F495698

General Info

Members Datasets Scaffolds Average Seq Length
1786 740 3572 406

Family's Representative Sequence

Representative Sequence 3300025735|Ga0207713_1034368|Ga0207713_10343681
Length 387
Sequence MGALSHLRVLDLSRVLAGPWAGQILADLGAEVIKVERPGRGDDTRAWGPPFLADQAGNSTGEAAYYLAANRNKRSVTIDFTRPEGQQLVRELAANSDILIENFKVGGLAAYGLDYASLSAVNPQLIYCSITGFGQTGPYATRPGYDFMVQGMGGLMSLTGKADGDPGAGPAKVGVALTDILTGLYSTVAILAALQVACLANQAMNYLTTGVAPGRLGNAHPNIVPYQDFPTADGDFILTVGNDSQFAKFAQVAGHPEWATDTRFASNQQRVANRTQLIPLIRQATVFKTTQQWVTELEVAGVPCGPINDLAQVFADPQVLARGLAIQLKHPLAGTLPMVASPLRLSASPVEYRHAPPLLGEHTQEVLQQLLNMDAQTYDQLHAAGVV

Samples

Sample ID Description Type Environment
1 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
3 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
6 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
7 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
8 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
9 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
10 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
11 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
12 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
13 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
14 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
15 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
16 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
17 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
18 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
19 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
20 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
21 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
22 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
23 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
24 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
25 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
26 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
27 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
28 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
29 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
30 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
31 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
32 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
33 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
34 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
35 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
36 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
37 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
38 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
39 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
40 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
41 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
42 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
43 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
44 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
45 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
46 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
47 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
48 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
49 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
50 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
51 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
52 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
53 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
54 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
55 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
56 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
57 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
58 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
59 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
60 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
61 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
62 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
63 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
64 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
65 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
66 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
67 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
68 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
69 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
70 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
71 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
72 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
73 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
74 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
75 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
76 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
77 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
78 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
79 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
80 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
81 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
82 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
84 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
85 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
86 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
87 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
88 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
89 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
90 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
91 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
93 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
94 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
95 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
96 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
97 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
98 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
99 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
100 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
101 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
102 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
103 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
104 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
105 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
106 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
107 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
108 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
109 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
110 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
111 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
112 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
113 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
114 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
115 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
116 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
117 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
118 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
119 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
120 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
121 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
122 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
123 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
124 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
125 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
126 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
127 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
128 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
129 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
130 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
131 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
132 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
133 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
134 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
135 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
136 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
137 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
138 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
139 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
140 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
141 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
142 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
143 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
144 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
145 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
146 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
147 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
148 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
149 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
186 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
187 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
188 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
189 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
190 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
191 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
192 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
193 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
194 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
195 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
196 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
197 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
198 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
199 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
200 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
201 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
204 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
205 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
206 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
207 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
208 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
209 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
210 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
211 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
212 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
213 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
214 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
215 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
216 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
217 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
218 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
219 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
220 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
221 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
222 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
223 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
224 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
225 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
226 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
227 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
228 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
229 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
230 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
231 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
232 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
233 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
234 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
235 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
236 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
237 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
238 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
239 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
240 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
241 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
242 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
243 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
244 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
245 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
246 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
247 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
248 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
249 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
250 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
251 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
252 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
253 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
254 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
255 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
256 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
257 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
258 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
259 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
260 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
261 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
262 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
263 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
264 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
265 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
266 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
267 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
268 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
269 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
270 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
271 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
272 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
273 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
274 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
275 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
276 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
277 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
278 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
279 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
280 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
281 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
282 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
283 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
284 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
285 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
286 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
287 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
288 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
289 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
290 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
291 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
292 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
293 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
294 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
295 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
296 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
297 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
298 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
299 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
300 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
301 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
302 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
303 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
304 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
305 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
306 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
307 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
308 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
309 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
310 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
311 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
312 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
313 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
314 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
315 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
316 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
317 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
318 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
319 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
320 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
321 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
322 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
323 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
324 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
325 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
326 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
327 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
328 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
329 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
330 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
331 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
332 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
333 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
334 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
335 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
336 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
337 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
338 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
339 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
340 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
341 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
342 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
343 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
344 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
345 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
346 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
347 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
348 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
349 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
350 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
351 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
352 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
353 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
354 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
355 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
356 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
357 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
358 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
359 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
360 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
361 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
362 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
363 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
364 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
365 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
366 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
367 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
368 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
369 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
370 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
371 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
372 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
373 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
374 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
375 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
376 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
377 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
378 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
379 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
380 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
381 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
382 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
383 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
384 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
385 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
386 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
387 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
388 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
389 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
390 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
391 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
392 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
393 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
394 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
395 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
