F495698
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1786 | 740 | 3572 | 406 |
Family's Representative Sequence
| Representative Sequence | 3300025735|Ga0207713_1034368|Ga0207713_10343681 |
| Length | 387 |
| Sequence | MGALSHLRVLDLSRVLAGPWAGQILADLGAEVIKVERPGRGDDTRAWGPPFLADQAGNSTGEAAYYLAANRNKRSVTIDFTRPEGQQLVRELAANSDILIENFKVGGLAAYGLDYASLSAVNPQLIYCSITGFGQTGPYATRPGYDFMVQGMGGLMSLTGKADGDPGAGPAKVGVALTDILTGLYSTVAILAALQVACLANQAMNYLTTGVAPGRLGNAHPNIVPYQDFPTADGDFILTVGNDSQFAKFAQVAGHPEWATDTRFASNQQRVANRTQLIPLIRQATVFKTTQQWVTELEVAGVPCGPINDLAQVFADPQVLARGLAIQLKHPLAGTLPMVASPLRLSASPVEYRHAPPLLGEHTQEVLQQLLNMDAQTYDQLHAAGVV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 2 | 2124908027 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 | Metagenome | Rhizosphere |
| 3 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 4 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 5 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 6 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 7 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 8 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 9 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 10 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 11 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 12 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 13 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 14 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 15 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 16 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 17 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 18 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 19 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 20 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 21 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 22 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 23 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 24 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 25 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 26 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 27 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 28 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 29 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 30 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 31 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 32 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 33 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 34 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 35 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 38 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 40 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 41 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 54 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 55 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 59 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 61 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 62 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 63 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 64 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 65 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 66 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 67 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 68 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 69 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 70 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 71 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 72 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 73 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 74 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 75 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 76 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 77 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 78 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 79 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 80 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 81 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 82 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 84 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 85 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 86 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Metagenome | Rhizosphere |
| 102 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 113 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 115 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 116 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 117 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 119 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 120 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 121 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 122 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 123 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 124 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 125 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 126 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 127 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 128 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 129 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 130 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 131 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 132 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 134 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 135 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 136 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 137 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 138 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 139 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 140 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 141 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 142 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 143 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 144 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 145 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 146 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 147 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 148 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 149 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 186 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 187 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 201 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 204 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 205 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 206 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 207 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 208 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 209 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 210 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 211 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 212 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 213 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 214 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 215 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 216 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 217 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 218 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 219 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 220 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 221 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 222 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 223 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 224 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 225 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 226 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 227 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 228 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 229 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 230 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 231 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 232 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 233 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 234 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 235 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 236 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 237 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 238 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 239 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 240 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 241 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 242 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 243 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 244 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 245 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 246 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 247 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 248 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 249 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 250 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 251 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 252 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 253 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 254 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 255 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 256 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 257 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 258 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 259 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 260 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 261 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 262 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 263 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 264 | 3300042124 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 | Metagenome | Rhizosphere |
| 265 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 266 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 267 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 268 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 269 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 270 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 271 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 272 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 273 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 274 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 275 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 276 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 277 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 278 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 279 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 280 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 281 | 3300042530 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 | Metagenome | Rhizosphere |
| 282 | 3300042533 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 | Metagenome | Rhizosphere |
| 283 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 284 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 285 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 286 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 287 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 288 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 289 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 290 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 291 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 292 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 293 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 294 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 295 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 296 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 297 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 298 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 299 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 300 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 301 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 302 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 385 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 386 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 387 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 388 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 389 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 390 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 391 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 392 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 393 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 394 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 395 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 396 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 397 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 398 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 399 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 400 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 401 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 402 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 403 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 404 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 405 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 408 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 409 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 410 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 411 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 412 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 413 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 414 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 415 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 416 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 417 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 418 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 419 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 420 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 421 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 422 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 423 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 424 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 425 | 3300049673 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought | Metagenome | Rhizosphere |
| 426 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 427 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 428 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 429 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 430 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 431 | 3300049778 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control | Metagenome | Rhizosphere |
| 432 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 433 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 434 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 435 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 436 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 437 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 438 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 439 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 440 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 441 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 442 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 443 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 444 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 445 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 446 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 447 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 448 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 449 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 450 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 451 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 452 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 453 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 454 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 455 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 456 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 457 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 458 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 459 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 460 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 461 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 462 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 463 | 2511231002 | Polaromonas sp. CF318 | Isolate | Rhizosphere |
| 464 | 2511231004 | Pseudomonas sp. GM102 | Isolate | Nodule |
| 465 | 2511231006 | Pseudomonas sp. GM17 | Isolate | Nodule |
| 466 | 2511231007 | Pseudomonas sp. GM18 | Isolate | Nodule |
| 467 | 2511231008 | Pseudomonas sp. GM21 | Isolate | Nodule |
| 468 | 2511231010 | Pseudomonas sp. GM25 | Isolate | Nodule |
| 469 | 2511231011 | Pseudomonas sp. GM30 | Isolate | Nodule |
| 470 | 2511231012 | Pseudomonas sp. GM33 | Isolate | Nodule |
| 471 | 2511231014 | Pseudomonas sp. GM48 | Isolate | Nodule |
