_1000351 | |||
| 2381 | Ga0209026_1000104 | |||
| 2382 | Ga0209677_100001 | |||
| 2383 | Ga0209677_100601 | |||
| 2384 | Ga0209148_1000001 | |||
| 2385 | Ga0209148_1000002 | |||
| 2386 | Ga0209148_1000006 | |||
| 2387 | Ga0209148_1000108 | |||
| 2388 | Ga0209759_1000006 | |||
| 2389 | Ga0209759_1000052 | |||
| 2390 | Ga0209759_1000220 | |||
| 2391 | Ga0209759_1003685 | |||
| 2392 | Ga0209129_1000031 | |||
| 2393 | Ga0209129_1000737 | |||
| 2394 | Ga0209129_1005223 | |||
| 2395 | Ga0209233_1000002 | |||
| 2396 | Ga0209233_1000014 | |||
| 2397 | Ga0209233_1000018 | |||
| 2398 | Ga0209233_1000545 | |||
| 2399 | Ga0209233_1002368 | |||
| 2400 | Ga0209233_1008622 | |||
| 2401 | Ga0209455_1000003 | |||
| 2402 | Ga0209455_1000079 | |||
| 2403 | Ga0209455_1000102 | |||
| 2404 | Ga0209455_1001023 | |||
| 2405 | Ga0209455_1002782 | |||
| 2406 | Ga0209673_1005552 | |||
| 2407 | Ga0209130_1000693 | |||
| 2408 | Ga0209676_1000100 | |||
| 2409 | Ga0209676_1001455 | |||
| 2410 | Ga0209676_1004470 | |||
| 2411 | Ga0209676_1007055 | |||
| 2412 | Ga0209025_1000012 | |||
| 2413 | Ga0209025_1000473 | |||
| 2414 | Ga0209025_1000509 | |||
| 2415 | Ga0209025_1000721 | |||
| 2416 | Ga0209025_1000802 | |||
| 2417 | Ga0209025_1031800 | |||
| 2418 | Ga0209564_1006514 | |||
| 2419 | Ga0209564_1015451 | |||
| 2420 | Ga0209758_1000009 | |||
| 2421 | Ga0209758_1000143 | |||
| 2422 | Ga0209758_1000853 | |||
| 2423 | Ga0209758_1002491 | |||
| 2424 | Ga0209758_1031122 | |||
| 2425 | Ga0209758_1036152 | |||
| 2426 | Ga0209050_1000005 | |||
| 2427 | Ga0209050_1008322 | |||
| 2428 | Ga0209256_1000752 | |||
| 2429 | Ga0209256_1001211 | |||
| 2430 | Ga0209256_1001259 | |||
| 2431 | Ga0207426_1000020 | |||
| 2432 | Ga0207426_1000080 | |||
| 2433 | Ga0207426_1001406 | |||
| 2434 | Ga0207426_1024668 | |||
| 2435 | Ga0209051_1000507 | |||
| 2436 | Ga0209051_1001813 | |||
| 2437 | Ga0209051_1024235 | |||
| 2438 | Ga0209257_1000712 | |||
| 2439 | Ga0209257_1000822 | |||
| 2440 | Ga0209257_1001291 | |||
| 2441 | Ga0209257_1001585 | |||
| 2442 | Ga0209257_1005469 | |||
| 2443 | Ga0209257_1008420 | |||
| 2444 | Ga0209257_1019269 | |||
| 2445 | Ga0207697_10042039 | |||
| 2446 | Ga0207656_10018669 | |||
| 2447 | Ga0207656_10022080 | |||
| 2448 | Ga0207696_1011511 | |||
| 2449 | Ga0207655_1022025 | |||
| 2450 | Ga0207713_1000462 | |||
| 2451 | Ga0207653_10052439 | |||
| 2452 | Ga0207710_10002756 | |||
| 2453 | Ga0207710_10074409 | |||
| 2454 | Ga0207688_10000304 | |||
| 2455 | Ga0207680_10084806 | |||
| 2456 | Ga0207647_10000278 | |||
| 2457 | Ga0207647_10005308 | |||
| 2458 | Ga0207647_10012431 | |||
| 2459 | Ga0207647_10030452 | |||
| 2460 | Ga0207699_10008403 | |||
| 2461 | Ga0207699_10033589 | |||
| 2462 | Ga0207645_10023338 | |||
| 2463 | Ga0207645_10041363 | |||
| 2464 | Ga0207645_10069247 | |||
| 2465 | Ga0207645_10108041 | |||
| 2466 | Ga0207643_10013673 | |||
| 2467 | Ga0207705_10020989 | |||
| 2468 | Ga0207705_10217003 | |||
| 2469 | Ga0207684_10000389 | |||
| 2470 | Ga0207684_10004583 | |||
| 2471 | Ga0207684_10046578 | |||
| 2472 | Ga0207654_10000023 | |||
| 2473 | Ga0207654_10004886 | |||
| 2474 | Ga0207654_10005075 | |||
| 2475 | Ga0207654_10021511 | |||
| 2476 | Ga0207654_10041420 | |||
| 2477 | Ga0207654_10160223 | |||
| 2478 | Ga0207707_10021868 | |||
| 2479 | Ga0207707_10028260 | |||
| 2480 | Ga0207707_10044183 | |||
| 2481 | Ga0207707_10080650 | |||
| 2482 | Ga0207695_10000001 | |||
| 2483 | Ga0207695_10000026 | |||
| 2484 | Ga0207695_10000096 | |||
| 2485 | Ga0207695_10000144 | |||
| 2486 | Ga0207695_10000624 | |||
| 2487 | Ga0207695_10002958 | |||
| 2488 | Ga0207695_10008025 | |||
| 2489 | Ga0207695_10008849 | |||
| 2490 | Ga0207695_10010412 | |||
| 2491 | Ga0207695_10032685 | |||
| 2492 | Ga0207695_10070881 | |||
| 2493 | Ga0207695_10072943 | |||
| 2494 | Ga0207695_10078805 | |||
| 2495 | Ga0207695_10204021 | |||
| 2496 | Ga0207695_10226624 | |||
| 2497 | Ga0207671_10000890 | |||
| 2498 | Ga0207671_10003428 | |||
| 2499 | Ga0207671_10004998 | |||
| 2500 | Ga0207671_10007898 | |||
| 2501 | Ga0207671_10031185 | |||
| 2502 | Ga0207671_10049004 | |||
| 2503 | Ga0207671_10082288 | |||
| 2504 | Ga0207671_10093025 | |||
| 2505 | Ga0207671_10121419 | |||
| 2506 | Ga0207693_10000016 | |||
| 2507 | Ga0207693_10000067 | |||
| 2508 | Ga0207693_10000415 | |||
| 2509 | Ga0207693_10009303 | |||
| 2510 | Ga0207693_10010555 | |||
| 2511 | Ga0207693_10024245 | |||
| 2512 | Ga0207693_10081768 | |||
| 2513 | Ga0207663_10000608 | |||
| 2514 | Ga0207663_10151620 | |||
| 2515 | Ga0207660_10080862 | |||
| 2516 | Ga0207660_10240824 | |||
| 2517 | Ga0207662_10008567 | |||
| 2518 | Ga0207662_10024528 | |||
| 2519 | Ga0207657_10000003 | |||
| 2520 | Ga0207657_10006444 | |||
| 2521 | Ga0207657_10007051 | |||
| 2522 | Ga0207657_10013752 | |||
| 2523 | Ga0207657_10015794 | |||
| 2524 | Ga0207657_10017961 | |||
| 2525 | Ga0207657_10092158 | |||
| 2526 | Ga0207649_10002972 | |||
| 2527 | Ga0207649_10012549 | |||
| 2528 | Ga0207649_10015414 | |||
| 2529 | Ga0207649_10023379 | |||
| 2530 | Ga0207649_10026449 | |||
| 2531 | Ga0207649_10058379 | |||
| 2532 | Ga0207652_10005130 | |||
| 2533 | Ga0207652_10061707 | |||