396 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
397 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
398 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
399 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
400 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
401 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
402 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
403 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
404 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
405 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
406 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
407 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
408 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
409 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
410 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
411 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
412 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
413 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
414 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
415 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
416 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
417 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
418 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
419 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
420 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
421 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
422 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
423 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
424 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
425 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
426 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
427 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
428 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
429 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
430 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
431 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
432 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
433 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
434 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
435 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
436 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
437 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
438 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
439 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
440 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
441 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
442 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
443 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
444 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
445 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
446 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
447 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
448 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
449 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
450 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
451 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
452 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
453 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
454 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
455 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
456 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
457 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
458 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
459 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
460 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
461 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
462 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
463 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
464 2511231004 Pseudomonas sp. GM102 Isolate Nodule
465 2511231006 Pseudomonas sp. GM17 Isolate Nodule
466 2511231007 Pseudomonas sp. GM18 Isolate Nodule
467 2511231008 Pseudomonas sp. GM21 Isolate Nodule
468 2511231010 Pseudomonas sp. GM25 Isolate Nodule
469 2511231011 Pseudomonas sp. GM30 Isolate Nodule
470 2511231012 Pseudomonas sp. GM33 Isolate Nodule
471 2511231014 Pseudomonas sp. GM48 Isolate Nodule
472 2511231015 Pseudomonas sp. GM49 Isolate Nodule
473 2511231016 Pseudomonas sp. GM50 Isolate Nodule
474 2511231017 Pseudomonas sp. GM55 Isolate Nodule
475 2511231018 Pseudomonas sp. GM60 Isolate Nodule
476 2511231019 Pseudomonas sp. GM67 Isolate Nodule
477 2511231020 Pseudomonas sp. GM74 Isolate Nodule
478 2511231021 Pseudomonas sp. GM78 Isolate Nodule
479 2511231022 Pseudomonas sp. GM79 Isolate Nodule
480 2511231023 Pseudomonas sp. GM80 Isolate Nodule
481 2511231024 Pseudomonas sp. GM84 Isolate Nodule
482 2511231031 Pseudomonas sp. GM16 Isolate Nodule
483 2511231156 Pseudomonas ogarae F113 Isolate Rhizosphere
484 2511231221 Azospirillum lipoferum 4B Isolate Rhizosphere
485 2512047018 Pseudomonas chlororaphis chlororaphis GP72 Isolate Rhizosphere
486 2515154123 Trinickia symbiotica JPY347 Isolate Nodule
487 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
488 2522572158 Azospirillum halopraeferens DSM 3675 Isolate Unclassified
489 2554235132 Pseudomonas aeruginosa PGPR2 Isolate Unclassified
490 2554235231 Pseudomonas putida MTCC 5279 Isolate Unclassified
491 2554235341 Pseudomonas protegens CHA0 Isolate Rhizosphere
492 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
493 2574179768 Azoarcus communis DSM 12120 Isolate Unclassified
494 2582580736 Prauserella sp. Am3 Isolate Unclassified
495 2582580891 Pseudomonas chlororaphis YL-1 Isolate Unclassified
496 2597489887 Pseudomonas chlororaphis aureofaciens 30-84 Isolate Rhizosphere
497 2597489888 Pseudomonas fluorescens SS101 Isolate Rhizosphere
498 2597489889 Pseudomonas synxantha BG33R Isolate Rhizosphere
499 2597490356 Azospirillum brasilense sp7 Isolate Unclassified
500 2599185155 Pseudomonas sp. NFACC10-1 Isolate Rhizoplane
501 2599185160 Pseudomonas sp. NFPP25 Isolate Rhizoplane
502 2599185161 Pseudomonas sp. NFPP09 Isolate Rhizoplane
503 2599185162 Pseudomonas sp. NFPP10 Isolate Rhizoplane
504 2599185163 Pseudomonas sp. NFPP12 Isolate Rhizoplane
505 2599185164 Pseudomonas sp. NFPP13 Isolate Rhizoplane
506 2599185165 Pseudomonas sp. NFPP18 Isolate Rhizoplane
507 2599185166 Pseudomonas sp. NFPP08 Isolate Rhizoplane
508 2599185167 Pseudomonas sp. NFPP28 Isolate Rhizoplane
509 2599185168 Pseudomonas sp. NFPP05 Isolate Rhizoplane
510 2599185179 Pseudomonas sp. NFR09 Isolate Rhizoplane
511 2599185181 Pseudomonas sp. NFPP17 Isolate Rhizoplane
512 2599185182 Pseudomonas sp. NFPP19 Isolate Rhizoplane
513 2599185185 Pseudomonas sp. NFPP07 Isolate Rhizoplane
514 2599185186 Pseudomonas sp. NFPP15 Isolate Rhizoplane
515 2599185188 Pseudomonas sp. NFACC45 Isolate Rhizoplane
516 2599185189 Pseudomonas sp. NFPP02 Isolate Rhizoplane
517 2599185190 Pseudomonas sp. NFPP04 Isolate Rhizoplane
518 2599185191 Pseudomonas sp. NFPP24 Isolate Rhizoplane
519 2599185212 Pseudomonas sp. NFACC15-1 Isolate Rhizoplane
520 2599185248 Pseudomonas sp. NFACC08-1 Isolate Rhizoplane
521 2599185257 Pseudomonas sp. NFACC41-3 Isolate Rhizoplane
522 2599185288 Pseudomonas sp. NFACC25 Isolate Rhizoplane
523 2599185289 Pseudomonas sp. NFACC51 Isolate Rhizoplane
524 2599185290 Pseudomonas sp. NFPP11 Isolate Rhizoplane
525 2599185291 Pseudomonas sp. NFACC48-1 Isolate Rhizoplane
526 2599185302 Pseudomonas sp. NFACC43 Isolate Rhizoplane
527 2599185303 Pseudomonas sp. NFACC42-2 Isolate Rhizoplane
528 2599185304 Pseudomonas sp. NFACC47-1 Isolate Rhizoplane
529 2599185305 Pseudomonas sp. NFACC07-1 Isolate Rhizoplane
530 2599185306 Pseudomonas sp. NFACC16-2 Isolate Rhizoplane
531 2599185307 Pseudomonas sp. NFACC02 Isolate Rhizoplane
532 2599185308 Pseudomonas sp. NFACC17-2 Isolate Rhizoplane
533 2599185309 Pseudomonas sp. NFACC49-2 Isolate Rhizoplane
534 2599185310 Pseudomonas sp. NFACC09-4 Isolate Rhizoplane
535 2599185311 Pseudomonas sp. NFACC04-2 Isolate Rhizoplane
536 2599185312 Pseudomonas sp. NFACC32-1 Isolate Rhizoplane
537 2599185313 Pseudomonas sp. NFACC05-1 Isolate Rhizoplane
538 2599185314 Pseudomonas sp. NFACC23-1 Isolate Rhizoplane
539 2599185315 Pseudomonas sp. NFACC44-2 Isolate Rhizoplane
540 2599185316 Pseudomonas sp. NFACC52 Isolate Rhizoplane
541 2599185317 Pseudomonas sp. NFACC06-1 Isolate Rhizoplane
542 2599185318 Pseudomonas sp. NFACC13-1 Isolate Rhizoplane
543 2599185319 Pseudomonas sp. NFACC24-1 Isolate Rhizoplane
544 2599185320 Pseudomonas sp. NFACC36 Isolate Rhizoplane
545 2599185321 Pseudomonas sp. NFACC54 Isolate Rhizoplane
546 2599185322 Pseudomonas sp. NFACC14 Isolate Rhizoplane
547 2599185323 Pseudomonas sp. NFACC37-1 Isolate Rhizoplane
548 2599185324 Pseudomonas sp. NFACC46-3 Isolate Rhizoplane
549 2599185325 Pseudomonas sp. NFACC56-3 Isolate Rhizoplane
550 2599185356 Pseudomonas sp. NFPP14 Isolate Rhizoplane
551 2600254930 Pseudomonas sp. NFIX10 Isolate Rhizoplane
552 2600254931 Pseudomonas sp. NFIX28 Isolate Rhizoplane
553 2600254954 Pseudomonas sp. NFACC19-2 Isolate Rhizoplane
554 2600255283 Pseudomonas sp. NFR16 Isolate Rhizoplane
555 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
556 2600255296 Pseudomonas sp. NFR02 Isolate Rhizoplane
557 2600255313 Pseudomonas sp. NFPP16 Isolate Rhizoplane
558 2600255318 Pseudomonas putida NFIX47 Isolate Rhizoplane
559 2600255389 Pseudomonas sp. NFPP33 Isolate Rhizoplane
560 2603880185 Pseudomonas sp. NFIX46 Isolate Rhizoplane
561 2603880199 Pseudomonas sp. NFIX49 Isolate Rhizoplane
562 2606217733 Pseudomonas aeruginosa NFHH01 Isolate Rhizoplane
563 2619619299 Pseudomonas veronii R4 Genome sequencing Isolate Unclassified
564 2623620443 Pseudomonas sp. DR 5-09 Isolate Unclassified
565 2623620446 Pseudomonas sp. GR 6-02 Isolate Unclassified
566 2643221565 Pseudomonas sp. Root562 Isolate Unclassified
567 2643221571 Pseudomonas sp. Root569 Isolate Unclassified
568 2643221589 Pseudomonas sp. Root68 Isolate Unclassified
569 2643221602 Pseudomonas sp. Root71 Isolate Unclassified
570 2643221633 Pseudomonas sp. Root329 Isolate Unclassified
571 2643221650 Pseudomonas sp. Root401 Isolate Unclassified
572 2643221713 Pseudomonas sp. Root9 Isolate Unclassified
573 2651869719 Genome Sequence of Pseudomonas fluorescens UM270 Isolate Rhizosphere
574 2667528170 Pseudomonas sp. NFACC50-1 Isolate Rhizoplane
575 2667528171 Pseudomonas sp. NFPP22 Isolate Rhizoplane
576 2667528176 Pseudomonas sp. NFACC11-2 Isolate Rhizoplane
577 2671180172 Pseudomonas sp. NFIX51 Isolate Rhizoplane
578 2675903420 Pseudomonas fluorescens Ps006 Isolate Unclassified
579 2675903515 Pseudomonas thivervalensis DSM 13194 Isolate Unclassified
580 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
581 2713897148 Pseudomonas fluorescens SF39a Isolate Rhizosphere
582 2713897149 Pseudomonas fluorescens SF4c Isolate Rhizosphere
583 2721755607 Pseudomonas fluorescens Pt14 Isolate Rhizosphere
584 2738541265 Pseudomonas sp. GV077 Isolate Unclassified
585 2738541271 Pseudomonas sp. GV021 Isolate Unclassified
586 2738541282 Pseudomonas sp. GV058 Isolate Unclassified
587 2738541294 Pseudomonas sp. GV087 Isolate Unclassified
588 2738541303 Pseudomonas sp. GV105 Isolate Unclassified
589 2738541309 Pseudomonas sp. GV047 Isolate Unclassified
590 2738543004 Pseudomonas sp. GV085 Isolate Unclassified
591 2738543015 Pseudomonas sp. GV041 Isolate Unclassified
592 2738543016 Pseudomonas sp. GV012 Isolate Unclassified
593 2738543025 Pseudomonas sp. GV091 Isolate Unclassified
594 2740892503 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
595 2744054620 Pseudomonas thivervalensis LMG 21626 Isolate Unclassified
596 2765235841 Pseudomonas putida AA7 Isolate Unclassified
597 2773857670 Pseudomonas sp. 478 Isolate Unclassified
598 2773857673 Pseudomonas sp. 443 Isolate Unclassified
599 2784132063 Pseudomonas sp. 424 Isolate Unclassified
600 2784132072 Pseudomonas sp. 460 Isolate Unclassified
601 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
602 2791355520 Pseudomonas sp. s211(2017) Isolate Unclassified
603 2806310737 Pseudomonas mosselii BS011 Isolate Unclassified
604 2806310745 Pseudomonas mosselii PtA1 Isolate Unclassified
605 2808606361 Pseudomonas sp. SJZ075 Isolate Rhizosphere
606 2808606373 Pseudomonas sp. SLBN-2 Isolate Unclassified
607 2808606376 Pseudomonas sp. SJZ074 Isolate Rhizosphere
608 2808606377 Pseudomonas sp. SJZ083 Isolate Rhizosphere
609 2808606378 Pseudomonas sp. SJZ078 Isolate Rhizosphere
610 2808606379 Pseudomonas sp. SJZ079 Isolate Rhizosphere
611 2808606380 Pseudomonas sp. SJZ085 Isolate Rhizosphere
612 2808606381 Pseudomonas sp. SJZ077 Isolate Rhizosphere
613 2808606382 Pseudomonas sp. SJZ080 Isolate Rhizosphere
614 2808606383 Pseudomonas sp. SJZ124 Isolate Rhizosphere
615 2808606385 Pseudomonas sp. SJZ103 Isolate Rhizosphere
616 2808606388 Pseudomonas sp. SJZ094 Isolate Rhizosphere
617 2808606389 Pseudomonas sp. SJZ101 Isolate Rhizosphere
618 2808606445 Pseudomonas sp. SJZ131 Isolate Rhizosphere
619 2811994881 Pseudomonas sp. SLBN-26 Isolate Unclassified
620 2816332298 Pseudomonas veronii R02 Isolate Rhizosphere
621 2818991450 Burkholderia sp. 604 Isolate Unclassified
622 2818991456 Pseudomonas koreensis 3286 Isolate Rhizosphere
623 2818991464 Pseudomonas protegens 3295 Isolate Rhizosphere
624 2823421272 Pseudomonas mendocina S5.2 Isolate Rhizoplane
625 2825651385 Pseudomonas brassicacearum L13-6-12 Isolate Rhizosphere
626 2826581358 Pseudomonas viridiflava CDRTc14 Isolate Unclassified
627 2834028612 Pseudomonas fluorescens 513 Isolate Unclassified
628 2842711865 Duganella sp. R-73148 Isolate Unclassified
629 2842815866 Pseudomonas sp. R-72210 Isolate Unclassified
630 2842826826 Pseudomonas sp. R-72172 Isolate Unclassified
631 2842832357 Pseudomonas sp. R-72164 Isolate Unclassified
632 2842837860 Pseudomonas sp. R-72102 Isolate Unclassified
633 2842843487 Pseudomonas sp. R-72074 Isolate Unclassified
634 2842849001 Pseudomonas sp. R-72008 Isolate Unclassified
635 2842854478 Pseudomonas sp. R-71998 Isolate Unclassified
636 2844665904 Pseudomonas protegens H1F10C Isolate Unclassified
637 2846952575 Azospirillum brasilense sp7 Isolate Unclassified
638 2852612431 Pseudomonas sp. SJZ073 Isolate Rhizosphere
639 2852657418 Pseudomonas sp. JAI115 Isolate Rhizosphere
640 2852667396 Pseudomonas sp. JAI120 Isolate Rhizosphere
641 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
642 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
643 2860867994 Pseudomonas sp. R1-43-08 Isolate Rhizosphere
644 2873314349 Sphaerisporangium siamense DSM 45784 Isolate Rhizosphere
645 2878029506 Pseudomonas fluorescens DR397 Isolate Rhizosphere
646 2880230671 Pseudomonas fluorescens LBUM677 Isolate Unclassified
647 2885080285 Janthinobacterium sp. AD80 Isolate Rhizosphere
648 2885270888 Paraburkholderia sp. UYCPa14C Isolate Unclassified
649 2897803580 Azospirillum doebereinerae GSF71 Isolate Unclassified
650 2900634093 Paraburkholderia dipogonis ICMP 19430 Isolate Unclassified
651 2904518522 Pseudomonas fluorescens 4488 Isolate Rhizosphere
652 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
653 2904550169 Stutzerimonas stutzeri 1099 Isolate Rhizosphere
654 2904615490 Paraburkholderia franconis CNPSo 3157 Isolate Unclassified
655 2904699407
656 2908446538 Pseudomonas sp. R76 Isolate Rhizosphere
657 2912963787 Pseudomonas sp. R32 Isolate Rhizosphere
658 2913036834 Pseudomonas viciae 11K1 Isolate Rhizosphere
659 2917070673 Pseudomonas protegens CHA0 Isolate Rhizosphere
660 2919063839 Pseudomonas pharyngis 1098 Isolate Rhizosphere
661 2919155634 Pseudomonas fulva 1992 Isolate Unclassified
662 2919385768 Pseudomonas sp. 2957 Isolate Unclassified
663 2919456309 Pseudomonas sp. 3296 Isolate Rhizosphere
664 2919481497 Pseudomonas brassicacearum 3432 Isolate Unclassified
665 2919487758 Pseudomonas koreensis 3441 Isolate Unclassified
666 2919501602 Pseudomonas alcaliphila 3512 Isolate Unclassified
667 2919697872 Pseudomonas frederiksbergensis 4169 Isolate Unclassified
668 2923153595 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
669 2923519811 Pseudomonas otitidis SLBN-103 Isolate Rhizosphere
670 2923586266 Pseudomonas fluorescens 1550 Isolate Rhizosphere
671 2926063275 Pseudomonas sp. 3400 Isolate Unclassified
672 2928108538 Paraburkholderia terricola 1595 Isolate Rhizosphere
673 2928135762 Paraburkholderia terricola 1988 Isolate Unclassified
674 2928503688 Paraburkholderia terricola 1263 Isolate Rhizosphere
675 2929144301 Pseudomonas sp. R-71838 Hybrid assembly Isolate Unclassified
676 2929189879 Pseudomonas sp. R-71842 Hybrid assembly Isolate Unclassified
677 2931369376 Pseudomonas fluorescens DR133 Isolate Rhizosphere
678 2931390751 Pseudomonas sp. DR208 Isolate Rhizosphere
679 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
680 2932410948 Janthinobacterium lividum 2829 Isolate Rhizosphere
681 2932416698 Janthinobacterium lividum 2830 Isolate Rhizosphere
682 2932422444 Comamonas sp. 4034 Isolate Rhizosphere
683 2935353572 Pseudomonas protegens TECH19 Isolate Unclassified
684 2939636861 Pseudomonas sp. 2725 Isolate Rhizosphere
685 2939651529 Pseudomonas sp. 2835 Isolate Rhizosphere
686 2945928738 Pseudomonas cedrina W1I11 Isolate Rhizosphere
687 2945961074 Pseudomonas sp. W2I6 Isolate Rhizosphere
688 2946006987 Pseudomonas sp. W3I7 Isolate Rhizosphere
689 2947233263 Pseudomonas synxantha W2I4 Isolate Rhizosphere
690 2969304461 Pseudomonas sp. R84 Isolate Rhizosphere
691 2974289157 Pseudomonas fluorescens SORGH_AS 191 Isolate Unclassified
692 2984286254 Pseudomonas chlororaphis aurantiaca JD37 Isolate Rhizosphere
693 2987605356 Stenotrophomonas sp. ATCM1_4 Isolate Unclassified
694 2988728565 Pseudomonas corrugata RM1-1-4 Isolate Rhizosphere
695 2998139840 Pseudomonas iranensis SWRI54 Isolate Rhizosphere
696 3007252601 Pseudomonas punonensis D1-6 Isolate Unclassified
697 3007315729 Pseudomonas argentinensis SA190 Isolate Unclassified
698 3007395558 Pseudomonas chlororaphis PCL1601 Isolate Rhizosphere
699 3007419365 Pseudomonas vanderleydeniana RW8P3 Isolate Unclassified
700 3007511990 Pseudomonas fluorescens G20-18 Isolate Rhizosphere
701 3007614139 Pseudomonas sp. PB106 Isolate Unclassified
702 3007619802 Pseudomonas sp. PB120 Isolate Unclassified
703 3007718800 Pseudomonas fluorescens BW11P2 Isolate Rhizosphere
704 3007803356 Pseudomonas sp. CM27 Isolate Unclassified
705 3007855910 Pseudomonas khorasanensis SWRI153 Isolate Rhizosphere
706 3007861166 Pseudomonas hamedanensis SWRI65 Isolate Rhizosphere
707 3007866637 Pseudomonas marvdashtae SWRI102 Isolate Rhizosphere
708 3007872151 Pseudomonas sp. SWRI51 Isolate Rhizosphere
709 637000220 Pseudomonas protegens Pf-5 Isolate Rhizoplane
710 639633007 Azoarcus olearius BH72 Isolate Unclassified
711 8011350971 Pseudomonas sp. 30_B Isolate Rhizosphere
712 8015687852 Pseudomonas chlororaphis aurantiaca RP4 Isolate Rhizosphere
713 8019769354 Pseudomonas sp. MSSRFD41 Isolate Rhizosphere
714 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere
715 8021120328 Burkholderia sp. LS-044 Isolate Rhizosphere
716 8029995093 Pseudomonas atacamensis SM1 Isolate Rhizosphere
717 8034962539 Pseudomonas sediminis PI11 Isolate Rhizosphere
718 8052494512 Pseudomonas putida LD6 Isolate Unclassified
719 8054002106 Azospirillum lipoferum 59b Isolate Unclassified
720 8054285046 Pseudomonas petroselini MAFF 311096 Isolate Nodule
721 8054347763 Pseudomonas carnis NWU Be30 Isolate Unclassified
722 8054503363 Pseudomonas sivasensis BsEB-1 Isolate Unclassified
723 8054929484 Pseudomonas vlassakiae RW4S1 Isolate Rhizosphere
724 8055770955 Pseudomonas chlororaphis qlu-1 Isolate Rhizosphere
725 8055817908 Pseudomonas pergaminensis 1008 Isolate Rhizosphere
726 8055878733 Pseudomonas palmensis BBB001 Isolate Rhizosphere
727 8056115690 Pseudomonas muyukensis COW39 Isolate Rhizosphere
728 8056120720 Pseudomonas maumuensis COW77 Isolate Rhizosphere
729 8056125926 Pseudomonas azerbaijanorientalis SWRI123 Isolate Rhizosphere
730 8056131705 Pseudomonas asgharzadehiana SWRI132 Isolate Rhizosphere
731 8056137416 Pseudomonas fakonensis COW40 Isolate Rhizosphere
732 8056143049 Pseudomonas alvandae SWRI17 Isolate Rhizosphere
733 8056148874 Pseudomonas khavaziana SWRI124 Isolate Rhizosphere
734 8056155041 Pseudomonas farris SWRI79 Isolate Rhizosphere
735 8056161164 Pseudomonas azadiae SWRI103 Isolate Rhizosphere
736 8056166840 Pseudomonas triticicola SWRI88 Isolate Rhizosphere
737 8056172158 Pseudomonas ekonensis COR58 Isolate Rhizosphere
738 8056177738 Pseudomonas azerbaijanoccidentalis SWRI74 Isolate Rhizosphere
739 8056569372 Pseudomonas serboccidentalis IT-P374 Isolate Rhizosphere
740 8057798959 Pseudomonas piscis BW16M1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 84.26
Metatranscriptomes 0.11
Isolates 15.63

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.22
Nodule 1.9
Rhizoplane 4.98
Rhizosphere 72.79