| 472 | 2511231015 | Pseudomonas sp. GM49 | Isolate | Nodule |
| 473 | 2511231016 | Pseudomonas sp. GM50 | Isolate | Nodule |
| 474 | 2511231017 | Pseudomonas sp. GM55 | Isolate | Nodule |
| 475 | 2511231018 | Pseudomonas sp. GM60 | Isolate | Nodule |
| 476 | 2511231019 | Pseudomonas sp. GM67 | Isolate | Nodule |
| 477 | 2511231020 | Pseudomonas sp. GM74 | Isolate | Nodule |
| 478 | 2511231021 | Pseudomonas sp. GM78 | Isolate | Nodule |
| 479 | 2511231022 | Pseudomonas sp. GM79 | Isolate | Nodule |
| 480 | 2511231023 | Pseudomonas sp. GM80 | Isolate | Nodule |
| 481 | 2511231024 | Pseudomonas sp. GM84 | Isolate | Nodule |
| 482 | 2511231031 | Pseudomonas sp. GM16 | Isolate | Nodule |
| 483 | 2511231156 | Pseudomonas ogarae F113 | Isolate | Rhizosphere |
| 484 | 2511231221 | Azospirillum lipoferum 4B | Isolate | Rhizosphere |
| 485 | 2512047018 | Pseudomonas chlororaphis chlororaphis GP72 | Isolate | Rhizosphere |
| 486 | 2515154123 | Trinickia symbiotica JPY347 | Isolate | Nodule |
| 487 | 2515154189 | Paraburkholderia nodosa DSM 21604 | Isolate | Unclassified |
| 488 | 2522572158 | Azospirillum halopraeferens DSM 3675 | Isolate | Unclassified |
| 489 | 2554235132 | Pseudomonas aeruginosa PGPR2 | Isolate | Unclassified |
| 490 | 2554235231 | Pseudomonas putida MTCC 5279 | Isolate | Unclassified |
| 491 | 2554235341 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 492 | 2562617112 | Burkholderia sp. BT03 | Isolate | Rhizosphere |
| 493 | 2574179768 | Azoarcus communis DSM 12120 | Isolate | Unclassified |
| 494 | 2582580736 | Prauserella sp. Am3 | Isolate | Unclassified |
| 495 | 2582580891 | Pseudomonas chlororaphis YL-1 | Isolate | Unclassified |
| 496 | 2597489887 | Pseudomonas chlororaphis aureofaciens 30-84 | Isolate | Rhizosphere |
| 497 | 2597489888 | Pseudomonas fluorescens SS101 | Isolate | Rhizosphere |
| 498 | 2597489889 | Pseudomonas synxantha BG33R | Isolate | Rhizosphere |
| 499 | 2597490356 | Azospirillum brasilense sp7 | Isolate | Unclassified |
| 500 | 2599185155 | Pseudomonas sp. NFACC10-1 | Isolate | Rhizoplane |
| 501 | 2599185160 | Pseudomonas sp. NFPP25 | Isolate | Rhizoplane |
| 502 | 2599185161 | Pseudomonas sp. NFPP09 | Isolate | Rhizoplane |
| 503 | 2599185162 | Pseudomonas sp. NFPP10 | Isolate | Rhizoplane |
| 504 | 2599185163 | Pseudomonas sp. NFPP12 | Isolate | Rhizoplane |
| 505 | 2599185164 | Pseudomonas sp. NFPP13 | Isolate | Rhizoplane |
| 506 | 2599185165 | Pseudomonas sp. NFPP18 | Isolate | Rhizoplane |
| 507 | 2599185166 | Pseudomonas sp. NFPP08 | Isolate | Rhizoplane |
| 508 | 2599185167 | Pseudomonas sp. NFPP28 | Isolate | Rhizoplane |
| 509 | 2599185168 | Pseudomonas sp. NFPP05 | Isolate | Rhizoplane |
| 510 | 2599185179 | Pseudomonas sp. NFR09 | Isolate | Rhizoplane |
| 511 | 2599185181 | Pseudomonas sp. NFPP17 | Isolate | Rhizoplane |
| 512 | 2599185182 | Pseudomonas sp. NFPP19 | Isolate | Rhizoplane |
| 513 | 2599185185 | Pseudomonas sp. NFPP07 | Isolate | Rhizoplane |
| 514 | 2599185186 | Pseudomonas sp. NFPP15 | Isolate | Rhizoplane |
| 515 | 2599185188 | Pseudomonas sp. NFACC45 | Isolate | Rhizoplane |
| 516 | 2599185189 | Pseudomonas sp. NFPP02 | Isolate | Rhizoplane |
| 517 | 2599185190 | Pseudomonas sp. NFPP04 | Isolate | Rhizoplane |
| 518 | 2599185191 | Pseudomonas sp. NFPP24 | Isolate | Rhizoplane |
| 519 | 2599185212 | Pseudomonas sp. NFACC15-1 | Isolate | Rhizoplane |
| 520 | 2599185248 | Pseudomonas sp. NFACC08-1 | Isolate | Rhizoplane |
| 521 | 2599185257 | Pseudomonas sp. NFACC41-3 | Isolate | Rhizoplane |
| 522 | 2599185288 | Pseudomonas sp. NFACC25 | Isolate | Rhizoplane |
| 523 | 2599185289 | Pseudomonas sp. NFACC51 | Isolate | Rhizoplane |
| 524 | 2599185290 | Pseudomonas sp. NFPP11 | Isolate | Rhizoplane |
| 525 | 2599185291 | Pseudomonas sp. NFACC48-1 | Isolate | Rhizoplane |
| 526 | 2599185302 | Pseudomonas sp. NFACC43 | Isolate | Rhizoplane |
| 527 | 2599185303 | Pseudomonas sp. NFACC42-2 | Isolate | Rhizoplane |
| 528 | 2599185304 | Pseudomonas sp. NFACC47-1 | Isolate | Rhizoplane |
| 529 | 2599185305 | Pseudomonas sp. NFACC07-1 | Isolate | Rhizoplane |
| 530 | 2599185306 | Pseudomonas sp. NFACC16-2 | Isolate | Rhizoplane |
| 531 | 2599185307 | Pseudomonas sp. NFACC02 | Isolate | Rhizoplane |
| 532 | 2599185308 | Pseudomonas sp. NFACC17-2 | Isolate | Rhizoplane |
| 533 | 2599185309 | Pseudomonas sp. NFACC49-2 | Isolate | Rhizoplane |
| 534 | 2599185310 | Pseudomonas sp. NFACC09-4 | Isolate | Rhizoplane |
| 535 | 2599185311 | Pseudomonas sp. NFACC04-2 | Isolate | Rhizoplane |
| 536 | 2599185312 | Pseudomonas sp. NFACC32-1 | Isolate | Rhizoplane |
| 537 | 2599185313 | Pseudomonas sp. NFACC05-1 | Isolate | Rhizoplane |
| 538 | 2599185314 | Pseudomonas sp. NFACC23-1 | Isolate | Rhizoplane |
| 539 | 2599185315 | Pseudomonas sp. NFACC44-2 | Isolate | Rhizoplane |
| 540 | 2599185316 | Pseudomonas sp. NFACC52 | Isolate | Rhizoplane |
| 541 | 2599185317 | Pseudomonas sp. NFACC06-1 | Isolate | Rhizoplane |
| 542 | 2599185318 | Pseudomonas sp. NFACC13-1 | Isolate | Rhizoplane |
| 543 | 2599185319 | Pseudomonas sp. NFACC24-1 | Isolate | Rhizoplane |
| 544 | 2599185320 | Pseudomonas sp. NFACC36 | Isolate | Rhizoplane |
| 545 | 2599185321 | Pseudomonas sp. NFACC54 | Isolate | Rhizoplane |
| 546 | 2599185322 | Pseudomonas sp. NFACC14 | Isolate | Rhizoplane |
| 547 | 2599185323 | Pseudomonas sp. NFACC37-1 | Isolate | Rhizoplane |
| 548 | 2599185324 | Pseudomonas sp. NFACC46-3 | Isolate | Rhizoplane |
| 549 | 2599185325 | Pseudomonas sp. NFACC56-3 | Isolate | Rhizoplane |
| 550 | 2599185356 | Pseudomonas sp. NFPP14 | Isolate | Rhizoplane |
| 551 | 2600254930 | Pseudomonas sp. NFIX10 | Isolate | Rhizoplane |
| 552 | 2600254931 | Pseudomonas sp. NFIX28 | Isolate | Rhizoplane |
| 553 | 2600254954 | Pseudomonas sp. NFACC19-2 | Isolate | Rhizoplane |
| 554 | 2600255283 | Pseudomonas sp. NFR16 | Isolate | Rhizoplane |
| 555 | 2600255292 | Janthinobacterium lividum NFR18 | Isolate | Rhizoplane |
| 556 | 2600255296 | Pseudomonas sp. NFR02 | Isolate | Rhizoplane |
| 557 | 2600255313 | Pseudomonas sp. NFPP16 | Isolate | Rhizoplane |
| 558 | 2600255318 | Pseudomonas putida NFIX47 | Isolate | Rhizoplane |
| 559 | 2600255389 | Pseudomonas sp. NFPP33 | Isolate | Rhizoplane |
| 560 | 2603880185 | Pseudomonas sp. NFIX46 | Isolate | Rhizoplane |
| 561 | 2603880199 | Pseudomonas sp. NFIX49 | Isolate | Rhizoplane |
| 562 | 2606217733 | Pseudomonas aeruginosa NFHH01 | Isolate | Rhizoplane |
| 563 | 2619619299 | Pseudomonas veronii R4 Genome sequencing | Isolate | Unclassified |
| 564 | 2623620443 | Pseudomonas sp. DR 5-09 | Isolate | Unclassified |
| 565 | 2623620446 | Pseudomonas sp. GR 6-02 | Isolate | Unclassified |
| 566 | 2643221565 | Pseudomonas sp. Root562 | Isolate | Unclassified |
| 567 | 2643221571 | Pseudomonas sp. Root569 | Isolate | Unclassified |
| 568 | 2643221589 | Pseudomonas sp. Root68 | Isolate | Unclassified |
| 569 | 2643221602 | Pseudomonas sp. Root71 | Isolate | Unclassified |
| 570 | 2643221633 | Pseudomonas sp. Root329 | Isolate | Unclassified |
| 571 | 2643221650 | Pseudomonas sp. Root401 | Isolate | Unclassified |
| 572 | 2643221713 | Pseudomonas sp. Root9 | Isolate | Unclassified |
| 573 | 2651869719 | Genome Sequence of Pseudomonas fluorescens UM270 | Isolate | Rhizosphere |
| 574 | 2667528170 | Pseudomonas sp. NFACC50-1 | Isolate | Rhizoplane |
| 575 | 2667528171 | Pseudomonas sp. NFPP22 | Isolate | Rhizoplane |
| 576 | 2667528176 | Pseudomonas sp. NFACC11-2 | Isolate | Rhizoplane |
| 577 | 2671180172 | Pseudomonas sp. NFIX51 | Isolate | Rhizoplane |
| 578 | 2675903420 | Pseudomonas fluorescens Ps006 | Isolate | Unclassified |
| 579 | 2675903515 | Pseudomonas thivervalensis DSM 13194 | Isolate | Unclassified |
| 580 | 2711768613 | Burkholderia sp. BT03 | Isolate | Rhizosphere |
| 581 | 2713897148 | Pseudomonas fluorescens SF39a | Isolate | Rhizosphere |
| 582 | 2713897149 | Pseudomonas fluorescens SF4c | Isolate | Rhizosphere |
| 583 | 2721755607 | Pseudomonas fluorescens Pt14 | Isolate | Rhizosphere |
| 584 | 2738541265 | Pseudomonas sp. GV077 | Isolate | Unclassified |
| 585 | 2738541271 | Pseudomonas sp. GV021 | Isolate | Unclassified |
| 586 | 2738541282 | Pseudomonas sp. GV058 | Isolate | Unclassified |
| 587 | 2738541294 | Pseudomonas sp. GV087 | Isolate | Unclassified |
| 588 | 2738541303 | Pseudomonas sp. GV105 | Isolate | Unclassified |
| 589 | 2738541309 | Pseudomonas sp. GV047 | Isolate | Unclassified |
| 590 | 2738543004 | Pseudomonas sp. GV085 | Isolate | Unclassified |
| 591 | 2738543015 | Pseudomonas sp. GV041 | Isolate | Unclassified |
| 592 | 2738543016 | Pseudomonas sp. GV012 | Isolate | Unclassified |
| 593 | 2738543025 | Pseudomonas sp. GV091 | Isolate | Unclassified |
| 594 | 2740892503 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 595 | 2744054620 | Pseudomonas thivervalensis LMG 21626 | Isolate | Unclassified |
| 596 | 2765235841 | Pseudomonas putida AA7 | Isolate | Unclassified |
| 597 | 2773857670 | Pseudomonas sp. 478 | Isolate | Unclassified |
| 598 | 2773857673 | Pseudomonas sp. 443 | Isolate | Unclassified |
| 599 | 2784132063 | Pseudomonas sp. 424 | Isolate | Unclassified |
| 600 | 2784132072 | Pseudomonas sp. 460 | Isolate | Unclassified |
| 601 | 2791355137 | Paraburkholderia piptadeniae STM7183 | Isolate | Unclassified |
| 602 | 2791355520 | Pseudomonas sp. s211(2017) | Isolate | Unclassified |
| 603 | 2806310737 | Pseudomonas mosselii BS011 | Isolate | Unclassified |
| 604 | 2806310745 | Pseudomonas mosselii PtA1 | Isolate | Unclassified |
| 605 | 2808606361 | Pseudomonas sp. SJZ075 | Isolate | Rhizosphere |
| 606 | 2808606373 | Pseudomonas sp. SLBN-2 | Isolate | Unclassified |
| 607 | 2808606376 | Pseudomonas sp. SJZ074 | Isolate | Rhizosphere |
| 608 | 2808606377 | Pseudomonas sp. SJZ083 | Isolate | Rhizosphere |
| 609 | 2808606378 | Pseudomonas sp. SJZ078 | Isolate | Rhizosphere |
| 610 | 2808606379 | Pseudomonas sp. SJZ079 | Isolate | Rhizosphere |
| 611 | 2808606380 | Pseudomonas sp. SJZ085 | Isolate | Rhizosphere |
| 612 | 2808606381 | Pseudomonas sp. SJZ077 | Isolate | Rhizosphere |
| 613 | 2808606382 | Pseudomonas sp. SJZ080 | Isolate | Rhizosphere |
| 614 | 2808606383 | Pseudomonas sp. SJZ124 | Isolate | Rhizosphere |
| 615 | 2808606385 | Pseudomonas sp. SJZ103 | Isolate | Rhizosphere |
| 616 | 2808606388 | Pseudomonas sp. SJZ094 | Isolate | Rhizosphere |
| 617 | 2808606389 | Pseudomonas sp. SJZ101 | Isolate | Rhizosphere |
| 618 | 2808606445 | Pseudomonas sp. SJZ131 | Isolate | Rhizosphere |
| 619 | 2811994881 | Pseudomonas sp. SLBN-26 | Isolate | Unclassified |
| 620 | 2816332298 | Pseudomonas veronii R02 | Isolate | Rhizosphere |
| 621 | 2818991450 | Burkholderia sp. 604 | Isolate | Unclassified |
| 622 | 2818991456 | Pseudomonas koreensis 3286 | Isolate | Rhizosphere |
| 623 | 2818991464 | Pseudomonas protegens 3295 | Isolate | Rhizosphere |
| 624 | 2823421272 | Pseudomonas mendocina S5.2 | Isolate | Rhizoplane |
| 625 | 2825651385 | Pseudomonas brassicacearum L13-6-12 | Isolate | Rhizosphere |
| 626 | 2826581358 | Pseudomonas viridiflava CDRTc14 | Isolate | Unclassified |
| 627 | 2834028612 | Pseudomonas fluorescens 513 | Isolate | Unclassified |
| 628 | 2842711865 | Duganella sp. R-73148 | Isolate | Unclassified |
| 629 | 2842815866 | Pseudomonas sp. R-72210 | Isolate | Unclassified |
| 630 | 2842826826 | Pseudomonas sp. R-72172 | Isolate | Unclassified |
| 631 | 2842832357 | Pseudomonas sp. R-72164 | Isolate | Unclassified |
| 632 | 2842837860 | Pseudomonas sp. R-72102 | Isolate | Unclassified |
| 633 | 2842843487 | Pseudomonas sp. R-72074 | Isolate | Unclassified |
| 634 | 2842849001 | Pseudomonas sp. R-72008 | Isolate | Unclassified |
| 635 | 2842854478 | Pseudomonas sp. R-71998 | Isolate | Unclassified |
| 636 | 2844665904 | Pseudomonas protegens H1F10C | Isolate | Unclassified |
| 637 | 2846952575 | Azospirillum brasilense sp7 | Isolate | Unclassified |
| 638 | 2852612431 | Pseudomonas sp. SJZ073 | Isolate | Rhizosphere |
| 639 | 2852657418 | Pseudomonas sp. JAI115 | Isolate | Rhizosphere |
| 640 | 2852667396 | Pseudomonas sp. JAI120 | Isolate | Rhizosphere |
| 641 | 2857547612 | Janthinobacterium sp. R-74502 | Isolate | Unclassified |
| 642 | 2860339153 | Pseudomonas sp. JAI111 | Isolate | Rhizosphere |
| 643 | 2860867994 | Pseudomonas sp. R1-43-08 | Isolate | Rhizosphere |
| 644 | 2873314349 | Sphaerisporangium siamense DSM 45784 | Isolate | Rhizosphere |
| 645 | 2878029506 | Pseudomonas fluorescens DR397 | Isolate | Rhizosphere |
| 646 | 2880230671 | Pseudomonas fluorescens LBUM677 | Isolate | Unclassified |
| 647 | 2885080285 | Janthinobacterium sp. AD80 | Isolate | Rhizosphere |
| 648 | 2885270888 | Paraburkholderia sp. UYCPa14C | Isolate | Unclassified |
| 649 | 2897803580 | Azospirillum doebereinerae GSF71 | Isolate | Unclassified |
| 650 | 2900634093 | Paraburkholderia dipogonis ICMP 19430 | Isolate | Unclassified |
| 651 | 2904518522 | Pseudomonas fluorescens 4488 | Isolate | Rhizosphere |
| 652 | 2904541872 | Variovorax sp. 1615 | Isolate | Rhizosphere |
| 653 | 2904550169 | Stutzerimonas stutzeri 1099 | Isolate | Rhizosphere |
| 654 | 2904615490 | Paraburkholderia franconis CNPSo 3157 | Isolate | Unclassified |
| 655 | 2904699407 | |||
| 656 | 2908446538 | Pseudomonas sp. R76 | Isolate | Rhizosphere |
| 657 | 2912963787 | Pseudomonas sp. R32 | Isolate | Rhizosphere |
| 658 | 2913036834 | Pseudomonas viciae 11K1 | Isolate | Rhizosphere |
| 659 | 2917070673 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 660 | 2919063839 | Pseudomonas pharyngis 1098 | Isolate | Rhizosphere |
| 661 | 2919155634 | Pseudomonas fulva 1992 | Isolate | Unclassified |
| 662 | 2919385768 | Pseudomonas sp. 2957 | Isolate | Unclassified |
| 663 | 2919456309 | Pseudomonas sp. 3296 | Isolate | Rhizosphere |
| 664 | 2919481497 | Pseudomonas brassicacearum 3432 | Isolate | Unclassified |
| 665 | 2919487758 | Pseudomonas koreensis 3441 | Isolate | Unclassified |
| 666 | 2919501602 | Pseudomonas alcaliphila 3512 | Isolate | Unclassified |
| 667 | 2919697872 | Pseudomonas frederiksbergensis 4169 | Isolate | Unclassified |
| 668 | 2923153595 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 669 | 2923519811 | Pseudomonas otitidis SLBN-103 | Isolate | Rhizosphere |
| 670 | 2923586266 | Pseudomonas fluorescens 1550 | Isolate | Rhizosphere |
| 671 | 2926063275 | Pseudomonas sp. 3400 | Isolate | Unclassified |
| 672 | 2928108538 | Paraburkholderia terricola 1595 | Isolate | Rhizosphere |
| 673 | 2928135762 | Paraburkholderia terricola 1988 | Isolate | Unclassified |
| 674 | 2928503688 | Paraburkholderia terricola 1263 | Isolate | Rhizosphere |
| 675 | 2929144301 | Pseudomonas sp. R-71838 Hybrid assembly | Isolate | Unclassified |
| 676 | 2929189879 | Pseudomonas sp. R-71842 Hybrid assembly | Isolate | Unclassified |
| 677 | 2931369376 | Pseudomonas fluorescens DR133 | Isolate | Rhizosphere |
| 678 | 2931390751 | Pseudomonas sp. DR208 | Isolate | Rhizosphere |
| 679 | 2931396565 | Pseudomonas sp. DR48 | Isolate | Rhizosphere |
| 680 | 2932410948 | Janthinobacterium lividum 2829 | Isolate | Rhizosphere |
| 681 | 2932416698 | Janthinobacterium lividum 2830 | Isolate | Rhizosphere |
| 682 | 2932422444 | Comamonas sp. 4034 | Isolate | Rhizosphere |
| 683 | 2935353572 | Pseudomonas protegens TECH19 | Isolate | Unclassified |
| 684 | 2939636861 | Pseudomonas sp. 2725 | Isolate | Rhizosphere |
| 685 | 2939651529 | Pseudomonas sp. 2835 | Isolate | Rhizosphere |
| 686 | 2945928738 | Pseudomonas cedrina W1I11 | Isolate | Rhizosphere |
| 687 | 2945961074 | Pseudomonas sp. W2I6 | Isolate | Rhizosphere |
| 688 | 2946006987 | Pseudomonas sp. W3I7 | Isolate | Rhizosphere |
| 689 | 2947233263 | Pseudomonas synxantha W2I4 | Isolate | Rhizosphere |
| 690 | 2969304461 | Pseudomonas sp. R84 | Isolate | Rhizosphere |
| 691 | 2974289157 | Pseudomonas fluorescens SORGH_AS 191 | Isolate | Unclassified |
| 692 | 2984286254 | Pseudomonas chlororaphis aurantiaca JD37 | Isolate | Rhizosphere |
| 693 | 2987605356 | Stenotrophomonas sp. ATCM1_4 | Isolate | Unclassified |
| 694 | 2988728565 | Pseudomonas corrugata RM1-1-4 | Isolate | Rhizosphere |
| 695 | 2998139840 | Pseudomonas iranensis SWRI54 | Isolate | Rhizosphere |
| 696 | 3007252601 | Pseudomonas punonensis D1-6 | Isolate | Unclassified |
| 697 | 3007315729 | Pseudomonas argentinensis SA190 | Isolate | Unclassified |
| 698 | 3007395558 | Pseudomonas chlororaphis PCL1601 | Isolate | Rhizosphere |
| 699 | 3007419365 | Pseudomonas vanderleydeniana RW8P3 | Isolate | Unclassified |
| 700 | 3007511990 | Pseudomonas fluorescens G20-18 | Isolate | Rhizosphere |
| 701 | 3007614139 | Pseudomonas sp. PB106 | Isolate | Unclassified |
| 702 | 3007619802 | Pseudomonas sp. PB120 | Isolate | Unclassified |
| 703 | 3007718800 | Pseudomonas fluorescens BW11P2 | Isolate | Rhizosphere |
| 704 | 3007803356 | Pseudomonas sp. CM27 | Isolate | Unclassified |
| 705 | 3007855910 | Pseudomonas khorasanensis SWRI153 | Isolate | Rhizosphere |
| 706 | 3007861166 | Pseudomonas hamedanensis SWRI65 | Isolate | Rhizosphere |
| 707 | 3007866637 | Pseudomonas marvdashtae SWRI102 | Isolate | Rhizosphere |
| 708 | 3007872151 | Pseudomonas sp. SWRI51 | Isolate | Rhizosphere |
| 709 | 637000220 | Pseudomonas protegens Pf-5 | Isolate | Rhizoplane |
| 710 | 639633007 | Azoarcus olearius BH72 | Isolate | Unclassified |
| 711 | 8011350971 | Pseudomonas sp. 30_B | Isolate | Rhizosphere |
| 712 | 8015687852 | Pseudomonas chlororaphis aurantiaca RP4 | Isolate | Rhizosphere |
| 713 | 8019769354 | Pseudomonas sp. MSSRFD41 | Isolate | Rhizosphere |