| 2534 | Ga0207652_10078988 | |||
| 2535 | Ga0207646_10001021 | |||
| 2536 | Ga0207646_10003890 | |||
| 2537 | Ga0207646_10004869 | |||
| 2538 | Ga0207646_10129302 | |||
| 2539 | Ga0207694_10000028 | |||
| 2540 | Ga0207694_10000205 | |||
| 2541 | Ga0207694_10002229 | |||
| 2542 | Ga0207694_10011031 | |||
| 2543 | Ga0207694_10013189 | |||
| 2544 | Ga0207694_10015901 | |||
| 2545 | Ga0207694_10022150 | |||
| 2546 | Ga0207694_10026135 | |||
| 2547 | Ga0207694_10069923 | |||
| 2548 | Ga0207694_10221002 | |||
| 2549 | Ga0207650_10004541 | |||
| 2550 | Ga0207650_10162687 | |||
| 2551 | Ga0207659_10021238 | |||
| 2552 | Ga0207659_10037951 | |||
| 2553 | Ga0207687_10004132 | |||
| 2554 | Ga0207687_10212691 | |||
| 2555 | Ga0207700_10001225 | |||
| 2556 | Ga0207700_10008306 | |||
| 2557 | Ga0207700_10015420 | |||
| 2558 | Ga0207700_10017810 | |||
| 2559 | Ga0207700_10086091 | |||
| 2560 | Ga0207700_10088453 | |||
| 2561 | Ga0207664_10000158 | |||
| 2562 | Ga0207664_10030837 | |||
| 2563 | Ga0207664_10079271 | |||
| 2564 | Ga0207664_10109095 | |||
| 2565 | Ga0207664_10138572 | |||
| 2566 | Ga0207644_10033148 | |||
| 2567 | Ga0207690_10000007 | |||
| 2568 | Ga0207690_10001066 | |||
| 2569 | Ga0207690_10058000 | |||
| 2570 | Ga0207706_10002117 | |||
| 2571 | Ga0207706_10006147 | |||
| 2572 | Ga0207706_10035048 | |||
| 2573 | Ga0207706_10043245 | |||
| 2574 | Ga0207706_10052579 | |||
| 2575 | Ga0207706_10057290 | |||
| 2576 | Ga0207706_10063372 | |||
| 2577 | Ga0207686_10003543 | |||
| 2578 | Ga0207709_10005564 | |||
| 2579 | Ga0207669_10058280 | |||
| 2580 | Ga0207669_10131933 | |||
| 2581 | Ga0207704_10061262 | |||
| 2582 | Ga0207704_10155020 | |||
| 2583 | Ga0207704_10237209 | |||
| 2584 | Ga0207665_10004770 | |||
| 2585 | Ga0207665_10009285 | |||
| 2586 | Ga0207665_10012890 | |||
| 2587 | Ga0207665_10049135 | |||
| 2588 | Ga0207665_10061216 | |||
| 2589 | Ga0207665_10064816 | |||
| 2590 | Ga0207691_10006717 | |||
| 2591 | Ga0207691_10021448 | |||
| 2592 | Ga0207691_10029915 | |||
| 2593 | Ga0207711_10001182 | |||
| 2594 | Ga0207711_10021006 | |||
| 2595 | Ga0207711_10026400 | |||
| 2596 | Ga0207711_10099740 | |||
| 2597 | Ga0207711_10183800 | |||
| 2598 | Ga0207711_10205833 | |||
| 2599 | Ga0207711_10281436 | |||
| 2600 | Ga0207689_10003366 | |||
| 2601 | Ga0207689_10004289 | |||
| 2602 | Ga0207689_10279551 | |||
| 2603 | Ga0207661_10000250 | |||
| 2604 | Ga0207661_10002410 | |||
| 2605 | Ga0207661_10042036 | |||
| 2606 | Ga0207661_10042551 | |||
| 2607 | Ga0207661_10156626 | |||
| 2608 | Ga0207679_10087239 | |||
| 2609 | Ga0207679_10352683 | |||
| 2610 | Ga0207667_10000923 | |||
| 2611 | Ga0207667_10004811 | |||
| 2612 | Ga0207667_10005817 | |||
| 2613 | Ga0207667_10006129 | |||
| 2614 | Ga0207667_10011767 | |||
| 2615 | Ga0207667_10017454 | |||
| 2616 | Ga0207667_10028348 | |||
| 2617 | Ga0207667_10148399 | |||
| 2618 | Ga0207651_10033047 | |||
| 2619 | Ga0207712_10017716 | |||
| 2620 | Ga0207712_10091636 | |||
| 2621 | Ga0207712_10200051 | |||
| 2622 | Ga0207668_10056129 | |||
| 2623 | Ga0207668_10076056 | |||
| 2624 | Ga0207640_10149197 | |||
| 2625 | Ga0207640_10213416 | |||
| 2626 | Ga0207658_10001989 | |||
| 2627 | Ga0207658_10078736 | |||
| 2628 | Ga0207677_10000275 | |||
| 2629 | Ga0207677_10000439 | |||
| 2630 | Ga0207677_10013304 | |||
| 2631 | Ga0207677_10064994 | |||
| 2632 | Ga0207677_10187755 | |||
| 2633 | Ga0207677_10205067 | |||
| 2634 | Ga0207703_10000742 | |||
| 2635 | Ga0207703_10002465 | |||
| 2636 | Ga0207703_10022130 | |||
| 2637 | Ga0207639_10000105 | |||
| 2638 | Ga0207639_10014892 | |||
| 2639 | Ga0207639_10027591 | |||
| 2640 | Ga0207639_10070662 | |||
| 2641 | Ga0207639_10290576 | |||
| 2642 | Ga0207639_10374246 | |||
| 2643 | Ga0207678_10011557 | |||
| 2644 | Ga0207678_10030250 | |||
| 2645 | Ga0207678_10165117 | |||
| 2646 | Ga0207708_10008754 | |||
| 2647 | Ga0207708_10021493 | |||
| 2648 | Ga0207708_10071994 | |||
| 2649 | Ga0207708_10127174 | |||
| 2650 | Ga0207702_10000599 | |||
| 2651 | Ga0207702_10004059 | |||
| 2652 | Ga0207702_10046810 | |||
| 2653 | Ga0207702_10048079 | |||
| 2654 | Ga0207702_10061824 | |||
| 2655 | Ga0207702_10074126 | |||
| 2656 | Ga0207702_10113742 | |||
| 2657 | Ga0207702_10121003 | |||
| 2658 | Ga0207702_10148586 | |||
| 2659 | Ga0207641_10010365 | |||
| 2660 | Ga0207641_10021490 | |||
| 2661 | Ga0207641_10029594 | |||
| 2662 | Ga0207641_10039723 | |||
| 2663 | Ga0207641_10047107 | |||
| 2664 | Ga0207641_10191931 | |||
| 2665 | Ga0207648_10006249 | |||
| 2666 | Ga0207648_10040593 | |||
| 2667 | Ga0207648_10188307 | |||
| 2668 | Ga0207676_10000524 | |||
| 2669 | Ga0207676_10005412 | |||
| 2670 | Ga0207676_10012101 | |||
| 2671 | Ga0207674_10002407 | |||
| 2672 | Ga0207674_10003429 | |||
| 2673 | Ga0207674_10014153 | |||
| 2674 | Ga0207674_10017603 | |||
| 2675 | Ga0207674_10024955 | |||
| 2676 | Ga0207674_10032964 | |||
| 2677 | Ga0207674_10044065 | |||
| 2678 | Ga0207674_10099978 | |||
| 2679 | Ga0207674_10119966 | |||
| 2680 | Ga0207674_10215337 | |||
| 2681 | Ga0207675_100019174 | |||
| 2682 | Ga0207675_100180147 | |||
| 2683 | Ga0207675_100238965 | |||
| 2684 | Ga0207683_10000235 | |||
| 2685 | Ga0207683_10004790 | |||