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207713_1034368 3300025735 Bacteria 2203
2 MRS2a_Contig_849 2124908027 Bacteria 16146
3 SwRhRL2b_contig_2139936 2162886007 Bacteria 1812
4 SwRhRL2b_contig_3821960 2162886007 Bacteria 5250
5 JGI24735J21928_10002975 3300002067 Bacteria 5833
6 JGI25156J39149_1001576 3300002705 Bacteria 9397
7 JGI25162J39368_1003079 3300002737 Bacteria 5361
8 JGI25154J39366_1001005 3300002738 Bacteria 11359
9 JGI25154J39366_1003567 3300002738 Bacteria 3198
10 JGI25157J39369_1000161 3300002741 Bacteria 56020
11 JGI25163J39215_1001189 3300002771 Bacteria 4976
12 JGI25163J39215_1001375 3300002771 Bacteria 4109
13 JGI25164J39214_1001483 3300002772 Bacteria 5361
14 JGI25164J39214_1001780 3300002772 Bacteria 4191
15 JGI25165J46597_1002668 3300003214 Bacteria 5361
16 JGI25165J46597_1003187 3300003214 Bacteria 4319
17 rootH2_10034079 3300003320 Bacteria 2479
18 rootL2_10118786 3300003322 Bacteria 3140
19 JGI25160J50197_1000228 3300003354 Bacteria 44139
20 JGI25161J50226_1000171 3300003374 Bacteria 44139
21 Ga0055538_1000012 3300003751 Bacteria 353826
22 Ga0055539_1000017 3300003752 Bacteria 353873
23 Ga0055539_1000819 3300003752 Bacteria 7323
24 Ga0055533_1000016 3300003756 Bacteria 396179
25 Ga0055533_1000021 3300003756 Bacteria 353826
26 Ga0055533_1000918 3300003756 Bacteria 8817
27 Ga0055532_1000020 3300003758 Bacteria 270853
28 Ga0055532_1000122 3300003758 Bacteria 79139
29 Ga0055525_1000117 3300003759 Bacteria 120690
30 Ga0055525_1000579 3300003759 Bacteria 16084
31 Ga0055527_1000078 3300003760 Bacteria 79672
32 Ga0055527_1004495 3300003760 Bacteria 1911
33 Ga0055535_1000054 3300003761 Bacteria 131373
34 Ga0055535_1000165 3300003761 Bacteria 71549
35 Ga0055535_1006646 3300003761 Bacteria 2311
36 Ga0055542_1001566 3300003762 Bacteria 10714
37 Ga0055529_1000214 3300003763 Bacteria 76244
38 Ga0055529_1000405 3300003763 Bacteria 45555
39 Ga0055536_1009213 3300003781 Bacteria 4120
40 Ga0055536_1009265 3300003781 Bacteria 4100
41 Ga0055530_10004442 3300003791 Bacteria 7208
42 Ga0055530_10004741 3300003791 Bacteria 6854
43 Ga0055540_1000378 3300003792 Bacteria 37178
44 Ga0055540_1003947 3300003792 Bacteria 6930
45 Ga0055540_1004013 3300003792 Bacteria 6854
46 Ga0055540_1014204 3300003792 Bacteria 2387
47 Ga0055531_10001099 3300003794 Bacteria 21179
48 Ga0055541_1000012 3300003841 Bacteria 353826
49 Ga0055543_1000333 3300004625 Bacteria 32214
50 Ga0065714_10007826 3300005288 Bacteria 2724
51 Ga0065714_10008516 3300005288 Bacteria 2940
52 Ga0065714_10009353 3300005288 Bacteria 2331
53 Ga0065714_10067720 3300005288 Bacteria 5254
54 Ga0065714_10069841 3300005288 Bacteria 4066
55 Ga0065714_10069906 3300005288 Bacteria 4040
56 Ga0065714_10111222 3300005288 Bacteria 1471
57 Ga0065704_10008316 3300005289 Bacteria 5773
58 Ga0065704_10071136 3300005289 Bacteria 12914
59 Ga0065704_10078938 3300005289 Bacteria 4298
60 Ga0065704_10102271 3300005289 Bacteria 2211
61 Ga0065712_10000372 3300005290 Bacteria 12338
62 Ga0065712_10081765 3300005290 Bacteria 2976
63 Ga0065715_10030400 3300005293 Bacteria 2815
64 Ga0070658_10003769 3300005327 Bacteria 12411
65 Ga0070676_10006747 3300005328 Bacteria 6146
66 Ga0070690_100004971 3300005330 Bacteria 7441
67 Ga0070670_100037777 3300005331 Bacteria 4153
68 Ga0070670_100051980 3300005331 Bacteria 3519
69 Ga0070670_100095274 3300005331 Bacteria 2560
70 Ga0068869_100017263 3300005334 Bacteria 4888
71 Ga0068869_100161123 3300005334 Bacteria 1746
72 Ga0068868_100023640 3300005338 Bacteria 4653
73 Ga0070660_100003374 3300005339 Bacteria 10985
74 Ga0070661_100000237 3300005344 Bacteria 45515
75 Ga0070669_100000277 3300005353 Bacteria 41213
76 Ga0070669_100014309 3300005353 Bacteria 5646
77 Ga0070675_100044645 3300005354 Bacteria 3624
78 Ga0070673_100003982 3300005364 Bacteria 9297
79 Ga0070659_100012909 3300005366 Bacteria 6208
80 Ga0070667_100244631 3300005367 Bacteria 1603
81 Ga0070714_100183514 3300005435 Bacteria 1905
82 Ga0070711_100021816 3300005439 Bacteria 4145
83 Ga0070700_100040447 3300005441 Bacteria 2854
84 Ga0070678_100132658 3300005456 Bacteria 1982
85 Ga0070662_100019698 3300005457 Bacteria 4584
86 Ga0070662_100020496 3300005457 Bacteria 4502
87 Ga0070662_100095490 3300005457 Bacteria 2241
88 Ga0070662_100133207 3300005457 Bacteria 1919
89 Ga0068867_100005827 3300005459 Bacteria 8738
90 Ga0068853_100000143 3300005539 Bacteria 48815
91 Ga0068853_100071924 3300005539 Bacteria 3013
92 Ga0070695_100106262 3300005545 Bacteria 1898
93 Ga0070696_100000044 3300005546 Bacteria 57075
94 Ga0070665_100001196 3300005548 Bacteria 31625
95 Ga0070665_100032296 3300005548 Bacteria 5270
96 Ga0070665_100293050 3300005548 Bacteria 1629
97 Ga0070665_100317496 3300005548 Bacteria 1562
98 Ga0068855_100001954 3300005563 Bacteria 25584
99 Ga0068855_100019854 3300005563 Bacteria 8072
100 Ga0068855_100045492 3300005563 Bacteria 5192
101 Ga0068855_100062589 3300005563 Bacteria 4343
102 Ga0068855_100121264 3300005563 Bacteria 2992
103 Ga0070664_100003174 3300005564 Bacteria 13279
104 Ga0070664_100025219 3300005564 Bacteria 4926
105 Ga0068857_100012908 3300005577 Bacteria 7279
106 Ga0068857_100125587 3300005577 Bacteria 2312
107 Ga0068854_100008045 3300005578 Bacteria 6757
108 Ga0068854_100069237 3300005578 Bacteria 2575
109 Ga0068856_100001351 3300005614 Bacteria 25782
110 Ga0068859_100294244 3300005617 Bacteria 1717
111 Ga0068861_100053912 3300005719 Bacteria 3062
112 Ga0068851_10000018 3300005834 Bacteria 137425
113 Ga0068851_10002048 3300005834 Bacteria 8891
114 Ga0068860_100155352 3300005843 Bacteria 2204
115 Ga0068862_100127773 3300005844 Bacteria 2246
116 Ga0075365_10005012 3300006038 Bacteria 7095
117 Ga0075363_100006720 3300006048 Bacteria 5248
118 Ga0075364_10030448 3300006051 Bacteria 3463
119 Ga0075364_10181827 3300006051 Bacteria 1423
120 Ga0075364_10183231 3300006051 Bacteria 1417
121 Ga0075432_10005891 3300006058 Bacteria 4170
122 Ga0075432_10010937 3300006058 Bacteria 3082
123 Ga0075362_10035226 3300006177 Bacteria 2184
124 Ga0075367_10073570 3300006178 Bacteria 2059
125 Ga0075369_10001718 3300006186 Bacteria 7579
126 Ga0075369_10034587 3300006186 Bacteria 2145
127 Ga0075366_10001098 3300006195 Bacteria 13285
128 Ga0075366_10069057 3300006195 Bacteria 2103
129 Ga0075370_10000523 3300006353 Bacteria 14643
130 Ga0075430_100010146 3300006846 Bacteria 7973
131 Ga0075430_100011601 3300006846 Bacteria 7494
132 Ga0075430_100046312 3300006846 Bacteria 3673
133 Ga0075431_100000786 3300006847 Bacteria 27678
134 Ga0075431_100011765 3300006847 Bacteria 8829
135 Ga0075429_100001077 3300006880 Bacteria 21893
136 Ga0075429_100050654 3300006880 Bacteria 3613
137 Ga0068865_100008692 3300006881 Bacteria 6281
138 Ga0075436_100155945 3300006914 Bacteria 1608
139 Ga0097620_100294240 3300006931 Bacteria 1717
140 Ga0099823_1016467 3300006944 Bacteria 7259
141 Ga0099823_1032132 3300006944 Bacteria 4292
142 Ga0079104_1005125 3300006946 Bacteria 5331
143 Ga0079104_1006328 3300006946 Bacteria 4510
144 Ga0079104_1024727 3300006946 Bacteria 1577
145 Ga0099826_10003322 3300006948 Bacteria 10862
146 Ga0105251_10000033 3300009011 Bacteria 118905
147 Ga0105251_10000068 3300009011 Bacteria 98955
148 Ga0105251_10000164 3300009011 Bacteria 68693
149 Ga0105251_10002783 3300009011 Bacteria 13293
150 Ga0105251_10010844 3300009011 Bacteria 5249
151 Ga0105251_10013372 3300009011 Bacteria 4595
152 Ga0105251_10015218 3300009011 Bacteria 4215
153 Ga0105251_10015354 3300009011 Bacteria 4191
154 Ga0105251_10019273 3300009011 Bacteria 3608
155 Ga0105251_10029258 3300009011 Bacteria 2775
156 Ga0105251_10033590 3300009011 Bacteria 2545
157 Ga0105251_10061639 3300009011 Bacteria 1763
158 Ga0105251_10062003 3300009011 Bacteria 1757
159 Ga0105251_10076005 3300009011 Bacteria 1559
160 Ga0105251_10083480 3300009011 Bacteria 1475
161 Ga0105251_10101894 3300009011 Bacteria 1312
162 Ga0105244_10000073 3300009036 Bacteria 115279
163 Ga0105244_10010173 3300009036 Bacteria 5716
164 Ga0105244_10016315 3300009036 Bacteria 4234
165 Ga0105244_10017085 3300009036 Bacteria 4111
166 Ga0105244_10022905 3300009036 Bacteria 3434
167 Ga0105244_10032272 3300009036 Bacteria 2773
168 Ga0105244_10034872 3300009036 Bacteria 2646
169 Ga0105244_10035196 3300009036 Bacteria 2632
170 Ga0105244_10036394 3300009036 Bacteria 2579
171 Ga0105244_10042193 3300009036 Bacteria 2360
172 Ga0105244_10044602 3300009036 Bacteria 2283
173 Ga0105244_10057304 3300009036 Bacteria 1969
174 Ga0105244_10057882 3300009036 Bacteria 1958
175 Ga0105244_10083420 3300009036 Bacteria 1579
176 Ga0105244_10094451 3300009036 Bacteria 1468
177 Ga0105250_10003622 3300009092 Bacteria 7276
178 Ga0105250_10009006 3300009092 Bacteria 4218
179 Ga0105250_10009193 3300009092 Bacteria 4169
180 Ga0105250_10009210 3300009092 Bacteria 4163
181 Ga0105250_10019332 3300009092 Bacteria 2754
182 Ga0105250_10025608 3300009092 Bacteria 2376
183 Ga0105250_10029822 3300009092 Bacteria 2194
184 Ga0105250_10033368 3300009092 Bacteria 2067
185 Ga0105250_10041947 3300009092 Bacteria 1834
186 Ga0105250_10057606 3300009092 Bacteria 1559
187 Ga0105250_10068378 3300009092 Bacteria 1434
188 Ga0105240_10001785 3300009093 Bacteria 36285
189 Ga0105240_10018880 3300009093 Bacteria 9231
190 Ga0105240_10047594 3300009093 Bacteria 5425
191 Ga0105240_10268203 3300009093 Bacteria 1967
192 Ga0105245_10060018 3300009098 Bacteria 3425
193 Ga0114129_10009668 3300009147 Bacteria 13760
194 Ga0114129_10015093 3300009147 Bacteria 10994
195 Ga0105243_10000867 3300009148 Bacteria 28621
196 Ga0105243_10017764 3300009148 Bacteria 5382
197 Ga0105243_10017969 3300009148 Bacteria 5350
198 Ga0105243_10079103 3300009148 Bacteria 2679
199 Ga0105243_10145135 3300009148 Bacteria 2030
200 Ga0105243_10163865 3300009148 Bacteria 1919
201 Ga0105241_10022047 3300009174 Bacteria 4715
202 Ga0105241_10029074 3300009174 Bacteria 4121
203 Ga0105242_10019610 3300009176 Bacteria 5300
204 Ga0105248_10030717 3300009177 Bacteria 6000
205 Ga0105248_10295441 3300009177 Bacteria 1824
206 Ga0105248_10314119 3300009177 Bacteria 1765
207 Ga0105237_10005268 3300009545 Bacteria 14629
208 Ga0105237_10006601 3300009545 Bacteria 12827
209 Ga0105237_10020051 3300009545 Bacteria 6902
210 Ga0105237_10253832 3300009545 Bacteria 1761
211 Ga0105237_10260531 3300009545 Bacteria 1737
212 Ga0105238_10016263 3300009551 Bacteria 7530
213 Ga0105238_10050976 3300009551 Bacteria 4165
214 Ga0105238_10060257 3300009551 Bacteria 3800
215 Ga0105249_10034205 3300009553 Bacteria 4603
216 Ga0105249_10174753 3300009553 Bacteria 2085
217 Ga0105239_10001427 3300010375 Bacteria 31882
218 Ga0105239_10013882 3300010375 Bacteria 8940
219 Ga0105239_10015905 3300010375 Bacteria 8330
220 Ga0105239_10183976 3300010375 Bacteria 2338
221 Ga0105239_10548316 3300010375 Bacteria 1317
222 Ga0105246_10011951 3300011119 Bacteria 5404
223 Ga0105246_10036895 3300011119 Bacteria 3277
224 Ga0105246_10075544 3300011119 Bacteria 2385
225 Ga0157345_1000442 3300012498 Bacteria 4078
226 Ga0157373_10006536 3300013100 Bacteria 8697
227 Ga0157373_10027291 3300013100 Bacteria 4119
228 Ga0157373_10027729 3300013100 Bacteria 4086
229 Ga0157373_10027748 3300013100 Bacteria 4085
230 Ga0157373_10028485 3300013100 Bacteria 4030
231 Ga0157373_10029522 3300013100 Bacteria 3949
232 Ga0157373_10082661 3300013100 Bacteria 2264
233 Ga0157373_10138581 3300013100 Bacteria 1711
234 Ga0157373_10150738 3300013100 Bacteria 1636
235 Ga0157371_10000953 3300013102 Bacteria 32196
236 Ga0157371_10024662 3300013102 Bacteria 4389
237 Ga0157371_10025980 3300013102 Bacteria 4261
238 Ga0157371_10190682 3300013102 Bacteria 1468
239 Ga0157370_10002438 3300013104 Bacteria 22425
240 Ga0157370_10018816 3300013104 Bacteria 6945
241 Ga0157370_10071433 3300013104 Bacteria 3274
242 Ga0157370_10104735 3300013104 Bacteria 2648
243 Ga0157370_10163363 3300013104 Bacteria 2072
244 Ga0157370_10282960 3300013104 Bacteria 1532
245 Ga0157370_10296213 3300013104 Bacteria 1494
246 Ga0157369_10000059 3300013105 Bacteria 154283
247 Ga0157369_10007539 3300013105 Bacteria 12521
248 Ga0157369_10022299 3300013105 Bacteria 7069
249 Ga0157369_10052885 3300013105 Bacteria 4392
250 Ga0157369_10056658 3300013105 Bacteria 4229
251 Ga0157369_10059826 3300013105 Bacteria 4109
252 Ga0157369_10060450 3300013105 Bacteria 4086
253 Ga0157369_10061449 3300013105 Bacteria 4050
254 Ga0157369_10114782 3300013105 Bacteria 2860
255 Ga0157369_10140660 3300013105 Bacteria 2554
256 Ga0157369_10318947 3300013105 Bacteria 1616
257 Ga0157374_10000169 3300013296 Bacteria 60624
258 Ga0157378_10281119 3300013297 Bacteria 1604
259 Ga0163162_10088689 3300013306 Bacteria 3172
260 Ga0163162_10334811 3300013306 Bacteria 1646
261 Ga0157372_10013821 3300013307 Bacteria 8623
262 Ga0157372_10053489 3300013307 Bacteria 4501
263 Ga0157372_10054813 3300013307 Bacteria 4450
264 Ga0157372_10068726 3300013307 Bacteria 3983
265 Ga0157375_10047043 3300013308 Bacteria 4210
266 Ga0157375_10060495 3300013308 Bacteria 3756
267 Ga0157375_10077195 3300013308 Bacteria 3360
268 Ga0157375_10104585 3300013308 Bacteria 2920
269 Ga0157375_10230022 3300013308 Bacteria 2013
270 Ga0163163_10048170 3300014325 Bacteria 4190
271 Ga0182008_10001812 3300014497 Bacteria 13947
272 Ga0182008_10009427 3300014497 Bacteria 5266
273 Ga0182008_10014600 3300014497 Bacteria 4108
274 Ga0182008_10014636 3300014497 Bacteria 4103
275 Ga0182008_10014724 3300014497 Bacteria 4090
276 Ga0182008_10015562 3300014497 Bacteria 3966
277 Ga0182008_10029608 3300014497 Bacteria 2766
278 Ga0182008_10033783 3300014497 Bacteria 2566
279 Ga0182008_10034115 3300014497 Bacteria 2552
280 Ga0182008_10050749 3300014497 Bacteria 2059
281 Ga0182008_10055221 3300014497 Bacteria 1964
282 Ga0182008_10074458 3300014497 Bacteria 1671
283 Ga0157379_10149377 3300014968 Bacteria 2108
284 Ga0182006_1000010 3300015261 Bacteria 413414
285 Ga0182006_1010330 3300015261 Bacteria 4153
286 Ga0182006_1013537 3300015261 Bacteria 3538
287 Ga0182006_1016834 3300015261 Bacteria 3115
288 Ga0182006_1017640 3300015261 Bacteria 3029
289 Ga0182006_1029532 3300015261 Bacteria 2220
290 Ga0182006_1055698 3300015261 Bacteria 1509
291 Ga0182007_10000021 3300015262 Bacteria 193408
292 Ga0182007_10008472 3300015262 Bacteria 4222
293 Ga0182007_10008663 3300015262 Bacteria 4162
294 Ga0182007_10008990 3300015262 Bacteria 4067
295 Ga0182005_1000009 3300015265 Bacteria 455334
296 Ga0182005_1003466 3300015265 Bacteria 5337
297 Ga0182005_1022613 3300015265 Bacteria 1722
298 Ga0182005_1028172 3300015265 Bacteria 1532
299 Ga0163161_10016144 3300017792 Bacteria 5213
300 Ga0163161_10026393 3300017792 Bacteria 4115
301 Ga0163161_10026913 3300017792 Bacteria 4077
302 Ga0163161_10027232 3300017792 Bacteria 4055
303 Ga0163161_10061279 3300017792 Bacteria 2738
304 Ga0163161_10078481 3300017792 Bacteria 2427
305 Ga0163161_10100084 3300017792 Bacteria 2156
306 Ga0163161_10129265 3300017792 Bacteria 1904
307 Ga0163161_10201641 3300017792 Bacteria 1533
308 Ga0163161_10211938 3300017792 Bacteria 1497
309 Ga0206354_11526548 3300020081 Bacteria 1770
310 Ga0206353_11725857 3300020082 Bacteria 1379
311 Ga0213872_10001350 3300021361 Bacteria 16187
312 Ga0213875_10008155 3300021388 Bacteria 5378
313 Ga0209435_100441 3300025206 Bacteria 8419
314 Ga0209760_100230 3300025207 Bacteria 23968
315 Ga0209760_100611 3300025207 Bacteria 6100
316 Ga0209784_100007 3300025224 Bacteria 747715
317 Ga0209566_100009 3300025225 Bacteria 554018
318 Ga0209674_100021 3300025226 Bacteria 629811
319 Ga0209674_100041 3300025226 Bacteria 396231
320 Ga0209674_100130 3300025226 Bacteria 119638
321 Ga0209672_100036 3300025228 Bacteria 287801
322 Ga0209672_100221 3300025228 Bacteria 44075
323 Ga0209147_100009 3300025229 Bacteria 747409
324 Ga0209147_100066 3300025229 Bacteria 232474
325 Ga0209563_100018 3300025230 Bacteria 747850
326 Ga0209563_100043 3300025230 Bacteria 397271
327 Ga0209563_101799 3300025230 Bacteria 5325
328 Ga0207427_100005 3300025231 Bacteria 797999
329 Ga0207427_100006 3300025231 Bacteria 785415
330 Ga0207427_100381 3300025231 Bacteria 26800
331 Ga0209437_100013 3300025233 Bacteria 785457
332 Ga0209437_100018 3300025233 Bacteria 694400
333 Ga0209437_107785 3300025233 Bacteria 1729
334 Ga0209258_100085 3300025242 Bacteria 244731
335 Ga0209258_100237 3300025242 Bacteria 102220
336 Ga0209258_100270 3300025242 Bacteria 89254
337 Ga0209258_100659 3300025242 Bacteria 24988
338 Ga0209646_1000157 3300025246 Bacteria 94054
339 Ga0209646_1000277 3300025246 Bacteria 45368
340 Ga0209026_1000006 3300025250 Bacteria 677225
341 Ga0209677_100012 3300025253 Bacteria 554018
342 Ga0209677_100711 3300025253 Bacteria 16959
343 Ga0209677_101037 3300025253 Bacteria 13235
344 Ga0209677_101090 3300025253 Bacteria 12773
345 Ga0209148_1000198 3300025254 Bacteria 109136
346 Ga0209759_1000194 3300025256 Bacteria 97047
347 Ga0209759_1000424 3300025256 Bacteria 51523
348 Ga0209759_1000691 3300025256 Bacteria 30300
349 Ga0209759_1008092 3300025256 Bacteria 3309
350 Ga0209759_1008780 3300025256 Bacteria 3120
351 Ga0209759_1009425 3300025256 Bacteria 2953
352 Ga0209233_1000021 3300025261 Bacteria 798078
353 Ga0209233_1000022 3300025261 Bacteria 785415
354 Ga0209455_1000195 3300025272 Bacteria 89254
355 Ga0209455_1000289 3300025272 Bacteria 53897
356 Ga0209130_1000440 3300025284 Bacteria 44209
357 Ga0209675_1006200 3300025291 Bacteria 4849
358 Ga0209676_1000015 3300025292 Bacteria 784458
359 Ga0209676_1000157 3300025292 Bacteria 163094
360 Ga0209676_1000222 3300025292 Bacteria 124695
361 Ga0209676_1005209 3300025292 Bacteria 6894
362 Ga0209676_1034513 3300025292 Bacteria 1495
363 Ga0209025_1002963 3300025294 Bacteria 16867
364 Ga0209758_1004418 3300025297 Bacteria 11713
365 Ga0209050_1000030 3300025298 Bacteria 463381
366 Ga0209050_1000061 3300025298 Bacteria 321435
367 Ga0209050_1000296 3300025298 Bacteria 104732
368 Ga0209050_1001068 3300025298 Bacteria 33633
369 Ga0209050_1002164 3300025298 Bacteria 17803
370 Ga0207426_1000428 3300025302 Bacteria 68777
371 Ga0209051_1000143 3300025303 Bacteria 135182
372 Ga0209051_1000295 3300025303 Bacteria 79621
373 Ga0209051_1000572 3300025303 Bacteria 44529
374 Ga0209051_1002845 3300025303 Bacteria 11927
375 Ga0209051_1011071 3300025303 Bacteria 4487
376 Ga0209257_1000422 3300025304 Bacteria 81630
377 Ga0209257_1006394 3300025304 Bacteria 7613
378 Ga0207656_10000009 3300025321 Bacteria 245637
379 Ga0207656_10001119 3300025321 Bacteria 8805
380 Ga0207656_10020296 3300025321 Bacteria 2640
381 Ga0207696_1000055 3300025711 Bacteria 258289
382 Ga0207696_1000127 3300025711 Bacteria 135531
383 Ga0207696_1000151 3300025711 Bacteria 120171
384 Ga0207696_1000165 3300025711 Bacteria 104683
385 Ga0207696_1006896 3300025711 Bacteria 4516
386 Ga0207696_1010951 3300025711 Bacteria 3297
387 Ga0207696_1019707 3300025711 Bacteria 2189
388 Ga0207696_1020824 3300025711 Bacteria 2107
389 Ga0207696_1025011 3300025711 Bacteria 1867
390 Ga0207696_1025475 3300025711 Bacteria 1844
391 Ga0207655_1000135 3300025728 Bacteria 143597
392 Ga0207655_1000548 3300025728 Bacteria 47302
393 Ga0207655_1000667 3300025728 Bacteria 40487
394 Ga0207655_1000754 3300025728 Bacteria 36294
395 Ga0207655_1001354 3300025728 Bacteria 22999
396 Ga0207655_1001521 3300025728 Bacteria 21107
397 Ga0207655_1007039 3300025728 Bacteria 7363
398 Ga0207655_1007611 3300025728 Bacteria 7003
399 Ga0207655_1014954 3300025728 Bacteria 4345
400 Ga0207655_1015759 3300025728 Bacteria 4180
401 Ga0207655_1020097 3300025728 Bacteria 3455
402 Ga0207655_1021272 3300025728 Bacteria 3298
403 Ga0207655_1021500 3300025728 Bacteria 3272
404 Ga0207655_1025941 3300025728 Bacteria 2828
405 Ga0207655_1032556 3300025728 Bacteria 2380
406 Ga0207655_1036360 3300025728 Bacteria 2185
407 Ga0207655_1044563 3300025728 Bacteria 1863
408 Ga0207655_1045529 3300025728 Bacteria 1831
409 Ga0207713_1000103 3300025735 Bacteria 138415
410 Ga0207713_1000126 3300025735 Bacteria 118913
411 Ga0207713_1000325 3300025735 Bacteria 53895
412 Ga0207713_1000716 3300025735 Bacteria 30986
413 Ga0207713_1011815 3300025735 Bacteria 4714
414 Ga0207713_1013444 3300025735 Bacteria 4312
415 Ga0207713_1013814 3300025735 Bacteria 4232
416 Ga0207713_1014219 3300025735 Bacteria 4150
417 Ga0207713_1018465 3300025735 Bacteria 3452
418 Ga0207713_1025165 3300025735 Bacteria 2756
419 Ga0207713_1025439 3300025735 Bacteria 2733
420 Ga0207713_1031704 3300025735 Bacteria 2332
421 Ga0207713_1039008 3300025735 Bacteria 2009
422 Ga0207713_1041563 3300025735 Bacteria 1917
423 Ga0207647_10000091 3300025904 Bacteria 68421
424 Ga0207647_10000272 3300025904 Bacteria 42247
425 Ga0207647_10001804 3300025904 Bacteria 16408
426 Ga0207645_10011652 3300025907 Bacteria 5996
427 Ga0207705_10002361 3300025909 Bacteria 14597
428 Ga0207705_10086015 3300025909 Bacteria 2297
429 Ga0207695_10003498 3300025913 Bacteria 22039
430 Ga0207695_10010947 3300025913 Bacteria 11032
431 Ga0207695_10096044 3300025913 Bacteria 2966
432 Ga0207695_10112070 3300025913 Bacteria 2707
433 Ga0207695_10138817 3300025913 Bacteria 2382
434 Ga0207671_10000876 3300025914 Bacteria 38121
435 Ga0207671_10003791 3300025914 Bacteria 14837
436 Ga0207671_10015444 3300025914 Bacteria 5977