| 714 | 8019775933 | Pseudomonas sp. PvR083 | Isolate | Rhizosphere |
| 715 | 8021120328 | Burkholderia sp. LS-044 | Isolate | Rhizosphere |
| 716 | 8029995093 | Pseudomonas atacamensis SM1 | Isolate | Rhizosphere |
| 717 | 8034962539 | Pseudomonas sediminis PI11 | Isolate | Rhizosphere |
| 718 | 8052494512 | Pseudomonas putida LD6 | Isolate | Unclassified |
| 719 | 8054002106 | Azospirillum lipoferum 59b | Isolate | Unclassified |
| 720 | 8054285046 | Pseudomonas petroselini MAFF 311096 | Isolate | Nodule |
| 721 | 8054347763 | Pseudomonas carnis NWU Be30 | Isolate | Unclassified |
| 722 | 8054503363 | Pseudomonas sivasensis BsEB-1 | Isolate | Unclassified |
| 723 | 8054929484 | Pseudomonas vlassakiae RW4S1 | Isolate | Rhizosphere |
| 724 | 8055770955 | Pseudomonas chlororaphis qlu-1 | Isolate | Rhizosphere |
| 725 | 8055817908 | Pseudomonas pergaminensis 1008 | Isolate | Rhizosphere |
| 726 | 8055878733 | Pseudomonas palmensis BBB001 | Isolate | Rhizosphere |
| 727 | 8056115690 | Pseudomonas muyukensis COW39 | Isolate | Rhizosphere |
| 728 | 8056120720 | Pseudomonas maumuensis COW77 | Isolate | Rhizosphere |
| 729 | 8056125926 | Pseudomonas azerbaijanorientalis SWRI123 | Isolate | Rhizosphere |
| 730 | 8056131705 | Pseudomonas asgharzadehiana SWRI132 | Isolate | Rhizosphere |
| 731 | 8056137416 | Pseudomonas fakonensis COW40 | Isolate | Rhizosphere |
| 732 | 8056143049 | Pseudomonas alvandae SWRI17 | Isolate | Rhizosphere |
| 733 | 8056148874 | Pseudomonas khavaziana SWRI124 | Isolate | Rhizosphere |
| 734 | 8056155041 | Pseudomonas farris SWRI79 | Isolate | Rhizosphere |
| 735 | 8056161164 | Pseudomonas azadiae SWRI103 | Isolate | Rhizosphere |
| 736 | 8056166840 | Pseudomonas triticicola SWRI88 | Isolate | Rhizosphere |
| 737 | 8056172158 | Pseudomonas ekonensis COR58 | Isolate | Rhizosphere |
| 738 | 8056177738 | Pseudomonas azerbaijanoccidentalis SWRI74 | Isolate | Rhizosphere |
| 739 | 8056569372 | Pseudomonas serboccidentalis IT-P374 | Isolate | Rhizosphere |
| 740 | 8057798959 | Pseudomonas piscis BW16M1 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 84.26 |
| Metatranscriptomes | 0.11 |
| Isolates | 15.63 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 7.22 |
| Nodule | 1.9 |
| Rhizoplane | 4.98 |
| Rhizosphere | 72.79 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0207713_1034368 | 3300025735 | Bacteria | 2203 |
| 2 | MRS2a_Contig_849 | 2124908027 | Bacteria | 16146 |
| 3 | SwRhRL2b_contig_2139936 | 2162886007 | Bacteria | 1812 |
| 4 | SwRhRL2b_contig_3821960 | 2162886007 | Bacteria | 5250 |
| 5 | JGI24735J21928_10002975 | 3300002067 | Bacteria | 5833 |
| 6 | JGI25156J39149_1001576 | 3300002705 | Bacteria | 9397 |
| 7 | JGI25162J39368_1003079 | 3300002737 | Bacteria | 5361 |
| 8 | JGI25154J39366_1001005 | 3300002738 | Bacteria | 11359 |
| 9 | JGI25154J39366_1003567 | 3300002738 | Bacteria | 3198 |
| 10 | JGI25157J39369_1000161 | 3300002741 | Bacteria | 56020 |
| 11 | JGI25163J39215_1001189 | 3300002771 | Bacteria | 4976 |
| 12 | JGI25163J39215_1001375 | 3300002771 | Bacteria | 4109 |
| 13 | JGI25164J39214_1001483 | 3300002772 | Bacteria | 5361 |
| 14 | JGI25164J39214_1001780 | 3300002772 | Bacteria | 4191 |
| 15 | JGI25165J46597_1002668 | 3300003214 | Bacteria | 5361 |
| 16 | JGI25165J46597_1003187 | 3300003214 | Bacteria | 4319 |
| 17 | rootH2_10034079 | 3300003320 | Bacteria | 2479 |
| 18 | rootL2_10118786 | 3300003322 | Bacteria | 3140 |
| 19 | JGI25160J50197_1000228 | 3300003354 | Bacteria | 44139 |
| 20 | JGI25161J50226_1000171 | 3300003374 | Bacteria | 44139 |
| 21 | Ga0055538_1000012 | 3300003751 | Bacteria | 353826 |
| 22 | Ga0055539_1000017 | 3300003752 | Bacteria | 353873 |
| 23 | Ga0055539_1000819 | 3300003752 | Bacteria | 7323 |
| 24 | Ga0055533_1000016 | 3300003756 | Bacteria | 396179 |
| 25 | Ga0055533_1000021 | 3300003756 | Bacteria | 353826 |
| 26 | Ga0055533_1000918 | 3300003756 | Bacteria | 8817 |
| 27 | Ga0055532_1000020 | 3300003758 | Bacteria | 270853 |
| 28 | Ga0055532_1000122 | 3300003758 | Bacteria | 79139 |
| 29 | Ga0055525_1000117 | 3300003759 | Bacteria | 120690 |
| 30 | Ga0055525_1000579 | 3300003759 | Bacteria | 16084 |
| 31 | Ga0055527_1000078 | 3300003760 | Bacteria | 79672 |
| 32 | Ga0055527_1004495 | 3300003760 | Bacteria | 1911 |
| 33 | Ga0055535_1000054 | 3300003761 | Bacteria | 131373 |
| 34 | Ga0055535_1000165 | 3300003761 | Bacteria | 71549 |
| 35 | Ga0055535_1006646 | 3300003761 | Bacteria | 2311 |
| 36 | Ga0055542_1001566 | 3300003762 | Bacteria | 10714 |
| 37 | Ga0055529_1000214 | 3300003763 | Bacteria | 76244 |
| 38 | Ga0055529_1000405 | 3300003763 | Bacteria | 45555 |
| 39 | Ga0055536_1009213 | 3300003781 | Bacteria | 4120 |
| 40 | Ga0055536_1009265 | 3300003781 | Bacteria | 4100 |
| 41 | Ga0055530_10004442 | 3300003791 | Bacteria | 7208 |
| 42 | Ga0055530_10004741 | 3300003791 | Bacteria | 6854 |
| 43 | Ga0055540_1000378 | 3300003792 | Bacteria | 37178 |
| 44 | Ga0055540_1003947 | 3300003792 | Bacteria | 6930 |
| 45 | Ga0055540_1004013 | 3300003792 | Bacteria | 6854 |
| 46 | Ga0055540_1014204 | 3300003792 | Bacteria | 2387 |
| 47 | Ga0055531_10001099 | 3300003794 | Bacteria | 21179 |
| 48 | Ga0055541_1000012 | 3300003841 | Bacteria | 353826 |
| 49 | Ga0055543_1000333 | 3300004625 | Bacteria | 32214 |
| 50 | Ga0065714_10007826 | 3300005288 | Bacteria | 2724 |
| 51 | Ga0065714_10008516 | 3300005288 | Bacteria | 2940 |
| 52 | Ga0065714_10009353 | 3300005288 | Bacteria | 2331 |
| 53 | Ga0065714_10067720 | 3300005288 | Bacteria | 5254 |
| 54 | Ga0065714_10069841 | 3300005288 | Bacteria | 4066 |
| 55 | Ga0065714_10069906 | 3300005288 | Bacteria | 4040 |
| 56 | Ga0065714_10111222 | 3300005288 | Bacteria | 1471 |
| 57 | Ga0065704_10008316 | 3300005289 | Bacteria | 5773 |
| 58 | Ga0065704_10071136 | 3300005289 | Bacteria | 12914 |
| 59 | Ga0065704_10078938 | 3300005289 | Bacteria | 4298 |
| 60 | Ga0065704_10102271 | 3300005289 | Bacteria | 2211 |
| 61 | Ga0065712_10000372 | 3300005290 | Bacteria | 12338 |
| 62 | Ga0065712_10081765 | 3300005290 | Bacteria | 2976 |
| 63 | Ga0065715_10030400 | 3300005293 | Bacteria | 2815 |
| 64 | Ga0070658_10003769 | 3300005327 | Bacteria | 12411 |
| 65 | Ga0070676_10006747 | 3300005328 | Bacteria | 6146 |
| 66 | Ga0070690_100004971 | 3300005330 | Bacteria | 7441 |
| 67 | Ga0070670_100037777 | 3300005331 | Bacteria | 4153 |
| 68 | Ga0070670_100051980 | 3300005331 | Bacteria | 3519 |
| 69 | Ga0070670_100095274 | 3300005331 | Bacteria | 2560 |
| 70 | Ga0068869_100017263 | 3300005334 | Bacteria | 4888 |
| 71 | Ga0068869_100161123 | 3300005334 | Bacteria | 1746 |
| 72 | Ga0068868_100023640 | 3300005338 | Bacteria | 4653 |
| 73 | Ga0070660_100003374 | 3300005339 | Bacteria | 10985 |
| 74 | Ga0070661_100000237 | 3300005344 | Bacteria | 45515 |
| 75 | Ga0070669_100000277 | 3300005353 | Bacteria | 41213 |
| 76 | Ga0070669_100014309 | 3300005353 | Bacteria | 5646 |
| 77 | Ga0070675_100044645 | 3300005354 | Bacteria | 3624 |
| 78 | Ga0070673_100003982 | 3300005364 | Bacteria | 9297 |
| 79 | Ga0070659_100012909 | 3300005366 | Bacteria | 6208 |
| 80 | Ga0070667_100244631 | 3300005367 | Bacteria | 1603 |
| 81 | Ga0070714_100183514 | 3300005435 | Bacteria | 1905 |
| 82 | Ga0070711_100021816 | 3300005439 | Bacteria | 4145 |
| 83 | Ga0070700_100040447 | 3300005441 | Bacteria | 2854 |
| 84 | Ga0070678_100132658 | 3300005456 | Bacteria | 1982 |
| 85 | Ga0070662_100019698 | 3300005457 | Bacteria | 4584 |
| 86 | Ga0070662_100020496 | 3300005457 | Bacteria | 4502 |
| 87 | Ga0070662_100095490 | 3300005457 | Bacteria | 2241 |
| 88 | Ga0070662_100133207 | 3300005457 | Bacteria | 1919 |
| 89 | Ga0068867_100005827 | 3300005459 | Bacteria | 8738 |
| 90 | Ga0068853_100000143 | 3300005539 | Bacteria | 48815 |
| 91 | Ga0068853_100071924 | 3300005539 | Bacteria | 3013 |
| 92 | Ga0070695_100106262 | 3300005545 | Bacteria | 1898 |
| 93 | Ga0070696_100000044 | 3300005546 | Bacteria | 57075 |
| 94 | Ga0070665_100001196 | 3300005548 | Bacteria | 31625 |
| 95 | Ga0070665_100032296 | 3300005548 | Bacteria | 5270 |
| 96 | Ga0070665_100293050 | 3300005548 | Bacteria | 1629 |
| 97 | Ga0070665_100317496 | 3300005548 | Bacteria | 1562 |
| 98 | Ga0068855_100001954 | 3300005563 | Bacteria | 25584 |
| 99 | Ga0068855_100019854 | 3300005563 | Bacteria | 8072 |
| 100 | Ga0068855_100045492 | 3300005563 | Bacteria | 5192 |
| 101 | Ga0068855_100062589 | 3300005563 | Bacteria | 4343 |
| 102 | Ga0068855_100121264 | 3300005563 | Bacteria | 2992 |
| 103 | Ga0070664_100003174 | 3300005564 | Bacteria | 13279 |
| 104 | Ga0070664_100025219 | 3300005564 | Bacteria | 4926 |
| 105 | Ga0068857_100012908 | 3300005577 | Bacteria | 7279 |
| 106 | Ga0068857_100125587 | 3300005577 | Bacteria | 2312 |
| 107 | Ga0068854_100008045 | 3300005578 | Bacteria | 6757 |
| 108 | Ga0068854_100069237 | 3300005578 | Bacteria | 2575 |
| 109 | Ga0068856_100001351 | 3300005614 | Bacteria | 25782 |
| 110 | Ga0068859_100294244 | 3300005617 | Bacteria | 1717 |
| 111 | Ga0068861_100053912 | 3300005719 | Bacteria | 3062 |
| 112 | Ga0068851_10000018 | 3300005834 | Bacteria | 137425 |
| 113 | Ga0068851_10002048 | 3300005834 | Bacteria | 8891 |
| 114 | Ga0068860_100155352 | 3300005843 | Bacteria | 2204 |
| 115 | Ga0068862_100127773 | 3300005844 | Bacteria | 2246 |
| 116 | Ga0075365_10005012 | 3300006038 | Bacteria | 7095 |
| 117 | Ga0075363_100006720 | 3300006048 | Bacteria | 5248 |
| 118 | Ga0075364_10030448 | 3300006051 | Bacteria | 3463 |
| 119 | Ga0075364_10181827 | 3300006051 | Bacteria | 1423 |
| 120 | Ga0075364_10183231 | 3300006051 | Bacteria | 1417 |
| 121 | Ga0075432_10005891 | 3300006058 | Bacteria | 4170 |
| 122 | Ga0075432_10010937 | 3300006058 | Bacteria | 3082 |
| 123 | Ga0075362_10035226 | 3300006177 | Bacteria | 2184 |
| 124 | Ga0075367_10073570 | 3300006178 | Bacteria | 2059 |
| 125 | Ga0075369_10001718 | 3300006186 | Bacteria | 7579 |
| 126 | Ga0075369_10034587 | 3300006186 | Bacteria | 2145 |
| 127 | Ga0075366_10001098 | 3300006195 | Bacteria | 13285 |
| 128 | Ga0075366_10069057 | 3300006195 | Bacteria | 2103 |
| 129 | Ga0075370_10000523 | 3300006353 | Bacteria | 14643 |
| 130 | Ga0075430_100010146 | 3300006846 | Bacteria | 7973 |
| 131 | Ga0075430_100011601 | 3300006846 | Bacteria | 7494 |
| 132 | Ga0075430_100046312 | 3300006846 | Bacteria | 3673 |
| 133 | Ga0075431_100000786 | 3300006847 | Bacteria | 27678 |
| 134 | Ga0075431_100011765 | 3300006847 | Bacteria | 8829 |
| 135 | Ga0075429_100001077 | 3300006880 | Bacteria | 21893 |
| 136 | Ga0075429_100050654 | 3300006880 | Bacteria | 3613 |
| 137 | Ga0068865_100008692 | 3300006881 | Bacteria | 6281 |
| 138 | Ga0075436_100155945 | 3300006914 | Bacteria | 1608 |
| 139 | Ga0097620_100294240 | 3300006931 | Bacteria | 1717 |
| 140 | Ga0099823_1016467 | 3300006944 | Bacteria | 7259 |
| 141 | Ga0099823_1032132 | 3300006944 | Bacteria | 4292 |
| 142 | Ga0079104_1005125 | 3300006946 | Bacteria | 5331 |
| 143 | Ga0079104_1006328 | 3300006946 | Bacteria | 4510 |
| 144 | Ga0079104_1024727 | 3300006946 | Bacteria | 1577 |
| 145 | Ga0099826_10003322 | 3300006948 | Bacteria | 10862 |
| 146 | Ga0105251_10000033 | 3300009011 | Bacteria | 118905 |
| 147 | Ga0105251_10000068 | 3300009011 | Bacteria | 98955 |
| 148 | Ga0105251_10000164 | 3300009011 | Bacteria | 68693 |
| 149 | Ga0105251_10002783 | 3300009011 | Bacteria | 13293 |
| 150 | Ga0105251_10010844 | 3300009011 | Bacteria | 5249 |
| 151 | Ga0105251_10013372 | 3300009011 | Bacteria | 4595 |
| 152 | Ga0105251_10015218 | 3300009011 | Bacteria | 4215 |
| 153 | Ga0105251_10015354 | 3300009011 | Bacteria | 4191 |
| 154 | Ga0105251_10019273 | 3300009011 | Bacteria | 3608 |
| 155 | Ga0105251_10029258 | 3300009011 | Bacteria | 2775 |
| 156 | Ga0105251_10033590 | 3300009011 | Bacteria | 2545 |
| 157 | Ga0105251_10061639 | 3300009011 | Bacteria | 1763 |
| 158 | Ga0105251_10062003 | 3300009011 | Bacteria | 1757 |
| 159 | Ga0105251_10076005 | 3300009011 | Bacteria | 1559 |
| 160 | Ga0105251_10083480 | 3300009011 | Bacteria | 1475 |
| 161 | Ga0105251_10101894 | 3300009011 | Bacteria | 1312 |
| 162 | Ga0105244_10000073 | 3300009036 | Bacteria | 115279 |
| 163 | Ga0105244_10010173 | 3300009036 | Bacteria | 5716 |
| 164 | Ga0105244_10016315 | 3300009036 | Bacteria | 4234 |
| 165 | Ga0105244_10017085 | 3300009036 | Bacteria | 4111 |
| 166 | Ga0105244_10022905 | 3300009036 | Bacteria | 3434 |
| 167 | Ga0105244_10032272 | 3300009036 | Bacteria | 2773 |
| 168 | Ga0105244_10034872 | 3300009036 | Bacteria | 2646 |
| 169 | Ga0105244_10035196 | 3300009036 | Bacteria | 2632 |
| 170 | Ga0105244_10036394 | 3300009036 | Bacteria | 2579 |
| 171 | Ga0105244_10042193 | 3300009036 | Bacteria | 2360 |
| 172 | Ga0105244_10044602 | 3300009036 | Bacteria | 2283 |
| 173 | Ga0105244_10057304 | 3300009036 | Bacteria | 1969 |
| 174 | Ga0105244_10057882 | 3300009036 | Bacteria | 1958 |
| 175 | Ga0105244_10083420 | 3300009036 | Bacteria | 1579 |
| 176 | Ga0105244_10094451 | 3300009036 | Bacteria | 1468 |
| 177 | Ga0105250_10003622 | 3300009092 | Bacteria | 7276 |
| 178 | Ga0105250_10009006 | 3300009092 | Bacteria | 4218 |
| 179 | Ga0105250_10009193 | 3300009092 | Bacteria | 4169 |
| 180 | Ga0105250_10009210 | 3300009092 | Bacteria | 4163 |
| 181 | Ga0105250_10019332 | 3300009092 | Bacteria | 2754 |
| 182 | Ga0105250_10025608 | 3300009092 | Bacteria | 2376 |
| 183 | Ga0105250_10029822 | 3300009092 | Bacteria | 2194 |
| 184 | Ga0105250_10033368 | 3300009092 | Bacteria | 2067 |
| 185 | Ga0105250_10041947 | 3300009092 | Bacteria | 1834 |
| 186 | Ga0105250_10057606 | 3300009092 | Bacteria | 1559 |
| 187 | Ga0105250_10068378 | 3300009092 | Bacteria | 1434 |
| 188 | Ga0105240_10001785 | 3300009093 | Bacteria | 36285 |
| 189 | Ga0105240_10018880 | 3300009093 | Bacteria | 9231 |
| 190 | Ga0105240_10047594 | 3300009093 | Bacteria | 5425 |
| 191 | Ga0105240_10268203 | 3300009093 | Bacteria | 1967 |
| 192 | Ga0105245_10060018 | 3300009098 | Bacteria | 3425 |
| 193 | Ga0114129_10009668 | 3300009147 | Bacteria | 13760 |
| 194 | Ga0114129_10015093 | 3300009147 | Bacteria | 10994 |
| 195 | Ga0105243_10000867 | 3300009148 | Bacteria | 28621 |
| 196 | Ga0105243_10017764 | 3300009148 | Bacteria | 5382 |
| 197 | Ga0105243_10017969 | 3300009148 | Bacteria | 5350 |
| 198 | Ga0105243_10079103 | 3300009148 | Bacteria | 2679 |
| 199 | Ga0105243_10145135 | 3300009148 | Bacteria | 2030 |
| 200 | Ga0105243_10163865 | 3300009148 | Bacteria | 1919 |
| 201 | Ga0105241_10022047 | 3300009174 | Bacteria | 4715 |
| 202 | Ga0105241_10029074 | 3300009174 | Bacteria | 4121 |
| 203 | Ga0105242_10019610 | 3300009176 | Bacteria | 5300 |
| 204 | Ga0105248_10030717 | 3300009177 | Bacteria | 6000 |
| 205 | Ga0105248_10295441 | 3300009177 | Bacteria | 1824 |
| 206 | Ga0105248_10314119 | 3300009177 | Bacteria | 1765 |
| 207 | Ga0105237_10005268 | 3300009545 | Bacteria | 14629 |
| 208 | Ga0105237_10006601 | 3300009545 | Bacteria | 12827 |
| 209 | Ga0105237_10020051 | 3300009545 | Bacteria | 6902 |
| 210 | Ga0105237_10253832 | 3300009545 | Bacteria | 1761 |
| 211 | Ga0105237_10260531 | 3300009545 | Bacteria | 1737 |
| 212 | Ga0105238_10016263 | 3300009551 | Bacteria | 7530 |
| 213 | Ga0105238_10050976 | 3300009551 | Bacteria | 4165 |
| 214 | Ga0105238_10060257 | 3300009551 | Bacteria | 3800 |
| 215 | Ga0105249_10034205 | 3300009553 | Bacteria | 4603 |
| 216 | Ga0105249_10174753 | 3300009553 | Bacteria | 2085 |
| 217 | Ga0105239_10001427 | 3300010375 | Bacteria | 31882 |
| 218 | Ga0105239_10013882 | 3300010375 | Bacteria | 8940 |
| 219 | Ga0105239_10015905 | 3300010375 | Bacteria | 8330 |
| 220 | Ga0105239_10183976 | 3300010375 | Bacteria | 2338 |
| 221 | Ga0105239_10548316 | 3300010375 | Bacteria | 1317 |
| 222 | Ga0105246_10011951 | 3300011119 | Bacteria | 5404 |
| 223 | Ga0105246_10036895 | 3300011119 | Bacteria | 3277 |
| 224 | Ga0105246_10075544 | 3300011119 | Bacteria | 2385 |
| 225 | Ga0157345_1000442 | 3300012498 | Bacteria | 4078 |
| 226 | Ga0157373_10006536 | 3300013100 | Bacteria | 8697 |
| 227 | Ga0157373_10027291 | 3300013100 | Bacteria | 4119 |
| 228 | Ga0157373_10027729 | 3300013100 | Bacteria | 4086 |
| 229 | Ga0157373_10027748 | 3300013100 | Bacteria | 4085 |
| 230 | Ga0157373_10028485 | 3300013100 | Bacteria | 4030 |
| 231 | Ga0157373_10029522 | 3300013100 | Bacteria | 3949 |
| 232 | Ga0157373_10082661 | 3300013100 | Bacteria | 2264 |
| 233 | Ga0157373_10138581 | 3300013100 | Bacteria | 1711 |
| 234 | Ga0157373_10150738 | 3300013100 | Bacteria | 1636 |
| 235 | Ga0157371_10000953 | 3300013102 | Bacteria | 32196 |
| 236 | Ga0157371_10024662 | 3300013102 | Bacteria | 4389 |
| 237 | Ga0157371_10025980 | 3300013102 | Bacteria | 4261 |
| 238 | Ga0157371_10190682 | 3300013102 | Bacteria | 1468 |
| 239 | Ga0157370_10002438 | 3300013104 | Bacteria | 22425 |
| 240 | Ga0157370_10018816 | 3300013104 | Bacteria | 6945 |
| 241 | Ga0157370_10071433 | 3300013104 | Bacteria | 3274 |
| 242 | Ga0157370_10104735 | 3300013104 | Bacteria | 2648 |
| 243 | Ga0157370_10163363 | 3300013104 | Bacteria | 2072 |
| 244 | Ga0157370_10282960 | 3300013104 | Bacteria | 1532 |
| 245 | Ga0157370_10296213 | 3300013104 | Bacteria | 1494 |
| 246 | Ga0157369_10000059 | 3300013105 | Bacteria | 154283 |
| 247 | Ga0157369_10007539 | 3300013105 | Bacteria | 12521 |
| 248 | Ga0157369_10022299 | 3300013105 | Bacteria | 7069 |
| 249 | Ga0157369_10052885 | 3300013105 | Bacteria | 4392 |
| 250 | Ga0157369_10056658 | 3300013105 | Bacteria | 4229 |
| 251 | Ga0157369_10059826 | 3300013105 | Bacteria | 4109 |
| 252 | Ga0157369_10060450 | 3300013105 | Bacteria | 4086 |
| 253 | Ga0157369_10061449 | 3300013105 | Bacteria | 4050 |