| 2686 | Ga0207683_10039387 | |||
| 2687 | Ga0207683_10099965 | |||
| 2688 | Ga0207683_10111306 | |||
| 2689 | Ga0207683_10133697 | |||
| 2690 | Ga0207698_10000118 | |||
| 2691 | Ga0207698_10000128 | |||
| 2692 | Ga0207698_10000713 | |||
| 2693 | Ga0207698_10019726 | |||
| 2694 | Ga0207698_10048292 | |||
| 2695 | Ga0207698_10291069 | |||
| 2696 | Ga0209371_1000064 | |||
| 2697 | Ga0209371_1000156 | |||
| 2698 | Ga0209371_1000163 | |||
| 2699 | Ga0209371_1009505 | |||
| 2700 | Ga0209813_10002733 | |||
| 2701 | Ga0209813_10025731 | |||
| 2702 | Ga0209974_10029906 | |||
| 2703 | Ga0207428_10000139 | |||
| 2704 | Ga0207428_10083545 | |||
| 2705 | Ga0268266_10000001 | |||
| 2706 | Ga0268266_10000002 | |||
| 2707 | Ga0268266_10002024 | |||
| 2708 | Ga0268266_10063972 | |||
| 2709 | Ga0268266_10088318 | |||
| 2710 | Ga0268266_10123909 | |||
| 2711 | Ga0268266_10162313 | |||
| 2712 | Ga0268265_10041251 | |||
| 2713 | Ga0268265_10095534 | |||
| 2714 | Ga0268265_10101642 | |||
| 2715 | Ga0268264_10013801 | |||
| 2716 | Ga0268264_10029579 | |||
| 2717 | Ga0268264_10052154 | |||
| 2718 | Ga0268264_10059118 | |||
| 2719 | Ga0265334_10005063 | |||
| 2720 | Ga0265318_10005296 | |||
| 2721 | Ga0307517_10101037 | |||
| 2722 | Ga0307515_10000382 | |||
| 2723 | Ga0307515_10012279 | |||
| 2724 | Ga0307515_10019915 | |||
| 2725 | Ga0307515_10030579 | |||
| 2726 | Ga0307515_10074648 | |||
| 2727 | Ga0307515_10172322 | |||
| 2728 | Ga0265338_10001393 | |||
| 2729 | Ga0265338_10002714 | |||
| 2730 | Ga0265338_10007466 | |||
| 2731 | Ga0265338_10014811 | |||
| 2732 | Ga0265338_10017582 | |||
| 2733 | Ga0265338_10090147 | |||
| 2734 | Ga0265338_10144124 | |||
| 2735 | Ga0268256_1000028 | |||
| 2736 | Ga0268256_1000130 | |||
| 2737 | Ga0268256_1010223 | |||
| 2738 | Ga0307512_10007391 | |||
| 2739 | Ga0307512_10008127 | |||
| 2740 | Ga0307512_10034426 | |||
| 2741 | Ga0265330_10008769 | |||
| 2742 | Ga0265332_10003860 | |||
| 2743 | Ga0265332_10069791 | |||
| 2744 | Ga0265328_10002208 | |||
| 2745 | Ga0265328_10039329 | |||
| 2746 | Ga0265320_10000855 | |||
| 2747 | Ga0265320_10001597 | |||
| 2748 | Ga0265325_10003448 | |||
| 2749 | Ga0265329_10028998 | |||
| 2750 | Ga0265340_10000265 | |||
| 2751 | Ga0265340_10004766 | |||
| 2752 | Ga0265340_10007005 | |||
| 2753 | Ga0265339_10000040 | |||
| 2754 | Ga0265339_10002741 | |||
| 2755 | Ga0265339_10025292 | |||
| 2756 | Ga0265339_10030108 | |||
| 2757 | Ga0265331_10036190 | |||
| 2758 | Ga0265316_10010021 | |||
| 2759 | Ga0265316_10011815 | |||
| 2760 | Ga0265316_10076669 | |||
| 2761 | Ga0307513_10002543 | |||
| 2762 | Ga0307513_10014673 | |||
| 2763 | Ga0307513_10177374 | |||
| 2764 | Ga0307513_10228258 | |||
| 2765 | Ga0307509_10001893 | |||
| 2766 | Ga0307408_100036836 | |||
| 2767 | Ga0307408_100077198 | |||
| 2768 | Ga0265313_10004931 | |||
| 2769 | Ga0307508_10004834 | |||
| 2770 | Ga0307508_10111009 | |||
| 2771 | Ga0307508_10147031 | |||
| 2772 | Ga0307514_10012978 | |||
| 2773 | Ga0307514_10045789 | |||
| 2774 | Ga0265314_10002539 | |||
| 2775 | Ga0265314_10009578 | |||
| 2776 | Ga0265342_10000423 | |||
| 2777 | Ga0265342_10003774 | |||
| 2778 | Ga0265342_10006771 | |||
| 2779 | Ga0265342_10016092 | |||
| 2780 | Ga0265342_10066307 | |||
| 2781 | Ga0307516_10004216 | |||
| 2782 | Ga0307516_10014805 | |||
| 2783 | Ga0307516_10105861 | |||
| 2784 | Ga0307516_10211993 | |||
| 2785 | Ga0307405_10001559 | |||
| 2786 | Ga0307405_10026348 | |||
| 2787 | Ga0307410_10010347 | |||
| 2788 | Ga0307410_10027063 | |||
| 2789 | Ga0307410_10121053 | |||
| 2790 | Ga0307406_10009321 | |||
| 2791 | Ga0307407_10047162 | |||
| 2792 | Ga0307412_10000002 | |||
| 2793 | Ga0307409_100000035 | |||
| 2794 | Ga0307409_100025384 | |||
| 2795 | Ga0307409_100234346 | |||
| 2796 | Ga0307416_100000287 | |||
| 2797 | Ga0307416_100014506 | |||
| 2798 | Ga0307416_100238705 | |||
| 2799 | Ga0307416_100308438 | |||
| 2800 | Ga0307411_10016202 | |||
| 2801 | Ga0307415_100000003 | |||
| 2802 | Ga0307415_100003349 | |||
| 2803 | Ga0307415_100088003 | |||
| 2804 | Ga0307415_100156918 | |||
| 2805 | Ga0307507_10058129 | |||
| 2806 | Ga0307510_10024598 | |||
| 2807 | Ga0307510_10152346 | |||
| 2808 | Ga0307510_10160483 | |||
| 2809 | Ga0373936_0001387 | |||
| 2810 | Ga0373936_0004339 | |||
| 2811 | Ga0373954_0001393 | |||
| 2812 | Ga0373954_0036677 | |||
| 2813 | Ga0373954_0069570 | |||
| 2814 | Ga0373956_0010264 | |||
| 2815 | Ga0373957_0008634 | |||
| 2816 | Ga0373957_0067817 | |||
| 2817 | Ga0373943_0002644 | |||
| 2818 | Ga0373943_0014875 | |||
| 2819 | Ga0373946_0021681 | |||
| 2820 | Ga0373946_0042168 | |||
| 2821 | Ga0373955_0000268 | |||
| 2822 | Ga0373955_0010254 | |||
| 2823 | Ga0373955_0026620 | |||
| 2824 | Ga0373955_0081872 | |||
| 2825 | Ga0373955_0105566 | |||
| 2826 | Ga0316574_0020405 | |||
| 2827 | Ga0373924_0012004 | |||
| 2828 | Ga0373924_0053057 | |||
| 2829 | Ga0373924_0061963 | |||
| 2830 | Ga0373935_0003009 | |||
| 2831 | Ga0373935_0032408 | |||
| 2832 | Ga0373927_0001212 | |||
| 2833 | Ga0373933_0000815 | |||
| 2834 | Ga0373933_0062042 | |||
| 2835 | Ga0373933_0119161 | |||
| 2836 | Ga0373933_0119972 | |||
| 2837 | Ga0373933_0195479 | |||