437 Ga0207657_10004644 3300025919 Bacteria 14507
438 Ga0207657_10205738 3300025919 Bacteria 1581
439 Ga0207649_10000007 3300025920 Bacteria 334217
440 Ga0207681_10000291 3300025923 Bacteria 37201
441 Ga0207681_10001552 3300025923 Bacteria 14792
442 Ga0207694_10001660 3300025924 Bacteria 18654
443 Ga0207694_10041592 3300025924 Bacteria 3542
444 Ga0207694_10112983 3300025924 Bacteria 2162
445 Ga0207650_10000308 3300025925 Bacteria 48275
446 Ga0207650_10000407 3300025925 Bacteria 38580
447 Ga0207650_10016920 3300025925 Bacteria 5100
448 Ga0207659_10022325 3300025926 Bacteria 4213
449 Ga0207700_10110379 3300025928 Bacteria 2212
450 Ga0207664_10126972 3300025929 Bacteria 2143
451 Ga0207644_10009545 3300025931 Bacteria 6373
452 Ga0207690_10011023 3300025932 Bacteria 5389
453 Ga0207706_10000050 3300025933 Bacteria 116811
454 Ga0207706_10016345 3300025933 Bacteria 6699
455 Ga0207706_10045896 3300025933 Bacteria 3870
456 Ga0207706_10162278 3300025933 Bacteria 1964
457 Ga0207686_10160735 3300025934 Bacteria 1574
458 Ga0207709_10000107 3300025935 Bacteria 129240
459 Ga0207709_10007573 3300025935 Bacteria 6032
460 Ga0207709_10008362 3300025935 Bacteria 5726
461 Ga0207709_10092703 3300025935 Bacteria 1978
462 Ga0207689_10010915 3300025942 Bacteria 7809
463 Ga0207689_10173882 3300025942 Bacteria 1776
464 Ga0207679_10000013 3300025945 Bacteria 334197
465 Ga0207679_10009846 3300025945 Bacteria 6136
466 Ga0207679_10080874 3300025945 Bacteria 2482
467 Ga0207667_10000379 3300025949 Bacteria 60157
468 Ga0207667_10046021 3300025949 Bacteria 4619
469 Ga0207667_10124367 3300025949 Bacteria 2657
470 Ga0207667_10217556 3300025949 Bacteria 1957
471 Ga0207651_10004392 3300025960 Bacteria 7097
472 Ga0207712_10001134 3300025961 Bacteria 18557
473 Ga0207712_10066761 3300025961 Bacteria 2572
474 Ga0207640_10003822 3300025981 Bacteria 8122
475 Ga0207640_10067306 3300025981 Bacteria 2396
476 Ga0207640_10125902 3300025981 Bacteria 1844
477 Ga0207658_10006370 3300025986 Bacteria 8057
478 Ga0207677_10007314 3300026023 Bacteria 6097
479 Ga0207639_10000079 3300026041 Bacteria 83859
480 Ga0207639_10011033 3300026041 Bacteria 6266
481 Ga0207678_10001000 3300026067 Bacteria 25729
482 Ga0207678_10173025 3300026067 Bacteria 1844
483 Ga0207702_10014223 3300026078 Bacteria 6609
484 Ga0207648_10013130 3300026089 Bacteria 7721
485 Ga0207648_10181471 3300026089 Bacteria 1863
486 Ga0207674_10033449 3300026116 Bacteria 5383
487 Ga0207674_10036724 3300026116 Bacteria 5101
488 Ga0207674_10053121 3300026116 Bacteria 4130
489 Ga0207675_100029012 3300026118 Bacteria 5155
490 Ga0207683_10032577 3300026121 Bacteria 4527
491 Ga0207683_10151050 3300026121 Bacteria 2096
492 Ga0209281_1000091 3300027111 Bacteria 242588
493 Ga0209281_1003801 3300027111 Bacteria 4786
494 Ga0209281_1011417 3300027111 Bacteria 1991
495 Ga0209281_1012731 3300027111 Bacteria 1836
496 Ga0209389_1000065 3300027296 Bacteria 102064
497 Ga0209389_1021659 3300027296 Bacteria 5713
498 Ga0209371_1000073 3300027312 Bacteria 199474
499 Ga0209371_1000775 3300027312 Bacteria 26456
500 Ga0209969_1000072 3300027360 Bacteria 12262
501 Ga0209967_1003726 3300027364 Bacteria 2011
502 Ga0209981_1000108 3300027378 Bacteria 9363
503 Ga0209996_1004305 3300027395 Bacteria 1809
504 Ga0210000_1000423 3300027462 Bacteria 5831
505 Ga0209995_1001435 3300027471 Bacteria 3678
506 Ga0209968_1003403 3300027526 Bacteria 2391
507 Ga0209999_1000212 3300027543 Bacteria 8165
508 Ga0209983_1001173 3300027665 Bacteria 5791
509 Ga0209983_1006675 3300027665 Bacteria 2369
510 Ga0209971_1001954 3300027682 Bacteria 5030
511 Ga0209966_1009664 3300027695 Bacteria 1727
512 Ga0209974_10009674 3300027876 Bacteria 3269
513 Ga0209974_10010740 3300027876 Bacteria 3085
514 Ga0207428_10060798 3300027907 Bacteria 2992
515 Ga0207428_10074405 3300027907 Bacteria 2664
516 Ga0207428_10144090 3300027907 Bacteria 1817
517 Ga0207428_10151253 3300027907 Bacteria 1767
518 Ga0207428_10175230 3300027907 Bacteria 1623
519 Ga0207428_10193243 3300027907 Bacteria 1534
520 Ga0268266_10000006 3300028379 Bacteria 1410021
521 Ga0268266_10017690 3300028379 Bacteria 6076
522 Ga0268264_10032366 3300028381 Bacteria 4290
523 Ga0268264_10285339 3300028381 Bacteria 1548
524 Ga0265336_10000189 3300028666 Bacteria 42983
525 Ga0307515_10000104 3300028794 Bacteria 198238
526 Ga0307515_10005049 3300028794 Bacteria 26858
527 Ga0307515_10005461 3300028794 Bacteria 25733
528 Ga0307515_10037602 3300028794 Bacteria 7778
529 Ga0265338_10107072 3300028800 Bacteria 2262
530 Ga0265324_10000255 3300029957 Bacteria 39393
531 Ga0268256_1000247 3300030500 Bacteria 57439
532 Ga0268256_1001404 3300030500 Bacteria 14601
533 Ga0307511_10030120 3300030521 Bacteria 4881
534 Ga0314311_1025917 3300030733 Bacteria 3125
535 Ga0316178_1123526 3300030735 Bacteria 9747
536 Ga0316183_1118649 3300030742 Bacteria 2188
537 Ga0316183_1178545 3300030742 Bacteria 4345
538 Ga0265332_10006593 3300031238 Bacteria 5261
539 Ga0265329_10027195 3300031242 Bacteria 1881
540 Ga0265340_10011527 3300031247 Bacteria 4697
541 Ga0265339_10000801 3300031249 Bacteria 24249
542 Ga0265316_10040536 3300031344 Bacteria 3733
543 Ga0307513_10000034 3300031456 Bacteria 185012
544 Ga0307513_10002789 3300031456 Bacteria 23982
545 Ga0307513_10030775 3300031456 Bacteria 6092
546 Ga0307509_10003313 3300031507 Bacteria 24671
547 Ga0307408_100000028 3300031548 Bacteria 233440
548 Ga0307408_100000338 3300031548 Bacteria 44357
549 Ga0307408_100026625 3300031548 Bacteria 3976
550 Ga0307408_100036015 3300031548 Bacteria 3475
551 Ga0307408_100056151 3300031548 Bacteria 2854
552 Ga0307408_100119184 3300031548 Bacteria 2041
553 Ga0265313_10000307 3300031595 Bacteria 53087
554 Ga0307514_10003090 3300031649 Bacteria 16388
555 Ga0265342_10000100 3300031712 Bacteria 94554
556 Ga0307516_10000897 3300031730 Bacteria 40914
557 Ga0307516_10006945 3300031730 Bacteria 13137
558 Ga0307516_10009346 3300031730 Bacteria 10945
559 Ga0307516_10013621 3300031730 Bacteria 8642
560 Ga0307516_10050576 3300031730 Bacteria 4077
561 Ga0307516_10050777 3300031730 Bacteria 4067
562 Ga0307405_10013526 3300031731 Bacteria 4356
563 Ga0307405_10015744 3300031731 Bacteria 4103
564 Ga0307405_10016560 3300031731 Bacteria 4022
565 Ga0307405_10059682 3300031731 Bacteria 2404
566 Ga0307413_10079353 3300031824 Bacteria 2098
567 Ga0307413_10084560 3300031824 Bacteria 2045
568 Ga0307413_10125521 3300031824 Bacteria 1747
569 Ga0307410_10145750 3300031852 Bacteria 1757
570 Ga0307406_10106134 3300031901 Bacteria 1923
571 Ga0307412_10018660 3300031911 Bacteria 4180
572 Ga0307412_10020551 3300031911 Bacteria 4021
573 Ga0307412_10020661 3300031911 Bacteria 4010
574 Ga0307412_10023350 3300031911 Bacteria 3804
575 Ga0307412_10041635 3300031911 Bacteria 2978
576 Ga0307412_10058169 3300031911 Bacteria 2584
577 Ga0307409_100025004 3300031995 Bacteria 4179
578 Ga0307409_100070387 3300031995 Bacteria 2776
579 Ga0307416_100016949 3300032002 Bacteria 5081
580 Ga0307416_100025732 3300032002 Bacteria 4321
581 Ga0307416_100146046 3300032002 Bacteria 2159
582 Ga0307414_10006140 3300032004 Bacteria 6674
583 Ga0307414_10023837 3300032004 Bacteria 3889
584 Ga0307414_10056148 3300032004 Bacteria 2760
585 Ga0307411_10017935 3300032005 Bacteria 4049
586 Ga0307411_10053502 3300032005 Bacteria 2645
587 Ga0307411_10236690 3300032005 Bacteria 1427
588 Ga0307510_10054664 3300033180 Bacteria 4178
589 Ga0373926_0025936 3300035083 Bacteria 2048
590 Ga0373931_0000552 3300035691 Bacteria 15381
591 Ga0373927_0020208 3300035695 Bacteria 4366
592 Ga0373927_0075028 3300035695 Bacteria 2190
593 Ga0395899_0000036 3300037312 Bacteria 289502
594 Ga0395899_0000714 3300037312 Bacteria 33286
595 Ga0395899_0018524 3300037312 Bacteria 5292
596 Ga0395900_0000071 3300037418 Bacteria 187816
597 Ga0395900_0036795 3300037418 Bacteria 5045
598 Ga0395900_0109555 3300037418 Bacteria 2837
599 Ga0395900_0116347 3300037418 Bacteria 2743
600 Ga0395898_0000115 3300037466 Bacteria 211806
601 Ga0395898_0012451 3300037466 Bacteria 8795
602 Ga0395898_0085204 3300037466 Bacteria 3045
603 Ga0395898_0096604 3300037466 Bacteria 2838
604 Ga0395905_0001506 3300037471 Bacteria 27863
605 Ga0436364_1525509 3300037853 Bacteria 7135
606 Ga0395901_0000004 3300038443 Bacteria 657361
607 Ga0395901_0001368 3300038443 Bacteria 25522
608 Ga0395901_0158453 3300038443 Bacteria 2377
609 Ga0436361_0466601 3300039447 Bacteria 36969
610 Ga0436361_1053838 3300039447 Bacteria 4275
611 Ga0439436_0000225 3300041404 Bacteria 13580
612 Ga0439438_002200 3300041405 Bacteria 8386
613 Ga0439438_004067 3300041405 Bacteria 5732
614 Ga0439438_005970 3300041405 Bacteria 4392
615 Ga0439438_005973 3300041405 Bacteria 4391
616 Ga0439438_006320 3300041405 Bacteria 4203
617 Ga0439438_006365 3300041405 Bacteria 4180
618 Ga0439438_006499 3300041405 Bacteria 4114
619 Ga0439438_006519 3300041405 Bacteria 4105
620 Ga0439438_006743 3300041405 Bacteria 4008
621 Ga0439438_006761 3300041405 Bacteria 4003
622 Ga0439438_006831 3300041405 Bacteria 3977
623 Ga0439438_014045 3300041405 Bacteria 2393
624 Ga0439438_022521 3300041405 Bacteria 1746
625 Ga0439439_0030447 3300041406 Bacteria 1372
626 Ga0439447_002459 3300041407 Bacteria 6741
627 Ga0439447_003125 3300041407 Bacteria 5907
628 Ga0439447_004709 3300041407 Bacteria 4651
629 Ga0439447_005458 3300041407 Bacteria 4231
630 Ga0439447_009499 3300041407 Bacteria 2942
631 Ga0439447_014228 3300041407 Bacteria 2236
632 Ga0439447_020490 3300041407 Bacteria 1753
633 Ga0439447_025009 3300041407 Bacteria 1541
634 Ga0439466_0000796 3300041411 Bacteria 11984
635 Ga0439466_0004708 3300041411 Bacteria 5245
636 Ga0439466_0005092 3300041411 Bacteria 5038
637 Ga0439466_0007368 3300041411 Bacteria 4167
638 Ga0439466_0009753 3300041411 Bacteria 3580
639 Ga0439466_0013980 3300041411 Bacteria 2930
640 Ga0439466_0020978 3300041411 Bacteria 2322
641 Ga0439466_0026003 3300041411 Bacteria 2038
642 Ga0439466_0032009 3300041411 Bacteria 1795
643 Ga0439466_0033250 3300041411 Bacteria 1753
644 Ga0439466_0038739 3300041411 Bacteria 1600
645 Ga0439465_0025204 3300041413 Bacteria 1876
646 Ga0439465_0043143 3300041413 Bacteria 1463
647 Ga0451839_1109028 3300041496 Bacteria 1791
648 Ga0451853_0711122 3300041512 Bacteria 1395
649 Ga0439431_0003906 3300041997 Bacteria 3288
650 Ga0439431_0012654 3300041997 Bacteria 1941
651 Ga0439445_0013584 3300042004 Bacteria 1972
652 Ga0439445_0018474 3300042004 Bacteria 1731
653 Ga0439448_0000581 3300042005 Bacteria 8578
654 Ga0439432_001654 3300042006 Bacteria 8345
655 Ga0439432_005913 3300042006 Bacteria 4391
656 Ga0439432_006204 3300042006 Bacteria 4280
657 Ga0439432_006953 3300042006 Bacteria 4026
658 Ga0439432_007015 3300042006 Bacteria 4006
659 Ga0439432_010771 3300042006 Bacteria 3160
660 Ga0439432_017464 3300042006 Bacteria 2407
661 Ga0439449_0000464 3300042007 Bacteria 15110
662 Ga0439449_0005192 3300042007 Bacteria 4997
663 Ga0439451_003295 3300042009 Bacteria 3277
664 Ga0439451_006019 3300042009 Bacteria 2478
665 Ga0439451_008503 3300042009 Bacteria 2081
666 Ga0439452_000130 3300042010 Bacteria 57394
667 Ga0439452_003722 3300042010 Bacteria 5269
668 Ga0439452_005386 3300042010 Bacteria 4118
669 Ga0439452_005491 3300042010 Bacteria 4074
670 Ga0439452_005745 3300042010 Bacteria 3964
671 Ga0439452_009541 3300042010 Bacteria 2853
672 Ga0439452_011783 3300042010 Bacteria 2504
673 Ga0439452_012672 3300042010 Bacteria 2389
674 Ga0439452_019181 3300042010 Bacteria 1812
675 Ga0439452_023796 3300042010 Bacteria 1572
676 Ga0439452_029483 3300042010 Bacteria 1361
677 Ga0439456_000036 3300042013 Bacteria 49413
678 Ga0439456_001886 3300042013 Bacteria 4225
679 Ga0439456_002202 3300042013 Bacteria 3922
680 Ga0439456_010498 3300042013 Bacteria 1914
681 Ga0439456_015419 3300042013 Bacteria 1595
682 Ga0439456_016827 3300042013 Bacteria 1530
683 Ga0439456_017209 3300042013 Bacteria 1515
684 Ga0439462_0001819 3300042015 Bacteria 4832
685 Ga0439463_001273 3300042016 Bacteria 6738
686 Ga0439463_001697 3300042016 Bacteria 5766
687 Ga0439463_002033 3300042016 Bacteria 5250
688 Ga0439463_008109 3300042016 Bacteria 2591
689 Ga0439463_014299 3300042016 Bacteria 1956
690 Ga0439463_017672 3300042016 Bacteria 1770
691 Ga0439463_022200 3300042016 Bacteria 1587
692 Ga0439463_022382 3300042016 Bacteria 1581
693 Ga0450911_000027 3300042115 Bacteria 82476
694 Ga0450911_002156 3300042115 Bacteria 4004
695 Ga0450911_005048 3300042115 Bacteria 2086
696 Ga0450919_002076 3300042121 Bacteria 2600
697 Ga0450922_001625 3300042124 Bacteria 2198
698 Ga0450923_009272 3300042125 Bacteria 1718
699 Ga0450890_003479 3300042127 Bacteria 2091
700 Ga0450898_011868 3300042134 Bacteria 1431
701 Ga0450902_001681 3300042137 Bacteria 3046
702 Ga0450903_008964 3300042138 Bacteria 1634
703 Ga0450904_000135 3300042139 Bacteria 16319
704 Ga0450904_001911 3300042139 Bacteria 2684
705 Ga0450905_000251 3300042142 Bacteria 6264
706 Ga0450906_009115 3300042145 Bacteria 1899
707 Ga0450907_000328 3300042146 Bacteria 15121
708 Ga0450907_012909 3300042146 Bacteria 1391
709 Ga0450910_000604 3300042147 Bacteria 4280
710 Ga0450910_002175 3300042147 Bacteria 2561
711 Ga0450910_003725 3300042147 Bacteria 2034
712 Ga0439446_0000014 3300042156 Bacteria 39067
713 Ga0439446_0021432 3300042156 Bacteria 1826
714 Ga0450908_008616 3300042184 Bacteria 1908
715 Ga0450909_001936 3300042185 Bacteria 2923
716 Ga0450909_005675 3300042185 Bacteria 1796
717 Ga0439434_0002300 3300042435 Bacteria 5551
718 Ga0439464_0020896 3300042439 Bacteria 1794
719 Ga0439460_0002952 3300042461 Bacteria 4098
720 Ga0450916_000275 3300042530 Bacteria 4059
721 Ga0450901_002167 3300042533 Bacteria 2158
722 Ga0451577_0014309 3300042876 Bacteria 7396
723 Ga0451577_0024496 3300042876 Bacteria 5490
724 Ga0451577_0026154 3300042876 Bacteria 5286
725 Ga0439440_0001756 3300042993 Bacteria 3997
726 Ga0439440_0015796 3300042993 Bacteria 1644
727 Ga0466969_0011303 3300044656 Bacteria 4727
728 Ga0466972_0012303 3300044658 Bacteria 4301
729 Ga0453683_0000328 3300044673 Bacteria 58409
730 Ga0453683_0004904 3300044673 Bacteria 9397
731 Ga0453683_0007818 3300044673 Bacteria 7222
732 Ga0466965_0000089 3300044683 Bacteria 26574
733 Ga0466965_0018474 3300044683 Bacteria 3342
734 Ga0466965_0029001 3300044683 Bacteria 2691
735 Ga0466966_0000011 3300044684 Bacteria 136987
736 Ga0466966_0001297 3300044684 Bacteria 15995
737 Ga0466966_0006083 3300044684 Bacteria 7973
738 Ga0466966_0007670 3300044684 Bacteria 7152
739 Ga0466966_0051452 3300044684 Bacteria 2618
740 Ga0466961_0000210 3300044693 Bacteria 39137
741 Ga0466961_0000372 3300044693 Bacteria 29038
742 Ga0466961_0055685 3300044693 Bacteria 2520
743 Ga0466963_0002174 3300044694 Bacteria 10828
744 Ga0466963_0002861 3300044694 Bacteria 9745
745 Ga0466963_0004620 3300044694 Bacteria 8027
746 Ga0466964_0007901 3300044706 Bacteria 3983
747 Ga0466964_0023540 3300044706 Bacteria 2394
748 Ga0453684_0334467 3300044712 Bacteria 1712
749 Ga0466971_0002989 3300044719 Bacteria 7183
750 Ga0466971_0027909 3300044719 Bacteria 2527
751 Ga0466968_0003337 3300044735 Bacteria 5927
752 Ga0466968_0022741 3300044735 Bacteria 2550
753 Ga0466970_0017932 3300044765 Bacteria 3662
754 Ga0466957_0005059 3300044842 Bacteria 7380
755 Ga0466957_0008447 3300044842 Bacteria 5857
756 Ga0466957_0015152 3300044842 Bacteria 4499
757 Ga0466959_0001660 3300045049 Bacteria 13784
758 Ga0466959_0001900 3300045049 Bacteria 13149
759 Ga0466959_0005828 3300045049 Bacteria 8486
760 Ga0466959_0011539 3300045049 Bacteria 6351
761 Ga0451576_0000695 3300045051 Bacteria 68253
762 Ga0451576_0009989 3300045051 Bacteria 10942
763 Ga0451576_0301730 3300045051 Bacteria 1675
764 Ga0466958_0002609 3300045836 Bacteria 9105
765 Ga0466958_0014114 3300045836 Bacteria 4557
766 Ga0466958_0016177 3300045836 Bacteria 4291
767 Ga0466967_0032689 3300045976 Bacteria 4396
768 Ga0466967_0115853 3300045976 Bacteria 2468
769 Ga0495617_006004 3300046452 Bacteria 4282
770 Ga0495617_015682 3300046452 Bacteria 2565
771 Ga0495617_026342 3300046452 Bacteria 1957
772 Ga0495627_000115 3300046453 Bacteria 99960
773 Ga0495627_000869 3300046453 Bacteria 21472
774 Ga0495627_004307 3300046453 Bacteria 5984
775 Ga0495627_008096 3300046453 Bacteria 3962
776 Ga0495627_022986 3300046453 Bacteria 2047
777 Ga0495627_023468 3300046453 Bacteria 2020
778 Ga0495627_027309 3300046453 Bacteria 1832
779 Ga0495627_029811 3300046453 Bacteria 1732
780 Ga0495603_0003108 3300046455 Bacteria 9864
781 Ga0495590_0014737 3300046457 Bacteria 2850
782 Ga0495590_0033615 3300046457 Bacteria 1792
783 Ga0495590_0033893 3300046457 Bacteria 1784
784 Ga0495590_0044684 3300046457 Bacteria 1544
785 Ga0495591_000061 3300046458 Bacteria 126594
786 Ga0495591_000334 3300046458 Bacteria 42109
787 Ga0495591_000628 3300046458 Bacteria 26285
788 Ga0495591_002793 3300046458 Bacteria 9401
789 Ga0495591_004212 3300046458 Bacteria 7128
790 Ga0495591_006168 3300046458 Bacteria 5359
791 Ga0495591_008800 3300046458 Bacteria 4089
792 Ga0495591_009192 3300046458 Bacteria 3950
793 Ga0495591_019015 3300046458 Bacteria 2312
794 Ga0495591_023045 3300046458 Bacteria 2002
795 Ga0495591_023079 3300046458 Bacteria 2000
796 Ga0495591_026451 3300046458 Bacteria 1802
797 Ga0495591_030832 3300046458 Bacteria 1615
798 Ga0495591_031082 3300046458 Bacteria 1605
799 Ga0495591_040254 3300046458 Bacteria 1333
800 Ga0495629_0004392 3300046459 Bacteria 10561
801 Ga0495629_0063569 3300046459 Bacteria 2577
802 Ga0495638_0022540 3300046460 Bacteria 4133
803 Ga0495638_0023306 3300046460 Bacteria 4050
804 Ga0495638_0024472 3300046460 Bacteria 3937
805 Ga0495638_0075785 3300046460 Bacteria 2049
806 Ga0495638_0078804 3300046460 Bacteria 2004
807 Ga0495638_0078998 3300046460 Bacteria 2001
808 Ga0495638_0092394 3300046460 Bacteria 1821
809 Ga0495638_0093145 3300046460 Bacteria 1812
810 Ga0495638_0094204 3300046460 Bacteria 1800
811 Ga0495638_0098647 3300046460 Bacteria 1750
812 Ga0495638_0102624 3300046460 Bacteria 1708
813 Ga0495638_0105579 3300046460 Bacteria 1678
814 Ga0495653_0008489 3300046463 Bacteria 8422
815 Ga0495653_0029892 3300046463 Bacteria 4343
816 Ga0495653_0061267 3300046463 Bacteria 2847
817 Ga0495653_0080332 3300046463 Bacteria 2412
818 Ga0495653_0099975 3300046463 Bacteria 2103
819 Ga0495653_0171227 3300046463 Bacteria 1498
820 Ga0495650_0001603 3300046471 Bacteria 21154
821 Ga0495650_0006532 3300046471 Bacteria 7246
822 Ga0495650_0015289 3300046471 Bacteria 3942
823 Ga0495650_0032641 3300046471 Bacteria 2326
824 Ga0495650_0039947 3300046471 Bacteria 2019
825 Ga0495650_0044138 3300046471 Bacteria 1886
826 Ga0495650_0044202 3300046471 Bacteria 1884
827 Ga0495650_0047490 3300046471 Bacteria 1795
828 Ga0495580_0002591 3300046472 Bacteria 15728
829 Ga0495605_0000376 3300046474 Bacteria 42124
830 Ga0495605_0000441 3300046474 Bacteria 37414
831 Ga0495605_0001221 3300046474 Bacteria 17091
832 Ga0495605_0004763 3300046474 Bacteria 7929
833 Ga0495605_0010819 3300046474 Bacteria 5096
834 Ga0495605_0016196 3300046474 Bacteria 4038
835 Ga0495605_0030882 3300046474 Bacteria 2741
836 Ga0495605_0047069 3300046474 Bacteria 2116
837 Ga0495605_0047337 3300046474 Bacteria 2110
838 Ga0495639_0009832 3300046475 Bacteria 4106
839 Ga0495639_0058928 3300046475 Bacteria 1757
840 Ga0495639_0087005 3300046475 Bacteria 1462
841 Ga0495662_0063874 3300046476 Bacteria 1779
842 Ga0495664_0005113 3300046477 Bacteria 7193
843 Ga0495584_0007969 3300046491 Bacteria 5505
844 Ga0495584_0011920 3300046491 Bacteria 4443
845 Ga0495584_0013290 3300046491 Bacteria 4202
846 Ga0495584_0017193 3300046491 Bacteria 3685
847 Ga0495584_0029322 3300046491 Bacteria 2788
848 Ga0495584_0036252 3300046491 Bacteria 2491
849 Ga0495584_0038208 3300046491 Bacteria 2426
850 Ga0495584_0043553 3300046491 Bacteria 2265
851 Ga0495584_0046847 3300046491 Bacteria 2180
852 Ga0495584_0046957 3300046491 Bacteria 2177
853 Ga0495584_0048906 3300046491 Bacteria 2131
854 Ga0495584_0050134 3300046491 Bacteria 2102
855 Ga0495584_0054077 3300046491 Bacteria 2020
856 Ga0495584_0097176 3300046491 Bacteria 1487
857 Ga0495584_0103246 3300046491 Bacteria 1441
858 Ga0495585_0009776 3300046492 Bacteria 5738
859 Ga0495585_0010924 3300046492 Bacteria 5395
860 Ga0495585_0018037 3300046492 Bacteria 4072
861 Ga0495585_0025281 3300046492 Bacteria 3403
862 Ga0495585_0038450 3300046492 Bacteria 2693
863 Ga0495585_0055565 3300046492 Bacteria 2187
864 Ga0495585_0066260 3300046492 Bacteria 1977
865 Ga0495585_0073689 3300046492 Bacteria 1858
866 Ga0495585_0075512 3300046492 Bacteria 1832
867 Ga0495585_0077657 3300046492 Bacteria 1802
868 Ga0495585_0083679 3300046492 Bacteria 1726
869 Ga0495594_0032304 3300046499 Bacteria 2840
870 Ga0495594_0092949 3300046499 Bacteria 1691
871 Ga0495594_0115021 3300046499 Bacteria 1518
872 Ga0495596_0004405 3300046500 Bacteria 6873
873 Ga0495596_0036356 3300046500 Bacteria 1951
874 Ga0495607_0000147 3300046501 Bacteria 74197
875 Ga0495607_0000560 3300046501 Bacteria 36227
876 Ga0495607_0000747 3300046501 Bacteria 31132
877 Ga0495607_0000751 3300046501 Bacteria 31037
878 Ga0495607_0002973 3300046501 Bacteria 13288
879 Ga0495607_0005110 3300046501 Bacteria 9488