| 254 | Ga0157369_10114782 | 3300013105 | Bacteria | 2860 |
| 255 | Ga0157369_10140660 | 3300013105 | Bacteria | 2554 |
| 256 | Ga0157369_10318947 | 3300013105 | Bacteria | 1616 |
| 257 | Ga0157374_10000169 | 3300013296 | Bacteria | 60624 |
| 258 | Ga0157378_10281119 | 3300013297 | Bacteria | 1604 |
| 259 | Ga0163162_10088689 | 3300013306 | Bacteria | 3172 |
| 260 | Ga0163162_10334811 | 3300013306 | Bacteria | 1646 |
| 261 | Ga0157372_10013821 | 3300013307 | Bacteria | 8623 |
| 262 | Ga0157372_10053489 | 3300013307 | Bacteria | 4501 |
| 263 | Ga0157372_10054813 | 3300013307 | Bacteria | 4450 |
| 264 | Ga0157372_10068726 | 3300013307 | Bacteria | 3983 |
| 265 | Ga0157375_10047043 | 3300013308 | Bacteria | 4210 |
| 266 | Ga0157375_10060495 | 3300013308 | Bacteria | 3756 |
| 267 | Ga0157375_10077195 | 3300013308 | Bacteria | 3360 |
| 268 | Ga0157375_10104585 | 3300013308 | Bacteria | 2920 |
| 269 | Ga0157375_10230022 | 3300013308 | Bacteria | 2013 |
| 270 | Ga0163163_10048170 | 3300014325 | Bacteria | 4190 |
| 271 | Ga0182008_10001812 | 3300014497 | Bacteria | 13947 |
| 272 | Ga0182008_10009427 | 3300014497 | Bacteria | 5266 |
| 273 | Ga0182008_10014600 | 3300014497 | Bacteria | 4108 |
| 274 | Ga0182008_10014636 | 3300014497 | Bacteria | 4103 |
| 275 | Ga0182008_10014724 | 3300014497 | Bacteria | 4090 |
| 276 | Ga0182008_10015562 | 3300014497 | Bacteria | 3966 |
| 277 | Ga0182008_10029608 | 3300014497 | Bacteria | 2766 |
| 278 | Ga0182008_10033783 | 3300014497 | Bacteria | 2566 |
| 279 | Ga0182008_10034115 | 3300014497 | Bacteria | 2552 |
| 280 | Ga0182008_10050749 | 3300014497 | Bacteria | 2059 |
| 281 | Ga0182008_10055221 | 3300014497 | Bacteria | 1964 |
| 282 | Ga0182008_10074458 | 3300014497 | Bacteria | 1671 |
| 283 | Ga0157379_10149377 | 3300014968 | Bacteria | 2108 |
| 284 | Ga0182006_1000010 | 3300015261 | Bacteria | 413414 |
| 285 | Ga0182006_1010330 | 3300015261 | Bacteria | 4153 |
| 286 | Ga0182006_1013537 | 3300015261 | Bacteria | 3538 |
| 287 | Ga0182006_1016834 | 3300015261 | Bacteria | 3115 |
| 288 | Ga0182006_1017640 | 3300015261 | Bacteria | 3029 |
| 289 | Ga0182006_1029532 | 3300015261 | Bacteria | 2220 |
| 290 | Ga0182006_1055698 | 3300015261 | Bacteria | 1509 |
| 291 | Ga0182007_10000021 | 3300015262 | Bacteria | 193408 |
| 292 | Ga0182007_10008472 | 3300015262 | Bacteria | 4222 |
| 293 | Ga0182007_10008663 | 3300015262 | Bacteria | 4162 |
| 294 | Ga0182007_10008990 | 3300015262 | Bacteria | 4067 |
| 295 | Ga0182005_1000009 | 3300015265 | Bacteria | 455334 |
| 296 | Ga0182005_1003466 | 3300015265 | Bacteria | 5337 |
| 297 | Ga0182005_1022613 | 3300015265 | Bacteria | 1722 |
| 298 | Ga0182005_1028172 | 3300015265 | Bacteria | 1532 |
| 299 | Ga0163161_10016144 | 3300017792 | Bacteria | 5213 |
| 300 | Ga0163161_10026393 | 3300017792 | Bacteria | 4115 |
| 301 | Ga0163161_10026913 | 3300017792 | Bacteria | 4077 |
| 302 | Ga0163161_10027232 | 3300017792 | Bacteria | 4055 |
| 303 | Ga0163161_10061279 | 3300017792 | Bacteria | 2738 |
| 304 | Ga0163161_10078481 | 3300017792 | Bacteria | 2427 |
| 305 | Ga0163161_10100084 | 3300017792 | Bacteria | 2156 |
| 306 | Ga0163161_10129265 | 3300017792 | Bacteria | 1904 |
| 307 | Ga0163161_10201641 | 3300017792 | Bacteria | 1533 |
| 308 | Ga0163161_10211938 | 3300017792 | Bacteria | 1497 |
| 309 | Ga0206354_11526548 | 3300020081 | Bacteria | 1770 |
| 310 | Ga0206353_11725857 | 3300020082 | Bacteria | 1379 |
| 311 | Ga0213872_10001350 | 3300021361 | Bacteria | 16187 |
| 312 | Ga0213875_10008155 | 3300021388 | Bacteria | 5378 |
| 313 | Ga0209435_100441 | 3300025206 | Bacteria | 8419 |
| 314 | Ga0209760_100230 | 3300025207 | Bacteria | 23968 |
| 315 | Ga0209760_100611 | 3300025207 | Bacteria | 6100 |
| 316 | Ga0209784_100007 | 3300025224 | Bacteria | 747715 |
| 317 | Ga0209566_100009 | 3300025225 | Bacteria | 554018 |
| 318 | Ga0209674_100021 | 3300025226 | Bacteria | 629811 |
| 319 | Ga0209674_100041 | 3300025226 | Bacteria | 396231 |
| 320 | Ga0209674_100130 | 3300025226 | Bacteria | 119638 |
| 321 | Ga0209672_100036 | 3300025228 | Bacteria | 287801 |
| 322 | Ga0209672_100221 | 3300025228 | Bacteria | 44075 |
| 323 | Ga0209147_100009 | 3300025229 | Bacteria | 747409 |
| 324 | Ga0209147_100066 | 3300025229 | Bacteria | 232474 |
| 325 | Ga0209563_100018 | 3300025230 | Bacteria | 747850 |
| 326 | Ga0209563_100043 | 3300025230 | Bacteria | 397271 |
| 327 | Ga0209563_101799 | 3300025230 | Bacteria | 5325 |
| 328 | Ga0207427_100005 | 3300025231 | Bacteria | 797999 |
| 329 | Ga0207427_100006 | 3300025231 | Bacteria | 785415 |
| 330 | Ga0207427_100381 | 3300025231 | Bacteria | 26800 |
| 331 | Ga0209437_100013 | 3300025233 | Bacteria | 785457 |
| 332 | Ga0209437_100018 | 3300025233 | Bacteria | 694400 |
| 333 | Ga0209437_107785 | 3300025233 | Bacteria | 1729 |
| 334 | Ga0209258_100085 | 3300025242 | Bacteria | 244731 |
| 335 | Ga0209258_100237 | 3300025242 | Bacteria | 102220 |
| 336 | Ga0209258_100270 | 3300025242 | Bacteria | 89254 |
| 337 | Ga0209258_100659 | 3300025242 | Bacteria | 24988 |
| 338 | Ga0209646_1000157 | 3300025246 | Bacteria | 94054 |
| 339 | Ga0209646_1000277 | 3300025246 | Bacteria | 45368 |
| 340 | Ga0209026_1000006 | 3300025250 | Bacteria | 677225 |
| 341 | Ga0209677_100012 | 3300025253 | Bacteria | 554018 |
| 342 | Ga0209677_100711 | 3300025253 | Bacteria | 16959 |
| 343 | Ga0209677_101037 | 3300025253 | Bacteria | 13235 |
| 344 | Ga0209677_101090 | 3300025253 | Bacteria | 12773 |
| 345 | Ga0209148_1000198 | 3300025254 | Bacteria | 109136 |
| 346 | Ga0209759_1000194 | 3300025256 | Bacteria | 97047 |
| 347 | Ga0209759_1000424 | 3300025256 | Bacteria | 51523 |
| 348 | Ga0209759_1000691 | 3300025256 | Bacteria | 30300 |
| 349 | Ga0209759_1008092 | 3300025256 | Bacteria | 3309 |
| 350 | Ga0209759_1008780 | 3300025256 | Bacteria | 3120 |
| 351 | Ga0209759_1009425 | 3300025256 | Bacteria | 2953 |
| 352 | Ga0209233_1000021 | 3300025261 | Bacteria | 798078 |
| 353 | Ga0209233_1000022 | 3300025261 | Bacteria | 785415 |
| 354 | Ga0209455_1000195 | 3300025272 | Bacteria | 89254 |
| 355 | Ga0209455_1000289 | 3300025272 | Bacteria | 53897 |
| 356 | Ga0209130_1000440 | 3300025284 | Bacteria | 44209 |
| 357 | Ga0209675_1006200 | 3300025291 | Bacteria | 4849 |
| 358 | Ga0209676_1000015 | 3300025292 | Bacteria | 784458 |
| 359 | Ga0209676_1000157 | 3300025292 | Bacteria | 163094 |
| 360 | Ga0209676_1000222 | 3300025292 | Bacteria | 124695 |
| 361 | Ga0209676_1005209 | 3300025292 | Bacteria | 6894 |
| 362 | Ga0209676_1034513 | 3300025292 | Bacteria | 1495 |
| 363 | Ga0209025_1002963 | 3300025294 | Bacteria | 16867 |
| 364 | Ga0209758_1004418 | 3300025297 | Bacteria | 11713 |
| 365 | Ga0209050_1000030 | 3300025298 | Bacteria | 463381 |
| 366 | Ga0209050_1000061 | 3300025298 | Bacteria | 321435 |
| 367 | Ga0209050_1000296 | 3300025298 | Bacteria | 104732 |
| 368 | Ga0209050_1001068 | 3300025298 | Bacteria | 33633 |
| 369 | Ga0209050_1002164 | 3300025298 | Bacteria | 17803 |
| 370 | Ga0207426_1000428 | 3300025302 | Bacteria | 68777 |
| 371 | Ga0209051_1000143 | 3300025303 | Bacteria | 135182 |
| 372 | Ga0209051_1000295 | 3300025303 | Bacteria | 79621 |
| 373 | Ga0209051_1000572 | 3300025303 | Bacteria | 44529 |
| 374 | Ga0209051_1002845 | 3300025303 | Bacteria | 11927 |
| 375 | Ga0209051_1011071 | 3300025303 | Bacteria | 4487 |
| 376 | Ga0209257_1000422 | 3300025304 | Bacteria | 81630 |
| 377 | Ga0209257_1006394 | 3300025304 | Bacteria | 7613 |
| 378 | Ga0207656_10000009 | 3300025321 | Bacteria | 245637 |
| 379 | Ga0207656_10001119 | 3300025321 | Bacteria | 8805 |
| 380 | Ga0207656_10020296 | 3300025321 | Bacteria | 2640 |
| 381 | Ga0207696_1000055 | 3300025711 | Bacteria | 258289 |
| 382 | Ga0207696_1000127 | 3300025711 | Bacteria | 135531 |
| 383 | Ga0207696_1000151 | 3300025711 | Bacteria | 120171 |
| 384 | Ga0207696_1000165 | 3300025711 | Bacteria | 104683 |
| 385 | Ga0207696_1006896 | 3300025711 | Bacteria | 4516 |
| 386 | Ga0207696_1010951 | 3300025711 | Bacteria | 3297 |
| 387 | Ga0207696_1019707 | 3300025711 | Bacteria | 2189 |
| 388 | Ga0207696_1020824 | 3300025711 | Bacteria | 2107 |
| 389 | Ga0207696_1025011 | 3300025711 | Bacteria | 1867 |
| 390 | Ga0207696_1025475 | 3300025711 | Bacteria | 1844 |
| 391 | Ga0207655_1000135 | 3300025728 | Bacteria | 143597 |
| 392 | Ga0207655_1000548 | 3300025728 | Bacteria | 47302 |
| 393 | Ga0207655_1000667 | 3300025728 | Bacteria | 40487 |
| 394 | Ga0207655_1000754 | 3300025728 | Bacteria | 36294 |
| 395 | Ga0207655_1001354 | 3300025728 | Bacteria | 22999 |
| 396 | Ga0207655_1001521 | 3300025728 | Bacteria | 21107 |
| 397 | Ga0207655_1007039 | 3300025728 | Bacteria | 7363 |
| 398 | Ga0207655_1007611 | 3300025728 | Bacteria | 7003 |
| 399 | Ga0207655_1014954 | 3300025728 | Bacteria | 4345 |
| 400 | Ga0207655_1015759 | 3300025728 | Bacteria | 4180 |
| 401 | Ga0207655_1020097 | 3300025728 | Bacteria | 3455 |
| 402 | Ga0207655_1021272 | 3300025728 | Bacteria | 3298 |
| 403 | Ga0207655_1021500 | 3300025728 | Bacteria | 3272 |
| 404 | Ga0207655_1025941 | 3300025728 | Bacteria | 2828 |
| 405 | Ga0207655_1032556 | 3300025728 | Bacteria | 2380 |
| 406 | Ga0207655_1036360 | 3300025728 | Bacteria | 2185 |
| 407 | Ga0207655_1044563 | 3300025728 | Bacteria | 1863 |
| 408 | Ga0207655_1045529 | 3300025728 | Bacteria | 1831 |
| 409 | Ga0207713_1000103 | 3300025735 | Bacteria | 138415 |
| 410 | Ga0207713_1000126 | 3300025735 | Bacteria | 118913 |
| 411 | Ga0207713_1000325 | 3300025735 | Bacteria | 53895 |
| 412 | Ga0207713_1000716 | 3300025735 | Bacteria | 30986 |
| 413 | Ga0207713_1011815 | 3300025735 | Bacteria | 4714 |
| 414 | Ga0207713_1013444 | 3300025735 | Bacteria | 4312 |
| 415 | Ga0207713_1013814 | 3300025735 | Bacteria | 4232 |
| 416 | Ga0207713_1014219 | 3300025735 | Bacteria | 4150 |
| 417 | Ga0207713_1018465 | 3300025735 | Bacteria | 3452 |
| 418 | Ga0207713_1025165 | 3300025735 | Bacteria | 2756 |
| 419 | Ga0207713_1025439 | 3300025735 | Bacteria | 2733 |
| 420 | Ga0207713_1031704 | 3300025735 | Bacteria | 2332 |
| 421 | Ga0207713_1039008 | 3300025735 | Bacteria | 2009 |
| 422 | Ga0207713_1041563 | 3300025735 | Bacteria | 1917 |
| 423 | Ga0207647_10000091 | 3300025904 | Bacteria | 68421 |
| 424 | Ga0207647_10000272 | 3300025904 | Bacteria | 42247 |
| 425 | Ga0207647_10001804 | 3300025904 | Bacteria | 16408 |
| 426 | Ga0207645_10011652 | 3300025907 | Bacteria | 5996 |
| 427 | Ga0207705_10002361 | 3300025909 | Bacteria | 14597 |
| 428 | Ga0207705_10086015 | 3300025909 | Bacteria | 2297 |
| 429 | Ga0207695_10003498 | 3300025913 | Bacteria | 22039 |
| 430 | Ga0207695_10010947 | 3300025913 | Bacteria | 11032 |
| 431 | Ga0207695_10096044 | 3300025913 | Bacteria | 2966 |
| 432 | Ga0207695_10112070 | 3300025913 | Bacteria | 2707 |
| 433 | Ga0207695_10138817 | 3300025913 | Bacteria | 2382 |
| 434 | Ga0207671_10000876 | 3300025914 | Bacteria | 38121 |
| 435 | Ga0207671_10003791 | 3300025914 | Bacteria | 14837 |
| 436 | Ga0207671_10015444 | 3300025914 | Bacteria | 5977 |
| 437 | Ga0207657_10004644 | 3300025919 | Bacteria | 14507 |
| 438 | Ga0207657_10205738 | 3300025919 | Bacteria | 1581 |
| 439 | Ga0207649_10000007 | 3300025920 | Bacteria | 334217 |
| 440 | Ga0207681_10000291 | 3300025923 | Bacteria | 37201 |
| 441 | Ga0207681_10001552 | 3300025923 | Bacteria | 14792 |
| 442 | Ga0207694_10001660 | 3300025924 | Bacteria | 18654 |
| 443 | Ga0207694_10041592 | 3300025924 | Bacteria | 3542 |
| 444 | Ga0207694_10112983 | 3300025924 | Bacteria | 2162 |
| 445 | Ga0207650_10000308 | 3300025925 | Bacteria | 48275 |
| 446 | Ga0207650_10000407 | 3300025925 | Bacteria | 38580 |
| 447 | Ga0207650_10016920 | 3300025925 | Bacteria | 5100 |
| 448 | Ga0207659_10022325 | 3300025926 | Bacteria | 4213 |
| 449 | Ga0207700_10110379 | 3300025928 | Bacteria | 2212 |
| 450 | Ga0207664_10126972 | 3300025929 | Bacteria | 2143 |
| 451 | Ga0207644_10009545 | 3300025931 | Bacteria | 6373 |
| 452 | Ga0207690_10011023 | 3300025932 | Bacteria | 5389 |
| 453 | Ga0207706_10000050 | 3300025933 | Bacteria | 116811 |
| 454 | Ga0207706_10016345 | 3300025933 | Bacteria | 6699 |
| 455 | Ga0207706_10045896 | 3300025933 | Bacteria | 3870 |
| 456 | Ga0207706_10162278 | 3300025933 | Bacteria | 1964 |
| 457 | Ga0207686_10160735 | 3300025934 | Bacteria | 1574 |
| 458 | Ga0207709_10000107 | 3300025935 | Bacteria | 129240 |
| 459 | Ga0207709_10007573 | 3300025935 | Bacteria | 6032 |
| 460 | Ga0207709_10008362 | 3300025935 | Bacteria | 5726 |
| 461 | Ga0207709_10092703 | 3300025935 | Bacteria | 1978 |
| 462 | Ga0207689_10010915 | 3300025942 | Bacteria | 7809 |
| 463 | Ga0207689_10173882 | 3300025942 | Bacteria | 1776 |
| 464 | Ga0207679_10000013 | 3300025945 | Bacteria | 334197 |
| 465 | Ga0207679_10009846 | 3300025945 | Bacteria | 6136 |
| 466 | Ga0207679_10080874 | 3300025945 | Bacteria | 2482 |
| 467 | Ga0207667_10000379 | 3300025949 | Bacteria | 60157 |
| 468 | Ga0207667_10046021 | 3300025949 | Bacteria | 4619 |
| 469 | Ga0207667_10124367 | 3300025949 | Bacteria | 2657 |
| 470 | Ga0207667_10217556 | 3300025949 | Bacteria | 1957 |
| 471 | Ga0207651_10004392 | 3300025960 | Bacteria | 7097 |
| 472 | Ga0207712_10001134 | 3300025961 | Bacteria | 18557 |
| 473 | Ga0207712_10066761 | 3300025961 | Bacteria | 2572 |
| 474 | Ga0207640_10003822 | 3300025981 | Bacteria | 8122 |
| 475 | Ga0207640_10067306 | 3300025981 | Bacteria | 2396 |
| 476 | Ga0207640_10125902 | 3300025981 | Bacteria | 1844 |
| 477 | Ga0207658_10006370 | 3300025986 | Bacteria | 8057 |
| 478 | Ga0207677_10007314 | 3300026023 | Bacteria | 6097 |
| 479 | Ga0207639_10000079 | 3300026041 | Bacteria | 83859 |
| 480 | Ga0207639_10011033 | 3300026041 | Bacteria | 6266 |
| 481 | Ga0207678_10001000 | 3300026067 | Bacteria | 25729 |
| 482 | Ga0207678_10173025 | 3300026067 | Bacteria | 1844 |
| 483 | Ga0207702_10014223 | 3300026078 | Bacteria | 6609 |
| 484 | Ga0207648_10013130 | 3300026089 | Bacteria | 7721 |
| 485 | Ga0207648_10181471 | 3300026089 | Bacteria | 1863 |
| 486 | Ga0207674_10033449 | 3300026116 | Bacteria | 5383 |
| 487 | Ga0207674_10036724 | 3300026116 | Bacteria | 5101 |
| 488 | Ga0207674_10053121 | 3300026116 | Bacteria | 4130 |
| 489 | Ga0207675_100029012 | 3300026118 | Bacteria | 5155 |
| 490 | Ga0207683_10032577 | 3300026121 | Bacteria | 4527 |
| 491 | Ga0207683_10151050 | 3300026121 | Bacteria | 2096 |
| 492 | Ga0209281_1000091 | 3300027111 | Bacteria | 242588 |
| 493 | Ga0209281_1003801 | 3300027111 | Bacteria | 4786 |
| 494 | Ga0209281_1011417 | 3300027111 | Bacteria | 1991 |
| 495 | Ga0209281_1012731 | 3300027111 | Bacteria | 1836 |
| 496 | Ga0209389_1000065 | 3300027296 | Bacteria | 102064 |
| 497 | Ga0209389_1021659 | 3300027296 | Bacteria | 5713 |
| 498 | Ga0209371_1000073 | 3300027312 | Bacteria | 199474 |
| 499 | Ga0209371_1000775 | 3300027312 | Bacteria | 26456 |
| 500 | Ga0209969_1000072 | 3300027360 | Bacteria | 12262 |
| 501 | Ga0209967_1003726 | 3300027364 | Bacteria | 2011 |
| 502 | Ga0209981_1000108 | 3300027378 | Bacteria | 9363 |
| 503 | Ga0209996_1004305 | 3300027395 | Bacteria | 1809 |
| 504 | Ga0210000_1000423 | 3300027462 | Bacteria | 5831 |
| 505 | Ga0209995_1001435 | 3300027471 | Bacteria | 3678 |
| 506 | Ga0209968_1003403 | 3300027526 | Bacteria | 2391 |
| 507 | Ga0209999_1000212 | 3300027543 | Bacteria | 8165 |
| 508 | Ga0209983_1001173 | 3300027665 | Bacteria | 5791 |
| 509 | Ga0209983_1006675 | 3300027665 | Bacteria | 2369 |
| 510 | Ga0209971_1001954 | 3300027682 | Bacteria | 5030 |
| 511 | Ga0209966_1009664 | 3300027695 | Bacteria | 1727 |
| 512 | Ga0209974_10009674 | 3300027876 | Bacteria | 3269 |
| 513 | Ga0209974_10010740 | 3300027876 | Bacteria | 3085 |
| 514 | Ga0207428_10060798 | 3300027907 | Bacteria | 2992 |
| 515 | Ga0207428_10074405 | 3300027907 | Bacteria | 2664 |
| 516 | Ga0207428_10144090 | 3300027907 | Bacteria | 1817 |
| 517 | Ga0207428_10151253 | 3300027907 | Bacteria | 1767 |
| 518 | Ga0207428_10175230 | 3300027907 | Bacteria | 1623 |
| 519 | Ga0207428_10193243 | 3300027907 | Bacteria | 1534 |
| 520 | Ga0268266_10000006 | 3300028379 | Bacteria | 1410021 |
| 521 | Ga0268266_10017690 | 3300028379 | Bacteria | 6076 |
| 522 | Ga0268264_10032366 | 3300028381 | Bacteria | 4290 |
| 523 | Ga0268264_10285339 | 3300028381 | Bacteria | 1548 |
| 524 | Ga0265336_10000189 | 3300028666 | Bacteria | 42983 |
| 525 | Ga0307515_10000104 | 3300028794 | Bacteria | 198238 |
| 526 | Ga0307515_10005049 | 3300028794 | Bacteria | 26858 |
| 527 | Ga0307515_10005461 | 3300028794 | Bacteria | 25733 |
| 528 | Ga0307515_10037602 | 3300028794 | Bacteria | 7778 |
| 529 | Ga0265338_10107072 | 3300028800 | Bacteria | 2262 |
| 530 | Ga0265324_10000255 | 3300029957 | Bacteria | 39393 |
| 531 | Ga0268256_1000247 | 3300030500 | Bacteria | 57439 |
| 532 | Ga0268256_1001404 | 3300030500 | Bacteria | 14601 |
| 533 | Ga0307511_10030120 | 3300030521 | Bacteria | 4881 |
| 534 | Ga0314311_1025917 | 3300030733 | Bacteria | 3125 |
| 535 | Ga0316178_1123526 | 3300030735 | Bacteria | 9747 |
| 536 | Ga0316183_1118649 | 3300030742 | Bacteria | 2188 |
| 537 | Ga0316183_1178545 | 3300030742 | Bacteria | 4345 |
| 538 | Ga0265332_10006593 | 3300031238 | Bacteria | 5261 |
| 539 | Ga0265329_10027195 | 3300031242 | Bacteria | 1881 |
| 540 | Ga0265340_10011527 | 3300031247 | Bacteria | 4697 |
| 541 | Ga0265339_10000801 | 3300031249 | Bacteria | 24249 |
| 542 | Ga0265316_10040536 | 3300031344 | Bacteria | 3733 |
| 543 | Ga0307513_10000034 | 3300031456 | Bacteria | 185012 |
| 544 | Ga0307513_10002789 | 3300031456 | Bacteria | 23982 |
| 545 | Ga0307513_10030775 | 3300031456 | Bacteria | 6092 |
| 546 | Ga0307509_10003313 | 3300031507 | Bacteria | 24671 |