| 2838 | Ga0373947_0000576 | |||
| 2839 | Ga0373947_0017352 | |||
| 2840 | Ga0373947_0020634 | |||
| 2841 | Ga0373947_0021702 | |||
| 2842 | Ga0373937_0001164 | |||
| 2843 | Ga0373937_0018449 | |||
| 2844 | Ga0373937_0039520 | |||
| 2845 | Ga0373937_0041709 | |||
| 2846 | Ga0373937_0061892 | |||
| 2847 | Ga0373937_0112477 | |||
| 2848 | Ga0373937_0114659 | |||
| 2849 | Ga0373937_0120279 | |||
| 2850 | Ga0373925_0000695 | |||
| 2851 | Ga0373925_0022538 | |||
| 2852 | Ga0373925_0028721 | |||
| 2853 | Ga0373925_0044235 | |||
| 2854 | Ga0373925_0048469 | |||
| 2855 | Ga0373925_0191266 | |||
| 2856 | Ga0395899_0000007 | |||
| 2857 | Ga0395899_0008149 | |||
| 2858 | Ga0395899_0027370 | |||
| 2859 | Ga0395900_0000178 | |||
| 2860 | Ga0395900_0008538 | |||
| 2861 | Ga0395900_0010740 | |||
| 2862 | Ga0395900_0021731 | |||
| 2863 | Ga0395900_0021936 | |||
| 2864 | Ga0395900_0122854 | |||
| 2865 | Ga0395900_0347418 | |||
| 2866 | Ga0395898_0000015 | |||
| 2867 | Ga0395898_0000276 | |||
| 2868 | Ga0395898_0003978 | |||
| 2869 | Ga0395898_0006320 | |||
| 2870 | Ga0395898_0012063 | |||
| 2871 | Ga0395898_0093924 | |||
| 2872 | Ga0395898_0330453 | |||
| 2873 | Ga0395905_0101233 | |||
| 2874 | Ga0395901_0004706 | |||
| 2875 | Ga0395901_0058868 | |||
| 2876 | Ga0395901_0205286 | |||
| 2877 | Ga0237819_00091 | |||
| 2878 | Ga0436365_1038204 | |||
| 2879 | Ga0436365_1103987 | |||
| 2880 | Ga0436365_1795729 | |||
| 2881 | Ga0436360_0019322 | |||
| 2882 | Ga0436360_1187113 | |||
| 2883 | Ga0436360_1316174 | |||
| 2884 | Ga0436361_0179379 | |||
| 2885 | Ga0436361_0251474 | |||
| 2886 | Ga0436361_0644146 | |||
| 2887 | Ga0436361_1155064 | |||
| 2888 | Ga0439436_0004743 | |||
| 2889 | Ga0439439_0004386 | |||
| 2890 | Ga0439461_0001590 | |||
| 2891 | Ga0439466_0010665 | |||
| 2892 | Ga0439465_0001613 | |||
| 2893 | Ga0439465_0002800 | |||
| 2894 | Ga0451798_0507020 | |||
| 2895 | Ga0451837_0067998 | |||
| 2896 | Ga0451843_1584175 | |||
| 2897 | Ga0439443_008533 | |||
| 2898 | Ga0439445_0000750 | |||
| 2899 | Ga0439448_0000101 | |||
| 2900 | Ga0439449_0000569 | |||
| 2901 | Ga0439457_008621 | |||
| 2902 | Ga0439446_0011920 | |||
| 2903 | Ga0439458_0000316 | |||
| 2904 | Ga0439434_0003556 | |||
| 2905 | Ga0439435_0003112 | |||
| 2906 | Ga0439435_0021646 | |||
| 2907 | Ga0466972_0043225 | |||
| 2908 | Ga0466965_0000624 | |||
| 2909 | Ga0466965_0072603 | |||
| 2910 | Ga0466961_0016023 | |||
| 2911 | Ga0466961_0025946 | |||
| 2912 | Ga0466961_0035759 | |||
| 2913 | Ga0466971_0038881 | |||
| 2914 | Ga0466971_0045234 | |||
| 2915 | Ga0466970_0042424 | |||
| 2916 | Ga0466957_0005735 | |||
| 2917 | Ga0466957_0007465 | |||
| 2918 | Ga0466957_0074006 | |||
| 2919 | Ga0466960_0011664 | |||
| 2920 | Ga0466960_0102830 | |||
| 2921 | Ga0466960_0120629 | |||
| 2922 | Ga0466959_0100912 | |||
| 2923 | Ga0466959_0112636 | |||
| 2924 | Ga0466958_0044976 | |||
| 2925 | Ga0466958_0083084 | |||
| 2926 | Ga0466967_0023808 | |||
| 2927 | Ga0466967_0039729 | |||
| 2928 | Ga0466967_0142380 | |||
| 2929 | Ga0466967_0278625 | |||
| 2930 | Ga0495592_0002012 | |||
| 2931 | Ga0495592_0030843 | |||
| 2932 | Ga0495592_0093548 | |||
| 2933 | Ga0495592_0162248 | |||
| 2934 | Ga0495603_0020105 | |||
| 2935 | Ga0495590_0005946 | |||
| 2936 | Ga0495590_0012541 | |||
| 2937 | Ga0495591_007498 | |||
| 2938 | Ga0495629_0002803 | |||
| 2939 | Ga0495629_0008252 | |||
| 2940 | Ga0495629_0018703 | |||
| 2941 | Ga0495629_0036598 | |||
| 2942 | Ga0495629_0047179 | |||
| 2943 | Ga0495629_0060195 | |||
| 2944 | Ga0495638_0000524 | |||
| 2945 | Ga0495638_0000660 | |||
| 2946 | Ga0495638_0000771 | |||
| 2947 | Ga0495638_0115939 | |||
| 2948 | Ga0495641_0018334 | |||
| 2949 | Ga0495641_0044696 | |||
| 2950 | Ga0495641_0062336 | |||
| 2951 | Ga0495651_0016841 | |||
| 2952 | Ga0495651_0059266 | |||
| 2953 | Ga0495651_0063761 | |||
| 2954 | Ga0495653_0022294 | |||
| 2955 | Ga0495653_0059574 | |||
| 2956 | Ga0495650_0000010 | |||
| 2957 | Ga0495650_0002608 | |||
| 2958 | Ga0495650_0006223 | |||
| 2959 | Ga0495650_0006684 | |||
| 2960 | Ga0495650_0008172 | |||
| 2961 | Ga0495650_0029271 | |||
| 2962 | Ga0495580_0001025 | |||
| 2963 | Ga0495580_0002243 | |||
| 2964 | Ga0495580_0008623 | |||
| 2965 | Ga0495580_0013994 | |||
| 2966 | Ga0495580_0019567 | |||
| 2967 | Ga0495580_0026937 | |||
| 2968 | Ga0495580_0027927 | |||
| 2969 | Ga0495580_0089287 | |||
| 2970 | Ga0495580_0181247 | |||
| 2971 | Ga0495580_0196376 | |||
| 2972 | Ga0495582_0000629 | |||
| 2973 | Ga0495582_0003241 | |||
| 2974 | Ga0495582_0004552 | |||
| 2975 | Ga0495582_0010551 | |||
| 2976 | Ga0495582_0122311 | |||
| 2977 | Ga0495605_0015098 | |||
| 2978 | Ga0495605_0074168 | |||
| 2979 | Ga0495639_0007177 | |||
| 2980 | Ga0495662_0012591 | |||
| 2981 | Ga0495664_0004527 | |||
| 2982 | Ga0495664_0014620 | |||
| 2983 | Ga0495664_0029425 | |||
| 2984 | Ga0495585_0011113 | |||
| 2985 | Ga0495585_0036929 | |||
| 2986 | Ga0495594_0005454 | |||
| 2987 | Ga0495594_0007680 | |||
| 2988 | Ga0495594_0012425 | |||
| 2989 | Ga0495594_0048432 | |||
| 2990 | Ga0495596_0008596 | |||
| 2991 | Ga0495596_0017058 | |||
| 2992 | Ga0495596_0022158 | |||
| 2993 | Ga0495596_0039457 | |||
| 2994 | Ga0495583_0007667 | |||