880 Ga0495607_0008448 3300046501 Bacteria 7035
881 Ga0495607_0012768 3300046501 Bacteria 5528
882 Ga0495607_0017578 3300046501 Bacteria 4585
883 Ga0495607_0019645 3300046501 Bacteria 4288
884 Ga0495607_0020345 3300046501 Bacteria 4197
885 Ga0495607_0028688 3300046501 Bacteria 3431
886 Ga0495607_0039642 3300046501 Bacteria 2812
887 Ga0495607_0068672 3300046501 Bacteria 1986
888 Ga0495607_0073646 3300046501 Bacteria 1898
889 Ga0495607_0082298 3300046501 Bacteria 1766
890 Ga0495607_0093523 3300046501 Bacteria 1623
891 Ga0495607_0100249 3300046501 Bacteria 1553
892 Ga0495607_0101689 3300046501 Bacteria 1538
893 Ga0495583_0000026 3300046506 Bacteria 256777
894 Ga0495583_0000982 3300046506 Bacteria 32675
895 Ga0495583_0001389 3300046506 Bacteria 24734
896 Ga0495583_0002607 3300046506 Bacteria 15077
897 Ga0495583_0004827 3300046506 Bacteria 9435
898 Ga0495583_0008616 3300046506 Bacteria 6207
899 Ga0495583_0011202 3300046506 Bacteria 5165
900 Ga0495583_0014011 3300046506 Bacteria 4440
901 Ga0495583_0032658 3300046506 Bacteria 2510
902 Ga0495583_0041375 3300046506 Bacteria 2158
903 Ga0495583_0045315 3300046506 Bacteria 2034
904 Ga0495583_0049252 3300046506 Bacteria 1930
905 Ga0495606_0002457 3300046507 Bacteria 21484
906 Ga0495606_0003787 3300046507 Bacteria 15718
907 Ga0495606_0013422 3300046507 Bacteria 6471
908 Ga0495606_0017724 3300046507 Bacteria 5370
909 Ga0495606_0018538 3300046507 Bacteria 5213
910 Ga0495606_0026516 3300046507 Bacteria 4129
911 Ga0495606_0027667 3300046507 Bacteria 4014
912 Ga0495606_0048978 3300046507 Bacteria 2774
913 Ga0495606_0055877 3300046507 Bacteria 2551
914 Ga0495606_0075474 3300046507 Bacteria 2109
915 Ga0495606_0089461 3300046507 Bacteria 1896
916 Ga0495606_0151900 3300046507 Bacteria 1358
917 Ga0495610_0012579 3300046512 Bacteria 5082
918 Ga0495610_0017395 3300046512 Bacteria 4100
919 Ga0495610_0018009 3300046512 Bacteria 4004
920 Ga0495610_0018310 3300046512 Bacteria 3961
921 Ga0495610_0018603 3300046512 Bacteria 3917
922 Ga0495610_0027084 3300046512 Bacteria 3052
923 Ga0495610_0028281 3300046512 Bacteria 2966
924 Ga0495610_0041045 3300046512 Bacteria 2326
925 Ga0495610_0047716 3300046512 Bacteria 2106
926 Ga0495610_0051602 3300046512 Bacteria 2000
927 Ga0495610_0054732 3300046512 Bacteria 1926
928 Ga0495610_0057025 3300046512 Bacteria 1875
929 Ga0495610_0059534 3300046512 Bacteria 1822
930 Ga0495610_0082899 3300046512 Bacteria 1468
931 Ga0495616_0000142 3300046513 Bacteria 62829
932 Ga0495616_0015223 3300046513 Bacteria 4280
933 Ga0495616_0015419 3300046513 Bacteria 4251
934 Ga0495616_0018889 3300046513 Bacteria 3769
935 Ga0495616_0024783 3300046513 Bacteria 3212
936 Ga0495616_0049565 3300046513 Bacteria 2104
937 Ga0495616_0056753 3300046513 Bacteria 1932
938 Ga0495616_0066637 3300046513 Bacteria 1751
939 Ga0495616_0079572 3300046513 Bacteria 1570
940 Ga0495616_0089808 3300046513 Bacteria 1456
941 Ga0495616_0097141 3300046513 Bacteria 1386
942 Ga0495620_0000023 3300046515 Bacteria 131512
943 Ga0495620_0000044 3300046515 Bacteria 110431
944 Ga0495620_0002605 3300046515 Bacteria 10433
945 Ga0495620_0006293 3300046515 Bacteria 6532
946 Ga0495620_0009524 3300046515 Bacteria 5159
947 Ga0495620_0013688 3300046515 Bacteria 4146
948 Ga0495620_0036857 3300046515 Bacteria 2183
949 Ga0495620_0038162 3300046515 Bacteria 2133
950 Ga0495620_0053525 3300046515 Bacteria 1708
951 Ga0495620_0063387 3300046515 Bacteria 1532
952 Ga0495620_0076852 3300046515 Bacteria 1356
953 Ga0495628_0031861 3300046516 Bacteria 4261
954 Ga0495630_0028475 3300046517 Bacteria 4150
955 Ga0495631_0007171 3300046518 Bacteria 5686
956 Ga0495631_0012421 3300046518 Bacteria 4158
957 Ga0495631_0041225 3300046518 Bacteria 2043
958 Ga0495631_0044370 3300046518 Bacteria 1959
959 Ga0495631_0055248 3300046518 Bacteria 1730
960 Ga0495631_0067726 3300046518 Bacteria 1544
961 Ga0495632_0005847 3300046519 Bacteria 8045
962 Ga0495632_0010414 3300046519 Bacteria 5511
963 Ga0495632_0011851 3300046519 Bacteria 5068
964 Ga0495632_0013667 3300046519 Bacteria 4619
965 Ga0495632_0015691 3300046519 Bacteria 4236
966 Ga0495632_0016106 3300046519 Bacteria 4168
967 Ga0495632_0032798 3300046519 Bacteria 2672
968 Ga0495632_0045169 3300046519 Bacteria 2195
969 Ga0495632_0054798 3300046519 Bacteria 1953
970 Ga0495632_0066415 3300046519 Bacteria 1740
971 Ga0495637_0000054 3300046520 Bacteria 99531
972 Ga0495637_0000413 3300046520 Bacteria 31487
973 Ga0495637_0011527 3300046520 Bacteria 4244
974 Ga0495637_0012548 3300046520 Bacteria 4048
975 Ga0495637_0012885 3300046520 Bacteria 3985
976 Ga0495637_0022910 3300046520 Bacteria 2842
977 Ga0495637_0038884 3300046520 Bacteria 2057
978 Ga0495637_0043911 3300046520 Bacteria 1905
979 Ga0495637_0044315 3300046520 Bacteria 1894
980 Ga0495637_0044359 3300046520 Bacteria 1893
981 Ga0495637_0054890 3300046520 Bacteria 1653
982 Ga0495637_0055616 3300046520 Bacteria 1640
983 Ga0495637_0057727 3300046520 Bacteria 1602
984 Ga0495637_0062604 3300046520 Bacteria 1522
985 Ga0495637_0070966 3300046520 Bacteria 1405
986 Ga0495637_0074560 3300046520 Bacteria 1362
987 Ga0495643_0001170 3300046522 Bacteria 25602
988 Ga0495643_0018356 3300046522 Bacteria 4067
989 Ga0495643_0040895 3300046522 Bacteria 2530
990 Ga0495643_0046599 3300046522 Bacteria 2349
991 Ga0495643_0062808 3300046522 Bacteria 1965
992 Ga0495643_0067463 3300046522 Bacteria 1885
993 Ga0495643_0067927 3300046522 Bacteria 1876
994 Ga0495643_0073669 3300046522 Bacteria 1789
995 Ga0495643_0076012 3300046522 Bacteria 1756
996 Ga0495643_0082803 3300046522 Bacteria 1666
997 Ga0495643_0119928 3300046522 Bacteria 1330
998 Ga0495644_0000073 3300046523 Bacteria 49382
999 Ga0495644_0004602 3300046523 Bacteria 5419
1000 Ga0495644_0007318 3300046523 Bacteria 4263
1001 Ga0495644_0043914 3300046523 Bacteria 1681
1002 Ga0495644_0050875 3300046523 Bacteria 1555
1003 Ga0495648_0002643 3300046524 Bacteria 16260
1004 Ga0495648_0008018 3300046524 Bacteria 8369
1005 Ga0495648_0010343 3300046524 Bacteria 7111
1006 Ga0495648_0039878 3300046524 Bacteria 2983
1007 Ga0495648_0046294 3300046524 Bacteria 2697
1008 Ga0495648_0066508 3300046524 Bacteria 2113
1009 Ga0495648_0067831 3300046524 Bacteria 2084
1010 Ga0495648_0069193 3300046524 Bacteria 2055
1011 Ga0495648_0077765 3300046524 Bacteria 1900
1012 Ga0495648_0080760 3300046524 Bacteria 1851
1013 Ga0495648_0082312 3300046524 Bacteria 1828
1014 Ga0495648_0093583 3300046524 Bacteria 1675
1015 Ga0495648_0104308 3300046524 Bacteria 1557
1016 Ga0495648_0127291 3300046524 Bacteria 1359
1017 Ga0495663_0007818 3300046525 Bacteria 2957
1018 Ga0495666_0046488 3300046526 Bacteria 2092
1019 Ga0495666_0047827 3300046526 Bacteria 2061
1020 Ga0495642_0002807 3300046528 Bacteria 6969
1021 Ga0495642_0017035 3300046528 Bacteria 2837
1022 Ga0495642_0040885 3300046528 Bacteria 1884
1023 Ga0495654_0001880 3300046530 Bacteria 13956
1024 Ga0495654_0008381 3300046530 Bacteria 5714
1025 Ga0495654_0010756 3300046530 Bacteria 4970
1026 Ga0495654_0014479 3300046530 Bacteria 4197
1027 Ga0495654_0014495 3300046530 Bacteria 4194
1028 Ga0495654_0015724 3300046530 Bacteria 4015
1029 Ga0495654_0043479 3300046530 Bacteria 2226
1030 Ga0495654_0046064 3300046530 Bacteria 2149
1031 Ga0495654_0050913 3300046530 Bacteria 2022
1032 Ga0495654_0058995 3300046530 Bacteria 1849
1033 Ga0495654_0066385 3300046530 Bacteria 1719
1034 Ga0495654_0085616 3300046530 Bacteria 1470
1035 Ga0495654_0086248 3300046530 Bacteria 1463
1036 Ga0495665_0000097 3300046531 Bacteria 40415
1037 Ga0495586_0048419 3300046535 Bacteria 2296
1038 Ga0495587_0020663 3300046536 Bacteria 4061
1039 Ga0495587_0078831 3300046536 Bacteria 1910
1040 Ga0495609_0000061 3300046538 Bacteria 139848
1041 Ga0495609_0000072 3300046538 Bacteria 125273
1042 Ga0495609_0000319 3300046538 Bacteria 43061
1043 Ga0495609_0000696 3300046538 Bacteria 25895
1044 Ga0495609_0003794 3300046538 Bacteria 8508
1045 Ga0495609_0012217 3300046538 Bacteria 4073
1046 Ga0495609_0014792 3300046538 Bacteria 3662
1047 Ga0495609_0037331 3300046538 Bacteria 2191
1048 Ga0495609_0049867 3300046538 Bacteria 1867
1049 Ga0495597_0001045 3300046542 Bacteria 21150
1050 Ga0495597_0003533 3300046542 Bacteria 9039
1051 Ga0495597_0011999 3300046542 Bacteria 4187
1052 Ga0495597_0020850 3300046542 Bacteria 3048
1053 Ga0495597_0038336 3300046542 Bacteria 2148
1054 Ga0495597_0044786 3300046542 Bacteria 1966
1055 Ga0495597_0044929 3300046542 Bacteria 1963
1056 Ga0495597_0047212 3300046542 Bacteria 1906
1057 Ga0495597_0052910 3300046542 Bacteria 1786
1058 Ga0495597_0065152 3300046542 Bacteria 1581
1059 Ga0495597_0077054 3300046542 Bacteria 1429
1060 Ga0495645_0001036 3300046543 Bacteria 18923
1061 Ga0495645_0125890 3300046543 Bacteria 1800
1062 Ga0495622_0000333 3300046557 Bacteria 34073
1063 Ga0495622_0003058 3300046557 Bacteria 7937
1064 Ga0495622_0006951 3300046557 Bacteria 5252
1065 Ga0495622_0010948 3300046557 Bacteria 4185
1066 Ga0495622_0023881 3300046557 Bacteria 2852
1067 Ga0495622_0037064 3300046557 Bacteria 2272
1068 Ga0495622_0045602 3300046557 Bacteria 2036
1069 Ga0495622_0047677 3300046557 Bacteria 1990
1070 Ga0495633_0000440 3300046558 Bacteria 42906
1071 Ga0495633_0000751 3300046558 Bacteria 29251
1072 Ga0495633_0005273 3300046558 Bacteria 7957
1073 Ga0495633_0043315 3300046558 Bacteria 2135
1074 Ga0495633_0043350 3300046558 Bacteria 2135
1075 Ga0495633_0047399 3300046558 Bacteria 2030
1076 Ga0495656_0002308 3300046615 Bacteria 6306
1077 Ga0495656_0007984 3300046615 Bacteria 3765
1078 Ga0495668_0010518 3300046616 Bacteria 5595
1079 Ga0495668_0018713 3300046616 Bacteria 4003
1080 Ga0495668_0048554 3300046616 Bacteria 2354
1081 Ga0495668_0053228 3300046616 Bacteria 2238
1082 Ga0495668_0062419 3300046616 Bacteria 2053
1083 Ga0495634_0138130 3300046642 Bacteria 1549
1084 Ga0495634_0162821 3300046642 Bacteria 1406
1085 Ga0495611_0000240 3300046648 Bacteria 37890
1086 Ga0495611_0002469 3300046648 Bacteria 8438
1087 Ga0495611_0009450 3300046648 Bacteria 4120
1088 Ga0495611_0010041 3300046648 Bacteria 4005
1089 Ga0495611_0057174 3300046648 Bacteria 1767
1090 Ga0495611_0090096 3300046648 Bacteria 1417
1091 Ga0495625_0000147 3300046660 Bacteria 107983
1092 Ga0495625_0003060 3300046660 Bacteria 17136
1093 Ga0495625_0016733 3300046660 Bacteria 5759
1094 Ga0495625_0030491 3300046660 Bacteria 4022
1095 Ga0495625_0095515 3300046660 Bacteria 2049
1096 Ga0495625_0146846 3300046660 Bacteria 1587
1097 Ga0495625_0159957 3300046660 Bacteria 1509
1098 Ga0495635_0006331 3300046663 Bacteria 8252
1099 Ga0495635_0025955 3300046663 Bacteria 4079
1100 Ga0495659_0002449 3300046664 Bacteria 5988
1101 Ga0495659_0061635 3300046664 Bacteria 1386
1102 Ga0495661_0000153 3300046665 Bacteria 81096
1103 Ga0495661_0000431 3300046665 Bacteria 44303
1104 Ga0495661_0000484 3300046665 Bacteria 41967
1105 Ga0495661_0000660 3300046665 Bacteria 34588
1106 Ga0495661_0003901 3300046665 Bacteria 10890
1107 Ga0495661_0012702 3300046665 Bacteria 5683
1108 Ga0495661_0023222 3300046665 Bacteria 4025
1109 Ga0495661_0025128 3300046665 Bacteria 3851
1110 Ga0495661_0031039 3300046665 Bacteria 3396
1111 Ga0495661_0067831 3300046665 Bacteria 2094
1112 Ga0495661_0086915 3300046665 Bacteria 1789
1113 Ga0495661_0100080 3300046665 Bacteria 1633
1114 Ga0495661_0105585 3300046665 Bacteria 1577
1115 Ga0495661_0133101 3300046665 Bacteria 1360
1116 Ga0495588_0011744 3300046674 Bacteria 4118
1117 Ga0495599_0180010 3300046678 Bacteria 1303
1118 Ga0495623_0012745 3300046679 Bacteria 5444
1119 Ga0495623_0069958 3300046679 Bacteria 2186
1120 Ga0495646_0031424 3300046680 Bacteria 3308
1121 Ga0495646_0069808 3300046680 Bacteria 2072
1122 Ga0495646_0095329 3300046680 Bacteria 1712
1123 Ga0495624_0126599 3300046690 Bacteria 1567
1124 Ga0495670_0004546 3300046691 Bacteria 6802
1125 Ga0495670_0008702 3300046691 Bacteria 4996
1126 Ga0495670_0014047 3300046691 Bacteria 3939
1127 Ga0495670_0022166 3300046691 Bacteria 3135
1128 Ga0495670_0047232 3300046691 Bacteria 2152
1129 Ga0495671_0004757 3300046692 Bacteria 8020
1130 Ga0495671_0006442 3300046692 Bacteria 6778
1131 Ga0495671_0007024 3300046692 Bacteria 6453
1132 Ga0495671_0009068 3300046692 Bacteria 5578
1133 Ga0495671_0013844 3300046692 Bacteria 4352
1134 Ga0495671_0022357 3300046692 Bacteria 3315
1135 Ga0495671_0024308 3300046692 Bacteria 3156
1136 Ga0495671_0029148 3300046692 Bacteria 2836
1137 Ga0495671_0039652 3300046692 Bacteria 2377
1138 Ga0495671_0050532 3300046692 Bacteria 2069
1139 Ga0495671_0054888 3300046692 Bacteria 1974
1140 Ga0495671_0057248 3300046692 Bacteria 1929
1141 Ga0495649_0002836 3300046694 Bacteria 12028
1142 Ga0495649_0003588 3300046694 Bacteria 10403
1143 Ga0495649_0006508 3300046694 Bacteria 7269
1144 Ga0495649_0010921 3300046694 Bacteria 5349
1145 Ga0495649_0048043 3300046694 Bacteria 2319
1146 Ga0495649_0049506 3300046694 Bacteria 2282
1147 Ga0495649_0056397 3300046694 Bacteria 2121
1148 Ga0495649_0057437 3300046694 Bacteria 2098
1149 Ga0495649_0064347 3300046694 Bacteria 1969
1150 Ga0495649_0069988 3300046694 Bacteria 1881
1151 Ga0495649_0085131 3300046694 Bacteria 1687
1152 Ga0495649_0098691 3300046694 Bacteria 1553
1153 Ga0495649_0106350 3300046694 Bacteria 1489
1154 Ga0495589_0002215 3300046794 Bacteria 10937
1155 Ga0495589_0010176 3300046794 Bacteria 4886
1156 Ga0495589_0012870 3300046794 Bacteria 4323
1157 Ga0495589_0045870 3300046794 Bacteria 2170
1158 Ga0495589_0056638 3300046794 Bacteria 1929
1159 Ga0495589_0065124 3300046794 Bacteria 1786
1160 Ga0495589_0066388 3300046794 Bacteria 1766
1161 Ga0495589_0073000 3300046794 Bacteria 1675
1162 Ga0495589_0084317 3300046794 Bacteria 1544
1163 Ga0495589_0103083 3300046794 Bacteria 1379
1164 Ga0495600_0008635 3300046809 Bacteria 6266
1165 Ga0495660_0001480 3300046810 Bacteria 15980
1166 Ga0495660_0007766 3300046810 Bacteria 6302
1167 Ga0495660_0010281 3300046810 Bacteria 5440
1168 Ga0495660_0016142 3300046810 Bacteria 4306
1169 Ga0495660_0019012 3300046810 Bacteria 3944
1170 Ga0495660_0036001 3300046810 Bacteria 2762
1171 Ga0495660_0038266 3300046810 Bacteria 2667
1172 Ga0495660_0053872 3300046810 Bacteria 2181
1173 Ga0495660_0060722 3300046810 Bacteria 2029
1174 Ga0495660_0062417 3300046810 Bacteria 1997
1175 Ga0495660_0092957 3300046810 Bacteria 1564
1176 Ga0495660_0103358 3300046810 Bacteria 1463
1177 Ga0495660_0113690 3300046810 Bacteria 1378
1178 Ga0495581_0079890 3300047315 Bacteria 1893
1179 Ga0495604_0012826 3300047317 Bacteria 6674
1180 Ga0495604_0031336 3300047317 Bacteria 4217
1181 Ga0495604_0155962 3300047317 Bacteria 1617
1182 Ga0495636_0026013 3300047318 Bacteria 2378
1183 Ga0495674_0038521 3300047319 Bacteria 4290
1184 Ga0495674_0072930 3300047319 Bacteria 2960
1185 Ga0495672_0004589 3300047320 Bacteria 11229
1186 Ga0495672_0020526 3300047320 Bacteria 4326
1187 Ga0495672_0020530 3300047320 Bacteria 4325
1188 Ga0495672_0021121 3300047320 Bacteria 4250
1189 Ga0495672_0021797 3300047320 Bacteria 4173
1190 Ga0495672_0023164 3300047320 Bacteria 4025
1191 Ga0495672_0034599 3300047320 Bacteria 3119
1192 Ga0495672_0036067 3300047320 Bacteria 3039
1193 Ga0495672_0039194 3300047320 Bacteria 2882
1194 Ga0495672_0044487 3300047320 Bacteria 2663
1195 Ga0495672_0044887 3300047320 Bacteria 2648
1196 Ga0495672_0058028 3300047320 Bacteria 2245
1197 Ga0495672_0058215 3300047320 Bacteria 2241
1198 Ga0495672_0070869 3300047320 Bacteria 1973
1199 Ga0495672_0085494 3300047320 Bacteria 1747
1200 Ga0495672_0086434 3300047320 Bacteria 1734
1201 Ga0495676_0000027 3300047321 Bacteria 141955
1202 Ga0495676_0101317 3300047321 Bacteria 2130
1203 Ga0495676_0111832 3300047321 Bacteria 2002
1204 Ga0495676_0196861 3300047321 Bacteria 1402
1205 Ga0495680_0005310 3300047322 Bacteria 12162
1206 Ga0495680_0021752 3300047322 Bacteria 5362
1207 Ga0495680_0094617 3300047322 Bacteria 2235
1208 Ga0495680_0160567 3300047322 Bacteria 1632
1209 Ga0495683_0000038 3300047323 Bacteria 139494
1210 Ga0495683_0000236 3300047323 Bacteria 50369
1211 Ga0495683_0026155 3300047323 Bacteria 2986
1212 Ga0495683_0054234 3300047323 Bacteria 1998
1213 Ga0495683_0057883 3300047323 Bacteria 1925
1214 Ga0495683_0058778 3300047323 Bacteria 1908
1215 Ga0495683_0090854 3300047323 Bacteria 1479
1216 Ga0495683_0091691 3300047323 Bacteria 1471
1217 Ga0495687_000313 3300047443 Bacteria 63173
1218 Ga0495687_001285 3300047443 Bacteria 23621
1219 Ga0495687_028574 3300047443 Bacteria 2592
1220 Ga0495675_0019492 3300047444 Bacteria 4309
1221 Ga0495675_0060569 3300047444 Bacteria 2399
1222 Ga0495677_0000306 3300047445 Bacteria 21272
1223 Ga0495677_0002657 3300047445 Bacteria 6984
1224 Ga0495677_0006896 3300047445 Bacteria 4271
1225 Ga0495677_0037663 3300047445 Bacteria 1766
1226 Ga0495679_000237 3300047446 Bacteria 45847
1227 Ga0495679_001014 3300047446 Bacteria 17250
1228 Ga0495679_008506 3300047446 Bacteria 4165
1229 Ga0495679_009276 3300047446 Bacteria 3948
1230 Ga0495679_022332 3300047446 Bacteria 2167
1231 Ga0495679_024389 3300047446 Bacteria 2038
1232 Ga0495679_042006 3300047446 Bacteria 1412
1233 Ga0495679_042152 3300047446 Bacteria 1409
1234 Ga0495679_042553 3300047446 Bacteria 1400
1235 Ga0495685_000137 3300047447 Bacteria 25064
1236 Ga0495673_0001349 3300047469 Bacteria 19897
1237 Ga0495673_0001927 3300047469 Bacteria 15436
1238 Ga0495673_0001940 3300047469 Bacteria 15348
1239 Ga0495673_0007883 3300047469 Bacteria 6053
1240 Ga0495673_0010029 3300047469 Bacteria 5188
1241 Ga0495673_0012515 3300047469 Bacteria 4494
1242 Ga0495673_0013763 3300047469 Bacteria 4231
1243 Ga0495673_0014316 3300047469 Bacteria 4127
1244 Ga0495673_0014628 3300047469 Bacteria 4074
1245 Ga0495673_0024354 3300047469 Bacteria 2926
1246 Ga0495673_0047341 3300047469 Bacteria 1900
1247 Ga0495673_0053617 3300047469 Bacteria 1757
1248 Ga0495673_0063135 3300047469 Bacteria 1579
1249 Ga0495673_0077477 3300047469 Bacteria 1384
1250 Ga0495681_0002342 3300047470 Bacteria 13606
1251 Ga0495681_0016470 3300047470 Bacteria 4140
1252 Ga0495681_0018386 3300047470 Bacteria 3852
1253 Ga0495681_0033419 3300047470 Bacteria 2576
1254 Ga0495681_0035876 3300047470 Bacteria 2458
1255 Ga0495681_0036459 3300047470 Bacteria 2431
1256 Ga0495681_0037450 3300047470 Bacteria 2388
1257 Ga0495681_0051002 3300047470 Bacteria 1947
1258 Ga0495681_0051820 3300047470 Bacteria 1928
1259 Ga0495681_0055715 3300047470 Bacteria 1842
1260 Ga0495681_0056572 3300047470 Bacteria 1824
1261 Ga0495681_0066009 3300047470 Bacteria 1652
1262 Ga0495681_0070867 3300047470 Bacteria 1579
1263 Ga0495681_0087960 3300047470 Bacteria 1376
1264 Ga0495686_0000038 3300047472 Bacteria 306383
1265 Ga0495686_0013850 3300047472 Bacteria 5582
1266 Ga0495686_0063352 3300047472 Bacteria 2291
1267 Ga0495686_0068931 3300047472 Bacteria 2181
1268 Ga0495686_0094336 3300047472 Bacteria 1813
1269 Ga0495686_0134630 3300047472 Bacteria 1462
1270 Ga0495593_0000787 3300047673 Bacteria 18362
1271 Ga0495593_0030746 3300047673 Bacteria 2936
1272 Ga0495593_0103612 3300047673 Bacteria 1457
1273 Ga0495602_0022153 3300048088 Bacteria 6226
1274 Ga0495602_0182038 3300048088 Bacteria 1619
1275 Ga0495626_0000067 3300048091 Bacteria 139969
1276 Ga0495626_0006113 3300048091 Bacteria 6909
1277 Ga0495626_0006151 3300048091 Bacteria 6875
1278 Ga0495626_0012561 3300048091 Bacteria 4432
1279 Ga0495626_0014232 3300048091 Bacteria 4109
1280 Ga0495626_0038567 3300048091 Bacteria 2264
1281 Ga0495626_0040115 3300048091 Bacteria 2212
1282 Ga0495626_0045210 3300048091 Bacteria 2056
1283 Ga0495626_0062218 3300048091 Bacteria 1695
1284 Ga0495626_0067327 3300048091 Bacteria 1617
1285 Ga0496100_0073402 3300048903 Bacteria 2289
1286 Ga0496100_0084686 3300048903 Bacteria 2149
1287 Ga0496102_0043863 3300048905 Bacteria 4057
1288 Ga0496102_0063586 3300048905 Bacteria 3379
1289 Ga0496102_0072694 3300048905 Bacteria 3161
1290 Ga0496102_0102866 3300048905 Bacteria 2656
1291 Ga0496104_0031916 3300048907 Bacteria 4900
1292 Ga0496104_0123590 3300048907 Bacteria 2484
1293 Ga0496105_0000815 3300048908 Bacteria 21113
1294 Ga0496105_0085943 3300048908 Bacteria 2599
1295 Ga0496107_0048629 3300048910 Bacteria 3056
1296 Ga0496110_0068866 3300048913 Bacteria 3133
1297 Ga0496112_0069194 3300048915 Bacteria 3487
1298 Ga0496112_0225136 3300048915 Bacteria 1831
1299 Ga0496112_0283605 3300048915 Bacteria 1603
1300 Ga0496113_0013329 3300048916 Bacteria 5564
1301 Ga0496114_0017622 3300048917 Bacteria 5767
1302 Ga0496114_0184803 3300048917 Bacteria 1821
1303 Ga0496115_0050225 3300048918 Bacteria 3340
1304 Ga0496115_0099054 3300048918 Bacteria 2388
1305 Ga0496116_0010833 3300048919 Bacteria 7605
1306 Ga0496116_0018891 3300048919 Bacteria 5293
1307 Ga0496116_0019033 3300048919 Bacteria 5273
1308 Ga0496116_0021261 3300048919 Bacteria 4899
1309 Ga0496116_0027285 3300048919 Bacteria 4159
1310 Ga0496116_0068314 3300048919 Bacteria 2264
1311 Ga0496116_0071568 3300048919 Bacteria 2195
1312 Ga0496116_0087093 3300048919 Bacteria 1913
1313 Ga0496116_0098844 3300048919 Bacteria 1750
1314 Ga0496117_0000010 3300048920 Bacteria 611954
1315 Ga0496117_0003366 3300048920 Bacteria 18635
1316 Ga0496117_0005310 3300048920 Bacteria 13617
1317 Ga0496117_0012326 3300048920 Bacteria 7550