| 547 | Ga0307408_100000028 | 3300031548 | Bacteria | 233440 |
| 548 | Ga0307408_100000338 | 3300031548 | Bacteria | 44357 |
| 549 | Ga0307408_100026625 | 3300031548 | Bacteria | 3976 |
| 550 | Ga0307408_100036015 | 3300031548 | Bacteria | 3475 |
| 551 | Ga0307408_100056151 | 3300031548 | Bacteria | 2854 |
| 552 | Ga0307408_100119184 | 3300031548 | Bacteria | 2041 |
| 553 | Ga0265313_10000307 | 3300031595 | Bacteria | 53087 |
| 554 | Ga0307514_10003090 | 3300031649 | Bacteria | 16388 |
| 555 | Ga0265342_10000100 | 3300031712 | Bacteria | 94554 |
| 556 | Ga0307516_10000897 | 3300031730 | Bacteria | 40914 |
| 557 | Ga0307516_10006945 | 3300031730 | Bacteria | 13137 |
| 558 | Ga0307516_10009346 | 3300031730 | Bacteria | 10945 |
| 559 | Ga0307516_10013621 | 3300031730 | Bacteria | 8642 |
| 560 | Ga0307516_10050576 | 3300031730 | Bacteria | 4077 |
| 561 | Ga0307516_10050777 | 3300031730 | Bacteria | 4067 |
| 562 | Ga0307405_10013526 | 3300031731 | Bacteria | 4356 |
| 563 | Ga0307405_10015744 | 3300031731 | Bacteria | 4103 |
| 564 | Ga0307405_10016560 | 3300031731 | Bacteria | 4022 |
| 565 | Ga0307405_10059682 | 3300031731 | Bacteria | 2404 |
| 566 | Ga0307413_10079353 | 3300031824 | Bacteria | 2098 |
| 567 | Ga0307413_10084560 | 3300031824 | Bacteria | 2045 |
| 568 | Ga0307413_10125521 | 3300031824 | Bacteria | 1747 |
| 569 | Ga0307410_10145750 | 3300031852 | Bacteria | 1757 |
| 570 | Ga0307406_10106134 | 3300031901 | Bacteria | 1923 |
| 571 | Ga0307412_10018660 | 3300031911 | Bacteria | 4180 |
| 572 | Ga0307412_10020551 | 3300031911 | Bacteria | 4021 |
| 573 | Ga0307412_10020661 | 3300031911 | Bacteria | 4010 |
| 574 | Ga0307412_10023350 | 3300031911 | Bacteria | 3804 |
| 575 | Ga0307412_10041635 | 3300031911 | Bacteria | 2978 |
| 576 | Ga0307412_10058169 | 3300031911 | Bacteria | 2584 |
| 577 | Ga0307409_100025004 | 3300031995 | Bacteria | 4179 |
| 578 | Ga0307409_100070387 | 3300031995 | Bacteria | 2776 |
| 579 | Ga0307416_100016949 | 3300032002 | Bacteria | 5081 |
| 580 | Ga0307416_100025732 | 3300032002 | Bacteria | 4321 |
| 581 | Ga0307416_100146046 | 3300032002 | Bacteria | 2159 |
| 582 | Ga0307414_10006140 | 3300032004 | Bacteria | 6674 |
| 583 | Ga0307414_10023837 | 3300032004 | Bacteria | 3889 |
| 584 | Ga0307414_10056148 | 3300032004 | Bacteria | 2760 |
| 585 | Ga0307411_10017935 | 3300032005 | Bacteria | 4049 |
| 586 | Ga0307411_10053502 | 3300032005 | Bacteria | 2645 |
| 587 | Ga0307411_10236690 | 3300032005 | Bacteria | 1427 |
| 588 | Ga0307510_10054664 | 3300033180 | Bacteria | 4178 |
| 589 | Ga0373926_0025936 | 3300035083 | Bacteria | 2048 |
| 590 | Ga0373931_0000552 | 3300035691 | Bacteria | 15381 |
| 591 | Ga0373927_0020208 | 3300035695 | Bacteria | 4366 |
| 592 | Ga0373927_0075028 | 3300035695 | Bacteria | 2190 |
| 593 | Ga0395899_0000036 | 3300037312 | Bacteria | 289502 |
| 594 | Ga0395899_0000714 | 3300037312 | Bacteria | 33286 |
| 595 | Ga0395899_0018524 | 3300037312 | Bacteria | 5292 |
| 596 | Ga0395900_0000071 | 3300037418 | Bacteria | 187816 |
| 597 | Ga0395900_0036795 | 3300037418 | Bacteria | 5045 |
| 598 | Ga0395900_0109555 | 3300037418 | Bacteria | 2837 |
| 599 | Ga0395900_0116347 | 3300037418 | Bacteria | 2743 |
| 600 | Ga0395898_0000115 | 3300037466 | Bacteria | 211806 |
| 601 | Ga0395898_0012451 | 3300037466 | Bacteria | 8795 |
| 602 | Ga0395898_0085204 | 3300037466 | Bacteria | 3045 |
| 603 | Ga0395898_0096604 | 3300037466 | Bacteria | 2838 |
| 604 | Ga0395905_0001506 | 3300037471 | Bacteria | 27863 |
| 605 | Ga0436364_1525509 | 3300037853 | Bacteria | 7135 |
| 606 | Ga0395901_0000004 | 3300038443 | Bacteria | 657361 |
| 607 | Ga0395901_0001368 | 3300038443 | Bacteria | 25522 |
| 608 | Ga0395901_0158453 | 3300038443 | Bacteria | 2377 |
| 609 | Ga0436361_0466601 | 3300039447 | Bacteria | 36969 |
| 610 | Ga0436361_1053838 | 3300039447 | Bacteria | 4275 |
| 611 | Ga0439436_0000225 | 3300041404 | Bacteria | 13580 |
| 612 | Ga0439438_002200 | 3300041405 | Bacteria | 8386 |
| 613 | Ga0439438_004067 | 3300041405 | Bacteria | 5732 |
| 614 | Ga0439438_005970 | 3300041405 | Bacteria | 4392 |
| 615 | Ga0439438_005973 | 3300041405 | Bacteria | 4391 |
| 616 | Ga0439438_006320 | 3300041405 | Bacteria | 4203 |
| 617 | Ga0439438_006365 | 3300041405 | Bacteria | 4180 |
| 618 | Ga0439438_006499 | 3300041405 | Bacteria | 4114 |
| 619 | Ga0439438_006519 | 3300041405 | Bacteria | 4105 |
| 620 | Ga0439438_006743 | 3300041405 | Bacteria | 4008 |
| 621 | Ga0439438_006761 | 3300041405 | Bacteria | 4003 |
| 622 | Ga0439438_006831 | 3300041405 | Bacteria | 3977 |
| 623 | Ga0439438_014045 | 3300041405 | Bacteria | 2393 |
| 624 | Ga0439438_022521 | 3300041405 | Bacteria | 1746 |
| 625 | Ga0439439_0030447 | 3300041406 | Bacteria | 1372 |
| 626 | Ga0439447_002459 | 3300041407 | Bacteria | 6741 |
| 627 | Ga0439447_003125 | 3300041407 | Bacteria | 5907 |
| 628 | Ga0439447_004709 | 3300041407 | Bacteria | 4651 |
| 629 | Ga0439447_005458 | 3300041407 | Bacteria | 4231 |
| 630 | Ga0439447_009499 | 3300041407 | Bacteria | 2942 |
| 631 | Ga0439447_014228 | 3300041407 | Bacteria | 2236 |
| 632 | Ga0439447_020490 | 3300041407 | Bacteria | 1753 |
| 633 | Ga0439447_025009 | 3300041407 | Bacteria | 1541 |
| 634 | Ga0439466_0000796 | 3300041411 | Bacteria | 11984 |
| 635 | Ga0439466_0004708 | 3300041411 | Bacteria | 5245 |
| 636 | Ga0439466_0005092 | 3300041411 | Bacteria | 5038 |
| 637 | Ga0439466_0007368 | 3300041411 | Bacteria | 4167 |
| 638 | Ga0439466_0009753 | 3300041411 | Bacteria | 3580 |
| 639 | Ga0439466_0013980 | 3300041411 | Bacteria | 2930 |
| 640 | Ga0439466_0020978 | 3300041411 | Bacteria | 2322 |
| 641 | Ga0439466_0026003 | 3300041411 | Bacteria | 2038 |
| 642 | Ga0439466_0032009 | 3300041411 | Bacteria | 1795 |
| 643 | Ga0439466_0033250 | 3300041411 | Bacteria | 1753 |
| 644 | Ga0439466_0038739 | 3300041411 | Bacteria | 1600 |
| 645 | Ga0439465_0025204 | 3300041413 | Bacteria | 1876 |
| 646 | Ga0439465_0043143 | 3300041413 | Bacteria | 1463 |
| 647 | Ga0451839_1109028 | 3300041496 | Bacteria | 1791 |
| 648 | Ga0451853_0711122 | 3300041512 | Bacteria | 1395 |
| 649 | Ga0439431_0003906 | 3300041997 | Bacteria | 3288 |
| 650 | Ga0439431_0012654 | 3300041997 | Bacteria | 1941 |
| 651 | Ga0439445_0013584 | 3300042004 | Bacteria | 1972 |
| 652 | Ga0439445_0018474 | 3300042004 | Bacteria | 1731 |
| 653 | Ga0439448_0000581 | 3300042005 | Bacteria | 8578 |
| 654 | Ga0439432_001654 | 3300042006 | Bacteria | 8345 |
| 655 | Ga0439432_005913 | 3300042006 | Bacteria | 4391 |
| 656 | Ga0439432_006204 | 3300042006 | Bacteria | 4280 |
| 657 | Ga0439432_006953 | 3300042006 | Bacteria | 4026 |
| 658 | Ga0439432_007015 | 3300042006 | Bacteria | 4006 |
| 659 | Ga0439432_010771 | 3300042006 | Bacteria | 3160 |
| 660 | Ga0439432_017464 | 3300042006 | Bacteria | 2407 |
| 661 | Ga0439449_0000464 | 3300042007 | Bacteria | 15110 |
| 662 | Ga0439449_0005192 | 3300042007 | Bacteria | 4997 |
| 663 | Ga0439451_003295 | 3300042009 | Bacteria | 3277 |
| 664 | Ga0439451_006019 | 3300042009 | Bacteria | 2478 |
| 665 | Ga0439451_008503 | 3300042009 | Bacteria | 2081 |
| 666 | Ga0439452_000130 | 3300042010 | Bacteria | 57394 |
| 667 | Ga0439452_003722 | 3300042010 | Bacteria | 5269 |
| 668 | Ga0439452_005386 | 3300042010 | Bacteria | 4118 |
| 669 | Ga0439452_005491 | 3300042010 | Bacteria | 4074 |
| 670 | Ga0439452_005745 | 3300042010 | Bacteria | 3964 |
| 671 | Ga0439452_009541 | 3300042010 | Bacteria | 2853 |
| 672 | Ga0439452_011783 | 3300042010 | Bacteria | 2504 |
| 673 | Ga0439452_012672 | 3300042010 | Bacteria | 2389 |
| 674 | Ga0439452_019181 | 3300042010 | Bacteria | 1812 |
| 675 | Ga0439452_023796 | 3300042010 | Bacteria | 1572 |
| 676 | Ga0439452_029483 | 3300042010 | Bacteria | 1361 |
| 677 | Ga0439456_000036 | 3300042013 | Bacteria | 49413 |
| 678 | Ga0439456_001886 | 3300042013 | Bacteria | 4225 |
| 679 | Ga0439456_002202 | 3300042013 | Bacteria | 3922 |
| 680 | Ga0439456_010498 | 3300042013 | Bacteria | 1914 |
| 681 | Ga0439456_015419 | 3300042013 | Bacteria | 1595 |
| 682 | Ga0439456_016827 | 3300042013 | Bacteria | 1530 |
| 683 | Ga0439456_017209 | 3300042013 | Bacteria | 1515 |
| 684 | Ga0439462_0001819 | 3300042015 | Bacteria | 4832 |
| 685 | Ga0439463_001273 | 3300042016 | Bacteria | 6738 |
| 686 | Ga0439463_001697 | 3300042016 | Bacteria | 5766 |
| 687 | Ga0439463_002033 | 3300042016 | Bacteria | 5250 |
| 688 | Ga0439463_008109 | 3300042016 | Bacteria | 2591 |
| 689 | Ga0439463_014299 | 3300042016 | Bacteria | 1956 |
| 690 | Ga0439463_017672 | 3300042016 | Bacteria | 1770 |
| 691 | Ga0439463_022200 | 3300042016 | Bacteria | 1587 |
| 692 | Ga0439463_022382 | 3300042016 | Bacteria | 1581 |
| 693 | Ga0450911_000027 | 3300042115 | Bacteria | 82476 |
| 694 | Ga0450911_002156 | 3300042115 | Bacteria | 4004 |
| 695 | Ga0450911_005048 | 3300042115 | Bacteria | 2086 |
| 696 | Ga0450919_002076 | 3300042121 | Bacteria | 2600 |
| 697 | Ga0450922_001625 | 3300042124 | Bacteria | 2198 |
| 698 | Ga0450923_009272 | 3300042125 | Bacteria | 1718 |
| 699 | Ga0450890_003479 | 3300042127 | Bacteria | 2091 |
| 700 | Ga0450898_011868 | 3300042134 | Bacteria | 1431 |
| 701 | Ga0450902_001681 | 3300042137 | Bacteria | 3046 |
| 702 | Ga0450903_008964 | 3300042138 | Bacteria | 1634 |
| 703 | Ga0450904_000135 | 3300042139 | Bacteria | 16319 |
| 704 | Ga0450904_001911 | 3300042139 | Bacteria | 2684 |
| 705 | Ga0450905_000251 | 3300042142 | Bacteria | 6264 |
| 706 | Ga0450906_009115 | 3300042145 | Bacteria | 1899 |
| 707 | Ga0450907_000328 | 3300042146 | Bacteria | 15121 |
| 708 | Ga0450907_012909 | 3300042146 | Bacteria | 1391 |
| 709 | Ga0450910_000604 | 3300042147 | Bacteria | 4280 |
| 710 | Ga0450910_002175 | 3300042147 | Bacteria | 2561 |
| 711 | Ga0450910_003725 | 3300042147 | Bacteria | 2034 |
| 712 | Ga0439446_0000014 | 3300042156 | Bacteria | 39067 |
| 713 | Ga0439446_0021432 | 3300042156 | Bacteria | 1826 |
| 714 | Ga0450908_008616 | 3300042184 | Bacteria | 1908 |
| 715 | Ga0450909_001936 | 3300042185 | Bacteria | 2923 |
| 716 | Ga0450909_005675 | 3300042185 | Bacteria | 1796 |
| 717 | Ga0439434_0002300 | 3300042435 | Bacteria | 5551 |
| 718 | Ga0439464_0020896 | 3300042439 | Bacteria | 1794 |
| 719 | Ga0439460_0002952 | 3300042461 | Bacteria | 4098 |
| 720 | Ga0450916_000275 | 3300042530 | Bacteria | 4059 |
| 721 | Ga0450901_002167 | 3300042533 | Bacteria | 2158 |
| 722 | Ga0451577_0014309 | 3300042876 | Bacteria | 7396 |
| 723 | Ga0451577_0024496 | 3300042876 | Bacteria | 5490 |
| 724 | Ga0451577_0026154 | 3300042876 | Bacteria | 5286 |
| 725 | Ga0439440_0001756 | 3300042993 | Bacteria | 3997 |
| 726 | Ga0439440_0015796 | 3300042993 | Bacteria | 1644 |
| 727 | Ga0466969_0011303 | 3300044656 | Bacteria | 4727 |
| 728 | Ga0466972_0012303 | 3300044658 | Bacteria | 4301 |
| 729 | Ga0453683_0000328 | 3300044673 | Bacteria | 58409 |
| 730 | Ga0453683_0004904 | 3300044673 | Bacteria | 9397 |
| 731 | Ga0453683_0007818 | 3300044673 | Bacteria | 7222 |
| 732 | Ga0466965_0000089 | 3300044683 | Bacteria | 26574 |
| 733 | Ga0466965_0018474 | 3300044683 | Bacteria | 3342 |
| 734 | Ga0466965_0029001 | 3300044683 | Bacteria | 2691 |
| 735 | Ga0466966_0000011 | 3300044684 | Bacteria | 136987 |
| 736 | Ga0466966_0001297 | 3300044684 | Bacteria | 15995 |
| 737 | Ga0466966_0006083 | 3300044684 | Bacteria | 7973 |
| 738 | Ga0466966_0007670 | 3300044684 | Bacteria | 7152 |
| 739 | Ga0466966_0051452 | 3300044684 | Bacteria | 2618 |
| 740 | Ga0466961_0000210 | 3300044693 | Bacteria | 39137 |
| 741 | Ga0466961_0000372 | 3300044693 | Bacteria | 29038 |
| 742 | Ga0466961_0055685 | 3300044693 | Bacteria | 2520 |
| 743 | Ga0466963_0002174 | 3300044694 | Bacteria | 10828 |
| 744 | Ga0466963_0002861 | 3300044694 | Bacteria | 9745 |
| 745 | Ga0466963_0004620 | 3300044694 | Bacteria | 8027 |
| 746 | Ga0466964_0007901 | 3300044706 | Bacteria | 3983 |
| 747 | Ga0466964_0023540 | 3300044706 | Bacteria | 2394 |
| 748 | Ga0453684_0334467 | 3300044712 | Bacteria | 1712 |
| 749 | Ga0466971_0002989 | 3300044719 | Bacteria | 7183 |
| 750 | Ga0466971_0027909 | 3300044719 | Bacteria | 2527 |
| 751 | Ga0466968_0003337 | 3300044735 | Bacteria | 5927 |
| 752 | Ga0466968_0022741 | 3300044735 | Bacteria | 2550 |
| 753 | Ga0466970_0017932 | 3300044765 | Bacteria | 3662 |
| 754 | Ga0466957_0005059 | 3300044842 | Bacteria | 7380 |
| 755 | Ga0466957_0008447 | 3300044842 | Bacteria | 5857 |
| 756 | Ga0466957_0015152 | 3300044842 | Bacteria | 4499 |
| 757 | Ga0466959_0001660 | 3300045049 | Bacteria | 13784 |
| 758 | Ga0466959_0001900 | 3300045049 | Bacteria | 13149 |
| 759 | Ga0466959_0005828 | 3300045049 | Bacteria | 8486 |
| 760 | Ga0466959_0011539 | 3300045049 | Bacteria | 6351 |
| 761 | Ga0451576_0000695 | 3300045051 | Bacteria | 68253 |
| 762 | Ga0451576_0009989 | 3300045051 | Bacteria | 10942 |
| 763 | Ga0451576_0301730 | 3300045051 | Bacteria | 1675 |
| 764 | Ga0466958_0002609 | 3300045836 | Bacteria | 9105 |
| 765 | Ga0466958_0014114 | 3300045836 | Bacteria | 4557 |
| 766 | Ga0466958_0016177 | 3300045836 | Bacteria | 4291 |
| 767 | Ga0466967_0032689 | 3300045976 | Bacteria | 4396 |
| 768 | Ga0466967_0115853 | 3300045976 | Bacteria | 2468 |
| 769 | Ga0495617_006004 | 3300046452 | Bacteria | 4282 |
| 770 | Ga0495617_015682 | 3300046452 | Bacteria | 2565 |
| 771 | Ga0495617_026342 | 3300046452 | Bacteria | 1957 |
| 772 | Ga0495627_000115 | 3300046453 | Bacteria | 99960 |
| 773 | Ga0495627_000869 | 3300046453 | Bacteria | 21472 |
| 774 | Ga0495627_004307 | 3300046453 | Bacteria | 5984 |
| 775 | Ga0495627_008096 | 3300046453 | Bacteria | 3962 |
| 776 | Ga0495627_022986 | 3300046453 | Bacteria | 2047 |
| 777 | Ga0495627_023468 | 3300046453 | Bacteria | 2020 |
| 778 | Ga0495627_027309 | 3300046453 | Bacteria | 1832 |
| 779 | Ga0495627_029811 | 3300046453 | Bacteria | 1732 |
| 780 | Ga0495603_0003108 | 3300046455 | Bacteria | 9864 |
| 781 | Ga0495590_0014737 | 3300046457 | Bacteria | 2850 |
| 782 | Ga0495590_0033615 | 3300046457 | Bacteria | 1792 |
| 783 | Ga0495590_0033893 | 3300046457 | Bacteria | 1784 |
| 784 | Ga0495590_0044684 | 3300046457 | Bacteria | 1544 |
| 785 | Ga0495591_000061 | 3300046458 | Bacteria | 126594 |
| 786 | Ga0495591_000334 | 3300046458 | Bacteria | 42109 |
| 787 | Ga0495591_000628 | 3300046458 | Bacteria | 26285 |
| 788 | Ga0495591_002793 | 3300046458 | Bacteria | 9401 |
| 789 | Ga0495591_004212 | 3300046458 | Bacteria | 7128 |
| 790 | Ga0495591_006168 | 3300046458 | Bacteria | 5359 |
| 791 | Ga0495591_008800 | 3300046458 | Bacteria | 4089 |
| 792 | Ga0495591_009192 | 3300046458 | Bacteria | 3950 |
| 793 | Ga0495591_019015 | 3300046458 | Bacteria | 2312 |
| 794 | Ga0495591_023045 | 3300046458 | Bacteria | 2002 |
| 795 | Ga0495591_023079 | 3300046458 | Bacteria | 2000 |
| 796 | Ga0495591_026451 | 3300046458 | Bacteria | 1802 |
| 797 | Ga0495591_030832 | 3300046458 | Bacteria | 1615 |
| 798 | Ga0495591_031082 | 3300046458 | Bacteria | 1605 |
| 799 | Ga0495591_040254 | 3300046458 | Bacteria | 1333 |
| 800 | Ga0495629_0004392 | 3300046459 | Bacteria | 10561 |
| 801 | Ga0495629_0063569 | 3300046459 | Bacteria | 2577 |
| 802 | Ga0495638_0022540 | 3300046460 | Bacteria | 4133 |
| 803 | Ga0495638_0023306 | 3300046460 | Bacteria | 4050 |
| 804 | Ga0495638_0024472 | 3300046460 | Bacteria | 3937 |
| 805 | Ga0495638_0075785 | 3300046460 | Bacteria | 2049 |
| 806 | Ga0495638_0078804 | 3300046460 | Bacteria | 2004 |
| 807 | Ga0495638_0078998 | 3300046460 | Bacteria | 2001 |
| 808 | Ga0495638_0092394 | 3300046460 | Bacteria | 1821 |
| 809 | Ga0495638_0093145 | 3300046460 | Bacteria | 1812 |
| 810 | Ga0495638_0094204 | 3300046460 | Bacteria | 1800 |
| 811 | Ga0495638_0098647 | 3300046460 | Bacteria | 1750 |
| 812 | Ga0495638_0102624 | 3300046460 | Bacteria | 1708 |
| 813 | Ga0495638_0105579 | 3300046460 | Bacteria | 1678 |
| 814 | Ga0495653_0008489 | 3300046463 | Bacteria | 8422 |
| 815 | Ga0495653_0029892 | 3300046463 | Bacteria | 4343 |
| 816 | Ga0495653_0061267 | 3300046463 | Bacteria | 2847 |
| 817 | Ga0495653_0080332 | 3300046463 | Bacteria | 2412 |
| 818 | Ga0495653_0099975 | 3300046463 | Bacteria | 2103 |
| 819 | Ga0495653_0171227 | 3300046463 | Bacteria | 1498 |
| 820 | Ga0495650_0001603 | 3300046471 | Bacteria | 21154 |
| 821 | Ga0495650_0006532 | 3300046471 | Bacteria | 7246 |
| 822 | Ga0495650_0015289 | 3300046471 | Bacteria | 3942 |
| 823 | Ga0495650_0032641 | 3300046471 | Bacteria | 2326 |
| 824 | Ga0495650_0039947 | 3300046471 | Bacteria | 2019 |
| 825 | Ga0495650_0044138 | 3300046471 | Bacteria | 1886 |
| 826 | Ga0495650_0044202 | 3300046471 | Bacteria | 1884 |
| 827 | Ga0495650_0047490 | 3300046471 | Bacteria | 1795 |
| 828 | Ga0495580_0002591 | 3300046472 | Bacteria | 15728 |
| 829 | Ga0495605_0000376 | 3300046474 | Bacteria | 42124 |
| 830 | Ga0495605_0000441 | 3300046474 | Bacteria | 37414 |
| 831 | Ga0495605_0001221 | 3300046474 | Bacteria | 17091 |
| 832 | Ga0495605_0004763 | 3300046474 | Bacteria | 7929 |
| 833 | Ga0495605_0010819 | 3300046474 | Bacteria | 5096 |
| 834 | Ga0495605_0016196 | 3300046474 | Bacteria | 4038 |
| 835 | Ga0495605_0030882 | 3300046474 | Bacteria | 2741 |
| 836 | Ga0495605_0047069 | 3300046474 | Bacteria | 2116 |
| 837 | Ga0495605_0047337 | 3300046474 | Bacteria | 2110 |
| 838 | Ga0495639_0009832 | 3300046475 | Bacteria | 4106 |
| 839 | Ga0495639_0058928 | 3300046475 | Bacteria | 1757 |
| 840 | Ga0495639_0087005 | 3300046475 | Bacteria | 1462 |
| 841 | Ga0495662_0063874 | 3300046476 | Bacteria | 1779 |
| 842 | Ga0495664_0005113 | 3300046477 | Bacteria | 7193 |
| 843 | Ga0495584_0007969 | 3300046491 | Bacteria | 5505 |
| 844 | Ga0495584_0011920 | 3300046491 | Bacteria | 4443 |