| 2995 | Ga0495583_0039414 | |||
| 2996 | Ga0495606_0016529 | |||
| 2997 | Ga0495606_0055453 | |||
| 2998 | Ga0495606_0067888 | |||
| 2999 | Ga0495608_0040078 | |||
| 3000 | Ga0495608_0052888 | |||
| 3001 | Ga0495610_0002377 | |||
| 3002 | Ga0495610_0003137 | |||
| 3003 | Ga0495610_0032046 | |||
| 3004 | Ga0495618_0019115 | |||
| 3005 | Ga0495618_0031243 | |||
| 3006 | Ga0495620_0024001 | |||
| 3007 | Ga0495628_0002174 | |||
| 3008 | Ga0495628_0031291 | |||
| 3009 | Ga0495630_0006260 | |||
| 3010 | Ga0495630_0020419 | |||
| 3011 | Ga0495630_0044220 | |||
| 3012 | Ga0495630_0058861 | |||
| 3013 | Ga0495630_0059577 | |||
| 3014 | Ga0495630_0085528 | |||
| 3015 | Ga0495644_0003181 | |||
| 3016 | Ga0495648_0000066 | |||
| 3017 | Ga0495648_0014966 | |||
| 3018 | Ga0495648_0030098 | |||
| 3019 | Ga0495666_0010385 | |||
| 3020 | Ga0495666_0022651 | |||
| 3021 | Ga0495642_0014115 | |||
| 3022 | Ga0495642_0040154 | |||
| 3023 | Ga0495652_0013301 | |||
| 3024 | Ga0495654_0000456 | |||
| 3025 | Ga0495654_0044656 | |||
| 3026 | Ga0495654_0046961 | |||
| 3027 | Ga0495665_0005960 | |||
| 3028 | Ga0495665_0008376 | |||
| 3029 | Ga0495665_0028815 | |||
| 3030 | Ga0495665_0046416 | |||
| 3031 | Ga0495665_0061496 | |||
| 3032 | Ga0495640_0004522 | |||
| 3033 | Ga0495640_0008292 | |||
| 3034 | Ga0495640_0202713 | |||
| 3035 | Ga0495586_0073522 | |||
| 3036 | Ga0495587_0001737 | |||
| 3037 | Ga0495598_0002267 | |||
| 3038 | Ga0495598_0003753 | |||
| 3039 | Ga0495609_0010673 | |||
| 3040 | Ga0495621_0000085 | |||
| 3041 | Ga0495645_0000331 | |||
| 3042 | Ga0495645_0002552 | |||
| 3043 | Ga0495645_0025130 | |||
| 3044 | Ga0495645_0044754 | |||
| 3045 | Ga0495645_0081479 | |||
| 3046 | Ga0495645_0115443 | |||
| 3047 | Ga0495622_0039273 | |||
| 3048 | Ga0495622_0041595 | |||
| 3049 | Ga0495633_0030748 | |||
| 3050 | Ga0495633_0102686 | |||
| 3051 | Ga0495667_0038447 | |||
| 3052 | Ga0495667_0046163 | |||
| 3053 | Ga0495656_0026282 | |||
| 3054 | Ga0495668_0002861 | |||
| 3055 | Ga0495668_0004855 | |||
| 3056 | Ga0495668_0024560 | |||
| 3057 | Ga0495634_0107911 | |||
| 3058 | Ga0495625_0067523 | |||
| 3059 | Ga0495625_0094896 | |||
| 3060 | Ga0495635_0000993 | |||
| 3061 | Ga0495635_0008216 | |||
| 3062 | Ga0495635_0032291 | |||
| 3063 | Ga0495635_0081248 | |||
| 3064 | Ga0495635_0155215 | |||
| 3065 | Ga0495659_0050810 | |||
| 3066 | Ga0495661_0001703 | |||
| 3067 | Ga0495588_0008882 | |||
| 3068 | Ga0495657_0004997 | |||
| 3069 | Ga0495657_0025873 | |||
| 3070 | Ga0495657_0218651 | |||
| 3071 | Ga0495599_0079861 | |||
| 3072 | Ga0495623_0048362 | |||
| 3073 | Ga0495646_0000924 | |||
| 3074 | Ga0495646_0029020 | |||
| 3075 | Ga0495646_0066861 | |||
| 3076 | Ga0495669_0012480 | |||
| 3077 | Ga0495613_0003805 | |||
| 3078 | Ga0495613_0009065 | |||
| 3079 | Ga0495613_0016936 | |||
| 3080 | Ga0495613_0028018 | |||
| 3081 | Ga0495613_0074840 | |||
| 3082 | Ga0495624_0001188 | |||
| 3083 | Ga0495624_0016621 | |||
| 3084 | Ga0495624_0078015 | |||
| 3085 | Ga0495624_0152955 | |||
| 3086 | Ga0495670_0000012 | |||
| 3087 | Ga0495670_0004038 | |||
| 3088 | Ga0495670_0069207 | |||
| 3089 | Ga0495671_0013693 | |||
| 3090 | Ga0495649_0016355 | |||
| 3091 | Ga0495589_0022210 | |||
| 3092 | Ga0495589_0059478 | |||
| 3093 | Ga0495589_0067180 | |||
| 3094 | Ga0495600_0002361 | |||
| 3095 | Ga0495600_0014475 | |||
| 3096 | Ga0495600_0049867 | |||
| 3097 | Ga0495600_0126510 | |||
| 3098 | Ga0495581_0002516 | |||
| 3099 | Ga0495581_0005826 | |||
| 3100 | Ga0495581_0006324 | |||
| 3101 | Ga0495581_0007107 | |||
| 3102 | Ga0495581_0024403 | |||
| 3103 | Ga0495604_0000171 | |||
| 3104 | Ga0495636_0016396 | |||
| 3105 | Ga0495674_0001885 | |||
| 3106 | Ga0495674_0003055 | |||
| 3107 | Ga0495674_0004949 | |||
| 3108 | Ga0495674_0029631 | |||
| 3109 | Ga0495674_0064294 | |||
| 3110 | Ga0495674_0078474 | |||
| 3111 | Ga0495674_0106062 | |||
| 3112 | Ga0495674_0271867 | |||
| 3113 | Ga0495672_0005687 | |||
| 3114 | Ga0495672_0011070 | |||
| 3115 | Ga0495672_0104019 | |||
| 3116 | Ga0495676_0031826 | |||
| 3117 | Ga0495676_0055285 | |||
| 3118 | Ga0495680_0036344 | |||
| 3119 | Ga0495680_0081120 | |||
| 3120 | Ga0495680_0097822 | |||
| 3121 | Ga0495683_0002900 | |||
| 3122 | Ga0495683_0003522 | |||
| 3123 | Ga0495683_0011841 | |||
| 3124 | Ga0495683_0021022 | |||
| 3125 | Ga0495687_005145 | |||
| 3126 | Ga0495687_006290 | |||
| 3127 | Ga0495675_0016288 | |||
| 3128 | Ga0495675_0019550 | |||
| 3129 | Ga0495675_0123453 | |||
| 3130 | Ga0495679_000273 | |||
| 3131 | Ga0495679_000939 | |||
| 3132 | Ga0495679_034080 | |||
| 3133 | Ga0495673_0000333 | |||
| 3134 | Ga0495673_0022148 | |||
| 3135 | Ga0495684_0185286 | |||
| 3136 | Ga0495686_0001315 | |||
| 3137 | Ga0495686_0027530 | |||
| 3138 | Ga0495593_0017631 | |||
| 3139 | Ga0495593_0025352 | |||
| 3140 | Ga0495593_0081482 | |||
| 3141 | Ga0495602_0002240 | |||
| 3142 | Ga0495602_0025467 | |||
| 3143 | Ga0495602_0109752 | |||
| 3144 | Ga0495602_0241556 | |||
| 3145 | Ga0495614_0001803 | |||
| 3146 | Ga0495614_0006770 | |||
| 3147 | Ga0495626_0004431 | |||
| 3148 | Ga0495626_0006020 | |||
| 3149 | Ga0495626_0046631 | |||
| 3150 | Ga0496100_0000329 | |||