1318 Ga0496117_0017657 3300048920 Bacteria 5952
1319 Ga0496117_0018561 3300048920 Bacteria 5753
1320 Ga0496117_0021375 3300048920 Bacteria 5237
1321 Ga0496117_0036019 3300048920 Bacteria 3707
1322 Ga0496117_0041901 3300048920 Bacteria 3347
1323 Ga0496117_0065170 3300048920 Bacteria 2478
1324 Ga0496117_0086704 3300048920 Bacteria 2033
1325 Ga0496117_0118446 3300048920 Bacteria 1632
1326 Ga0496117_0123064 3300048920 Bacteria 1589
1327 Ga0496117_0142633 3300048920 Bacteria 1432
1328 Ga0496118_0000009 3300048921 Bacteria 611954
1329 Ga0496118_0006189 3300048921 Bacteria 13261
1330 Ga0496118_0018449 3300048921 Bacteria 6295
1331 Ga0496118_0047077 3300048921 Bacteria 3347
1332 Ga0496118_0052825 3300048921 Bacteria 3094
1333 Ga0496118_0053499 3300048921 Bacteria 3068
1334 Ga0496118_0056677 3300048921 Bacteria 2943
1335 Ga0496118_0072522 3300048921 Bacteria 2472
1336 Ga0496118_0075320 3300048921 Bacteria 2407
1337 Ga0496118_0102993 3300048921 Bacteria 1922
1338 Ga0496118_0104470 3300048921 Bacteria 1901
1339 Ga0496118_0122374 3300048921 Bacteria 1692
1340 Ga0496118_0143486 3300048921 Bacteria 1508
1341 Ga0496119_0000704 3300048922 Bacteria 44799
1342 Ga0496119_0039239 3300048922 Bacteria 3045
1343 Ga0496119_0091843 3300048922 Bacteria 1723
1344 Ga0496119_0119688 3300048922 Bacteria 1449
1345 Ga0496120_0010286 3300048923 Bacteria 6544
1346 Ga0496120_0014369 3300048923 Bacteria 5281
1347 Ga0496120_0095490 3300048923 Bacteria 1580
1348 Ga0496120_0098621 3300048923 Bacteria 1548
1349 Ga0496121_0003788 3300048924 Bacteria 21104
1350 Ga0496121_0004345 3300048924 Bacteria 19161
1351 Ga0496121_0005540 3300048924 Bacteria 16128
1352 Ga0496121_0027165 3300048924 Bacteria 5363
1353 Ga0496121_0036800 3300048924 Bacteria 4356
1354 Ga0496121_0057144 3300048924 Bacteria 3235
1355 Ga0496121_0068129 3300048924 Bacteria 2880
1356 Ga0496121_0071640 3300048924 Bacteria 2786
1357 Ga0496121_0115269 3300048924 Bacteria 2040
1358 Ga0496121_0117093 3300048924 Bacteria 2019
1359 Ga0496121_0127966 3300048924 Bacteria 1906
1360 Ga0496121_0130009 3300048924 Bacteria 1886
1361 Ga0496121_0151242 3300048924 Bacteria 1707
1362 Ga0496122_0000079 3300048925 Bacteria 212416
1363 Ga0496122_0000517 3300048925 Bacteria 79890
1364 Ga0496122_0000890 3300048925 Bacteria 55628
1365 Ga0496122_0002629 3300048925 Bacteria 25113
1366 Ga0496122_0023593 3300048925 Bacteria 5414
1367 Ga0496122_0033075 3300048925 Bacteria 4261
1368 Ga0496122_0035281 3300048925 Bacteria 4072
1369 Ga0496122_0048232 3300048925 Bacteria 3278
1370 Ga0496122_0052604 3300048925 Bacteria 3080
1371 Ga0496122_0075993 3300048925 Bacteria 2366
1372 Ga0496122_0077637 3300048925 Bacteria 2330
1373 Ga0496122_0088531 3300048925 Bacteria 2121
1374 Ga0496122_0099104 3300048925 Bacteria 1955
1375 Ga0496122_0126604 3300048925 Bacteria 1633
1376 Ga0496123_0000073 3300048926 Bacteria 198307
1377 Ga0496123_0000243 3300048926 Bacteria 109767
1378 Ga0496123_0001424 3300048926 Bacteria 33453
1379 Ga0496123_0004921 3300048926 Bacteria 13703
1380 Ga0496123_0011862 3300048926 Bacteria 7495
1381 Ga0496123_0028664 3300048926 Bacteria 4115
1382 Ga0496123_0055107 3300048926 Bacteria 2611
1383 Ga0496123_0059953 3300048926 Bacteria 2456
1384 Ga0496123_0086238 3300048926 Bacteria 1884
1385 Ga0496123_0089243 3300048926 Bacteria 1837
1386 Ga0496124_0000511 3300048927 Bacteria 66830
1387 Ga0496124_0025306 3300048927 Bacteria 5378
1388 Ga0496124_0034546 3300048927 Bacteria 4435
1389 Ga0496124_0038300 3300048927 Bacteria 4164
1390 Ga0496124_0038315 3300048927 Bacteria 4163
1391 Ga0496124_0081795 3300048927 Bacteria 2653
1392 Ga0496124_0093927 3300048927 Bacteria 2440
1393 Ga0496124_0101317 3300048927 Bacteria 2333
1394 Ga0496124_0133275 3300048927 Bacteria 1971
1395 Ga0496124_0164269 3300048927 Bacteria 1727
1396 Ga0496124_0169101 3300048927 Bacteria 1695
1397 Ga0496124_0170017 3300048927 Bacteria 1689
1398 Ga0496125_0002177 3300048928 Bacteria 26150
1399 Ga0496125_0005766 3300048928 Bacteria 13606
1400 Ga0496125_0038819 3300048928 Bacteria 4111
1401 Ga0496125_0039957 3300048928 Bacteria 4031
1402 Ga0496125_0040272 3300048928 Bacteria 4010
1403 Ga0496125_0077667 3300048928 Bacteria 2558
1404 Ga0496125_0098581 3300048928 Bacteria 2162
1405 Ga0496125_0109797 3300048928 Bacteria 2002
1406 Ga0496125_0140093 3300048928 Bacteria 1683
1407 Ga0496125_0167344 3300048928 Bacteria 1483
1408 Ga0496126_0000838 3300048929 Bacteria 54525
1409 Ga0496126_0044107 3300048929 Bacteria 4109
1410 Ga0496126_0045063 3300048929 Bacteria 4056
1411 Ga0496126_0196546 3300048929 Bacteria 1705
1412 Ga0496126_0224693 3300048929 Bacteria 1575
1413 Ga0495678_000054 3300049459 Bacteria 153487
1414 Ga0495678_000078 3300049459 Bacteria 123666
1415 Ga0495678_010708 3300049459 Bacteria 4434
1416 Ga0495678_011987 3300049459 Bacteria 4125
1417 Ga0495678_028649 3300049459 Bacteria 2347
1418 Ga0495678_030698 3300049459 Bacteria 2246
1419 Ga0495678_039949 3300049459 Bacteria 1889
1420 Ga0495678_042583 3300049459 Bacteria 1809
1421 Ga0495678_063478 3300049459 Bacteria 1379
1422 Ga0495678_068624 3300049459 Bacteria 1306
1423 Ga0495682_0000069 3300049460 Bacteria 94250
1424 Ga0495682_0003335 3300049460 Bacteria 7170
1425 Ga0495682_0003684 3300049460 Bacteria 6755
1426 Ga0495682_0028634 3300049460 Bacteria 2063
1427 Ga0501031_0005889 3300049568 Bacteria 7985
1428 Ga0501031_0058010 3300049568 Bacteria 2522
1429 Ga0501032_0000449 3300049569 Bacteria 33607
1430 Ga0501033_0001574 3300049570 Bacteria 20112
1431 Ga0501033_0092876 3300049570 Bacteria 2207
1432 Ga0501034_0000164 3300049571 Bacteria 125152
1433 Ga0501034_0007896 3300049571 Bacteria 11306
1434 Ga0501034_0023202 3300049571 Bacteria 6322
1435 Ga0501034_0229789 3300049571 Bacteria 1804
1436 Ga0501036_0001261 3300049572 Bacteria 19388
1437 Ga0501037_0001265 3300049573 Bacteria 18630
1438 Ga0501037_0066044 3300049573 Bacteria 2636
1439 Ga0501038_0012053 3300049574 Bacteria 7894
1440 Ga0501039_0064436 3300049575 Bacteria 2841
1441 Ga0501039_0104851 3300049575 Bacteria 2207
1442 Ga0501040_0000307 3300049576 Bacteria 28639
1443 Ga0501040_0001449 3300049576 Bacteria 15027
1444 Ga0501041_0034738 3300049577 Bacteria 3053
1445 Ga0501042_0000603 3300049578 Bacteria 19166
1446 Ga0501043_0003265 3300049579 Bacteria 13371
1447 Ga0501046_0001788 3300049580 Bacteria 20500
1448 Ga0501047_0003908 3300049581 Bacteria 14011
1449 Ga0501076_0020900 3300049592 Bacteria 5013
1450 Ga0501077_0083312 3300049593 Bacteria 2026
1451 Ga0501222_007907 3300049662 Bacteria 1415
1452 Ga0501235_023389 3300049669 Bacteria 1377
1453 Ga0501240_008426 3300049673 Bacteria 1322
1454 Ga0501079_0012489 3300049741 Bacteria 6483
1455 Ga0501079_0050515 3300049741 Bacteria 3210
1456 Ga0501081_0002881 3300049743 Bacteria 10921
1457 Ga0501241_004320 3300049758 Bacteria 2668
1458 Ga0501262_007974 3300049759 Bacteria 1290
1459 Ga0501269_002975 3300049766 Bacteria 2058
1460 Ga0501282_000230 3300049778 Bacteria 6822
1461 Ga0501035_0185893 3300049822 Bacteria 1788
1462 Ga0501044_0120768 3300049823 Bacteria 2621
1463 Ga0501045_0008665 3300049824 Bacteria 7093
1464 Ga0501226_000348 3300049853 Bacteria 6745
1465 nmdc:mga03683_41472_c1 3300050489 Bacteria 1891
1466 nmdc:mga00v17_154487_c1 3300050491 Bacteria 1475
1467 nmdc:mga0k408_107519_c1 3300050493 Bacteria 1648
1468 nmdc:mga0k408_272_c2 3300050493 Bacteria 26650
1469 nmdc:mga0k408_59276_c1 3300050493 Bacteria 2224
1470 nmdc:mga0k408_7263_c2 3300050493 Bacteria 3634
1471 nmdc:mga07m45_10124_c1 3300050496 Bacteria 4915
1472 nmdc:mga07m45_136_c1 3300050496 Bacteria 27318
1473 nmdc:mga07m45_37979_c1 3300050496 Bacteria 2686
1474 nmdc:mga07m45_55694_c1 3300050496 Bacteria 2235
1475 nmdc:mga05p37_24610_c1 3300050507 Bacteria 7319
1476 nmdc:mga05p37_75674_c1 3300050507 Bacteria 4144
1477 nmdc:mga09592_20902_c1 3300050508 Bacteria 5391
1478 nmdc:mga09592_365_c1 3300050508 Bacteria 33116
1479 nmdc:mga0qj67_112046_c1 3300050509 Bacteria 2203
1480 nmdc:mga0qj67_15012_c1 3300050509 Bacteria 5859
1481 nmdc:mga0qj67_7700_c1 3300050509 Bacteria 7960
1482 nmdc:mga06r32_112366_c1 3300050510 Bacteria 2681
1483 nmdc:mga06r32_25761_c1 3300050510 Bacteria 5475
1484 nmdc:mga08y16_237961_c1 3300050511 Bacteria 1882
1485 nmdc:mga0sz30_14524_c1 3300050516 Bacteria 3101
1486 Ga0500635_0000210 3300053080 Bacteria 28403
1487 Ga0495619_0027728 3300053085 Bacteria 3651
1488 Ga0500644_0003052 3300053088 Bacteria 4150
1489 Ga0500572_013953 3300053111 Bacteria 1998
1490 Ga0500595_000950 3300053119 Bacteria 16349
1491 Ga0500618_002869 3300053125 Bacteria 6179
1492 Ga0500618_003991 3300053125 Bacteria 4867
1493 Ga0500559_0076107 3300053136 Bacteria 1519
1494 Ga0500573_0088086 3300053140 Bacteria 1756
1495 Ga0500590_007334 3300053148 Bacteria 5439
1496 Ga0500619_003055 3300053154 Bacteria 3352
1497 Ga0500634_0015573 3300053161 Bacteria 4040
1498 Ga0500587_000416 3300053739 Bacteria 4975
1499 Ga0501084_0001517 3300054114 Bacteria 18424
1500 Ga0500661_002235 3300055283 Bacteria 3659
1501 Ga0501082_0013114 3300060353 Bacteria 7126
1502 Ga0466962_0003526 3300061719 Bacteria 7456
1503 Ga0466962_0005762 3300061719 Bacteria 5951
1504 Ga0466962_0010726 3300061719 Bacteria 4404
1505 Ga0466962_0112944 3300061719 Bacteria 1308
1506 Ga0530510_0138360 3300061734 Bacteria 1793
1507 2511246917 2511231002 Bacteria 5042903
1508 2511253735 2511231004 Bacteria 6669789
1509 2511264687 2511231006 Bacteria 6794709
1510 2511273726 2511231007 Bacteria 6306603
1511 2511279643 2511231008 Bacteria 6624100
1512 2511289598 2511231010 Bacteria 6373152
1513 2511294698 2511231011 Bacteria 6149768
1514 2511298841 2511231012 Bacteria 6738011
1515 2511317061 2511231014 Bacteria 6462302
1516 2511322157 2511231015 Bacteria 6598026
1517 2511324578 2511231016 Bacteria 6704427
1518 2511332314 2511231017 Bacteria 6503007
1519 2511337755 2511231018 Bacteria 6436256
1520 2511347348 2511231019 Bacteria 6520662
1521 2511352476 2511231020 Bacteria 6115223
1522 2511359234 2511231021 Bacteria 7302637
1523 2511360727 2511231022 Bacteria 6719296
1524 2511368853 2511231023 Bacteria 6808468
1525 2511376680 2511231024 Bacteria 5835885
1526 2511412356 2511231031 Bacteria 6558529
1527 2511822129 2511231156 Bacteria 6845832
1528 2512035257 2511231221 Bacteria 6846400
1529 2512325200 2512047018 Bacteria 6663241
1530 2515689207 2515154123 Bacteria 6387382
1531 2516022186 2515154189 Bacteria 9629850
1532 2523107502 2522572158 Bacteria 6514390
1533 2554812815 2554235132 Bacteria 6772433
1534 2555245343 2554235231 Bacteria 5215788
1535 2555667058 2554235341 Bacteria 6867980
1536 2563062658 2562617112 Bacteria 10918404
1537 2574433309 2574179768 Bacteria 4907129
1538 2583152962 2582580736 Bacteria 5325865
1539 2583795298 2582580891 Bacteria 6800976
1540 2597855310 2597489887 Bacteria 6666321
1541 2597861309 2597489888 Bacteria 6179543
1542 2597867056 2597489889 Bacteria 6297495
1543 2599104457 2597490356 Bacteria 7030811
1544 2599327947 2599185155 Bacteria 5827168
1545 2599355532 2599185160 Bacteria 6844013
1546 2599363065 2599185161 Bacteria 6960462
1547 2599368629 2599185162 Bacteria 6957254
1548 2599376174 2599185163 Bacteria 6995158
1549 2599380638 2599185164 Bacteria 6841688
1550 2599387846 2599185165 Bacteria 6843250
1551 2599395032 2599185166 Bacteria 6959206
1552 2599401197 2599185167 Bacteria 6353609
1553 2599406797 2599185168 Bacteria 6997636
1554 2599449470 2599185179 Bacteria 6611171
1555 2599462366 2599185181 Bacteria 6844519
1556 2599468211 2599185182 Bacteria 6883168
1557 2599487436 2599185185 Bacteria 6652270
1558 2599491383 2599185186 Bacteria 6831633
1559 2599503899 2599185188 Bacteria 6164180
1560 2599506135 2599185189 Bacteria 5862825
1561 2599516474 2599185190 Bacteria 6285678
1562 2599516516 2599185191 Bacteria 6297582
1563 2599616160 2599185212 Bacteria 6765997
1564 2599773707 2599185248 Bacteria 6696816
1565 2599804208 2599185257 Bacteria 6492581
1566 2599879431 2599185288 Bacteria 6666191
1567 2599888001 2599185289 Bacteria 6778765
1568 2599895864 2599185290 Bacteria 6289611
1569 2599899308 2599185291 Bacteria 6775623
1570 2599946263 2599185302 Bacteria 5954930
1571 2599948623 2599185303 Bacteria 6512725
1572 2599957438 2599185304 Bacteria 5951361
1573 2599963638 2599185305 Bacteria 6748700
1574 2599969790 2599185306 Bacteria 6637356
1575 2599975241 2599185307 Bacteria 6194719
1576 2599981311 2599185308 Bacteria 6621546
1577 2599986863 2599185309 Bacteria 5969593
1578 2599991258 2599185310 Bacteria 6014457
1579 2599997300 2599185311 Bacteria 6354990
1580 2600000911 2599185312 Bacteria 5912071
1581 2600007370 2599185313 Bacteria 6658188
1582 2600015109 2599185314 Bacteria 6621749
1583 2600021343 2599185315 Bacteria 6771107
1584 2600026735 2599185316 Bacteria 6320029
1585 2600032303 2599185317 Bacteria 6435722
1586 2600038549 2599185318 Bacteria 6961590
1587 2600043950 2599185319 Bacteria 6637840
1588 2600050133 2599185320 Bacteria 5963263
1589 2600056415 2599185321 Bacteria 6764560
1590 2600062396 2599185322 Bacteria 6763055
1591 2600065204 2599185323 Bacteria 6688755
1592 2600074282 2599185324 Bacteria 6590677
1593 2600080410 2599185325 Bacteria 6324919
1594 2600214988 2599185356 Bacteria 6843884
1595 2600361663 2600254930 Bacteria 6431253
1596 2600363079 2600254931 Bacteria 6734225
1597 2600446315 2600254954 Bacteria 5100516
1598 2601627796 2600255283 Bacteria 6061572
1599 2601666688 2600255292 Bacteria 6300551
1600 2601693383 2600255296 Bacteria 5784754
1601 2601775154 2600255313 Bacteria 6842543
1602 2601798100 2600255318 Bacteria 6383414
1603 2602012657 2600255389 Bacteria 5275336
1604 2606076988 2603880185 Bacteria 6379190
1605 2606129766 2603880199 Bacteria 6377649
1606 2608383279 2606217733 Bacteria 6360972
1607 2621296435 2619619299 Bacteria 6649820
1608 2624477895 2623620443 Bacteria 6427864
1609 2624489466 2623620446 Bacteria 6500345
1610 2643843455 2643221565 Bacteria 6216018
1611 2643873598 2643221571 Bacteria 6228673
1612 2643954642 2643221589 Bacteria 6250934
1613 2644022909 2643221602 Bacteria 6249926
1614 2644184081 2643221633 Bacteria 6733554
1615 2644282757 2643221650 Bacteria 7029547
1616 2644624385 2643221713 Bacteria 6554480
1617 2652547685 2651869719 Bacteria 6047974
1618 2671091812 2667528170 Bacteria 6786960
1619 2671099706 2667528171 Bacteria 6900659
1620 2671129520 2667528176 Bacteria 6724917
1621 2671771217 2671180172 Bacteria 6495783
1622 2677900361 2675903420 Bacteria 6247433
1623 2678266611 2675903515 Bacteria 6580491
1624 2713476895 2711768613 Bacteria 11048459
1625 2715749420 2713897148 Bacteria 5883533
1626 2715754422 2713897149 Bacteria 6506249
1627 2723246212 2721755607 Bacteria 5841722
1628 2738673381 2738541265 Bacteria 6594665
1629 2738690686 2738541271 Bacteria 5657310
1630 2738751774 2738541282 Bacteria 6593925
1631 2738807655 2738541294 Bacteria 6925949
1632 2738860815 2738541303 Bacteria 6591772
1633 2738895015 2738541309 Bacteria 6926455
1634 2739202319 2738543004 Bacteria 6381073
1635 2739262751 2738543015 Bacteria 6750701
1636 2739266460 2738543016 Bacteria 5657564
1637 2739312071 2738543025 Bacteria 6600348
1638 2743740879 2740892503 Bacteria 6855563
1639 2745007841 2744054620 Bacteria 6551379
1640 2765581323 2765235841 Bacteria 6137024
1641 2774117948 2773857670 Bacteria 6407454
1642 2774136620 2773857673 Bacteria 6513460
1643 2784261386 2784132063 Bacteria 6262788
1644 2784316434 2784132072 Bacteria 6596533
1645 2792833856 2791355137 Bacteria 9654227
1646 2794593680 2791355520 Bacteria 5948615
1647 2807410852 2806310737 Bacteria 5751088
1648 2807459193 2806310745 Bacteria 5742165
1649 2808858367 2808606361 Bacteria 6136259
1650 2808905784 2808606373 Bacteria 4423627
1651 2808923866 2808606376 Bacteria 6248667
1652 2808928028 2808606377 Bacteria 6646337
1653 2808938456 2808606378 Bacteria 6177535
1654 2808942097 2808606379 Bacteria 5022697
1655 2808946279 2808606380 Bacteria 6248705
1656 2808950790 2808606381 Bacteria 6646461
1657 2808960755 2808606382 Bacteria 6841132
1658 2808966808 2808606383 Bacteria 6138645
1659 2808980035 2808606385 Bacteria 6711065
1660 2808995755 2808606388 Bacteria 6706662
1661 2809001682 2808606389 Bacteria 6138126
1662 2809217649 2808606445 Bacteria 6057339
1663 2812369902 2811994881 Bacteria 6298475
1664 2817488086 2816332298 Bacteria 6852809
1665 2819624681 2818991450 Bacteria 6962147
1666 2819655550 2818991456 Bacteria 6123676
1667 2819704853 2818991464 Bacteria 6907494
1668 2823421462 2823421272 Bacteria 5372474
1669 2825654600 2825651385 Bacteria 6715909
1670 2826581587 2826581358 Bacteria 5963467
1671 2834031344 2834028612 Bacteria 6354979
1672 2842715346 2842711865 Bacteria 7155354
1673 2842821296 2842815866 Bacteria 5947510
1674 2842832047 2842826826 Bacteria 5974129
1675 2842833869 2842832357 Bacteria 5959113
1676 2842838318 2842837860 Bacteria 6066181
1677 2842846097 2842843487 Bacteria 6004777
1678 2842851885 2842849001 Bacteria 5924277
1679 2842856066 2842854478 Bacteria 6143501
1680 2844667546 2844665904 Bacteria 6817974
1681 2846956770 2846952575 Bacteria 6587527
1682 2852616741 2852612431 Bacteria 6885235
1683 2852662697 2852657418 Bacteria 6472974
1684 2852671709 2852667396 Bacteria 6885555
1685 2857548453 2857547612 Bacteria 6179999
1686 2860345335 2860339153 Bacteria 6846989
1687 2860868109 2860867994 Bacteria 5645326
1688 2873320507 2873314349 Bacteria 8512634
1689 2878029838 2878029506 Bacteria 6418441
1690 2880230789 2880230671 Bacteria 6140320
1691 2885084512 2885080285 Bacteria 6355622
1692 2885275516 2885270888 Bacteria 9831543
1693 2897806792 2897803580 Bacteria 7000062
1694 2900642114 2900634093 Bacteria 10263517
1695 2900642757 2900634093 Bacteria 10263517
1696 2904518522 2904518522 Bacteria 6068986
1697 2904542372 2904541872 Bacteria 8915136
1698 2904553326 2904550169 Bacteria 6221258
1699 2904622198 2904615490 Bacteria 10047340
1700 2904705613
1701 2908446699 2908446538 Bacteria 6829095
1702 2912963897 2912963787 Bacteria 5646108
1703 2913036967 2913036834 Bacteria 6704877
1704 2917070796 2917070673 Bacteria 6868303
1705 2919069657 2919063839 Bacteria 6302690
1706 2919156202 2919155634 Bacteria 4860545
1707 2919388753 2919385768 Bacteria 5897293
1708 2919457987 2919456309 Bacteria 6586567
1709 2919487136 2919481497 Bacteria 6907839
1710 2919493004 2919487758 Bacteria 5929766
1711 2919503096 2919501602 Bacteria 5286340
1712 2919702329 2919697872 Bacteria 6553725
1713 2923153711 2923153595 Bacteria 6870622
1714 2923523988 2923519811 Bacteria 6298479
1715 2923589465 2923586266 Bacteria 6565975
1716 2926064770 2926063275 Bacteria 5285848
1717 2928110629 2928108538 Bacteria 7360024
1718 2928140145 2928135762 Bacteria 7259641
1719 2928505638 2928503688 Bacteria 7268108
1720 2929144474 2929144301 Bacteria 6622272
1721 2929189992 2929189879 Bacteria 5930554
1722 2931372180 2931369376 Bacteria 6847892
1723 2931391054 2931390751 Bacteria 6273349
1724 2931398534 2931396565 Bacteria 7251677
1725 2932413046 2932410948 Bacteria 6312192
1726 2932420561 2932416698 Bacteria 6315112
1727 2932424593 2932422444 Bacteria 4678430
1728 2935357869 2935353572 Unclassified 6955622
1729 2939642688 2939636861 Bacteria 6297853
1730 2939654505 2939651529 Bacteria 5895393
1731 2945930490 2945928738 Bacteria 6053221
1732 2945967267 2945961074 Bacteria 7342064
1733 2946012835 2946006987 Bacteria 6705746
1734 2947234818 2947233263 Bacteria 6439278
1735 2969304596 2969304461 Bacteria 6601805
1736 2974293650 2974289157 Bacteria 6080362
1737 2984292402 2984286254 Bacteria 6702062
1738 2987606793 2987605356 Bacteria 4187822
1739 2988731907 2988728565 Bacteria 6124362
1740 2998140160 2998139840 Bacteria 6073514
1741 3007254849 3007252601 Bacteria 4559114
1742 3007316083 3007315729 Bacteria 5076637
1743 3007398964 3007395558 Bacteria 6755444
1744 3007419694 3007419365 Bacteria 7026924
1745 3007517573 3007511990 Bacteria 6481491
1746 3007614735 3007614139 Bacteria 6053559
1747 3007623897 3007619802 Bacteria 6411688
1748 3007722672 3007718800 Bacteria 5971527
1749 3007807243 3007803356 Bacteria 5931491
1750 3007859611 3007855910 Bacteria 5637581
1751 3007864660 3007861166 Bacteria 6045338
1752 3007871482 3007866637 Bacteria 5899198
1753 3007874907 3007872151 Bacteria 5268868
1754 637317461 637000220 Bacteria 7074893
1755 639787071 639633007 Bacteria 4376040
1756 8011352618 8011350971 Bacteria 6158957
1757 8015687974 8015687852 Bacteria 6613826
1758 8019769359 8019769354 Bacteria 6924660
1759 8019779552 8019775933 Bacteria 6858656
1760 8021127612 8021120328 Bacteria 8782274
1761 8029995093 8029995093 Bacteria 5990776
1762 8034964435 8034962539 Bacteria 4884839
1763 8052494513 8052494512 Bacteria 5765634
1764 8054009138 8054002106 Bacteria 7987183
1765 8054287042 8054285046 Bacteria 6919322
1766 8054288070 8054285046 Bacteria 6919322
1767 8054349199 8054347763 Bacteria 5901107
1768 8054503659 8054503363 Bacteria 6101651
1769 8054930045 8054929484 Bacteria 5599761
1770 8055771072 8055770955 Bacteria 6827675
1771 8055818023 8055817908 Bacteria 6609162
1772 8055883537 8055878733 Bacteria 5907058
1773 8056116464 8056115690 Bacteria 5527654
1774 8056125766 8056120720 Bacteria 5758328