| 845 | Ga0495584_0013290 | 3300046491 | Bacteria | 4202 |
| 846 | Ga0495584_0017193 | 3300046491 | Bacteria | 3685 |
| 847 | Ga0495584_0029322 | 3300046491 | Bacteria | 2788 |
| 848 | Ga0495584_0036252 | 3300046491 | Bacteria | 2491 |
| 849 | Ga0495584_0038208 | 3300046491 | Bacteria | 2426 |
| 850 | Ga0495584_0043553 | 3300046491 | Bacteria | 2265 |
| 851 | Ga0495584_0046847 | 3300046491 | Bacteria | 2180 |
| 852 | Ga0495584_0046957 | 3300046491 | Bacteria | 2177 |
| 853 | Ga0495584_0048906 | 3300046491 | Bacteria | 2131 |
| 854 | Ga0495584_0050134 | 3300046491 | Bacteria | 2102 |
| 855 | Ga0495584_0054077 | 3300046491 | Bacteria | 2020 |
| 856 | Ga0495584_0097176 | 3300046491 | Bacteria | 1487 |
| 857 | Ga0495584_0103246 | 3300046491 | Bacteria | 1441 |
| 858 | Ga0495585_0009776 | 3300046492 | Bacteria | 5738 |
| 859 | Ga0495585_0010924 | 3300046492 | Bacteria | 5395 |
| 860 | Ga0495585_0018037 | 3300046492 | Bacteria | 4072 |
| 861 | Ga0495585_0025281 | 3300046492 | Bacteria | 3403 |
| 862 | Ga0495585_0038450 | 3300046492 | Bacteria | 2693 |
| 863 | Ga0495585_0055565 | 3300046492 | Bacteria | 2187 |
| 864 | Ga0495585_0066260 | 3300046492 | Bacteria | 1977 |
| 865 | Ga0495585_0073689 | 3300046492 | Bacteria | 1858 |
| 866 | Ga0495585_0075512 | 3300046492 | Bacteria | 1832 |
| 867 | Ga0495585_0077657 | 3300046492 | Bacteria | 1802 |
| 868 | Ga0495585_0083679 | 3300046492 | Bacteria | 1726 |
| 869 | Ga0495594_0032304 | 3300046499 | Bacteria | 2840 |
| 870 | Ga0495594_0092949 | 3300046499 | Bacteria | 1691 |
| 871 | Ga0495594_0115021 | 3300046499 | Bacteria | 1518 |
| 872 | Ga0495596_0004405 | 3300046500 | Bacteria | 6873 |
| 873 | Ga0495596_0036356 | 3300046500 | Bacteria | 1951 |
| 874 | Ga0495607_0000147 | 3300046501 | Bacteria | 74197 |
| 875 | Ga0495607_0000560 | 3300046501 | Bacteria | 36227 |
| 876 | Ga0495607_0000747 | 3300046501 | Bacteria | 31132 |
| 877 | Ga0495607_0000751 | 3300046501 | Bacteria | 31037 |
| 878 | Ga0495607_0002973 | 3300046501 | Bacteria | 13288 |
| 879 | Ga0495607_0005110 | 3300046501 | Bacteria | 9488 |
| 880 | Ga0495607_0008448 | 3300046501 | Bacteria | 7035 |
| 881 | Ga0495607_0012768 | 3300046501 | Bacteria | 5528 |
| 882 | Ga0495607_0017578 | 3300046501 | Bacteria | 4585 |
| 883 | Ga0495607_0019645 | 3300046501 | Bacteria | 4288 |
| 884 | Ga0495607_0020345 | 3300046501 | Bacteria | 4197 |
| 885 | Ga0495607_0028688 | 3300046501 | Bacteria | 3431 |
| 886 | Ga0495607_0039642 | 3300046501 | Bacteria | 2812 |
| 887 | Ga0495607_0068672 | 3300046501 | Bacteria | 1986 |
| 888 | Ga0495607_0073646 | 3300046501 | Bacteria | 1898 |
| 889 | Ga0495607_0082298 | 3300046501 | Bacteria | 1766 |
| 890 | Ga0495607_0093523 | 3300046501 | Bacteria | 1623 |
| 891 | Ga0495607_0100249 | 3300046501 | Bacteria | 1553 |
| 892 | Ga0495607_0101689 | 3300046501 | Bacteria | 1538 |
| 893 | Ga0495583_0000026 | 3300046506 | Bacteria | 256777 |
| 894 | Ga0495583_0000982 | 3300046506 | Bacteria | 32675 |
| 895 | Ga0495583_0001389 | 3300046506 | Bacteria | 24734 |
| 896 | Ga0495583_0002607 | 3300046506 | Bacteria | 15077 |
| 897 | Ga0495583_0004827 | 3300046506 | Bacteria | 9435 |
| 898 | Ga0495583_0008616 | 3300046506 | Bacteria | 6207 |
| 899 | Ga0495583_0011202 | 3300046506 | Bacteria | 5165 |
| 900 | Ga0495583_0014011 | 3300046506 | Bacteria | 4440 |
| 901 | Ga0495583_0032658 | 3300046506 | Bacteria | 2510 |
| 902 | Ga0495583_0041375 | 3300046506 | Bacteria | 2158 |
| 903 | Ga0495583_0045315 | 3300046506 | Bacteria | 2034 |
| 904 | Ga0495583_0049252 | 3300046506 | Bacteria | 1930 |
| 905 | Ga0495606_0002457 | 3300046507 | Bacteria | 21484 |
| 906 | Ga0495606_0003787 | 3300046507 | Bacteria | 15718 |
| 907 | Ga0495606_0013422 | 3300046507 | Bacteria | 6471 |
| 908 | Ga0495606_0017724 | 3300046507 | Bacteria | 5370 |
| 909 | Ga0495606_0018538 | 3300046507 | Bacteria | 5213 |
| 910 | Ga0495606_0026516 | 3300046507 | Bacteria | 4129 |
| 911 | Ga0495606_0027667 | 3300046507 | Bacteria | 4014 |
| 912 | Ga0495606_0048978 | 3300046507 | Bacteria | 2774 |
| 913 | Ga0495606_0055877 | 3300046507 | Bacteria | 2551 |
| 914 | Ga0495606_0075474 | 3300046507 | Bacteria | 2109 |
| 915 | Ga0495606_0089461 | 3300046507 | Bacteria | 1896 |
| 916 | Ga0495606_0151900 | 3300046507 | Bacteria | 1358 |
| 917 | Ga0495610_0012579 | 3300046512 | Bacteria | 5082 |
| 918 | Ga0495610_0017395 | 3300046512 | Bacteria | 4100 |
| 919 | Ga0495610_0018009 | 3300046512 | Bacteria | 4004 |
| 920 | Ga0495610_0018310 | 3300046512 | Bacteria | 3961 |
| 921 | Ga0495610_0018603 | 3300046512 | Bacteria | 3917 |
| 922 | Ga0495610_0027084 | 3300046512 | Bacteria | 3052 |
| 923 | Ga0495610_0028281 | 3300046512 | Bacteria | 2966 |
| 924 | Ga0495610_0041045 | 3300046512 | Bacteria | 2326 |
| 925 | Ga0495610_0047716 | 3300046512 | Bacteria | 2106 |
| 926 | Ga0495610_0051602 | 3300046512 | Bacteria | 2000 |
| 927 | Ga0495610_0054732 | 3300046512 | Bacteria | 1926 |
| 928 | Ga0495610_0057025 | 3300046512 | Bacteria | 1875 |
| 929 | Ga0495610_0059534 | 3300046512 | Bacteria | 1822 |
| 930 | Ga0495610_0082899 | 3300046512 | Bacteria | 1468 |
| 931 | Ga0495616_0000142 | 3300046513 | Bacteria | 62829 |
| 932 | Ga0495616_0015223 | 3300046513 | Bacteria | 4280 |
| 933 | Ga0495616_0015419 | 3300046513 | Bacteria | 4251 |
| 934 | Ga0495616_0018889 | 3300046513 | Bacteria | 3769 |
| 935 | Ga0495616_0024783 | 3300046513 | Bacteria | 3212 |
| 936 | Ga0495616_0049565 | 3300046513 | Bacteria | 2104 |
| 937 | Ga0495616_0056753 | 3300046513 | Bacteria | 1932 |
| 938 | Ga0495616_0066637 | 3300046513 | Bacteria | 1751 |
| 939 | Ga0495616_0079572 | 3300046513 | Bacteria | 1570 |
| 940 | Ga0495616_0089808 | 3300046513 | Bacteria | 1456 |
| 941 | Ga0495616_0097141 | 3300046513 | Bacteria | 1386 |
| 942 | Ga0495620_0000023 | 3300046515 | Bacteria | 131512 |
| 943 | Ga0495620_0000044 | 3300046515 | Bacteria | 110431 |
| 944 | Ga0495620_0002605 | 3300046515 | Bacteria | 10433 |
| 945 | Ga0495620_0006293 | 3300046515 | Bacteria | 6532 |
| 946 | Ga0495620_0009524 | 3300046515 | Bacteria | 5159 |
| 947 | Ga0495620_0013688 | 3300046515 | Bacteria | 4146 |
| 948 | Ga0495620_0036857 | 3300046515 | Bacteria | 2183 |
| 949 | Ga0495620_0038162 | 3300046515 | Bacteria | 2133 |
| 950 | Ga0495620_0053525 | 3300046515 | Bacteria | 1708 |
| 951 | Ga0495620_0063387 | 3300046515 | Bacteria | 1532 |
| 952 | Ga0495620_0076852 | 3300046515 | Bacteria | 1356 |
| 953 | Ga0495628_0031861 | 3300046516 | Bacteria | 4261 |
| 954 | Ga0495630_0028475 | 3300046517 | Bacteria | 4150 |
| 955 | Ga0495631_0007171 | 3300046518 | Bacteria | 5686 |
| 956 | Ga0495631_0012421 | 3300046518 | Bacteria | 4158 |
| 957 | Ga0495631_0041225 | 3300046518 | Bacteria | 2043 |
| 958 | Ga0495631_0044370 | 3300046518 | Bacteria | 1959 |
| 959 | Ga0495631_0055248 | 3300046518 | Bacteria | 1730 |
| 960 | Ga0495631_0067726 | 3300046518 | Bacteria | 1544 |
| 961 | Ga0495632_0005847 | 3300046519 | Bacteria | 8045 |
| 962 | Ga0495632_0010414 | 3300046519 | Bacteria | 5511 |
| 963 | Ga0495632_0011851 | 3300046519 | Bacteria | 5068 |
| 964 | Ga0495632_0013667 | 3300046519 | Bacteria | 4619 |
| 965 | Ga0495632_0015691 | 3300046519 | Bacteria | 4236 |
| 966 | Ga0495632_0016106 | 3300046519 | Bacteria | 4168 |
| 967 | Ga0495632_0032798 | 3300046519 | Bacteria | 2672 |
| 968 | Ga0495632_0045169 | 3300046519 | Bacteria | 2195 |
| 969 | Ga0495632_0054798 | 3300046519 | Bacteria | 1953 |
| 970 | Ga0495632_0066415 | 3300046519 | Bacteria | 1740 |
| 971 | Ga0495637_0000054 | 3300046520 | Bacteria | 99531 |
| 972 | Ga0495637_0000413 | 3300046520 | Bacteria | 31487 |
| 973 | Ga0495637_0011527 | 3300046520 | Bacteria | 4244 |
| 974 | Ga0495637_0012548 | 3300046520 | Bacteria | 4048 |
| 975 | Ga0495637_0012885 | 3300046520 | Bacteria | 3985 |
| 976 | Ga0495637_0022910 | 3300046520 | Bacteria | 2842 |
| 977 | Ga0495637_0038884 | 3300046520 | Bacteria | 2057 |
| 978 | Ga0495637_0043911 | 3300046520 | Bacteria | 1905 |
| 979 | Ga0495637_0044315 | 3300046520 | Bacteria | 1894 |
| 980 | Ga0495637_0044359 | 3300046520 | Bacteria | 1893 |
| 981 | Ga0495637_0054890 | 3300046520 | Bacteria | 1653 |
| 982 | Ga0495637_0055616 | 3300046520 | Bacteria | 1640 |
| 983 | Ga0495637_0057727 | 3300046520 | Bacteria | 1602 |
| 984 | Ga0495637_0062604 | 3300046520 | Bacteria | 1522 |
| 985 | Ga0495637_0070966 | 3300046520 | Bacteria | 1405 |
| 986 | Ga0495637_0074560 | 3300046520 | Bacteria | 1362 |
| 987 | Ga0495643_0001170 | 3300046522 | Bacteria | 25602 |
| 988 | Ga0495643_0018356 | 3300046522 | Bacteria | 4067 |
| 989 | Ga0495643_0040895 | 3300046522 | Bacteria | 2530 |
| 990 | Ga0495643_0046599 | 3300046522 | Bacteria | 2349 |
| 991 | Ga0495643_0062808 | 3300046522 | Bacteria | 1965 |
| 992 | Ga0495643_0067463 | 3300046522 | Bacteria | 1885 |
| 993 | Ga0495643_0067927 | 3300046522 | Bacteria | 1876 |
| 994 | Ga0495643_0073669 | 3300046522 | Bacteria | 1789 |
| 995 | Ga0495643_0076012 | 3300046522 | Bacteria | 1756 |
| 996 | Ga0495643_0082803 | 3300046522 | Bacteria | 1666 |
| 997 | Ga0495643_0119928 | 3300046522 | Bacteria | 1330 |
| 998 | Ga0495644_0000073 | 3300046523 | Bacteria | 49382 |
| 999 | Ga0495644_0004602 | 3300046523 | Bacteria | 5419 |
| 1000 | Ga0495644_0007318 | 3300046523 | Bacteria | 4263 |
| 1001 | Ga0495644_0043914 | 3300046523 | Bacteria | 1681 |
| 1002 | Ga0495644_0050875 | 3300046523 | Bacteria | 1555 |
| 1003 | Ga0495648_0002643 | 3300046524 | Bacteria | 16260 |
| 1004 | Ga0495648_0008018 | 3300046524 | Bacteria | 8369 |
| 1005 | Ga0495648_0010343 | 3300046524 | Bacteria | 7111 |
| 1006 | Ga0495648_0039878 | 3300046524 | Bacteria | 2983 |
| 1007 | Ga0495648_0046294 | 3300046524 | Bacteria | 2697 |
| 1008 | Ga0495648_0066508 | 3300046524 | Bacteria | 2113 |
| 1009 | Ga0495648_0067831 | 3300046524 | Bacteria | 2084 |
| 1010 | Ga0495648_0069193 | 3300046524 | Bacteria | 2055 |
| 1011 | Ga0495648_0077765 | 3300046524 | Bacteria | 1900 |
| 1012 | Ga0495648_0080760 | 3300046524 | Bacteria | 1851 |
| 1013 | Ga0495648_0082312 | 3300046524 | Bacteria | 1828 |
| 1014 | Ga0495648_0093583 | 3300046524 | Bacteria | 1675 |
| 1015 | Ga0495648_0104308 | 3300046524 | Bacteria | 1557 |
| 1016 | Ga0495648_0127291 | 3300046524 | Bacteria | 1359 |
| 1017 | Ga0495663_0007818 | 3300046525 | Bacteria | 2957 |
| 1018 | Ga0495666_0046488 | 3300046526 | Bacteria | 2092 |
| 1019 | Ga0495666_0047827 | 3300046526 | Bacteria | 2061 |
| 1020 | Ga0495642_0002807 | 3300046528 | Bacteria | 6969 |
| 1021 | Ga0495642_0017035 | 3300046528 | Bacteria | 2837 |
| 1022 | Ga0495642_0040885 | 3300046528 | Bacteria | 1884 |
| 1023 | Ga0495654_0001880 | 3300046530 | Bacteria | 13956 |
| 1024 | Ga0495654_0008381 | 3300046530 | Bacteria | 5714 |
| 1025 | Ga0495654_0010756 | 3300046530 | Bacteria | 4970 |
| 1026 | Ga0495654_0014479 | 3300046530 | Bacteria | 4197 |
| 1027 | Ga0495654_0014495 | 3300046530 | Bacteria | 4194 |
| 1028 | Ga0495654_0015724 | 3300046530 | Bacteria | 4015 |
| 1029 | Ga0495654_0043479 | 3300046530 | Bacteria | 2226 |
| 1030 | Ga0495654_0046064 | 3300046530 | Bacteria | 2149 |
| 1031 | Ga0495654_0050913 | 3300046530 | Bacteria | 2022 |
| 1032 | Ga0495654_0058995 | 3300046530 | Bacteria | 1849 |
| 1033 | Ga0495654_0066385 | 3300046530 | Bacteria | 1719 |
| 1034 | Ga0495654_0085616 | 3300046530 | Bacteria | 1470 |
| 1035 | Ga0495654_0086248 | 3300046530 | Bacteria | 1463 |
| 1036 | Ga0495665_0000097 | 3300046531 | Bacteria | 40415 |
| 1037 | Ga0495586_0048419 | 3300046535 | Bacteria | 2296 |
| 1038 | Ga0495587_0020663 | 3300046536 | Bacteria | 4061 |
| 1039 | Ga0495587_0078831 | 3300046536 | Bacteria | 1910 |
| 1040 | Ga0495609_0000061 | 3300046538 | Bacteria | 139848 |
| 1041 | Ga0495609_0000072 | 3300046538 | Bacteria | 125273 |
| 1042 | Ga0495609_0000319 | 3300046538 | Bacteria | 43061 |
| 1043 | Ga0495609_0000696 | 3300046538 | Bacteria | 25895 |
| 1044 | Ga0495609_0003794 | 3300046538 | Bacteria | 8508 |
| 1045 | Ga0495609_0012217 | 3300046538 | Bacteria | 4073 |
| 1046 | Ga0495609_0014792 | 3300046538 | Bacteria | 3662 |
| 1047 | Ga0495609_0037331 | 3300046538 | Bacteria | 2191 |
| 1048 | Ga0495609_0049867 | 3300046538 | Bacteria | 1867 |
| 1049 | Ga0495597_0001045 | 3300046542 | Bacteria | 21150 |
| 1050 | Ga0495597_0003533 | 3300046542 | Bacteria | 9039 |
| 1051 | Ga0495597_0011999 | 3300046542 | Bacteria | 4187 |
| 1052 | Ga0495597_0020850 | 3300046542 | Bacteria | 3048 |
| 1053 | Ga0495597_0038336 | 3300046542 | Bacteria | 2148 |
| 1054 | Ga0495597_0044786 | 3300046542 | Bacteria | 1966 |
| 1055 | Ga0495597_0044929 | 3300046542 | Bacteria | 1963 |
| 1056 | Ga0495597_0047212 | 3300046542 | Bacteria | 1906 |
| 1057 | Ga0495597_0052910 | 3300046542 | Bacteria | 1786 |
| 1058 | Ga0495597_0065152 | 3300046542 | Bacteria | 1581 |
| 1059 | Ga0495597_0077054 | 3300046542 | Bacteria | 1429 |
| 1060 | Ga0495645_0001036 | 3300046543 | Bacteria | 18923 |
| 1061 | Ga0495645_0125890 | 3300046543 | Bacteria | 1800 |
| 1062 | Ga0495622_0000333 | 3300046557 | Bacteria | 34073 |
| 1063 | Ga0495622_0003058 | 3300046557 | Bacteria | 7937 |
| 1064 | Ga0495622_0006951 | 3300046557 | Bacteria | 5252 |
| 1065 | Ga0495622_0010948 | 3300046557 | Bacteria | 4185 |
| 1066 | Ga0495622_0023881 | 3300046557 | Bacteria | 2852 |
| 1067 | Ga0495622_0037064 | 3300046557 | Bacteria | 2272 |
| 1068 | Ga0495622_0045602 | 3300046557 | Bacteria | 2036 |
| 1069 | Ga0495622_0047677 | 3300046557 | Bacteria | 1990 |
| 1070 | Ga0495633_0000440 | 3300046558 | Bacteria | 42906 |
| 1071 | Ga0495633_0000751 | 3300046558 | Bacteria | 29251 |
| 1072 | Ga0495633_0005273 | 3300046558 | Bacteria | 7957 |
| 1073 | Ga0495633_0043315 | 3300046558 | Bacteria | 2135 |
| 1074 | Ga0495633_0043350 | 3300046558 | Bacteria | 2135 |
| 1075 | Ga0495633_0047399 | 3300046558 | Bacteria | 2030 |
| 1076 | Ga0495656_0002308 | 3300046615 | Bacteria | 6306 |
| 1077 | Ga0495656_0007984 | 3300046615 | Bacteria | 3765 |
| 1078 | Ga0495668_0010518 | 3300046616 | Bacteria | 5595 |
| 1079 | Ga0495668_0018713 | 3300046616 | Bacteria | 4003 |
| 1080 | Ga0495668_0048554 | 3300046616 | Bacteria | 2354 |
| 1081 | Ga0495668_0053228 | 3300046616 | Bacteria | 2238 |
| 1082 | Ga0495668_0062419 | 3300046616 | Bacteria | 2053 |
| 1083 | Ga0495634_0138130 | 3300046642 | Bacteria | 1549 |
| 1084 | Ga0495634_0162821 | 3300046642 | Bacteria | 1406 |
| 1085 | Ga0495611_0000240 | 3300046648 | Bacteria | 37890 |
| 1086 | Ga0495611_0002469 | 3300046648 | Bacteria | 8438 |
| 1087 | Ga0495611_0009450 | 3300046648 | Bacteria | 4120 |
| 1088 | Ga0495611_0010041 | 3300046648 | Bacteria | 4005 |
| 1089 | Ga0495611_0057174 | 3300046648 | Bacteria | 1767 |
| 1090 | Ga0495611_0090096 | 3300046648 | Bacteria | 1417 |
| 1091 | Ga0495625_0000147 | 3300046660 | Bacteria | 107983 |
| 1092 | Ga0495625_0003060 | 3300046660 | Bacteria | 17136 |
| 1093 | Ga0495625_0016733 | 3300046660 | Bacteria | 5759 |
| 1094 | Ga0495625_0030491 | 3300046660 | Bacteria | 4022 |
| 1095 | Ga0495625_0095515 | 3300046660 | Bacteria | 2049 |
| 1096 | Ga0495625_0146846 | 3300046660 | Bacteria | 1587 |
| 1097 | Ga0495625_0159957 | 3300046660 | Bacteria | 1509 |
| 1098 | Ga0495635_0006331 | 3300046663 | Bacteria | 8252 |
| 1099 | Ga0495635_0025955 | 3300046663 | Bacteria | 4079 |
| 1100 | Ga0495659_0002449 | 3300046664 | Bacteria | 5988 |
| 1101 | Ga0495659_0061635 | 3300046664 | Bacteria | 1386 |
| 1102 | Ga0495661_0000153 | 3300046665 | Bacteria | 81096 |
| 1103 | Ga0495661_0000431 | 3300046665 | Bacteria | 44303 |
| 1104 | Ga0495661_0000484 | 3300046665 | Bacteria | 41967 |
| 1105 | Ga0495661_0000660 | 3300046665 | Bacteria | 34588 |
| 1106 | Ga0495661_0003901 | 3300046665 | Bacteria | 10890 |
| 1107 | Ga0495661_0012702 | 3300046665 | Bacteria | 5683 |
| 1108 | Ga0495661_0023222 | 3300046665 | Bacteria | 4025 |
| 1109 | Ga0495661_0025128 | 3300046665 | Bacteria | 3851 |
| 1110 | Ga0495661_0031039 | 3300046665 | Bacteria | 3396 |
| 1111 | Ga0495661_0067831 | 3300046665 | Bacteria | 2094 |
| 1112 | Ga0495661_0086915 | 3300046665 | Bacteria | 1789 |
| 1113 | Ga0495661_0100080 | 3300046665 | Bacteria | 1633 |
| 1114 | Ga0495661_0105585 | 3300046665 | Bacteria | 1577 |
| 1115 | Ga0495661_0133101 | 3300046665 | Bacteria | 1360 |
| 1116 | Ga0495588_0011744 | 3300046674 | Bacteria | 4118 |
| 1117 | Ga0495599_0180010 | 3300046678 | Bacteria | 1303 |
| 1118 | Ga0495623_0012745 | 3300046679 | Bacteria | 5444 |
| 1119 | Ga0495623_0069958 | 3300046679 | Bacteria | 2186 |
| 1120 | Ga0495646_0031424 | 3300046680 | Bacteria | 3308 |
| 1121 | Ga0495646_0069808 | 3300046680 | Bacteria | 2072 |
| 1122 | Ga0495646_0095329 | 3300046680 | Bacteria | 1712 |
| 1123 | Ga0495624_0126599 | 3300046690 | Bacteria | 1567 |
| 1124 | Ga0495670_0004546 | 3300046691 | Bacteria | 6802 |
| 1125 | Ga0495670_0008702 | 3300046691 | Bacteria | 4996 |
| 1126 | Ga0495670_0014047 | 3300046691 | Bacteria | 3939 |
| 1127 | Ga0495670_0022166 | 3300046691 | Bacteria | 3135 |
| 1128 | Ga0495670_0047232 | 3300046691 | Bacteria | 2152 |
| 1129 | Ga0495671_0004757 | 3300046692 | Bacteria | 8020 |
| 1130 | Ga0495671_0006442 | 3300046692 | Bacteria | 6778 |
| 1131 | Ga0495671_0007024 | 3300046692 | Bacteria | 6453 |
| 1132 | Ga0495671_0009068 | 3300046692 | Bacteria | 5578 |
| 1133 | Ga0495671_0013844 | 3300046692 | Bacteria | 4352 |
| 1134 | Ga0495671_0022357 | 3300046692 | Bacteria | 3315 |
| 1135 | Ga0495671_0024308 | 3300046692 | Bacteria | 3156 |
| 1136 | Ga0495671_0029148 | 3300046692 | Bacteria | 2836 |
| 1137 | Ga0495671_0039652 | 3300046692 | Bacteria | 2377 |
| 1138 | Ga0495671_0050532 | 3300046692 | Bacteria | 2069 |