| 3151 | Ga0496100_0047202 | |||
| 3152 | Ga0496100_0109795 | |||
| 3153 | Ga0496100_0187490 | |||
| 3154 | Ga0496101_0000240 | |||
| 3155 | Ga0496101_0021193 | |||
| 3156 | Ga0496101_0158394 | |||
| 3157 | Ga0496101_0224304 | |||
| 3158 | Ga0496102_0000431 | |||
| 3159 | Ga0496102_0061300 | |||
| 3160 | Ga0496102_0066063 | |||
| 3161 | Ga0496102_0141287 | |||
| 3162 | Ga0496102_0193590 | |||
| 3163 | Ga0496103_0000536 | |||
| 3164 | Ga0496103_0030896 | |||
| 3165 | Ga0496103_0093199 | |||
| 3166 | Ga0496103_0107035 | |||
| 3167 | Ga0496103_0128347 | |||
| 3168 | Ga0496104_0000520 | |||
| 3169 | Ga0496104_0001700 | |||
| 3170 | Ga0496104_0025723 | |||
| 3171 | Ga0496104_0065529 | |||
| 3172 | Ga0496104_0161793 | |||
| 3173 | Ga0496104_0323625 | |||
| 3174 | Ga0496105_0004098 | |||
| 3175 | Ga0496105_0060506 | |||
| 3176 | Ga0496105_0061918 | |||
| 3177 | Ga0496105_0189970 | |||
| 3178 | Ga0496106_0000494 | |||
| 3179 | Ga0496106_0058812 | |||
| 3180 | Ga0496106_0118051 | |||
| 3181 | Ga0496107_0025599 | |||
| 3182 | Ga0496107_0031807 | |||
| 3183 | Ga0496108_0031402 | |||
| 3184 | Ga0496108_0067322 | |||
| 3185 | Ga0496109_0015425 | |||
| 3186 | Ga0496110_0388483 | |||
| 3187 | Ga0496111_0003474 | |||
| 3188 | Ga0496111_0010345 | |||
| 3189 | Ga0496111_0022644 | |||
| 3190 | Ga0496112_0015283 | |||
| 3191 | Ga0496112_0041087 | |||
| 3192 | Ga0496112_0110468 | |||
| 3193 | Ga0496112_0160144 | |||
| 3194 | Ga0496112_0347368 | |||
| 3195 | Ga0496113_0003971 | |||
| 3196 | Ga0496114_0009894 | |||
| 3197 | Ga0496114_0013881 | |||
| 3198 | Ga0496114_0022844 | |||
| 3199 | Ga0496114_0024150 | |||
| 3200 | Ga0496114_0083014 | |||
| 3201 | Ga0496114_0086916 | |||
| 3202 | Ga0496114_0265627 | |||
| 3203 | Ga0496115_0000095 | |||
| 3204 | Ga0496115_0000418 | |||
| 3205 | Ga0496115_0007083 | |||
| 3206 | Ga0496115_0007701 | |||
| 3207 | Ga0496115_0021039 | |||
| 3208 | Ga0496115_0039979 | |||
| 3209 | Ga0496115_0072207 | |||
| 3210 | Ga0496115_0090722 | |||
| 3211 | Ga0496115_0155710 | |||
| 3212 | Ga0496115_0356621 | |||
| 3213 | Ga0496116_0044250 | |||
| 3214 | Ga0496116_0070464 | |||
| 3215 | Ga0496117_0000660 | |||
| 3216 | Ga0496117_0001545 | |||
| 3217 | Ga0496117_0001713 | |||
| 3218 | Ga0496117_0005687 | |||
| 3219 | Ga0496117_0013332 | |||
| 3220 | Ga0496117_0123880 | |||
| 3221 | Ga0496118_0000489 | |||
| 3222 | Ga0496118_0000553 | |||
| 3223 | Ga0496118_0002148 | |||
| 3224 | Ga0496118_0003048 | |||
| 3225 | Ga0496118_0021171 | |||
| 3226 | Ga0496118_0026330 | |||
| 3227 | Ga0496118_0028675 | |||
| 3228 | Ga0496118_0056819 | |||
| 3229 | Ga0496118_0136068 | |||
| 3230 | Ga0496120_0013641 | |||
| 3231 | Ga0496121_0001288 | |||
| 3232 | Ga0496121_0012333 | |||
| 3233 | Ga0496122_0031846 | |||
| 3234 | Ga0496123_0038126 | |||
| 3235 | Ga0496124_0005515 | |||
| 3236 | Ga0496124_0006356 | |||
| 3237 | Ga0496124_0009191 | |||
| 3238 | Ga0496124_0037489 | |||
| 3239 | Ga0496124_0049123 | |||
| 3240 | Ga0496125_0009204 | |||
| 3241 | Ga0496125_0034981 | |||
| 3242 | Ga0496126_0000004 | |||
| 3243 | Ga0496126_0000012 | |||
| 3244 | Ga0496126_0000164 | |||
| 3245 | Ga0496126_0001766 | |||
| 3246 | Ga0496126_0005504 | |||
| 3247 | Ga0495678_000685 | |||
| 3248 | Ga0495678_002606 | |||
| 3249 | Ga0495678_010935 | |||
| 3250 | Ga0495678_023431 | |||
| 3251 | Ga0495682_0011546 | |||
| 3252 | Ga0495682_0033312 | |||
| 3253 | Ga0501031_0000677 | |||
| 3254 | Ga0501032_0022260 | |||
| 3255 | Ga0501032_0022667 | |||
| 3256 | Ga0501032_0037277 | |||
| 3257 | Ga0501033_0005905 | |||
| 3258 | Ga0501033_0052034 | |||
| 3259 | Ga0501033_0109883 | |||
| 3260 | Ga0501034_0000134 | |||
| 3261 | Ga0501034_0029789 | |||
| 3262 | Ga0501034_0031233 | |||
| 3263 | Ga0501034_0034281 | |||
| 3264 | Ga0501034_0039420 | |||
| 3265 | Ga0501034_0061238 | |||
| 3266 | Ga0501034_0067155 | |||
| 3267 | Ga0501034_0070685 | |||
| 3268 | Ga0501034_0117618 | |||
| 3269 | Ga0501034_0131338 | |||
| 3270 | Ga0501034_0265814 | |||
| 3271 | Ga0501036_0023597 | |||
| 3272 | Ga0501036_0059637 | |||
| 3273 | Ga0501036_0379981 | |||
| 3274 | Ga0501036_0398219 | |||
| 3275 | Ga0501037_0010071 | |||
| 3276 | Ga0501037_0016093 | |||
| 3277 | Ga0501037_0017926 | |||
| 3278 | Ga0501038_0015713 | |||
| 3279 | Ga0501038_0021058 | |||
| 3280 | Ga0501038_0028912 | |||
| 3281 | Ga0501038_0047993 | |||
| 3282 | Ga0501038_0051473 | |||
| 3283 | Ga0501038_0196683 | |||
| 3284 | Ga0501038_0272372 | |||
| 3285 | Ga0501039_0000155 | |||
| 3286 | Ga0501039_0003043 | |||
| 3287 | Ga0501039_0011983 | |||
| 3288 | Ga0501039_0018373 | |||
| 3289 | Ga0501039_0023094 | |||
| 3290 | Ga0501039_0064657 | |||
| 3291 | Ga0501043_0002350 | |||
| 3292 | Ga0501043_0005289 | |||
| 3293 | Ga0501043_0008249 | |||
| 3294 | Ga0501043_0104806 | |||
| 3295 | Ga0501046_0063205 | |||
| 3296 | Ga0501046_0077634 | |||
| 3297 | Ga0501046_0106977 | |||
| 3298 | Ga0501047_0002497 | |||
| 3299 | Ga0501047_0003483 | |||
| 3300 | Ga0501047_0012111 | |||
| 3301 | Ga0501047_0036175 | |||
| 3302 | Ga0501047_0052550 | |||
| 3303 | Ga0501047_0107039 | |||
| 3304 | Ga0501047_0139688 | |||
| 3305 | Ga0501047_0189711 | |||
| 3306 | Ga0501047_0222039 | |||