1775 8056126172 8056125926 Bacteria 6228218
1776 8056131991 8056131705 Bacteria 6107031
1777 8056137530 8056137416 Bacteria 6147080
1778 8056143395 8056143049 Bacteria 6307666
1779 8056151111 8056148874 Bacteria 6479865
1780 8056160150 8056155041 Bacteria 6486948
1781 8056164020 8056161164 Bacteria 6106669
1782 8056170889 8056166840 Bacteria 5820959
1783 8056177023 8056172158 Bacteria 6133900
1784 8056182375 8056177738 Bacteria 6748268
1785 8056570888 8056569372 Bacteria 5997322
1786 8057802354 8057798959 Bacteria 6713499
1787 Ga0207713_1034368
1788 MRS2a_Contig_849
1789 SwRhRL2b_contig_2139936
1790 SwRhRL2b_contig_3821960
1791 JGI24735J21928_10002975
1792 JGI25156J39149_1001576
1793 JGI25162J39368_1003079
1794 JGI25154J39366_1001005
1795 JGI25154J39366_1003567
1796 JGI25157J39369_1000161
1797 JGI25163J39215_1001189
1798 JGI25163J39215_1001375
1799 JGI25164J39214_1001483
1800 JGI25164J39214_1001780
1801 JGI25165J46597_1002668
1802 JGI25165J46597_1003187
1803 rootH2_10034079
1804 rootL2_10118786
1805 JGI25160J50197_1000228
1806 JGI25161J50226_1000171
1807 Ga0055538_1000012
1808 Ga0055539_1000017
1809 Ga0055539_1000819
1810 Ga0055533_1000016
1811 Ga0055533_1000021
1812 Ga0055533_1000918
1813 Ga0055532_1000020
1814 Ga0055532_1000122
1815 Ga0055525_1000117
1816 Ga0055525_1000579
1817 Ga0055527_1000078
1818 Ga0055527_1004495
1819 Ga0055535_1000054
1820 Ga0055535_1000165
1821 Ga0055535_1006646
1822 Ga0055542_1001566
1823 Ga0055529_1000214
1824 Ga0055529_1000405
1825 Ga0055536_1009213
1826 Ga0055536_1009265
1827 Ga0055530_10004442
1828 Ga0055530_10004741
1829 Ga0055540_1000378
1830 Ga0055540_1003947
1831 Ga0055540_1004013
1832 Ga0055540_1014204
1833 Ga0055531_10001099
1834 Ga0055541_1000012
1835 Ga0055543_1000333
1836 Ga0065714_10007826
1837 Ga0065714_10008516
1838 Ga0065714_10009353
1839 Ga0065714_10067720
1840 Ga0065714_10069841
1841 Ga0065714_10069906
1842 Ga0065714_10111222
1843 Ga0065704_10008316
1844 Ga0065704_10071136
1845 Ga0065704_10078938
1846 Ga0065704_10102271
1847 Ga0065712_10000372
1848 Ga0065712_10081765
1849 Ga0065715_10030400
1850 Ga0070658_10003769
1851 Ga0070676_10006747
1852 Ga0070690_100004971
1853 Ga0070670_100037777
1854 Ga0070670_100051980
1855 Ga0070670_100095274
1856 Ga0068869_100017263
1857 Ga0068869_100161123
1858 Ga0068868_100023640
1859 Ga0070660_100003374
1860 Ga0070661_100000237
1861 Ga0070669_100000277
1862 Ga0070669_100014309
1863 Ga0070675_100044645
1864 Ga0070673_100003982
1865 Ga0070659_100012909
1866 Ga0070667_100244631
1867 Ga0070714_100183514
1868 Ga0070711_100021816
1869 Ga0070700_100040447
1870 Ga0070678_100132658
1871 Ga0070662_100019698
1872 Ga0070662_100020496
1873 Ga0070662_100095490
1874 Ga0070662_100133207
1875 Ga0068867_100005827
1876 Ga0068853_100000143
1877 Ga0068853_100071924
1878 Ga0070695_100106262
1879 Ga0070696_100000044
1880 Ga0070665_100001196
1881 Ga0070665_100032296
1882 Ga0070665_100293050
1883 Ga0070665_100317496
1884 Ga0068855_100001954
1885 Ga0068855_100019854
1886 Ga0068855_100045492
1887 Ga0068855_100062589
1888 Ga0068855_100121264
1889 Ga0070664_100003174
1890 Ga0070664_100025219
1891 Ga0068857_100012908
1892 Ga0068857_100125587
1893 Ga0068854_100008045
1894 Ga0068854_100069237
1895 Ga0068856_100001351
1896 Ga0068859_100294244
1897 Ga0068861_100053912
1898 Ga0068851_10000018
1899 Ga0068851_10002048
1900 Ga0068860_100155352
1901 Ga0068862_100127773
1902 Ga0075365_10005012
1903 Ga0075363_100006720
1904 Ga0075364_10030448
1905 Ga0075364_10181827
1906 Ga0075364_10183231
1907 Ga0075432_10005891
1908 Ga0075432_10010937
1909 Ga0075362_10035226
1910 Ga0075367_10073570
1911 Ga0075369_10001718
1912 Ga0075369_10034587
1913 Ga0075366_10001098
1914 Ga0075366_10069057
1915 Ga0075370_10000523
1916 Ga0075430_100010146
1917 Ga0075430_100011601
1918 Ga0075430_100046312
1919 Ga0075431_100000786
1920 Ga0075431_100011765
1921 Ga0075429_100001077
1922 Ga0075429_100050654
1923 Ga0068865_100008692
1924 Ga0075436_100155945
1925 Ga0097620_100294240
1926 Ga0099823_1016467
1927 Ga0099823_1032132
1928 Ga0079104_1005125
1929 Ga0079104_1006328
1930 Ga0079104_1024727
1931 Ga0099826_10003322
1932 Ga0105251_10000033
1933 Ga0105251_10000068
1934 Ga0105251_10000164
1935 Ga0105251_10002783
1936 Ga0105251_10010844
1937 Ga0105251_10013372
1938 Ga0105251_10015218
1939 Ga0105251_10015354
1940 Ga0105251_10019273
1941 Ga0105251_10029258
1942 Ga0105251_10033590
1943 Ga0105251_10061639
1944 Ga0105251_10062003
1945 Ga0105251_10076005
1946 Ga0105251_10083480
1947 Ga0105251_10101894
1948 Ga0105244_10000073
1949 Ga0105244_10010173
1950 Ga0105244_10016315
1951 Ga0105244_10017085
1952 Ga0105244_10022905
1953 Ga0105244_10032272
1954 Ga0105244_10034872
1955 Ga0105244_10035196
1956 Ga0105244_10036394
1957 Ga0105244_10042193
1958 Ga0105244_10044602
1959 Ga0105244_10057304
1960 Ga0105244_10057882
1961 Ga0105244_10083420
1962 Ga0105244_10094451
1963 Ga0105250_10003622
1964 Ga0105250_10009006
1965 Ga0105250_10009193
1966 Ga0105250_10009210
1967 Ga0105250_10019332
1968 Ga0105250_10025608
1969 Ga0105250_10029822
1970 Ga0105250_10033368
1971 Ga0105250_10041947
1972 Ga0105250_10057606
1973 Ga0105250_10068378
1974 Ga0105240_10001785
1975 Ga0105240_10018880
1976 Ga0105240_10047594
1977 Ga0105240_10268203
1978 Ga0105245_10060018
1979 Ga0114129_10009668
1980 Ga0114129_10015093
1981 Ga0105243_10000867
1982 Ga0105243_10017764
1983 Ga0105243_10017969
1984 Ga0105243_10079103
1985 Ga0105243_10145135
1986 Ga0105243_10163865
1987 Ga0105241_10022047
1988 Ga0105241_10029074
1989 Ga0105242_10019610
1990 Ga0105248_10030717
1991 Ga0105248_10295441
1992 Ga0105248_10314119
1993 Ga0105237_10005268
1994 Ga0105237_10006601
1995 Ga0105237_10020051
1996 Ga0105237_10253832
1997 Ga0105237_10260531
1998 Ga0105238_10016263
1999 Ga0105238_10050976
2000 Ga0105238_10060257
2001 Ga0105249_10034205
2002 Ga0105249_10174753
2003 Ga0105239_10001427
2004 Ga0105239_10013882
2005 Ga0105239_10015905
2006 Ga0105239_10183976
2007 Ga0105239_10548316
2008 Ga0105246_10011951
2009 Ga0105246_10036895
2010 Ga0105246_10075544
2011 Ga0157345_1000442
2012 Ga0157373_10006536
2013 Ga0157373_10027291
2014 Ga0157373_10027729
2015 Ga0157373_10027748
2016 Ga0157373_10028485
2017 Ga0157373_10029522
2018 Ga0157373_10082661
2019 Ga0157373_10138581
2020 Ga0157373_10150738
2021 Ga0157371_10000953
2022 Ga0157371_10024662
2023 Ga0157371_10025980
2024 Ga0157371_10190682
2025 Ga0157370_10002438
2026 Ga0157370_10018816
2027 Ga0157370_10071433
2028 Ga0157370_10104735
2029 Ga0157370_10163363
2030 Ga0157370_10282960
2031 Ga0157370_10296213
2032 Ga0157369_10000059
2033 Ga0157369_10007539
2034 Ga0157369_10022299
2035 Ga0157369_10052885
2036 Ga0157369_10056658
2037 Ga0157369_10059826
2038 Ga0157369_10060450
2039 Ga0157369_10061449
2040 Ga0157369_10114782
2041 Ga0157369_10140660
2042 Ga0157369_10318947
2043 Ga0157374_10000169
2044 Ga0157378_10281119
2045 Ga0163162_10088689
2046 Ga0163162_10334811
2047 Ga0157372_10013821
2048 Ga0157372_10053489
2049 Ga0157372_10054813
2050 Ga0157372_10068726
2051 Ga0157375_10047043
2052 Ga0157375_10060495
2053 Ga0157375_10077195
2054 Ga0157375_10104585
2055 Ga0157375_10230022
2056 Ga0163163_10048170
2057 Ga0182008_10001812
2058 Ga0182008_10009427
2059 Ga0182008_10014600
2060 Ga0182008_10014636
2061 Ga0182008_10014724
2062 Ga0182008_10015562
2063 Ga0182008_10029608
2064 Ga0182008_10033783
2065 Ga0182008_10034115
2066 Ga0182008_10050749
2067 Ga0182008_10055221
2068 Ga0182008_10074458
2069 Ga0157379_10149377
2070 Ga0182006_1000010
2071 Ga0182006_1010330
2072 Ga0182006_1013537
2073 Ga0182006_1016834
2074 Ga0182006_1017640
2075 Ga0182006_1029532
2076 Ga0182006_1055698
2077 Ga0182007_10000021
2078 Ga0182007_10008472
2079 Ga0182007_10008663
2080 Ga0182007_10008990
2081 Ga0182005_1000009
2082 Ga0182005_1003466
2083 Ga0182005_1022613
2084 Ga0182005_1028172
2085 Ga0163161_10016144
2086 Ga0163161_10026393
2087 Ga0163161_10026913
2088 Ga0163161_10027232
2089 Ga0163161_10061279
2090 Ga0163161_10078481
2091 Ga0163161_10100084
2092 Ga0163161_10129265
2093 Ga0163161_10201641
2094 Ga0163161_10211938
2095 Ga0206354_11526548
2096 Ga0206353_11725857
2097 Ga0213872_10001350
2098 Ga0213875_10008155
2099 Ga0209435_100441
2100 Ga0209760_100230
2101 Ga0209760_100611
2102 Ga0209784_100007
2103 Ga0209566_100009
2104 Ga0209674_100021
2105 Ga0209674_100041
2106 Ga0209674_100130
2107 Ga0209672_100036
2108 Ga0209672_100221
2109 Ga0209147_100009
2110 Ga0209147_100066
2111 Ga0209563_100018
2112 Ga0209563_100043
2113 Ga0209563_101799
2114 Ga0207427_100005
2115 Ga0207427_100006
2116 Ga0207427_100381
2117 Ga0209437_100013
2118 Ga0209437_100018
2119 Ga0209437_107785
2120 Ga0209258_100085
2121 Ga0209258_100237
2122 Ga0209258_100270
2123 Ga0209258_100659
2124 Ga0209646_1000157
2125 Ga0209646_1000277
2126 Ga0209026_1000006
2127 Ga0209677_100012
2128 Ga0209677_100711
2129 Ga0209677_101037
2130 Ga0209677_101090
2131 Ga0209148_1000198
2132 Ga0209759_1000194
2133 Ga0209759_1000424
2134 Ga0209759_1000691
2135 Ga0209759_1008092
2136 Ga0209759_1008780
2137 Ga0209759_1009425
2138 Ga0209233_1000021
2139 Ga0209233_1000022
2140 Ga0209455_1000195
2141 Ga0209455_1000289
2142 Ga0209130_1000440
2143 Ga0209675_1006200
2144 Ga0209676_1000015
2145 Ga0209676_1000157
2146 Ga0209676_1000222
2147 Ga0209676_1005209
2148 Ga0209676_1034513
2149 Ga0209025_1002963
2150 Ga0209758_1004418
2151 Ga0209050_1000030
2152 Ga0209050_1000061
2153 Ga0209050_1000296
2154 Ga0209050_1001068
2155 Ga0209050_1002164
2156 Ga0207426_1000428
2157 Ga0209051_1000143
2158 Ga0209051_1000295
2159 Ga0209051_1000572
2160 Ga0209051_1002845
2161 Ga0209051_1011071
2162 Ga0209257_1000422
2163 Ga0209257_1006394
2164 Ga0207656_10000009
2165 Ga0207656_10001119
2166 Ga0207656_10020296
2167 Ga0207696_1000055
2168 Ga0207696_1000127
2169 Ga0207696_1000151
2170 Ga0207696_1000165
2171 Ga0207696_1006896
2172 Ga0207696_1010951
2173 Ga0207696_1019707
2174 Ga0207696_1020824
2175 Ga0207696_1025011
2176 Ga0207696_1025475
2177 Ga0207655_1000135
2178 Ga0207655_1000548
2179 Ga0207655_1000667
2180 Ga0207655_1000754
2181 Ga0207655_1001354
2182 Ga0207655_1001521
2183 Ga0207655_1007039
2184 Ga0207655_1007611
2185 Ga0207655_1014954
2186 Ga0207655_1015759
2187 Ga0207655_1020097
2188 Ga0207655_1021272
2189 Ga0207655_1021500
2190 Ga0207655_1025941
2191 Ga0207655_1032556
2192 Ga0207655_1036360
2193 Ga0207655_1044563
2194 Ga0207655_1045529
2195 Ga0207713_1000103
2196 Ga0207713_1000126
2197 Ga0207713_1000325
2198 Ga0207713_1000716
2199 Ga0207713_1011815
2200 Ga0207713_1013444
2201 Ga0207713_1013814
2202 Ga0207713_1014219
2203 Ga0207713_1018465
2204 Ga0207713_1025165
2205 Ga0207713_1025439
2206 Ga0207713_1031704
2207 Ga0207713_1039008
2208 Ga0207713_1041563
2209 Ga0207647_10000091
2210 Ga0207647_10000272
2211 Ga0207647_10001804
2212 Ga0207645_10011652
2213 Ga0207705_10002361
2214 Ga0207705_10086015
2215 Ga0207695_10003498
2216 Ga0207695_10010947
2217 Ga0207695_10096044
2218 Ga0207695_10112070
2219 Ga0207695_10138817
2220 Ga0207671_10000876
2221 Ga0207671_10003791
2222 Ga0207671_10015444
2223 Ga0207657_10004644
2224 Ga0207657_10205738
2225 Ga0207649_10000007
2226 Ga0207681_10000291
2227 Ga0207681_10001552
2228 Ga0207694_10001660
2229 Ga0207694_10041592
2230 Ga0207694_10112983
2231 Ga0207650_10000308
2232 Ga0207650_10000407
2233 Ga0207650_10016920
2234 Ga0207659_10022325
2235 Ga0207700_10110379
2236 Ga0207664_10126972
2237 Ga0207644_10009545
2238 Ga0207690_10011023
2239 Ga0207706_10000050
2240 Ga0207706_10016345
2241 Ga0207706_10045896
2242 Ga0207706_10162278
2243 Ga0207686_10160735
2244 Ga0207709_10000107
2245 Ga0207709_10007573
2246 Ga0207709_10008362
2247 Ga0207709_10092703
2248 Ga0207689_10010915
2249 Ga0207689_10173882
2250 Ga0207679_10000013
2251 Ga0207679_10009846
2252 Ga0207679_10080874
2253 Ga0207667_10000379
2254 Ga0207667_10046021
2255 Ga0207667_10124367
2256 Ga0207667_10217556
2257 Ga0207651_10004392
2258 Ga0207712_10001134
2259 Ga0207712_10066761
2260 Ga0207640_10003822
2261 Ga0207640_10067306
2262 Ga0207640_10125902
2263 Ga0207658_10006370
2264 Ga0207677_10007314
2265 Ga0207639_10000079
2266 Ga0207639_10011033
2267 Ga0207678_10001000
2268 Ga0207678_10173025
2269 Ga0207702_10014223
2270 Ga0207648_10013130
2271 Ga0207648_10181471
2272 Ga0207674_10033449
2273 Ga0207674_10036724
2274 Ga0207674_10053121
2275 Ga0207675_100029012
2276 Ga0207683_10032577
2277 Ga0207683_10151050
2278 Ga0209281_1000091
2279 Ga0209281_1003801
2280 Ga0209281_1011417
2281 Ga0209281_1012731
2282 Ga0209389_1000065
2283 Ga0209389_1021659
2284 Ga0209371_1000073
2285 Ga0209371_1000775
2286 Ga0209969_1000072
2287 Ga0209967_1003726
2288 Ga0209981_1000108
2289 Ga0209996_1004305
2290 Ga0210000_1000423
2291 Ga0209995_1001435
2292 Ga0209968_1003403
2293 Ga0209999_1000212
2294 Ga0209983_1001173
2295 Ga0209983_1006675
2296 Ga0209971_1001954
2297 Ga0209966_1009664
2298 Ga0209974_10009674
2299 Ga0209974_10010740
2300 Ga0207428_10060798
2301 Ga0207428_10074405
2302 Ga0207428_10144090
2303 Ga0207428_10151253
2304 Ga0207428_10175230
2305 Ga0207428_10193243
2306 Ga0268266_10000006
2307 Ga0268266_10017690
2308 Ga0268264_10032366
2309 Ga0268264_10285339
2310 Ga0265336_10000189
2311 Ga0307515_10000104
2312 Ga0307515_10005049
2313 Ga0307515_10005461
2314 Ga0307515_10037602
2315 Ga0265338_10107072
2316 Ga0265324_10000255
2317 Ga0268256_1000247
2318 Ga0268256_1001404
2319 Ga0307511_10030120
2320 Ga0314311_1025917
2321 Ga0316178_1123526
2322 Ga0316183_1118649
2323 Ga0316183_1178545
2324 Ga0265332_10006593
2325 Ga0265329_10027195
2326 Ga0265340_10011527
2327 Ga0265339_10000801
2328 Ga0265316_10040536
2329 Ga0307513_10000034
2330 Ga0307513_10002789
2331 Ga0307513_10030775
2332 Ga0307509_10003313
2333 Ga0307408_100000028
2334 Ga0307408_100000338
2335 Ga0307408_100026625
2336 Ga0307408_100036015
2337 Ga0307408_100056151
2338 Ga0307408_100119184
2339 Ga0265313_10000307
2340 Ga0307514_10003090
2341 Ga0265342_10000100
2342 Ga0307516_10000897
2343 Ga0307516_10006945
2344 Ga0307516_10009346
2345 Ga0307516_10013621
2346 Ga0307516_10050576
2347 Ga0307516_10050777
2348 Ga0307405_10013526
2349 Ga0307405_10015744
2350 Ga0307405_10016560
2351 Ga0307405_10059682
2352 Ga0307413_10079353
2353 Ga0307413_10084560
2354 Ga0307413_10125521
2355 Ga0307410_10145750
2356 Ga0307406_10106134
2357 Ga0307412_10018660
2358 Ga0307412_10020551
2359 Ga0307412_10020661
2360 Ga0307412_10023350
2361 Ga0307412_10041635
2362 Ga0307412_10058169
2363 Ga0307409_100025004
2364 Ga0307409_100070387
2365 Ga0307416_100016949
2366 Ga0307416_100025732
2367 Ga0307416_100146046
2368 Ga0307414_10006140
2369 Ga0307414_10023837
2370 Ga0307414_10056148
2371 Ga0307411_10017935
2372 Ga0307411_10053502
2373 Ga0307411_10236690
2374 Ga0307510_10054664
2375 Ga0373926_0025936
2376 Ga0373931_0000552
2377 Ga0373927_0020208
2378 Ga0373927_0075028
2379 Ga0395899_0000036
2380 Ga0395899_0000714
2381 Ga0395899_0018524
2382 Ga0395900_0000071
2383 Ga0395900_0036795
2384 Ga0395900_0109555
2385 Ga0395900_0116347
2386 Ga0395898_0000115
2387 Ga0395898_0012451
2388 Ga0395898_0085204
2389 Ga0395898_0096604
2390 Ga0395905_0001506
2391 Ga0436364_1525509
2392 Ga0395901_0000004
2393 Ga0395901_0001368
2394 Ga0395901_0158453
2395 Ga0436361_0466601
2396 Ga0436361_1053838
2397 Ga0439436_0000225
2398 Ga0439438_002200
2399 Ga0439438_004067
2400 Ga0439438_005970
2401 Ga0439438_005973
2402 Ga0439438_006320
2403 Ga0439438_006365
2404 Ga0439438_006499
2405 Ga0439438_006519
2406 Ga0439438_006743
2407 Ga0439438_006761
2408 Ga0439438_006831
2409 Ga0439438_014045
2410 Ga0439438_022521
2411 Ga0439439_0030447
2412 Ga0439447_002459
2413 Ga0439447_003125
2414 Ga0439447_004709
2415 Ga0439447_005458
2416 Ga0439447_009499
2417 Ga0439447_014228
2418 Ga0439447_020490
2419 Ga0439447_025009
2420 Ga0439466_0000796
2421 Ga0439466_0004708
2422 Ga0439466_0005092
2423 Ga0439466_0007368
2424 Ga0439466_0009753
2425 Ga0439466_0013980
2426 Ga0439466_0020978
2427 Ga0439466_0026003
2428 Ga0439466_0032009
2429 Ga0439466_0033250
2430 Ga0439466_0038739
2431 Ga0439465_0025204
2432 Ga0439465_0043143
2433 Ga0451839_1109028
2434 Ga0451853_0711122
2435 Ga0439431_0003906
2436 Ga0439431_0012654
2437 Ga0439445_0013584
2438 Ga0439445_0018474
2439 Ga0439448_0000581
2440 Ga0439432_001654
2441 Ga0439432_005913
2442 Ga0439432_006204
2443 Ga0439432_006953
2444 Ga0439432_007015
2445 Ga0439432_010771
2446 Ga0439432_017464
2447 Ga0439449_0000464
2448 Ga0439449_0005192
2449 Ga0439451_003295
2450 Ga0439451_006019
2451 Ga0439451_008503
2452 Ga0439452_000130
2453 Ga0439452_003722
2454 Ga0439452_005386
2455 Ga0439452_005491
2456 Ga0439452_005745
2457 Ga0439452_009541
2458 Ga0439452_011783
2459 Ga0439452_012672
2460 Ga0439452_019181
2461 Ga0439452_023796
2462 Ga0439452_029483
2463 Ga0439456_000036
2464 Ga0439456_001886
2465 Ga0439456_002202
2466 Ga0439456_010498
2467 Ga0439456_015419
2468 Ga0439456_016827
2469 Ga0439456_017209
2470 Ga0439462_0001819
2471 Ga0439463_001273
2472 Ga0439463_001697
2473 Ga0439463_002033
2474 Ga0439463_008109
2475 Ga0439463_014299
2476 Ga0439463_017672
2477 Ga0439463_022200
2478 Ga0439463_022382
2479 Ga0450911_000027
2480 Ga0450911_002156
2481 Ga0450911_005048
2482 Ga0450919_002076
2483 Ga0450922_001625
2484 Ga0450923_009272
2485 Ga0450890_003479
2486 Ga0450898_011868
2487 Ga0450902_001681
2488 Ga0450903_008964
2489 Ga0450904_000135
2490 Ga0450904_001911
2491 Ga0450905_000251
2492 Ga0450906_009115
2493 Ga0450907_000328
2494 Ga0450907_012909
2495 Ga0450910_000604
2496 Ga0450910_002175
2497 Ga0450910_003725
2498 Ga0439446_0000014
2499 Ga0439446_0021432
2500 Ga0450908_008616
2501 Ga0450909_001936
2502 Ga0450909_005675
2503 Ga0439434_0002300
2504 Ga0439464_0020896
2505 Ga0439460_0002952
2506 Ga0450916_000275
2507 Ga0450901_002167
2508 Ga0451577_0014309
2509 Ga0451577_0024496
2510 Ga0451577_0026154
2511 Ga0439440_0001756
2512 Ga0439440_0015796
2513 Ga0466969_0011303
2514 Ga0466972_0012303
2515 Ga0453683_0000328
2516 Ga0453683_0004904
2517 Ga0453683_0007818
2518 Ga0466965_0000089
2519 Ga0466965_0018474
2520 Ga0466965_0029001
2521 Ga0466966_0000011
2522 Ga0466966_0001297
2523 Ga0466966_0006083
2524 Ga0466966_0007670
2525 Ga0466966_0051452
2526 Ga0466961_0000210
2527 Ga0466961_0000372
2528 Ga0466961_0055685
2529 Ga0466963_0002174
2530 Ga0466963_0002861
2531 Ga0466963_0004620
2532 Ga0466964_0007901
2533 Ga0466964_0023540
2534 Ga0453684_0334467
2535 Ga0466971_0002989
2536 Ga0466971_0027909
2537 Ga0466968_0003337
2538 Ga0466968_0022741
2539 Ga0466970_0017932
2540 Ga0466957_0005059
2541 Ga0466957_0008447
2542 Ga0466957_0015152
2543 Ga0466959_0001660
2544 Ga0466959_0001900
2545 Ga0466959_0005828
2546 Ga0466959_0011539
2547 Ga0451576_0000695
2548 Ga0451576_0009989
2549 Ga0451576_0301730
2550 Ga0466958_0002609
2551 Ga0466958_0014114
2552 Ga0466958_0016177
2553 Ga0466967_0032689
2554 Ga0466967_0115853
2555 Ga0495617_006004
2556 Ga0495617_015682
2557 Ga0495617_026342
2558 Ga0495627_000115
2559 Ga0495627_000869
2560 Ga0495627_004307
2561 Ga0495627_008096
2562 Ga0495627_022986
2563 Ga0495627_023468
2564 Ga0495627_027309
2565 Ga0495627_029811
2566 Ga0495603_0003108
2567 Ga0495590_0014737
2568 Ga0495590_0033615
2569 Ga0495590_0033893
2570 Ga0495590_0044684
2571 Ga0495591_000061
2572 Ga0495591_000334
2573 Ga0495591_000628
2574 Ga0495591_002793
2575 Ga0495591_004212
2576 Ga0495591_006168
2577 Ga0495591_008800
2578 Ga0495591_009192
2579 Ga0495591_019015
2580 Ga0495591_023045
2581 Ga0495591_023079
2582 Ga0495591_026451
2583 Ga0495591_030832
2584 Ga0495591_031082
2585 Ga0495591_040254
2586 Ga0495629_0004392
2587 Ga0495629_0063569
2588 Ga0495638_0022540
2589 Ga0495638_0023306
2590 Ga0495638_0024472
2591 Ga0495638_0075785
2592 Ga0495638_0078804
2593 Ga0495638_0078998
2594 Ga0495638_0092394
2595 Ga0495638_0093145
2596 Ga0495638_0094204
2597 Ga0495638_0098647
2598 Ga0495638_0102624
2599 Ga0495638_0105579
2600 Ga0495653_0008489
2601 Ga0495653_0029892
2602 Ga0495653_0061267
2603 Ga0495653_0080332
2604 Ga0495653_0099975
2605 Ga0495653_0171227
2606 Ga0495650_0001603
2607 Ga0495650_0006532
2608 Ga0495650_0015289
2609 Ga0495650_0032641
2610 Ga0495650_0039947
2611 Ga0495650_0044138
2612 Ga0495650_0044202
2613 Ga0495650_0047490
2614 Ga0495580_0002591
2615 Ga0495605_0000376
2616 Ga0495605_0000441
2617 Ga0495605_0001221
2618 Ga0495605_0004763
2619 Ga0495605_0010819
2620 Ga0495605_0016196
2621 Ga0495605_0030882
2622 Ga0495605_0047069
2623 Ga0495605_0047337
2624 Ga0495639_0009832
2625 Ga0495639_0058928
2626 Ga0495639_0087005
2627 Ga0495662_0063874
2628 Ga0495664_0005113
2629 Ga0495584_0007969
2630 Ga0495584_0011920
2631 Ga0495584_0013290
2632 Ga0495584_0017193
2633 Ga0495584_0029322
2634 Ga0495584_0036252
2635 Ga0495584_0038208
2636 Ga0495584_0043553
2637 Ga0495584_0046847
2638 Ga0495584_0046957
2639 Ga0495584_0048906
2640 Ga0495584_0050134
2641 Ga0495584_0054077
2642 Ga0495584_0097176
2643 Ga0495584_0103246
2644 Ga0495585_0009776
2645 Ga0495585_0010924
2646 Ga0495585_0018037
2647 Ga0495585_0025281
2648 Ga0495585_0038450
2649 Ga0495585_0055565
2650 Ga0495585_0066260
2651 Ga0495585_0073689
2652 Ga0495585_0075512
2653 Ga0495585_0077657
2654 Ga0495585_0083679
2655 Ga0495594_0032304
2656 Ga0495594_0092949