| 1139 | Ga0495671_0054888 | 3300046692 | Bacteria | 1974 |
| 1140 | Ga0495671_0057248 | 3300046692 | Bacteria | 1929 |
| 1141 | Ga0495649_0002836 | 3300046694 | Bacteria | 12028 |
| 1142 | Ga0495649_0003588 | 3300046694 | Bacteria | 10403 |
| 1143 | Ga0495649_0006508 | 3300046694 | Bacteria | 7269 |
| 1144 | Ga0495649_0010921 | 3300046694 | Bacteria | 5349 |
| 1145 | Ga0495649_0048043 | 3300046694 | Bacteria | 2319 |
| 1146 | Ga0495649_0049506 | 3300046694 | Bacteria | 2282 |
| 1147 | Ga0495649_0056397 | 3300046694 | Bacteria | 2121 |
| 1148 | Ga0495649_0057437 | 3300046694 | Bacteria | 2098 |
| 1149 | Ga0495649_0064347 | 3300046694 | Bacteria | 1969 |
| 1150 | Ga0495649_0069988 | 3300046694 | Bacteria | 1881 |
| 1151 | Ga0495649_0085131 | 3300046694 | Bacteria | 1687 |
| 1152 | Ga0495649_0098691 | 3300046694 | Bacteria | 1553 |
| 1153 | Ga0495649_0106350 | 3300046694 | Bacteria | 1489 |
| 1154 | Ga0495589_0002215 | 3300046794 | Bacteria | 10937 |
| 1155 | Ga0495589_0010176 | 3300046794 | Bacteria | 4886 |
| 1156 | Ga0495589_0012870 | 3300046794 | Bacteria | 4323 |
| 1157 | Ga0495589_0045870 | 3300046794 | Bacteria | 2170 |
| 1158 | Ga0495589_0056638 | 3300046794 | Bacteria | 1929 |
| 1159 | Ga0495589_0065124 | 3300046794 | Bacteria | 1786 |
| 1160 | Ga0495589_0066388 | 3300046794 | Bacteria | 1766 |
| 1161 | Ga0495589_0073000 | 3300046794 | Bacteria | 1675 |
| 1162 | Ga0495589_0084317 | 3300046794 | Bacteria | 1544 |
| 1163 | Ga0495589_0103083 | 3300046794 | Bacteria | 1379 |
| 1164 | Ga0495600_0008635 | 3300046809 | Bacteria | 6266 |
| 1165 | Ga0495660_0001480 | 3300046810 | Bacteria | 15980 |
| 1166 | Ga0495660_0007766 | 3300046810 | Bacteria | 6302 |
| 1167 | Ga0495660_0010281 | 3300046810 | Bacteria | 5440 |
| 1168 | Ga0495660_0016142 | 3300046810 | Bacteria | 4306 |
| 1169 | Ga0495660_0019012 | 3300046810 | Bacteria | 3944 |
| 1170 | Ga0495660_0036001 | 3300046810 | Bacteria | 2762 |
| 1171 | Ga0495660_0038266 | 3300046810 | Bacteria | 2667 |
| 1172 | Ga0495660_0053872 | 3300046810 | Bacteria | 2181 |
| 1173 | Ga0495660_0060722 | 3300046810 | Bacteria | 2029 |
| 1174 | Ga0495660_0062417 | 3300046810 | Bacteria | 1997 |
| 1175 | Ga0495660_0092957 | 3300046810 | Bacteria | 1564 |
| 1176 | Ga0495660_0103358 | 3300046810 | Bacteria | 1463 |
| 1177 | Ga0495660_0113690 | 3300046810 | Bacteria | 1378 |
| 1178 | Ga0495581_0079890 | 3300047315 | Bacteria | 1893 |
| 1179 | Ga0495604_0012826 | 3300047317 | Bacteria | 6674 |
| 1180 | Ga0495604_0031336 | 3300047317 | Bacteria | 4217 |
| 1181 | Ga0495604_0155962 | 3300047317 | Bacteria | 1617 |
| 1182 | Ga0495636_0026013 | 3300047318 | Bacteria | 2378 |
| 1183 | Ga0495674_0038521 | 3300047319 | Bacteria | 4290 |
| 1184 | Ga0495674_0072930 | 3300047319 | Bacteria | 2960 |
| 1185 | Ga0495672_0004589 | 3300047320 | Bacteria | 11229 |
| 1186 | Ga0495672_0020526 | 3300047320 | Bacteria | 4326 |
| 1187 | Ga0495672_0020530 | 3300047320 | Bacteria | 4325 |
| 1188 | Ga0495672_0021121 | 3300047320 | Bacteria | 4250 |
| 1189 | Ga0495672_0021797 | 3300047320 | Bacteria | 4173 |
| 1190 | Ga0495672_0023164 | 3300047320 | Bacteria | 4025 |
| 1191 | Ga0495672_0034599 | 3300047320 | Bacteria | 3119 |
| 1192 | Ga0495672_0036067 | 3300047320 | Bacteria | 3039 |
| 1193 | Ga0495672_0039194 | 3300047320 | Bacteria | 2882 |
| 1194 | Ga0495672_0044487 | 3300047320 | Bacteria | 2663 |
| 1195 | Ga0495672_0044887 | 3300047320 | Bacteria | 2648 |
| 1196 | Ga0495672_0058028 | 3300047320 | Bacteria | 2245 |
| 1197 | Ga0495672_0058215 | 3300047320 | Bacteria | 2241 |
| 1198 | Ga0495672_0070869 | 3300047320 | Bacteria | 1973 |
| 1199 | Ga0495672_0085494 | 3300047320 | Bacteria | 1747 |
| 1200 | Ga0495672_0086434 | 3300047320 | Bacteria | 1734 |
| 1201 | Ga0495676_0000027 | 3300047321 | Bacteria | 141955 |
| 1202 | Ga0495676_0101317 | 3300047321 | Bacteria | 2130 |
| 1203 | Ga0495676_0111832 | 3300047321 | Bacteria | 2002 |
| 1204 | Ga0495676_0196861 | 3300047321 | Bacteria | 1402 |
| 1205 | Ga0495680_0005310 | 3300047322 | Bacteria | 12162 |
| 1206 | Ga0495680_0021752 | 3300047322 | Bacteria | 5362 |
| 1207 | Ga0495680_0094617 | 3300047322 | Bacteria | 2235 |
| 1208 | Ga0495680_0160567 | 3300047322 | Bacteria | 1632 |
| 1209 | Ga0495683_0000038 | 3300047323 | Bacteria | 139494 |
| 1210 | Ga0495683_0000236 | 3300047323 | Bacteria | 50369 |
| 1211 | Ga0495683_0026155 | 3300047323 | Bacteria | 2986 |
| 1212 | Ga0495683_0054234 | 3300047323 | Bacteria | 1998 |
| 1213 | Ga0495683_0057883 | 3300047323 | Bacteria | 1925 |
| 1214 | Ga0495683_0058778 | 3300047323 | Bacteria | 1908 |
| 1215 | Ga0495683_0090854 | 3300047323 | Bacteria | 1479 |
| 1216 | Ga0495683_0091691 | 3300047323 | Bacteria | 1471 |
| 1217 | Ga0495687_000313 | 3300047443 | Bacteria | 63173 |
| 1218 | Ga0495687_001285 | 3300047443 | Bacteria | 23621 |
| 1219 | Ga0495687_028574 | 3300047443 | Bacteria | 2592 |
| 1220 | Ga0495675_0019492 | 3300047444 | Bacteria | 4309 |
| 1221 | Ga0495675_0060569 | 3300047444 | Bacteria | 2399 |
| 1222 | Ga0495677_0000306 | 3300047445 | Bacteria | 21272 |
| 1223 | Ga0495677_0002657 | 3300047445 | Bacteria | 6984 |
| 1224 | Ga0495677_0006896 | 3300047445 | Bacteria | 4271 |
| 1225 | Ga0495677_0037663 | 3300047445 | Bacteria | 1766 |
| 1226 | Ga0495679_000237 | 3300047446 | Bacteria | 45847 |
| 1227 | Ga0495679_001014 | 3300047446 | Bacteria | 17250 |
| 1228 | Ga0495679_008506 | 3300047446 | Bacteria | 4165 |
| 1229 | Ga0495679_009276 | 3300047446 | Bacteria | 3948 |
| 1230 | Ga0495679_022332 | 3300047446 | Bacteria | 2167 |
| 1231 | Ga0495679_024389 | 3300047446 | Bacteria | 2038 |
| 1232 | Ga0495679_042006 | 3300047446 | Bacteria | 1412 |
| 1233 | Ga0495679_042152 | 3300047446 | Bacteria | 1409 |
| 1234 | Ga0495679_042553 | 3300047446 | Bacteria | 1400 |
| 1235 | Ga0495685_000137 | 3300047447 | Bacteria | 25064 |
| 1236 | Ga0495673_0001349 | 3300047469 | Bacteria | 19897 |
| 1237 | Ga0495673_0001927 | 3300047469 | Bacteria | 15436 |
| 1238 | Ga0495673_0001940 | 3300047469 | Bacteria | 15348 |
| 1239 | Ga0495673_0007883 | 3300047469 | Bacteria | 6053 |
| 1240 | Ga0495673_0010029 | 3300047469 | Bacteria | 5188 |
| 1241 | Ga0495673_0012515 | 3300047469 | Bacteria | 4494 |
| 1242 | Ga0495673_0013763 | 3300047469 | Bacteria | 4231 |
| 1243 | Ga0495673_0014316 | 3300047469 | Bacteria | 4127 |
| 1244 | Ga0495673_0014628 | 3300047469 | Bacteria | 4074 |
| 1245 | Ga0495673_0024354 | 3300047469 | Bacteria | 2926 |
| 1246 | Ga0495673_0047341 | 3300047469 | Bacteria | 1900 |
| 1247 | Ga0495673_0053617 | 3300047469 | Bacteria | 1757 |
| 1248 | Ga0495673_0063135 | 3300047469 | Bacteria | 1579 |
| 1249 | Ga0495673_0077477 | 3300047469 | Bacteria | 1384 |
| 1250 | Ga0495681_0002342 | 3300047470 | Bacteria | 13606 |
| 1251 | Ga0495681_0016470 | 3300047470 | Bacteria | 4140 |
| 1252 | Ga0495681_0018386 | 3300047470 | Bacteria | 3852 |
| 1253 | Ga0495681_0033419 | 3300047470 | Bacteria | 2576 |
| 1254 | Ga0495681_0035876 | 3300047470 | Bacteria | 2458 |
| 1255 | Ga0495681_0036459 | 3300047470 | Bacteria | 2431 |
| 1256 | Ga0495681_0037450 | 3300047470 | Bacteria | 2388 |
| 1257 | Ga0495681_0051002 | 3300047470 | Bacteria | 1947 |
| 1258 | Ga0495681_0051820 | 3300047470 | Bacteria | 1928 |
| 1259 | Ga0495681_0055715 | 3300047470 | Bacteria | 1842 |
| 1260 | Ga0495681_0056572 | 3300047470 | Bacteria | 1824 |
| 1261 | Ga0495681_0066009 | 3300047470 | Bacteria | 1652 |
| 1262 | Ga0495681_0070867 | 3300047470 | Bacteria | 1579 |
| 1263 | Ga0495681_0087960 | 3300047470 | Bacteria | 1376 |
| 1264 | Ga0495686_0000038 | 3300047472 | Bacteria | 306383 |
| 1265 | Ga0495686_0013850 | 3300047472 | Bacteria | 5582 |
| 1266 | Ga0495686_0063352 | 3300047472 | Bacteria | 2291 |
| 1267 | Ga0495686_0068931 | 3300047472 | Bacteria | 2181 |
| 1268 | Ga0495686_0094336 | 3300047472 | Bacteria | 1813 |
| 1269 | Ga0495686_0134630 | 3300047472 | Bacteria | 1462 |
| 1270 | Ga0495593_0000787 | 3300047673 | Bacteria | 18362 |
| 1271 | Ga0495593_0030746 | 3300047673 | Bacteria | 2936 |
| 1272 | Ga0495593_0103612 | 3300047673 | Bacteria | 1457 |
| 1273 | Ga0495602_0022153 | 3300048088 | Bacteria | 6226 |
| 1274 | Ga0495602_0182038 | 3300048088 | Bacteria | 1619 |
| 1275 | Ga0495626_0000067 | 3300048091 | Bacteria | 139969 |
| 1276 | Ga0495626_0006113 | 3300048091 | Bacteria | 6909 |
| 1277 | Ga0495626_0006151 | 3300048091 | Bacteria | 6875 |
| 1278 | Ga0495626_0012561 | 3300048091 | Bacteria | 4432 |
| 1279 | Ga0495626_0014232 | 3300048091 | Bacteria | 4109 |
| 1280 | Ga0495626_0038567 | 3300048091 | Bacteria | 2264 |
| 1281 | Ga0495626_0040115 | 3300048091 | Bacteria | 2212 |
| 1282 | Ga0495626_0045210 | 3300048091 | Bacteria | 2056 |
| 1283 | Ga0495626_0062218 | 3300048091 | Bacteria | 1695 |
| 1284 | Ga0495626_0067327 | 3300048091 | Bacteria | 1617 |
| 1285 | Ga0496100_0073402 | 3300048903 | Bacteria | 2289 |
| 1286 | Ga0496100_0084686 | 3300048903 | Bacteria | 2149 |
| 1287 | Ga0496102_0043863 | 3300048905 | Bacteria | 4057 |
| 1288 | Ga0496102_0063586 | 3300048905 | Bacteria | 3379 |
| 1289 | Ga0496102_0072694 | 3300048905 | Bacteria | 3161 |
| 1290 | Ga0496102_0102866 | 3300048905 | Bacteria | 2656 |
| 1291 | Ga0496104_0031916 | 3300048907 | Bacteria | 4900 |
| 1292 | Ga0496104_0123590 | 3300048907 | Bacteria | 2484 |
| 1293 | Ga0496105_0000815 | 3300048908 | Bacteria | 21113 |
| 1294 | Ga0496105_0085943 | 3300048908 | Bacteria | 2599 |
| 1295 | Ga0496107_0048629 | 3300048910 | Bacteria | 3056 |
| 1296 | Ga0496110_0068866 | 3300048913 | Bacteria | 3133 |
| 1297 | Ga0496112_0069194 | 3300048915 | Bacteria | 3487 |
| 1298 | Ga0496112_0225136 | 3300048915 | Bacteria | 1831 |
| 1299 | Ga0496112_0283605 | 3300048915 | Bacteria | 1603 |
| 1300 | Ga0496113_0013329 | 3300048916 | Bacteria | 5564 |
| 1301 | Ga0496114_0017622 | 3300048917 | Bacteria | 5767 |
| 1302 | Ga0496114_0184803 | 3300048917 | Bacteria | 1821 |
| 1303 | Ga0496115_0050225 | 3300048918 | Bacteria | 3340 |
| 1304 | Ga0496115_0099054 | 3300048918 | Bacteria | 2388 |
| 1305 | Ga0496116_0010833 | 3300048919 | Bacteria | 7605 |
| 1306 | Ga0496116_0018891 | 3300048919 | Bacteria | 5293 |
| 1307 | Ga0496116_0019033 | 3300048919 | Bacteria | 5273 |
| 1308 | Ga0496116_0021261 | 3300048919 | Bacteria | 4899 |
| 1309 | Ga0496116_0027285 | 3300048919 | Bacteria | 4159 |
| 1310 | Ga0496116_0068314 | 3300048919 | Bacteria | 2264 |
| 1311 | Ga0496116_0071568 | 3300048919 | Bacteria | 2195 |
| 1312 | Ga0496116_0087093 | 3300048919 | Bacteria | 1913 |
| 1313 | Ga0496116_0098844 | 3300048919 | Bacteria | 1750 |
| 1314 | Ga0496117_0000010 | 3300048920 | Bacteria | 611954 |
| 1315 | Ga0496117_0003366 | 3300048920 | Bacteria | 18635 |
| 1316 | Ga0496117_0005310 | 3300048920 | Bacteria | 13617 |
| 1317 | Ga0496117_0012326 | 3300048920 | Bacteria | 7550 |
| 1318 | Ga0496117_0017657 | 3300048920 | Bacteria | 5952 |
| 1319 | Ga0496117_0018561 | 3300048920 | Bacteria | 5753 |
| 1320 | Ga0496117_0021375 | 3300048920 | Bacteria | 5237 |
| 1321 | Ga0496117_0036019 | 3300048920 | Bacteria | 3707 |
| 1322 | Ga0496117_0041901 | 3300048920 | Bacteria | 3347 |
| 1323 | Ga0496117_0065170 | 3300048920 | Bacteria | 2478 |
| 1324 | Ga0496117_0086704 | 3300048920 | Bacteria | 2033 |
| 1325 | Ga0496117_0118446 | 3300048920 | Bacteria | 1632 |
| 1326 | Ga0496117_0123064 | 3300048920 | Bacteria | 1589 |
| 1327 | Ga0496117_0142633 | 3300048920 | Bacteria | 1432 |
| 1328 | Ga0496118_0000009 | 3300048921 | Bacteria | 611954 |
| 1329 | Ga0496118_0006189 | 3300048921 | Bacteria | 13261 |
| 1330 | Ga0496118_0018449 | 3300048921 | Bacteria | 6295 |
| 1331 | Ga0496118_0047077 | 3300048921 | Bacteria | 3347 |
| 1332 | Ga0496118_0052825 | 3300048921 | Bacteria | 3094 |
| 1333 | Ga0496118_0053499 | 3300048921 | Bacteria | 3068 |
| 1334 | Ga0496118_0056677 | 3300048921 | Bacteria | 2943 |
| 1335 | Ga0496118_0072522 | 3300048921 | Bacteria | 2472 |
| 1336 | Ga0496118_0075320 | 3300048921 | Bacteria | 2407 |
| 1337 | Ga0496118_0102993 | 3300048921 | Bacteria | 1922 |
| 1338 | Ga0496118_0104470 | 3300048921 | Bacteria | 1901 |
| 1339 | Ga0496118_0122374 | 3300048921 | Bacteria | 1692 |
| 1340 | Ga0496118_0143486 | 3300048921 | Bacteria | 1508 |
| 1341 | Ga0496119_0000704 | 3300048922 | Bacteria | 44799 |
| 1342 | Ga0496119_0039239 | 3300048922 | Bacteria | 3045 |
| 1343 | Ga0496119_0091843 | 3300048922 | Bacteria | 1723 |
| 1344 | Ga0496119_0119688 | 3300048922 | Bacteria | 1449 |
| 1345 | Ga0496120_0010286 | 3300048923 | Bacteria | 6544 |
| 1346 | Ga0496120_0014369 | 3300048923 | Bacteria | 5281 |
| 1347 | Ga0496120_0095490 | 3300048923 | Bacteria | 1580 |
| 1348 | Ga0496120_0098621 | 3300048923 | Bacteria | 1548 |
| 1349 | Ga0496121_0003788 | 3300048924 | Bacteria | 21104 |
| 1350 | Ga0496121_0004345 | 3300048924 | Bacteria | 19161 |
| 1351 | Ga0496121_0005540 | 3300048924 | Bacteria | 16128 |
| 1352 | Ga0496121_0027165 | 3300048924 | Bacteria | 5363 |
| 1353 | Ga0496121_0036800 | 3300048924 | Bacteria | 4356 |
| 1354 | Ga0496121_0057144 | 3300048924 | Bacteria | 3235 |
| 1355 | Ga0496121_0068129 | 3300048924 | Bacteria | 2880 |
| 1356 | Ga0496121_0071640 | 3300048924 | Bacteria | 2786 |
| 1357 | Ga0496121_0115269 | 3300048924 | Bacteria | 2040 |
| 1358 | Ga0496121_0117093 | 3300048924 | Bacteria | 2019 |
| 1359 | Ga0496121_0127966 | 3300048924 | Bacteria | 1906 |
| 1360 | Ga0496121_0130009 | 3300048924 | Bacteria | 1886 |
| 1361 | Ga0496121_0151242 | 3300048924 | Bacteria | 1707 |
| 1362 | Ga0496122_0000079 | 3300048925 | Bacteria | 212416 |
| 1363 | Ga0496122_0000517 | 3300048925 | Bacteria | 79890 |
| 1364 | Ga0496122_0000890 | 3300048925 | Bacteria | 55628 |
| 1365 | Ga0496122_0002629 | 3300048925 | Bacteria | 25113 |
| 1366 | Ga0496122_0023593 | 3300048925 | Bacteria | 5414 |
| 1367 | Ga0496122_0033075 | 3300048925 | Bacteria | 4261 |
| 1368 | Ga0496122_0035281 | 3300048925 | Bacteria | 4072 |
| 1369 | Ga0496122_0048232 | 3300048925 | Bacteria | 3278 |
| 1370 | Ga0496122_0052604 | 3300048925 | Bacteria | 3080 |
| 1371 | Ga0496122_0075993 | 3300048925 | Bacteria | 2366 |
| 1372 | Ga0496122_0077637 | 3300048925 | Bacteria | 2330 |
| 1373 | Ga0496122_0088531 | 3300048925 | Bacteria | 2121 |
| 1374 | Ga0496122_0099104 | 3300048925 | Bacteria | 1955 |
| 1375 | Ga0496122_0126604 | 3300048925 | Bacteria | 1633 |
| 1376 | Ga0496123_0000073 | 3300048926 | Bacteria | 198307 |
| 1377 | Ga0496123_0000243 | 3300048926 | Bacteria | 109767 |
| 1378 | Ga0496123_0001424 | 3300048926 | Bacteria | 33453 |
| 1379 | Ga0496123_0004921 | 3300048926 | Bacteria | 13703 |
| 1380 | Ga0496123_0011862 | 3300048926 | Bacteria | 7495 |
| 1381 | Ga0496123_0028664 | 3300048926 | Bacteria | 4115 |
| 1382 | Ga0496123_0055107 | 3300048926 | Bacteria | 2611 |
| 1383 | Ga0496123_0059953 | 3300048926 | Bacteria | 2456 |
| 1384 | Ga0496123_0086238 | 3300048926 | Bacteria | 1884 |
| 1385 | Ga0496123_0089243 | 3300048926 | Bacteria | 1837 |
| 1386 | Ga0496124_0000511 | 3300048927 | Bacteria | 66830 |
| 1387 | Ga0496124_0025306 | 3300048927 | Bacteria | 5378 |
| 1388 | Ga0496124_0034546 | 3300048927 | Bacteria | 4435 |
| 1389 | Ga0496124_0038300 | 3300048927 | Bacteria | 4164 |
| 1390 | Ga0496124_0038315 | 3300048927 | Bacteria | 4163 |
| 1391 | Ga0496124_0081795 | 3300048927 | Bacteria | 2653 |
| 1392 | Ga0496124_0093927 | 3300048927 | Bacteria | 2440 |
| 1393 | Ga0496124_0101317 | 3300048927 | Bacteria | 2333 |
| 1394 | Ga0496124_0133275 | 3300048927 | Bacteria | 1971 |
| 1395 | Ga0496124_0164269 | 3300048927 | Bacteria | 1727 |
| 1396 | Ga0496124_0169101 | 3300048927 | Bacteria | 1695 |
| 1397 | Ga0496124_0170017 | 3300048927 | Bacteria | 1689 |
| 1398 | Ga0496125_0002177 | 3300048928 | Bacteria | 26150 |
| 1399 | Ga0496125_0005766 | 3300048928 | Bacteria | 13606 |
| 1400 | Ga0496125_0038819 | 3300048928 | Bacteria | 4111 |
| 1401 | Ga0496125_0039957 | 3300048928 | Bacteria | 4031 |
| 1402 | Ga0496125_0040272 | 3300048928 | Bacteria | 4010 |
| 1403 | Ga0496125_0077667 | 3300048928 | Bacteria | 2558 |
| 1404 | Ga0496125_0098581 | 3300048928 | Bacteria | 2162 |
| 1405 | Ga0496125_0109797 | 3300048928 | Bacteria | 2002 |
| 1406 | Ga0496125_0140093 | 3300048928 | Bacteria | 1683 |
| 1407 | Ga0496125_0167344 | 3300048928 | Bacteria | 1483 |
| 1408 | Ga0496126_0000838 | 3300048929 | Bacteria | 54525 |
| 1409 | Ga0496126_0044107 | 3300048929 | Bacteria | 4109 |
| 1410 | Ga0496126_0045063 | 3300048929 | Bacteria | 4056 |
| 1411 | Ga0496126_0196546 | 3300048929 | Bacteria | 1705 |
| 1412 | Ga0496126_0224693 | 3300048929 | Bacteria | 1575 |
| 1413 | Ga0495678_000054 | 3300049459 | Bacteria | 153487 |
| 1414 | Ga0495678_000078 | 3300049459 | Bacteria | 123666 |
| 1415 | Ga0495678_010708 | 3300049459 | Bacteria | 4434 |
| 1416 | Ga0495678_011987 | 3300049459 | Bacteria | 4125 |
| 1417 | Ga0495678_028649 | 3300049459 | Bacteria | 2347 |
| 1418 | Ga0495678_030698 | 3300049459 | Bacteria | 2246 |
| 1419 | Ga0495678_039949 | 3300049459 | Bacteria | 1889 |
| 1420 | Ga0495678_042583 | 3300049459 | Bacteria | 1809 |
| 1421 | Ga0495678_063478 | 3300049459 | Bacteria | 1379 |
| 1422 | Ga0495678_068624 | 3300049459 | Bacteria | 1306 |
| 1423 | Ga0495682_0000069 | 3300049460 | Bacteria | 94250 |
| 1424 | Ga0495682_0003335 | 3300049460 | Bacteria | 7170 |
| 1425 | Ga0495682_0003684 | 3300049460 | Bacteria | 6755 |
| 1426 | Ga0495682_0028634 | 3300049460 | Bacteria | 2063 |
| 1427 | Ga0501031_0005889 | 3300049568 | Bacteria | 7985 |
| 1428 | Ga0501031_0058010 | 3300049568 | Bacteria | 2522 |
| 1429 | Ga0501032_0000449 | 3300049569 | Bacteria | 33607 |
| 1430 | Ga0501033_0001574 | 3300049570 | Bacteria | 20112 |
| 1431 | Ga0501033_0092876 | 3300049570 | Bacteria | 2207 |