| 3307 | Ga0501048_0020590 | |||
| 3308 | Ga0501048_0137840 | |||
| 3309 | Ga0501067_0002848 | |||
| 3310 | Ga0501067_0005996 | |||
| 3311 | Ga0501068_0016921 | |||
| 3312 | Ga0501068_0113478 | |||
| 3313 | Ga0501069_0000376 | |||
| 3314 | Ga0501070_0000063 | |||
| 3315 | Ga0501070_0005955 | |||
| 3316 | Ga0501070_0100445 | |||
| 3317 | Ga0501070_0280618 | |||
| 3318 | Ga0501071_0136805 | |||
| 3319 | Ga0501072_0070637 | |||
| 3320 | Ga0501073_0019811 | |||
| 3321 | Ga0501073_0049499 | |||
| 3322 | Ga0501073_0051797 | |||
| 3323 | Ga0501073_0077001 | |||
| 3324 | Ga0501074_0013722 | |||
| 3325 | Ga0501076_0243888 | |||
| 3326 | Ga0501079_0013523 | |||
| 3327 | Ga0501079_0017576 | |||
| 3328 | Ga0501080_0016216 | |||
| 3329 | Ga0501080_0056304 | |||
| 3330 | Ga0501080_0110619 | |||
| 3331 | Ga0501080_0151692 | |||
| 3332 | Ga0501083_0000253 | |||
| 3333 | Ga0501083_0000698 | |||
| 3334 | Ga0501083_0008100 | |||
| 3335 | Ga0501083_0010189 | |||
| 3336 | Ga0501083_0016677 | |||
| 3337 | Ga0501035_0002824 | |||
| 3338 | Ga0501035_0006275 | |||
| 3339 | Ga0501035_0022787 | |||
| 3340 | Ga0501035_0070383 | |||
| 3341 | Ga0501035_0168215 | |||
| 3342 | Ga0501035_0289115 | |||
| 3343 | Ga0501044_0000231 | |||
| 3344 | Ga0501044_0003105 | |||
| 3345 | Ga0501044_0005924 | |||
| 3346 | Ga0501044_0146748 | |||
| 3347 | Ga0501044_0232059 | |||
| 3348 | nmdc:mga03683_104830_c1 | |||
| 3349 | nmdc:mga03n38_21227_c1 | |||
| 3350 | nmdc:mga00v17_1482_c1 | |||
| 3351 | nmdc:mga00v17_24033_c1 | |||
| 3352 | nmdc:mga00v17_49158_c1 | |||
| 3353 | nmdc:mga00v17_5440_c1 | |||
| 3354 | nmdc:mga00v17_678_c1 | |||
| 3355 | nmdc:mga00v17_83159_c1 | |||
| 3356 | nmdc:mga0yw44_159_c1 | |||
| 3357 | nmdc:mga0yw44_9052_c1 | |||
| 3358 | nmdc:mga0k408_1287_c1 | |||
| 3359 | nmdc:mga0k408_255_c1 | |||
| 3360 | nmdc:mga0k408_42255_c1 | |||
| 3361 | nmdc:mga06z11_2047_c1 | |||
| 3362 | nmdc:mga06z11_2323_c1 | |||
| 3363 | nmdc:mga04h51_1684_c1 | |||
| 3364 | nmdc:mga04h51_25807_c1 | |||
| 3365 | nmdc:mga07m45_115875_c1 | |||
| 3366 | nmdc:mga07m45_125_c1 | |||
| 3367 | nmdc:mga07m45_4932_c1 | |||
| 3368 | nmdc:mga05p37_1061_c1 | |||
| 3369 | nmdc:mga05p37_127307_c1 | |||
| 3370 | nmdc:mga05p37_26887_c1 | |||
| 3371 | nmdc:mga05p37_94457_c1 | |||
| 3372 | nmdc:mga09592_331305_c1 | |||
| 3373 | nmdc:mga09592_3415_c1 | |||
| 3374 | nmdc:mga0qj67_62723_c1 | |||
| 3375 | nmdc:mga06r32_302370_c1 | |||
| 3376 | nmdc:mga08y16_2005_c1 | |||
| 3377 | nmdc:mga08y16_30259_c1 | |||
| 3378 | nmdc:mga08y16_365477_c1 | |||
| 3379 | nmdc:mga08y16_75174_c1 | |||
| 3380 | nmdc:mga0n895_111855_c1 | |||
| 3381 | nmdc:mga0n895_123797_c1 | |||
| 3382 | nmdc:mga0n895_125788_c1 | |||
| 3383 | nmdc:mga0n895_148550_c1 | |||
| 3384 | nmdc:mga0n895_218486_c1 | |||
| 3385 | nmdc:mga0n895_400_c1 | |||
| 3386 | nmdc:mga0n895_95343_c1 | |||
| 3387 | nmdc:mga0rr50_153234_c1 | |||
| 3388 | nmdc:mga0rr50_3425_c1 | |||
| 3389 | nmdc:mga0rr50_64788_c1 | |||
| 3390 | nmdc:mga08x19_11861_c1 | |||
| 3391 | nmdc:mga08x19_15973_c1 | |||
| 3392 | nmdc:mga08x19_62163_c1 | |||
| 3393 | nmdc:mga08x19_812_c1 | |||
| 3394 | nmdc:mga08x19_8318_c1 | |||
| 3395 | nmdc:mga08x19_97023_c1 | |||
| 3396 | nmdc:mga0a205_267631_c1 | |||
| 3397 | nmdc:mga0a205_38681_c1 | |||
| 3398 | nmdc:mga0a205_76833_c1 | |||
| 3399 | nmdc:mga0sz30_21_c2 | |||
| 3400 | Ga0495601_0002820 | |||
| 3401 | Ga0495601_0030486 | |||
| 3402 | Ga0495601_0045594 | |||
| 3403 | Ga0495612_0046140 | |||
| 3404 | Ga0500635_0000075 | |||
| 3405 | Ga0495595_0026468 | |||
| 3406 | Ga0495619_0013014 | |||
| 3407 | Ga0495619_0025834 | |||
| 3408 | Ga0495619_0032276 | |||
| 3409 | Ga0495619_0050085 | |||
| 3410 | Ga0500578_0000082 | |||
| 3411 | Ga0500578_0000385 | |||
| 3412 | Ga0500643_011668 | |||
| 3413 | Ga0500644_0000109 | |||
| 3414 | Ga0500646_0000459 | |||
| 3415 | Ga0500566_0009372 | |||
| 3416 | Ga0500566_0029192 | |||
| 3417 | Ga0500640_004532 | |||
| 3418 | Ga0500562_058560 | |||
| 3419 | Ga0500572_001651 | |||
| 3420 | Ga0500595_000803 | |||
| 3421 | Ga0500614_000873 | |||
| 3422 | Ga0500658_0006658 | |||
| 3423 | Ga0500559_0009950 | |||
| 3424 | Ga0500568_0002365 | |||
| 3425 | Ga0500573_0041144 | |||
| 3426 | Ga0500577_0001382 | |||
| 3427 | Ga0500603_005912 | |||
| 3428 | Ga0500616_0000175 | |||
| 3429 | Ga0500616_0000304 | |||
| 3430 | Ga0500616_0007478 | |||
| 3431 | Ga0500619_039615 | |||
| 3432 | Ga0500622_0006457 | |||
| 3433 | Ga0500622_0022484 | |||
| 3434 | Ga0500622_0043262 | |||
| 3435 | Ga0500624_000010 | |||
| 3436 | Ga0500633_0003207 | |||
| 3437 | Ga0500636_0001018 | |||
| 3438 | Ga0500601_001174 | |||
| 3439 | Ga0501084_0023017 | |||
| 3440 | Ga0501084_0113137 | |||
| 3441 | Ga0501084_0220502 | |||
| 3442 | Ga0501082_0008535 | |||
| 3443 | Ga0501082_0008939 | |||
| 3444 | Ga0501082_0015864 | |||
| 3445 | Ga0501082_0149744 | |||
| 3446 | Ga0501082_0318212 | |||
| 3447 | Ga0466962_0011986 | |||
| 3448 | 2501071596 | |||
| 3449 | 2501406993 | |||
| 3450 | 2508735020 | |||
| 3451 | 2509075644 | |||
| 3452 | 2511097894 | |||
| 3453 | 2511108080 | |||
| 3454 | 2511171181 | |||
| 3455 | 2511196915 | |||
| 3456 | 2514046995 | |||
| 3457 | 2516021920 | |||
| 3458 | 2523105081 | |||