2657 Ga0495594_0115021
2658 Ga0495596_0004405
2659 Ga0495596_0036356
2660 Ga0495607_0000147
2661 Ga0495607_0000560
2662 Ga0495607_0000747
2663 Ga0495607_0000751
2664 Ga0495607_0002973
2665 Ga0495607_0005110
2666 Ga0495607_0008448
2667 Ga0495607_0012768
2668 Ga0495607_0017578
2669 Ga0495607_0019645
2670 Ga0495607_0020345
2671 Ga0495607_0028688
2672 Ga0495607_0039642
2673 Ga0495607_0068672
2674 Ga0495607_0073646
2675 Ga0495607_0082298
2676 Ga0495607_0093523
2677 Ga0495607_0100249
2678 Ga0495607_0101689
2679 Ga0495583_0000026
2680 Ga0495583_0000982
2681 Ga0495583_0001389
2682 Ga0495583_0002607
2683 Ga0495583_0004827
2684 Ga0495583_0008616
2685 Ga0495583_0011202
2686 Ga0495583_0014011
2687 Ga0495583_0032658
2688 Ga0495583_0041375
2689 Ga0495583_0045315
2690 Ga0495583_0049252
2691 Ga0495606_0002457
2692 Ga0495606_0003787
2693 Ga0495606_0013422
2694 Ga0495606_0017724
2695 Ga0495606_0018538
2696 Ga0495606_0026516
2697 Ga0495606_0027667
2698 Ga0495606_0048978
2699 Ga0495606_0055877
2700 Ga0495606_0075474
2701 Ga0495606_0089461
2702 Ga0495606_0151900
2703 Ga0495610_0012579
2704 Ga0495610_0017395
2705 Ga0495610_0018009
2706 Ga0495610_0018310
2707 Ga0495610_0018603
2708 Ga0495610_0027084
2709 Ga0495610_0028281
2710 Ga0495610_0041045
2711 Ga0495610_0047716
2712 Ga0495610_0051602
2713 Ga0495610_0054732
2714 Ga0495610_0057025
2715 Ga0495610_0059534
2716 Ga0495610_0082899
2717 Ga0495616_0000142
2718 Ga0495616_0015223
2719 Ga0495616_0015419
2720 Ga0495616_0018889
2721 Ga0495616_0024783
2722 Ga0495616_0049565
2723 Ga0495616_0056753
2724 Ga0495616_0066637
2725 Ga0495616_0079572
2726 Ga0495616_0089808
2727 Ga0495616_0097141
2728 Ga0495620_0000023
2729 Ga0495620_0000044
2730 Ga0495620_0002605
2731 Ga0495620_0006293
2732 Ga0495620_0009524
2733 Ga0495620_0013688
2734 Ga0495620_0036857
2735 Ga0495620_0038162
2736 Ga0495620_0053525
2737 Ga0495620_0063387
2738 Ga0495620_0076852
2739 Ga0495628_0031861
2740 Ga0495630_0028475
2741 Ga0495631_0007171
2742 Ga0495631_0012421
2743 Ga0495631_0041225
2744 Ga0495631_0044370
2745 Ga0495631_0055248
2746 Ga0495631_0067726
2747 Ga0495632_0005847
2748 Ga0495632_0010414
2749 Ga0495632_0011851
2750 Ga0495632_0013667
2751 Ga0495632_0015691
2752 Ga0495632_0016106
2753 Ga0495632_0032798
2754 Ga0495632_0045169
2755 Ga0495632_0054798
2756 Ga0495632_0066415
2757 Ga0495637_0000054
2758 Ga0495637_0000413
2759 Ga0495637_0011527
2760 Ga0495637_0012548
2761 Ga0495637_0012885
2762 Ga0495637_0022910
2763 Ga0495637_0038884
2764 Ga0495637_0043911
2765 Ga0495637_0044315
2766 Ga0495637_0044359
2767 Ga0495637_0054890
2768 Ga0495637_0055616
2769 Ga0495637_0057727
2770 Ga0495637_0062604
2771 Ga0495637_0070966
2772 Ga0495637_0074560
2773 Ga0495643_0001170
2774 Ga0495643_0018356
2775 Ga0495643_0040895
2776 Ga0495643_0046599
2777 Ga0495643_0062808
2778 Ga0495643_0067463
2779 Ga0495643_0067927
2780 Ga0495643_0073669
2781 Ga0495643_0076012
2782 Ga0495643_0082803
2783 Ga0495643_0119928
2784 Ga0495644_0000073
2785 Ga0495644_0004602
2786 Ga0495644_0007318
2787 Ga0495644_0043914
2788 Ga0495644_0050875
2789 Ga0495648_0002643
2790 Ga0495648_0008018
2791 Ga0495648_0010343
2792 Ga0495648_0039878
2793 Ga0495648_0046294
2794 Ga0495648_0066508
2795 Ga0495648_0067831
2796 Ga0495648_0069193
2797 Ga0495648_0077765
2798 Ga0495648_0080760
2799 Ga0495648_0082312
2800 Ga0495648_0093583
2801 Ga0495648_0104308
2802 Ga0495648_0127291
2803 Ga0495663_0007818
2804 Ga0495666_0046488
2805 Ga0495666_0047827
2806 Ga0495642_0002807
2807 Ga0495642_0017035
2808 Ga0495642_0040885
2809 Ga0495654_0001880
2810 Ga0495654_0008381
2811 Ga0495654_0010756
2812 Ga0495654_0014479
2813 Ga0495654_0014495
2814 Ga0495654_0015724
2815 Ga0495654_0043479
2816 Ga0495654_0046064
2817 Ga0495654_0050913
2818 Ga0495654_0058995
2819 Ga0495654_0066385
2820 Ga0495654_0085616
2821 Ga0495654_0086248
2822 Ga0495665_0000097
2823 Ga0495586_0048419
2824 Ga0495587_0020663
2825 Ga0495587_0078831
2826 Ga0495609_0000061
2827 Ga0495609_0000072
2828 Ga0495609_0000319
2829 Ga0495609_0000696
2830 Ga0495609_0003794
2831 Ga0495609_0012217
2832 Ga0495609_0014792
2833 Ga0495609_0037331
2834 Ga0495609_0049867
2835 Ga0495597_0001045
2836 Ga0495597_0003533
2837 Ga0495597_0011999
2838 Ga0495597_0020850
2839 Ga0495597_0038336
2840 Ga0495597_0044786
2841 Ga0495597_0044929
2842 Ga0495597_0047212
2843 Ga0495597_0052910
2844 Ga0495597_0065152
2845 Ga0495597_0077054
2846 Ga0495645_0001036
2847 Ga0495645_0125890
2848 Ga0495622_0000333
2849 Ga0495622_0003058
2850 Ga0495622_0006951
2851 Ga0495622_0010948
2852 Ga0495622_0023881
2853 Ga0495622_0037064
2854 Ga0495622_0045602
2855 Ga0495622_0047677
2856 Ga0495633_0000440
2857 Ga0495633_0000751
2858 Ga0495633_0005273
2859 Ga0495633_0043315
2860 Ga0495633_0043350
2861 Ga0495633_0047399
2862 Ga0495656_0002308
2863 Ga0495656_0007984
2864 Ga0495668_0010518
2865 Ga0495668_0018713
2866 Ga0495668_0048554
2867 Ga0495668_0053228
2868 Ga0495668_0062419
2869 Ga0495634_0138130
2870 Ga0495634_0162821
2871 Ga0495611_0000240
2872 Ga0495611_0002469
2873 Ga0495611_0009450
2874 Ga0495611_0010041
2875 Ga0495611_0057174
2876 Ga0495611_0090096
2877 Ga0495625_0000147
2878 Ga0495625_0003060
2879 Ga0495625_0016733
2880 Ga0495625_0030491
2881 Ga0495625_0095515
2882 Ga0495625_0146846
2883 Ga0495625_0159957
2884 Ga0495635_0006331
2885 Ga0495635_0025955
2886 Ga0495659_0002449
2887 Ga0495659_0061635
2888 Ga0495661_0000153
2889 Ga0495661_0000431
2890 Ga0495661_0000484
2891 Ga0495661_0000660
2892 Ga0495661_0003901
2893 Ga0495661_0012702
2894 Ga0495661_0023222
2895 Ga0495661_0025128
2896 Ga0495661_0031039
2897 Ga0495661_0067831
2898 Ga0495661_0086915
2899 Ga0495661_0100080
2900 Ga0495661_0105585
2901 Ga0495661_0133101
2902 Ga0495588_0011744
2903 Ga0495599_0180010
2904 Ga0495623_0012745
2905 Ga0495623_0069958
2906 Ga0495646_0031424
2907 Ga0495646_0069808
2908 Ga0495646_0095329
2909 Ga0495624_0126599
2910 Ga0495670_0004546
2911 Ga0495670_0008702
2912 Ga0495670_0014047
2913 Ga0495670_0022166
2914 Ga0495670_0047232
2915 Ga0495671_0004757
2916 Ga0495671_0006442
2917 Ga0495671_0007024
2918 Ga0495671_0009068
2919 Ga0495671_0013844
2920 Ga0495671_0022357
2921 Ga0495671_0024308
2922 Ga0495671_0029148
2923 Ga0495671_0039652
2924 Ga0495671_0050532
2925 Ga0495671_0054888
2926 Ga0495671_0057248
2927 Ga0495649_0002836
2928 Ga0495649_0003588
2929 Ga0495649_0006508
2930 Ga0495649_0010921
2931 Ga0495649_0048043
2932 Ga0495649_0049506
2933 Ga0495649_0056397
2934 Ga0495649_0057437
2935 Ga0495649_0064347
2936 Ga0495649_0069988
2937 Ga0495649_0085131
2938 Ga0495649_0098691
2939 Ga0495649_0106350
2940 Ga0495589_0002215
2941 Ga0495589_0010176
2942 Ga0495589_0012870
2943 Ga0495589_0045870
2944 Ga0495589_0056638
2945 Ga0495589_0065124
2946 Ga0495589_0066388
2947 Ga0495589_0073000
2948 Ga0495589_0084317
2949 Ga0495589_0103083
2950 Ga0495600_0008635
2951 Ga0495660_0001480
2952 Ga0495660_0007766
2953 Ga0495660_0010281
2954 Ga0495660_0016142
2955 Ga0495660_0019012
2956 Ga0495660_0036001
2957 Ga0495660_0038266
2958 Ga0495660_0053872
2959 Ga0495660_0060722
2960 Ga0495660_0062417
2961 Ga0495660_0092957
2962 Ga0495660_0103358
2963 Ga0495660_0113690
2964 Ga0495581_0079890
2965 Ga0495604_0012826
2966 Ga0495604_0031336
2967 Ga0495604_0155962
2968 Ga0495636_0026013
2969 Ga0495674_0038521
2970 Ga0495674_0072930
2971 Ga0495672_0004589
2972 Ga0495672_0020526
2973 Ga0495672_0020530
2974 Ga0495672_0021121
2975 Ga0495672_0021797
2976 Ga0495672_0023164
2977 Ga0495672_0034599
2978 Ga0495672_0036067
2979 Ga0495672_0039194
2980 Ga0495672_0044487
2981 Ga0495672_0044887
2982 Ga0495672_0058028
2983 Ga0495672_0058215
2984 Ga0495672_0070869
2985 Ga0495672_0085494
2986 Ga0495672_0086434
2987 Ga0495676_0000027
2988 Ga0495676_0101317
2989 Ga0495676_0111832
2990 Ga0495676_0196861
2991 Ga0495680_0005310
2992 Ga0495680_0021752
2993 Ga0495680_0094617
2994 Ga0495680_0160567
2995 Ga0495683_0000038
2996 Ga0495683_0000236
2997 Ga0495683_0026155
2998 Ga0495683_0054234
2999 Ga0495683_0057883
3000 Ga0495683_0058778
3001 Ga0495683_0090854
3002 Ga0495683_0091691
3003 Ga0495687_000313
3004 Ga0495687_001285
3005 Ga0495687_028574
3006 Ga0495675_0019492
3007 Ga0495675_0060569
3008 Ga0495677_0000306
3009 Ga0495677_0002657
3010 Ga0495677_0006896
3011 Ga0495677_0037663
3012 Ga0495679_000237
3013 Ga0495679_001014
3014 Ga0495679_008506
3015 Ga0495679_009276
3016 Ga0495679_022332
3017 Ga0495679_024389
3018 Ga0495679_042006
3019 Ga0495679_042152
3020 Ga0495679_042553
3021 Ga0495685_000137
3022 Ga0495673_0001349
3023 Ga0495673_0001927
3024 Ga0495673_0001940
3025 Ga0495673_0007883
3026 Ga0495673_0010029
3027 Ga0495673_0012515
3028 Ga0495673_0013763
3029 Ga0495673_0014316
3030 Ga0495673_0014628
3031 Ga0495673_0024354
3032 Ga0495673_0047341
3033 Ga0495673_0053617
3034 Ga0495673_0063135
3035 Ga0495673_0077477
3036 Ga0495681_0002342
3037 Ga0495681_0016470
3038 Ga0495681_0018386
3039 Ga0495681_0033419
3040 Ga0495681_0035876
3041 Ga0495681_0036459
3042 Ga0495681_0037450
3043 Ga0495681_0051002
3044 Ga0495681_0051820
3045 Ga0495681_0055715
3046 Ga0495681_0056572
3047 Ga0495681_0066009
3048 Ga0495681_0070867
3049 Ga0495681_0087960
3050 Ga0495686_0000038
3051 Ga0495686_0013850
3052 Ga0495686_0063352
3053 Ga0495686_0068931
3054 Ga0495686_0094336
3055 Ga0495686_0134630
3056 Ga0495593_0000787
3057 Ga0495593_0030746
3058 Ga0495593_0103612
3059 Ga0495602_0022153
3060 Ga0495602_0182038
3061 Ga0495626_0000067
3062 Ga0495626_0006113
3063 Ga0495626_0006151
3064 Ga0495626_0012561
3065 Ga0495626_0014232
3066 Ga0495626_0038567
3067 Ga0495626_0040115
3068 Ga0495626_0045210
3069 Ga0495626_0062218
3070 Ga0495626_0067327
3071 Ga0496100_0073402
3072 Ga0496100_0084686
3073 Ga0496102_0043863
3074 Ga0496102_0063586
3075 Ga0496102_0072694
3076 Ga0496102_0102866
3077 Ga0496104_0031916
3078 Ga0496104_0123590
3079 Ga0496105_0000815
3080 Ga0496105_0085943
3081 Ga0496107_0048629
3082 Ga0496110_0068866
3083 Ga0496112_0069194
3084 Ga0496112_0225136
3085 Ga0496112_0283605
3086 Ga0496113_0013329
3087 Ga0496114_0017622
3088 Ga0496114_0184803
3089 Ga0496115_0050225
3090 Ga0496115_0099054
3091 Ga0496116_0010833
3092 Ga0496116_0018891
3093 Ga0496116_0019033
3094 Ga0496116_0021261
3095 Ga0496116_0027285
3096 Ga0496116_0068314
3097 Ga0496116_0071568
3098 Ga0496116_0087093
3099 Ga0496116_0098844
3100 Ga0496117_0000010
3101 Ga0496117_0003366
3102 Ga0496117_0005310
3103 Ga0496117_0012326
3104 Ga0496117_0017657
3105 Ga0496117_0018561
3106 Ga0496117_0021375
3107 Ga0496117_0036019
3108 Ga0496117_0041901
3109 Ga0496117_0065170
3110 Ga0496117_0086704
3111 Ga0496117_0118446
3112 Ga0496117_0123064
3113 Ga0496117_0142633
3114 Ga0496118_0000009
3115 Ga0496118_0006189
3116 Ga0496118_0018449
3117 Ga0496118_0047077
3118 Ga0496118_0052825
3119 Ga0496118_0053499
3120 Ga0496118_0056677
3121 Ga0496118_0072522
3122 Ga0496118_0075320
3123 Ga0496118_0102993
3124 Ga0496118_0104470
3125 Ga0496118_0122374
3126 Ga0496118_0143486
3127 Ga0496119_0000704
3128 Ga0496119_0039239
3129 Ga0496119_0091843
3130 Ga0496119_0119688
3131 Ga0496120_0010286
3132 Ga0496120_0014369
3133 Ga0496120_0095490
3134 Ga0496120_0098621
3135 Ga0496121_0003788
3136 Ga0496121_0004345
3137 Ga0496121_0005540
3138 Ga0496121_0027165
3139 Ga0496121_0036800
3140 Ga0496121_0057144
3141 Ga0496121_0068129
3142 Ga0496121_0071640
3143 Ga0496121_0115269
3144 Ga0496121_0117093
3145 Ga0496121_0127966
3146 Ga0496121_0130009
3147 Ga0496121_0151242
3148 Ga0496122_0000079
3149 Ga0496122_0000517
3150 Ga0496122_0000890
3151 Ga0496122_0002629
3152 Ga0496122_0023593
3153 Ga0496122_0033075
3154 Ga0496122_0035281
3155 Ga0496122_0048232
3156 Ga0496122_0052604
3157 Ga0496122_0075993
3158 Ga0496122_0077637
3159 Ga0496122_0088531
3160 Ga0496122_0099104
3161 Ga0496122_0126604
3162 Ga0496123_0000073
3163 Ga0496123_0000243
3164 Ga0496123_0001424
3165 Ga0496123_0004921
3166 Ga0496123_0011862
3167 Ga0496123_0028664
3168 Ga0496123_0055107
3169 Ga0496123_0059953
3170 Ga0496123_0086238
3171 Ga0496123_0089243
3172 Ga0496124_0000511
3173 Ga0496124_0025306
3174 Ga0496124_0034546
3175 Ga0496124_0038300
3176 Ga0496124_0038315
3177 Ga0496124_0081795
3178 Ga0496124_0093927
3179 Ga0496124_0101317
3180 Ga0496124_0133275
3181 Ga0496124_0164269
3182 Ga0496124_0169101
3183 Ga0496124_0170017
3184 Ga0496125_0002177
3185 Ga0496125_0005766
3186 Ga0496125_0038819
3187 Ga0496125_0039957
3188 Ga0496125_0040272
3189 Ga0496125_0077667
3190 Ga0496125_0098581
3191 Ga0496125_0109797
3192 Ga0496125_0140093
3193 Ga0496125_0167344
3194 Ga0496126_0000838
3195 Ga0496126_0044107
3196 Ga0496126_0045063
3197 Ga0496126_0196546
3198 Ga0496126_0224693
3199 Ga0495678_000054
3200 Ga0495678_000078
3201 Ga0495678_010708
3202 Ga0495678_011987
3203 Ga0495678_028649
3204 Ga0495678_030698
3205 Ga0495678_039949
3206 Ga0495678_042583
3207 Ga0495678_063478
3208 Ga0495678_068624
3209 Ga0495682_0000069
3210 Ga0495682_0003335
3211 Ga0495682_0003684
3212 Ga0495682_0028634
3213 Ga0501031_0005889
3214 Ga0501031_0058010
3215 Ga0501032_0000449
3216 Ga0501033_0001574
3217 Ga0501033_0092876
3218 Ga0501034_0000164
3219 Ga0501034_0007896
3220 Ga0501034_0023202
3221 Ga0501034_0229789
3222 Ga0501036_0001261
3223 Ga0501037_0001265
3224 Ga0501037_0066044
3225 Ga0501038_0012053
3226 Ga0501039_0064436
3227 Ga0501039_0104851
3228 Ga0501040_0000307
3229 Ga0501040_0001449
3230 Ga0501041_0034738
3231 Ga0501042_0000603
3232 Ga0501043_0003265
3233 Ga0501046_0001788
3234 Ga0501047_0003908
3235 Ga0501076_0020900
3236 Ga0501077_0083312
3237 Ga0501222_007907
3238 Ga0501235_023389
3239 Ga0501240_008426
3240 Ga0501079_0012489
3241 Ga0501079_0050515
3242 Ga0501081_0002881
3243 Ga0501241_004320
3244 Ga0501262_007974
3245 Ga0501269_002975
3246 Ga0501282_000230
3247 Ga0501035_0185893
3248 Ga0501044_0120768
3249 Ga0501045_0008665
3250 Ga0501226_000348
3251 nmdc:mga03683_41472_c1
3252 nmdc:mga00v17_154487_c1
3253 nmdc:mga0k408_107519_c1
3254 nmdc:mga0k408_272_c2
3255 nmdc:mga0k408_59276_c1
3256 nmdc:mga0k408_7263_c2
3257 nmdc:mga07m45_10124_c1
3258 nmdc:mga07m45_136_c1
3259 nmdc:mga07m45_37979_c1
3260 nmdc:mga07m45_55694_c1
3261 nmdc:mga05p37_24610_c1
3262 nmdc:mga05p37_75674_c1
3263 nmdc:mga09592_20902_c1
3264 nmdc:mga09592_365_c1
3265 nmdc:mga0qj67_112046_c1
3266 nmdc:mga0qj67_15012_c1
3267 nmdc:mga0qj67_7700_c1
3268 nmdc:mga06r32_112366_c1
3269 nmdc:mga06r32_25761_c1
3270 nmdc:mga08y16_237961_c1
3271 nmdc:mga0sz30_14524_c1
3272 Ga0500635_0000210
3273 Ga0495619_0027728
3274 Ga0500644_0003052
3275 Ga0500572_013953
3276 Ga0500595_000950
3277 Ga0500618_002869
3278 Ga0500618_003991
3279 Ga0500559_0076107
3280 Ga0500573_0088086
3281 Ga0500590_007334
3282 Ga0500619_003055
3283 Ga0500634_0015573
3284 Ga0500587_000416
3285 Ga0501084_0001517
3286 Ga0500661_002235
3287 Ga0501082_0013114
3288 Ga0466962_0003526
3289 Ga0466962_0005762
3290 Ga0466962_0010726
3291 Ga0466962_0112944
3292 Ga0530510_0138360
3293 2511246917
3294 2511253735
3295 2511264687
3296 2511273726
3297 2511279643
3298 2511289598
3299 2511294698
3300 2511298841
3301 2511317061
3302 2511322157
3303 2511324578
3304 2511332314
3305 2511337755
3306 2511347348
3307 2511352476
3308 2511359234
3309 2511360727
3310 2511368853
3311 2511376680
3312 2511412356
3313 2511822129
3314 2512035257
3315 2512325200
3316 2515689207
3317 2516022186
3318 2523107502
3319 2554812815
3320 2555245343
3321 2555667058
3322 2563062658
3323 2574433309
3324 2583152962
3325 2583795298
3326 2597855310
3327 2597861309
3328 2597867056
3329 2599104457
3330 2599327947
3331 2599355532
3332 2599363065
3333 2599368629
3334 2599376174
3335 2599380638
3336 2599387846
3337 2599395032
3338 2599401197
3339 2599406797
3340 2599449470
3341 2599462366
3342 2599468211
3343 2599487436
3344 2599491383
3345 2599503899
3346 2599506135
3347 2599516474
3348 2599516516
3349 2599616160
3350 2599773707
3351 2599804208
3352 2599879431
3353 2599888001
3354 2599895864
3355 2599899308
3356 2599946263
3357 2599948623
3358 2599957438
3359 2599963638
3360 2599969790
3361 2599975241
3362 2599981311
3363 2599986863
3364 2599991258
3365 2599997300
3366 2600000911
3367 2600007370
3368 2600015109
3369 2600021343
3370 2600026735
3371 2600032303
3372 2600038549
3373 2600043950
3374 2600050133
3375 2600056415
3376 2600062396
3377 2600065204
3378 2600074282
3379 2600080410
3380 2600214988
3381 2600361663
3382 2600363079
3383 2600446315
3384 2601627796
3385 2601666688
3386 2601693383
3387 2601775154
3388 2601798100
3389 2602012657
3390 2606076988
3391 2606129766
3392 2608383279
3393 2621296435
3394 2624477895
3395 2624489466
3396 2643843455
3397 2643873598
3398 2643954642
3399 2644022909
3400 2644184081
3401 2644282757
3402 2644624385
3403 2652547685
3404 2671091812
3405 2671099706
3406 2671129520
3407 2671771217
3408 2677900361
3409 2678266611
3410 2713476895
3411 2715749420
3412 2715754422
3413 2723246212
3414 2738673381
3415 2738690686
3416 2738751774
3417 2738807655
3418 2738860815
3419 2738895015
3420 2739202319
3421 2739262751
3422 2739266460
3423 2739312071
3424 2743740879
3425 2745007841
3426 2765581323
3427 2774117948
3428 2774136620
3429 2784261386
3430 2784316434
3431 2792833856
3432 2794593680
3433 2807410852
3434 2807459193
3435 2808858367
3436 2808905784
3437 2808923866
3438 2808928028
3439 2808938456
3440 2808942097
3441 2808946279
3442 2808950790
3443 2808960755
3444 2808966808
3445 2808980035
3446 2808995755
3447 2809001682
3448 2809217649
3449 2812369902
3450 2817488086
3451 2819624681
3452 2819655550
3453 2819704853
3454 2823421462
3455 2825654600
3456 2826581587
3457 2834031344
3458 2842715346
3459 2842821296
3460 2842832047
3461 2842833869
3462 2842838318
3463 2842846097
3464 2842851885
3465 2842856066
3466 2844667546
3467 2846956770
3468 2852616741
3469 2852662697
3470 2852671709
3471 2857548453
3472 2860345335
3473 2860868109
3474 2873320507
3475 2878029838
3476 2880230789
3477 2885084512
3478 2885275516
3479 2897806792
3480 2900642114
3481 2900642757
3482 2904518522
3483 2904542372
3484 2904553326
3485 2904622198
3486 2904705613
3487 2908446699
3488 2912963897
3489 2913036967
3490 2917070796
3491 2919069657
3492 2919156202
3493 2919388753
3494 2919457987
3495 2919487136
3496 2919493004
3497 2919503096
3498 2919702329
3499 2923153711
3500 2923523988
3501 2923589465
3502 2926064770
3503 2928110629
3504 2928140145
3505 2928505638
3506 2929144474
3507 2929189992
3508 2931372180
3509 2931391054
3510 2931398534
3511 2932413046
3512 2932420561
3513 2932424593
3514 2935357869
3515 2939642688
3516 2939654505
3517 2945930490
3518 2945967267
3519 2946012835
3520 2947234818
3521 2969304596
3522 2974293650
3523 2984292402
3524 2987606793
3525 2988731907
3526 2998140160
3527 3007254849
3528 3007316083
3529 3007398964
3530 3007419694
3531 3007517573
3532 3007614735
3533 3007623897
3534 3007722672
3535 3007807243
3536 3007859611
3537 3007864660
3538 3007871482
3539 3007874907
3540 637317461
3541 639787071
3542 8011352618
3543 8015687974
3544 8019769359
3545 8019779552
3546 8021127612
3547 8029995093
3548 8034964435
3549 8052494513
3550 8054009138
3551 8054287042
3552 8054288070
3553 8054349199
3554 8054503659
3555 8054930045
3556 8055771072
3557 8055818023
3558 8055883537
3559 8056116464
3560 8056125766
3561 8056126172
3562 8056131991
3563 8056137530
3564 8056143395
3565 8056151111
3566 8056160150
3567 8056164020
3568 8056170889
3569 8056177023
3570 8056182375
3571 8056570888
3572 8057802354

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02515

CoA_transf_3

CoA-transferase family III

4

363

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
4hl6-assembly2.cif.gz_C yfde from escherichia coli 0.9566 1 388
5yit-assembly2.cif.gz_D crystal structure of hypothetical protein (rv3272) from mycobacterium tuberculosis 0.9536 1 381
5yit-assembly1.cif.gz_B crystal structure of hypothetical protein (rv3272) from mycobacterium tuberculosis 0.95 1 380
5yx6-assembly2.cif.gz_D crystal structure of rv3272 from m. tuberculosis orthorhombic form 0.9491 1 381
4hl6-assembly2.cif.gz_C yfde from escherichia coli 0.9491 1 388
ID Description Score Start End Superfamily
4ed9A02 Alpha Beta;2-Layer Sandwich;formyl-coa transferase, domain 3;formyl-coa transferase, domain 3 0.9834 235 326 3.30.1540.10
af_Q4V9F2_1_227_3.40.50.10540 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Crotonobetainyl-coa:carnitine coa-transferase; domain 1 0.976 24 245 3.40.50.10540
4ed9A02 Alpha Beta;2-Layer Sandwich;formyl-coa transferase, domain 3;formyl-coa transferase, domain 3 0.973 235 326 3.30.1540.10
af_Q9VDL4_46_327_3.40.50.10540 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Crotonobetainyl-coa:carnitine coa-transferase; domain 1 0.9728 1 292 3.40.50.10540
af_Q68FU4_261_348_3.30.1540.10 Alpha Beta;2-Layer Sandwich;formyl-coa transferase, domain 3;formyl-coa transferase, domain 3 0.9718 237 323 3.30.1540.10
ID Description Score Start End GO Terms
AF-A0A654DDV5-F1-model_v4 CoA-transferase family III 0.9868 2 405 GO:0008410
AF-A0A836ZHQ8-F1-model_v4 deleted 0.9867 104 258
AF-A0A318LDB7-F1-model_v4 Formyl-CoA transferase 0.9865 1 405 GO:0008410
AF-A0A0Q8Q6C9-F1-model_v4 CoA-transferase 0.9855 2 392 GO:0008410
AF-A0A7R6PCK0-F1-model_v4 CoA transferase 0.9838 1 404 GO:0008410

Map