| 3459 | 2583150147 | |||
| 3460 | 2585147618 | |||
| 3461 | 2585147965 | |||
| 3462 | 2585205182 | |||
| 3463 | 2585226398 | |||
| 3464 | 2585548682 | |||
| 3465 | 2599748274 | |||
| 3466 | 2600210186 | |||
| 3467 | 2600224762 | |||
| 3468 | 2600812328 | |||
| 3469 | 2643748312 | |||
| 3470 | 2643822235 | |||
| 3471 | 2644113688 | |||
| 3472 | 2644164351 | |||
| 3473 | 2644195736 | |||
| 3474 | 2644346378 | |||
| 3475 | 2644508165 | |||
| 3476 | 2676745676 | |||
| 3477 | 2691330082 | |||
| 3478 | 2738822118 | |||
| 3479 | 2738834600 | |||
| 3480 | 2738875804 | |||
| 3481 | 2739187756 | |||
| 3482 | 2739222402 | |||
| 3483 | 2739364161 | |||
| 3484 | 2748017801 | |||
| 3485 | 2774868766 | |||
| 3486 | 2775658118 | |||
| 3487 | 2776259943 | |||
| 3488 | 2792833666 | |||
| 3489 | 2793331656 | |||
| 3490 | 2793982534 | |||
| 3491 | 2808968865 | |||
| 3492 | 2809003696 | |||
| 3493 | 2809010973 | |||
| 3494 | 2819620445 | |||
| 3495 | 2821444784 | |||
| 3496 | 2844535182 | |||
| 3497 | 2844842987 | |||
| 3498 | 2862580343 | |||
| 3499 | 2866556077 | |||
| 3500 | 2870073679 | |||
| 3501 | 2882461803 | |||
| 3502 | 2883091828 | |||
| 3503 | 2884763828 | |||
| 3504 | 2885279411 | |||
| 3505 | 2891560362 | |||
| 3506 | 2891672537 | |||
| 3507 | 2894239613 | |||
| 3508 | 2894416919 | |||
| 3509 | 2897804475 | |||
| 3510 | 2899376802 | |||
| 3511 | 2900641679 | |||
| 3512 | 2904480616 | |||
| 3513 | 2904486756 | |||
| 3514 | 2904622837 | |||
| 3515 | 2904769089 | |||
| 3516 | 2904769650 | |||
| 3517 | 2904773216 | |||
| 3518 | 2904774119 | |||
| 3519 | 2908813950 | |||
| 3520 | 2919175511 | |||
| 3521 | 2919420204 | |||
| 3522 | 2919422421 | |||
| 3523 | 2919434037 | |||
| 3524 | 2919435326 | |||
| 3525 | 2919515779 | |||
| 3526 | 2919525086 | |||
| 3527 | 2919528087 | |||
| 3528 | 2919537687 | |||
| 3529 | 2919675500 | |||
| 3530 | 2921648255 | |||
| 3531 | 2928027868 | |||
| 3532 | 2928108953 | |||
| 3533 | 2928136177 | |||
| 3534 | 2928156713 | |||
| 3535 | 2928158255 | |||
| 3536 | 2928167526 | |||
| 3537 | 2928504042 | |||
| 3538 | 2928527493 | |||
| 3539 | 2939600523 | |||
| 3540 | 2945938430 | |||
| 3541 | 2946062943 | |||
| 3542 | 2981996646 | |||
| 3543 | 2984558755 | |||
| 3544 | 2984566739 | |||
| 3545 | 2990708432 | |||
| 3546 | 2993357927 | |||
| 3547 | 2996224566 | |||
| 3548 | 3005411816 | |||
| 3549 | 3006429796 | |||
| 3550 | 642615805 | |||
| 3551 | 8003015422 | |||
| 3552 | 8005387414 | |||
| 3553 | 8005400006 | |||
| 3554 | 8020942445 | |||
| 3555 | 8020952786 | |||
| 3556 | 8020954605 | |||
| 3557 | 8047719033 | |||
| 3558 | 8047893907 | |||
| 3559 | 8047901290 | |||
| 3560 | 8048135099 | |||
| 3561 | 8048357609 | |||
| 3562 | 8048364924 | |||
| 3563 | 8048370924 | |||
| 3564 | 8048378231 | |||
| 3565 | 8048387329 | |||
| 3566 | 8048388498 | |||
| 3567 | 8054304135 | |||
| 3568 | 8054473778 | |||
| 3569 | 8054478176 | |||
| 3570 | 8055268674 | |||
| 3571 | 8055304737 | |||
| 3572 | 8056063235 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3ow1-assembly5.cif.gz_G | crystal structure of d-mannonate dehydratase from chromohalobacter salexigens complexed with mg | 0.9968 | 1 | 402 |
| 4kpl-assembly1.cif.gz_E | crystal structure of d-mannonate dehydratase from chromohalobacter salexigens complexed with mg,d-mannonate and 2-keto-3-deoxy-d-gluconate | 0.9965 | 1 | 402 |
| 3ow1-assembly3.cif.gz_E | crystal structure of d-mannonate dehydratase from chromohalobacter salexigens complexed with mg | 0.9964 | 1 | 402 |
| 3rgt-assembly2.cif.gz_B | crystal structure of d-mannonate dehydratase from chromohalobacter salexigens complexed with d-arabinohydroxamate | 0.9962 | 1 | 402 |
| 4k2s-assembly3.cif.gz_H | crystal structure of the mutant p317a of d-mannonate dehydratase from chromohalobacter salexigens complexed with mg and d-gluconate | 0.9962 | 2 | 402 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P38104_1_104_3.30.390.10 | Alpha Beta;2-Layer Sandwich;Enolase-like; domain 1;Enolase-like, N-terminal domain | 0.9993 | 1 | 101 | 3.30.390.10 |
| 4k1wA01 | Alpha Beta;2-Layer Sandwich;Enolase-like; domain 1;Enolase-like, N-terminal domain | 0.9993 | 2 | 102 | 3.30.390.10 |
| 3bsmB02 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Enolase-like C-terminal domain | 0.9953 | 106 | 365 | 3.20.20.120 |
| 4f4rA02 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Enolase-like C-terminal domain | 0.9936 | 106 | 365 | 3.20.20.120 |
| 3bsmB01 | Alpha Beta;2-Layer Sandwich;Enolase-like; domain 1;Enolase-like, N-terminal domain | 0.9862 | 1 | 102 | 3.30.390.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A447U3M1-F1-model_v4 | Starvation sensing protein RspA | 0.9996 | 1 | 109 |
|
| AF-H1SGP0-F1-model_v4 | Bifunctional D-altronate/D-mannonate dehydratase | 0.9964 | 235 | 402 |
|
| AF-A0A838S228-F1-model_v4 | Bifunctional D-altronate/D-mannonate dehydratase | 0.9958 | 221 | 402 |
|
| AF-A0A7Y9GTP0-F1-model_v4 | Mannonate dehydratase (EC 4.2.1.8) | 0.9954 | 2 | 402 |
GO:0000287
GO:0008927 GO:0009063 GO:0016052 |
| AF-A0A2V5L7C7-F1-model_v4 | Bifunctional D-altronate/D-mannonate dehydratase | 0.9952 | 2 | 402 |
GO:0000287
GO:0008927 GO:0009063 GO:0016052 |