| 1432 | Ga0501034_0000164 | 3300049571 | Bacteria | 125152 |
| 1433 | Ga0501034_0007896 | 3300049571 | Bacteria | 11306 |
| 1434 | Ga0501034_0023202 | 3300049571 | Bacteria | 6322 |
| 1435 | Ga0501034_0229789 | 3300049571 | Bacteria | 1804 |
| 1436 | Ga0501036_0001261 | 3300049572 | Bacteria | 19388 |
| 1437 | Ga0501037_0001265 | 3300049573 | Bacteria | 18630 |
| 1438 | Ga0501037_0066044 | 3300049573 | Bacteria | 2636 |
| 1439 | Ga0501038_0012053 | 3300049574 | Bacteria | 7894 |
| 1440 | Ga0501039_0064436 | 3300049575 | Bacteria | 2841 |
| 1441 | Ga0501039_0104851 | 3300049575 | Bacteria | 2207 |
| 1442 | Ga0501040_0000307 | 3300049576 | Bacteria | 28639 |
| 1443 | Ga0501040_0001449 | 3300049576 | Bacteria | 15027 |
| 1444 | Ga0501041_0034738 | 3300049577 | Bacteria | 3053 |
| 1445 | Ga0501042_0000603 | 3300049578 | Bacteria | 19166 |
| 1446 | Ga0501043_0003265 | 3300049579 | Bacteria | 13371 |
| 1447 | Ga0501046_0001788 | 3300049580 | Bacteria | 20500 |
| 1448 | Ga0501047_0003908 | 3300049581 | Bacteria | 14011 |
| 1449 | Ga0501076_0020900 | 3300049592 | Bacteria | 5013 |
| 1450 | Ga0501077_0083312 | 3300049593 | Bacteria | 2026 |
| 1451 | Ga0501222_007907 | 3300049662 | Bacteria | 1415 |
| 1452 | Ga0501235_023389 | 3300049669 | Bacteria | 1377 |
| 1453 | Ga0501240_008426 | 3300049673 | Bacteria | 1322 |
| 1454 | Ga0501079_0012489 | 3300049741 | Bacteria | 6483 |
| 1455 | Ga0501079_0050515 | 3300049741 | Bacteria | 3210 |
| 1456 | Ga0501081_0002881 | 3300049743 | Bacteria | 10921 |
| 1457 | Ga0501241_004320 | 3300049758 | Bacteria | 2668 |
| 1458 | Ga0501262_007974 | 3300049759 | Bacteria | 1290 |
| 1459 | Ga0501269_002975 | 3300049766 | Bacteria | 2058 |
| 1460 | Ga0501282_000230 | 3300049778 | Bacteria | 6822 |
| 1461 | Ga0501035_0185893 | 3300049822 | Bacteria | 1788 |
| 1462 | Ga0501044_0120768 | 3300049823 | Bacteria | 2621 |
| 1463 | Ga0501045_0008665 | 3300049824 | Bacteria | 7093 |
| 1464 | Ga0501226_000348 | 3300049853 | Bacteria | 6745 |
| 1465 | nmdc:mga03683_41472_c1 | 3300050489 | Bacteria | 1891 |
| 1466 | nmdc:mga00v17_154487_c1 | 3300050491 | Bacteria | 1475 |
| 1467 | nmdc:mga0k408_107519_c1 | 3300050493 | Bacteria | 1648 |
| 1468 | nmdc:mga0k408_272_c2 | 3300050493 | Bacteria | 26650 |
| 1469 | nmdc:mga0k408_59276_c1 | 3300050493 | Bacteria | 2224 |
| 1470 | nmdc:mga0k408_7263_c2 | 3300050493 | Bacteria | 3634 |
| 1471 | nmdc:mga07m45_10124_c1 | 3300050496 | Bacteria | 4915 |
| 1472 | nmdc:mga07m45_136_c1 | 3300050496 | Bacteria | 27318 |
| 1473 | nmdc:mga07m45_37979_c1 | 3300050496 | Bacteria | 2686 |
| 1474 | nmdc:mga07m45_55694_c1 | 3300050496 | Bacteria | 2235 |
| 1475 | nmdc:mga05p37_24610_c1 | 3300050507 | Bacteria | 7319 |
| 1476 | nmdc:mga05p37_75674_c1 | 3300050507 | Bacteria | 4144 |
| 1477 | nmdc:mga09592_20902_c1 | 3300050508 | Bacteria | 5391 |
| 1478 | nmdc:mga09592_365_c1 | 3300050508 | Bacteria | 33116 |
| 1479 | nmdc:mga0qj67_112046_c1 | 3300050509 | Bacteria | 2203 |
| 1480 | nmdc:mga0qj67_15012_c1 | 3300050509 | Bacteria | 5859 |
| 1481 | nmdc:mga0qj67_7700_c1 | 3300050509 | Bacteria | 7960 |
| 1482 | nmdc:mga06r32_112366_c1 | 3300050510 | Bacteria | 2681 |
| 1483 | nmdc:mga06r32_25761_c1 | 3300050510 | Bacteria | 5475 |
| 1484 | nmdc:mga08y16_237961_c1 | 3300050511 | Bacteria | 1882 |
| 1485 | nmdc:mga0sz30_14524_c1 | 3300050516 | Bacteria | 3101 |
| 1486 | Ga0500635_0000210 | 3300053080 | Bacteria | 28403 |
| 1487 | Ga0495619_0027728 | 3300053085 | Bacteria | 3651 |
| 1488 | Ga0500644_0003052 | 3300053088 | Bacteria | 4150 |
| 1489 | Ga0500572_013953 | 3300053111 | Bacteria | 1998 |
| 1490 | Ga0500595_000950 | 3300053119 | Bacteria | 16349 |
| 1491 | Ga0500618_002869 | 3300053125 | Bacteria | 6179 |
| 1492 | Ga0500618_003991 | 3300053125 | Bacteria | 4867 |
| 1493 | Ga0500559_0076107 | 3300053136 | Bacteria | 1519 |
| 1494 | Ga0500573_0088086 | 3300053140 | Bacteria | 1756 |
| 1495 | Ga0500590_007334 | 3300053148 | Bacteria | 5439 |
| 1496 | Ga0500619_003055 | 3300053154 | Bacteria | 3352 |
| 1497 | Ga0500634_0015573 | 3300053161 | Bacteria | 4040 |
| 1498 | Ga0500587_000416 | 3300053739 | Bacteria | 4975 |
| 1499 | Ga0501084_0001517 | 3300054114 | Bacteria | 18424 |
| 1500 | Ga0500661_002235 | 3300055283 | Bacteria | 3659 |
| 1501 | Ga0501082_0013114 | 3300060353 | Bacteria | 7126 |
| 1502 | Ga0466962_0003526 | 3300061719 | Bacteria | 7456 |
| 1503 | Ga0466962_0005762 | 3300061719 | Bacteria | 5951 |
| 1504 | Ga0466962_0010726 | 3300061719 | Bacteria | 4404 |
| 1505 | Ga0466962_0112944 | 3300061719 | Bacteria | 1308 |
| 1506 | Ga0530510_0138360 | 3300061734 | Bacteria | 1793 |
| 1507 | 2511246917 | 2511231002 | Bacteria | 5042903 |
| 1508 | 2511253735 | 2511231004 | Bacteria | 6669789 |
| 1509 | 2511264687 | 2511231006 | Bacteria | 6794709 |
| 1510 | 2511273726 | 2511231007 | Bacteria | 6306603 |
| 1511 | 2511279643 | 2511231008 | Bacteria | 6624100 |
| 1512 | 2511289598 | 2511231010 | Bacteria | 6373152 |
| 1513 | 2511294698 | 2511231011 | Bacteria | 6149768 |
| 1514 | 2511298841 | 2511231012 | Bacteria | 6738011 |
| 1515 | 2511317061 | 2511231014 | Bacteria | 6462302 |
| 1516 | 2511322157 | 2511231015 | Bacteria | 6598026 |
| 1517 | 2511324578 | 2511231016 | Bacteria | 6704427 |
| 1518 | 2511332314 | 2511231017 | Bacteria | 6503007 |
| 1519 | 2511337755 | 2511231018 | Bacteria | 6436256 |
| 1520 | 2511347348 | 2511231019 | Bacteria | 6520662 |
| 1521 | 2511352476 | 2511231020 | Bacteria | 6115223 |
| 1522 | 2511359234 | 2511231021 | Bacteria | 7302637 |
| 1523 | 2511360727 | 2511231022 | Bacteria | 6719296 |
| 1524 | 2511368853 | 2511231023 | Bacteria | 6808468 |
| 1525 | 2511376680 | 2511231024 | Bacteria | 5835885 |
| 1526 | 2511412356 | 2511231031 | Bacteria | 6558529 |
| 1527 | 2511822129 | 2511231156 | Bacteria | 6845832 |
| 1528 | 2512035257 | 2511231221 | Bacteria | 6846400 |
| 1529 | 2512325200 | 2512047018 | Bacteria | 6663241 |
| 1530 | 2515689207 | 2515154123 | Bacteria | 6387382 |
| 1531 | 2516022186 | 2515154189 | Bacteria | 9629850 |
| 1532 | 2523107502 | 2522572158 | Bacteria | 6514390 |
| 1533 | 2554812815 | 2554235132 | Bacteria | 6772433 |
| 1534 | 2555245343 | 2554235231 | Bacteria | 5215788 |
| 1535 | 2555667058 | 2554235341 | Bacteria | 6867980 |
| 1536 | 2563062658 | 2562617112 | Bacteria | 10918404 |
| 1537 | 2574433309 | 2574179768 | Bacteria | 4907129 |
| 1538 | 2583152962 | 2582580736 | Bacteria | 5325865 |
| 1539 | 2583795298 | 2582580891 | Bacteria | 6800976 |
| 1540 | 2597855310 | 2597489887 | Bacteria | 6666321 |
| 1541 | 2597861309 | 2597489888 | Bacteria | 6179543 |
| 1542 | 2597867056 | 2597489889 | Bacteria | 6297495 |
| 1543 | 2599104457 | 2597490356 | Bacteria | 7030811 |
| 1544 | 2599327947 | 2599185155 | Bacteria | 5827168 |
| 1545 | 2599355532 | 2599185160 | Bacteria | 6844013 |
| 1546 | 2599363065 | 2599185161 | Bacteria | 6960462 |
| 1547 | 2599368629 | 2599185162 | Bacteria | 6957254 |
| 1548 | 2599376174 | 2599185163 | Bacteria | 6995158 |
| 1549 | 2599380638 | 2599185164 | Bacteria | 6841688 |
| 1550 | 2599387846 | 2599185165 | Bacteria | 6843250 |
| 1551 | 2599395032 | 2599185166 | Bacteria | 6959206 |
| 1552 | 2599401197 | 2599185167 | Bacteria | 6353609 |
| 1553 | 2599406797 | 2599185168 | Bacteria | 6997636 |
| 1554 | 2599449470 | 2599185179 | Bacteria | 6611171 |
| 1555 | 2599462366 | 2599185181 | Bacteria | 6844519 |
| 1556 | 2599468211 | 2599185182 | Bacteria | 6883168 |
| 1557 | 2599487436 | 2599185185 | Bacteria | 6652270 |
| 1558 | 2599491383 | 2599185186 | Bacteria | 6831633 |
| 1559 | 2599503899 | 2599185188 | Bacteria | 6164180 |
| 1560 | 2599506135 | 2599185189 | Bacteria | 5862825 |
| 1561 | 2599516474 | 2599185190 | Bacteria | 6285678 |
| 1562 | 2599516516 | 2599185191 | Bacteria | 6297582 |
| 1563 | 2599616160 | 2599185212 | Bacteria | 6765997 |
| 1564 | 2599773707 | 2599185248 | Bacteria | 6696816 |
| 1565 | 2599804208 | 2599185257 | Bacteria | 6492581 |
| 1566 | 2599879431 | 2599185288 | Bacteria | 6666191 |
| 1567 | 2599888001 | 2599185289 | Bacteria | 6778765 |
| 1568 | 2599895864 | 2599185290 | Bacteria | 6289611 |
| 1569 | 2599899308 | 2599185291 | Bacteria | 6775623 |
| 1570 | 2599946263 | 2599185302 | Bacteria | 5954930 |
| 1571 | 2599948623 | 2599185303 | Bacteria | 6512725 |
| 1572 | 2599957438 | 2599185304 | Bacteria | 5951361 |
| 1573 | 2599963638 | 2599185305 | Bacteria | 6748700 |
| 1574 | 2599969790 | 2599185306 | Bacteria | 6637356 |
| 1575 | 2599975241 | 2599185307 | Bacteria | 6194719 |
| 1576 | 2599981311 | 2599185308 | Bacteria | 6621546 |
| 1577 | 2599986863 | 2599185309 | Bacteria | 5969593 |
| 1578 | 2599991258 | 2599185310 | Bacteria | 6014457 |
| 1579 | 2599997300 | 2599185311 | Bacteria | 6354990 |
| 1580 | 2600000911 | 2599185312 | Bacteria | 5912071 |
| 1581 | 2600007370 | 2599185313 | Bacteria | 6658188 |
| 1582 | 2600015109 | 2599185314 | Bacteria | 6621749 |
| 1583 | 2600021343 | 2599185315 | Bacteria | 6771107 |
| 1584 | 2600026735 | 2599185316 | Bacteria | 6320029 |
| 1585 | 2600032303 | 2599185317 | Bacteria | 6435722 |
| 1586 | 2600038549 | 2599185318 | Bacteria | 6961590 |
| 1587 | 2600043950 | 2599185319 | Bacteria | 6637840 |
| 1588 | 2600050133 | 2599185320 | Bacteria | 5963263 |
| 1589 | 2600056415 | 2599185321 | Bacteria | 6764560 |
| 1590 | 2600062396 | 2599185322 | Bacteria | 6763055 |
| 1591 | 2600065204 | 2599185323 | Bacteria | 6688755 |
| 1592 | 2600074282 | 2599185324 | Bacteria | 6590677 |
| 1593 | 2600080410 | 2599185325 | Bacteria | 6324919 |
| 1594 | 2600214988 | 2599185356 | Bacteria | 6843884 |
| 1595 | 2600361663 | 2600254930 | Bacteria | 6431253 |
| 1596 | 2600363079 | 2600254931 | Bacteria | 6734225 |
| 1597 | 2600446315 | 2600254954 | Bacteria | 5100516 |
| 1598 | 2601627796 | 2600255283 | Bacteria | 6061572 |
| 1599 | 2601666688 | 2600255292 | Bacteria | 6300551 |
| 1600 | 2601693383 | 2600255296 | Bacteria | 5784754 |
| 1601 | 2601775154 | 2600255313 | Bacteria | 6842543 |
| 1602 | 2601798100 | 2600255318 | Bacteria | 6383414 |
| 1603 | 2602012657 | 2600255389 | Bacteria | 5275336 |
| 1604 | 2606076988 | 2603880185 | Bacteria | 6379190 |
| 1605 | 2606129766 | 2603880199 | Bacteria | 6377649 |
| 1606 | 2608383279 | 2606217733 | Bacteria | 6360972 |
| 1607 | 2621296435 | 2619619299 | Bacteria | 6649820 |
| 1608 | 2624477895 | 2623620443 | Bacteria | 6427864 |
| 1609 | 2624489466 | 2623620446 | Bacteria | 6500345 |
| 1610 | 2643843455 | 2643221565 | Bacteria | 6216018 |
| 1611 | 2643873598 | 2643221571 | Bacteria | 6228673 |
| 1612 | 2643954642 | 2643221589 | Bacteria | 6250934 |
| 1613 | 2644022909 | 2643221602 | Bacteria | 6249926 |
| 1614 | 2644184081 | 2643221633 | Bacteria | 6733554 |
| 1615 | 2644282757 | 2643221650 | Bacteria | 7029547 |
| 1616 | 2644624385 | 2643221713 | Bacteria | 6554480 |
| 1617 | 2652547685 | 2651869719 | Bacteria | 6047974 |
| 1618 | 2671091812 | 2667528170 | Bacteria | 6786960 |
| 1619 | 2671099706 | 2667528171 | Bacteria | 6900659 |
| 1620 | 2671129520 | 2667528176 | Bacteria | 6724917 |
| 1621 | 2671771217 | 2671180172 | Bacteria | 6495783 |
| 1622 | 2677900361 | 2675903420 | Bacteria | 6247433 |
| 1623 | 2678266611 | 2675903515 | Bacteria | 6580491 |
| 1624 | 2713476895 | 2711768613 | Bacteria | 11048459 |
| 1625 | 2715749420 | 2713897148 | Bacteria | 5883533 |
| 1626 | 2715754422 | 2713897149 | Bacteria | 6506249 |
| 1627 | 2723246212 | 2721755607 | Bacteria | 5841722 |
| 1628 | 2738673381 | 2738541265 | Bacteria | 6594665 |
| 1629 | 2738690686 | 2738541271 | Bacteria | 5657310 |
| 1630 | 2738751774 | 2738541282 | Bacteria | 6593925 |
| 1631 | 2738807655 | 2738541294 | Bacteria | 6925949 |
| 1632 | 2738860815 | 2738541303 | Bacteria | 6591772 |
| 1633 | 2738895015 | 2738541309 | Bacteria | 6926455 |
| 1634 | 2739202319 | 2738543004 | Bacteria | 6381073 |
| 1635 | 2739262751 | 2738543015 | Bacteria | 6750701 |
| 1636 | 2739266460 | 2738543016 | Bacteria | 5657564 |
| 1637 | 2739312071 | 2738543025 | Bacteria | 6600348 |
| 1638 | 2743740879 | 2740892503 | Bacteria | 6855563 |
| 1639 | 2745007841 | 2744054620 | Bacteria | 6551379 |
| 1640 | 2765581323 | 2765235841 | Bacteria | 6137024 |
| 1641 | 2774117948 | 2773857670 | Bacteria | 6407454 |
| 1642 | 2774136620 | 2773857673 | Bacteria | 6513460 |
| 1643 | 2784261386 | 2784132063 | Bacteria | 6262788 |
| 1644 | 2784316434 | 2784132072 | Bacteria | 6596533 |
| 1645 | 2792833856 | 2791355137 | Bacteria | 9654227 |
| 1646 | 2794593680 | 2791355520 | Bacteria | 5948615 |
| 1647 | 2807410852 | 2806310737 | Bacteria | 5751088 |
| 1648 | 2807459193 | 2806310745 | Bacteria | 5742165 |
| 1649 | 2808858367 | 2808606361 | Bacteria | 6136259 |
| 1650 | 2808905784 | 2808606373 | Bacteria | 4423627 |
| 1651 | 2808923866 | 2808606376 | Bacteria | 6248667 |
| 1652 | 2808928028 | 2808606377 | Bacteria | 6646337 |
| 1653 | 2808938456 | 2808606378 | Bacteria | 6177535 |
| 1654 | 2808942097 | 2808606379 | Bacteria | 5022697 |
| 1655 | 2808946279 | 2808606380 | Bacteria | 6248705 |
| 1656 | 2808950790 | 2808606381 | Bacteria | 6646461 |
| 1657 | 2808960755 | 2808606382 | Bacteria | 6841132 |
| 1658 | 2808966808 | 2808606383 | Bacteria | 6138645 |
| 1659 | 2808980035 | 2808606385 | Bacteria | 6711065 |
| 1660 | 2808995755 | 2808606388 | Bacteria | 6706662 |
| 1661 | 2809001682 | 2808606389 | Bacteria | 6138126 |
| 1662 | 2809217649 | 2808606445 | Bacteria | 6057339 |
| 1663 | 2812369902 | 2811994881 | Bacteria | 6298475 |
| 1664 | 2817488086 | 2816332298 | Bacteria | 6852809 |
| 1665 | 2819624681 | 2818991450 | Bacteria | 6962147 |
| 1666 | 2819655550 | 2818991456 | Bacteria | 6123676 |
| 1667 | 2819704853 | 2818991464 | Bacteria | 6907494 |
| 1668 | 2823421462 | 2823421272 | Bacteria | 5372474 |
| 1669 | 2825654600 | 2825651385 | Bacteria | 6715909 |
| 1670 | 2826581587 | 2826581358 | Bacteria | 5963467 |
| 1671 | 2834031344 | 2834028612 | Bacteria | 6354979 |
| 1672 | 2842715346 | 2842711865 | Bacteria | 7155354 |
| 1673 | 2842821296 | 2842815866 | Bacteria | 5947510 |
| 1674 | 2842832047 | 2842826826 | Bacteria | 5974129 |
| 1675 | 2842833869 | 2842832357 | Bacteria | 5959113 |
| 1676 | 2842838318 | 2842837860 | Bacteria | 6066181 |
| 1677 | 2842846097 | 2842843487 | Bacteria | 6004777 |
| 1678 | 2842851885 | 2842849001 | Bacteria | 5924277 |
| 1679 | 2842856066 | 2842854478 | Bacteria | 6143501 |
| 1680 | 2844667546 | 2844665904 | Bacteria | 6817974 |
| 1681 | 2846956770 | 2846952575 | Bacteria | 6587527 |
| 1682 | 2852616741 | 2852612431 | Bacteria | 6885235 |
| 1683 | 2852662697 | 2852657418 | Bacteria | 6472974 |
| 1684 | 2852671709 | 2852667396 | Bacteria | 6885555 |
| 1685 | 2857548453 | 2857547612 | Bacteria | 6179999 |
| 1686 | 2860345335 | 2860339153 | Bacteria | 6846989 |
| 1687 | 2860868109 | 2860867994 | Bacteria | 5645326 |
| 1688 | 2873320507 | 2873314349 | Bacteria | 8512634 |
| 1689 | 2878029838 | 2878029506 | Bacteria | 6418441 |
| 1690 | 2880230789 | 2880230671 | Bacteria | 6140320 |
| 1691 | 2885084512 | 2885080285 | Bacteria | 6355622 |
| 1692 | 2885275516 | 2885270888 | Bacteria | 9831543 |
| 1693 | 2897806792 | 2897803580 | Bacteria | 7000062 |
| 1694 | 2900642114 | 2900634093 | Bacteria | 10263517 |
| 1695 | 2900642757 | 2900634093 | Bacteria | 10263517 |
| 1696 | 2904518522 | 2904518522 | Bacteria | 6068986 |
| 1697 | 2904542372 | 2904541872 | Bacteria | 8915136 |
| 1698 | 2904553326 | 2904550169 | Bacteria | 6221258 |
| 1699 | 2904622198 | 2904615490 | Bacteria | 10047340 |
| 1700 | 2904705613 | |||
| 1701 | 2908446699 | 2908446538 | Bacteria | 6829095 |
| 1702 | 2912963897 | 2912963787 | Bacteria | 5646108 |
| 1703 | 2913036967 | 2913036834 | Bacteria | 6704877 |
| 1704 | 2917070796 | 2917070673 | Bacteria | 6868303 |
| 1705 | 2919069657 | 2919063839 | Bacteria | 6302690 |
| 1706 | 2919156202 | 2919155634 | Bacteria | 4860545 |
| 1707 | 2919388753 | 2919385768 | Bacteria | 5897293 |
| 1708 | 2919457987 | 2919456309 | Bacteria | 6586567 |
| 1709 | 2919487136 | 2919481497 | Bacteria | 6907839 |
| 1710 | 2919493004 | 2919487758 | Bacteria | 5929766 |
| 1711 | 2919503096 | 2919501602 | Bacteria | 5286340 |
| 1712 | 2919702329 | 2919697872 | Bacteria | 6553725 |
| 1713 | 2923153711 | 2923153595 | Bacteria | 6870622 |
| 1714 | 2923523988 | 2923519811 | Bacteria | 6298479 |
| 1715 | 2923589465 | 2923586266 | Bacteria | 6565975 |
| 1716 | 2926064770 | 2926063275 | Bacteria | 5285848 |
| 1717 | 2928110629 | 2928108538 | Bacteria | 7360024 |
| 1718 | 2928140145 | 2928135762 | Bacteria | 7259641 |
| 1719 | 2928505638 | 2928503688 | Bacteria | 7268108 |
| 1720 | 2929144474 | 2929144301 | Bacteria | 6622272 |
| 1721 | 2929189992 | 2929189879 | Bacteria | 5930554 |
| 1722 | 2931372180 | 2931369376 | Bacteria | 6847892 |
| 1723 | 2931391054 | 2931390751 | Bacteria | 6273349 |
| 1724 | 2931398534 | 2931396565 | Bacteria | 7251677 |
| 1725 | 2932413046 | 2932410948 | Bacteria | 6312192 |
| 1726 | 2932420561 | 2932416698 | Bacteria | 6315112 |
| 1727 | 2932424593 | 2932422444 | Bacteria | 4678430 |
| 1728 | 2935357869 | 2935353572 | Unclassified | 6955622 |
| 1729 | 2939642688 | 2939636861 | Bacteria | 6297853 |
| 1730 | 2939654505 | 2939651529 | Bacteria | 5895393 |
| 1731 | 2945930490 | 2945928738 | Bacteria | 6053221 |
| 1732 | 2945967267 | 2945961074 | Bacteria | 7342064 |
| 1733 | 2946012835 | 2946006987 | Bacteria | 6705746 |
| 1734 | 2947234818 | 2947233263 | Bacteria | 6439278 |
| 1735 | 2969304596 | 2969304461 | Bacteria | 6601805 |
| 1736 | 2974293650 | 2974289157 | Bacteria | 6080362 |
| 1737 | 2984292402 | 2984286254 | Bacteria | 6702062 |
| 1738 | 2987606793 | 2987605356 | Bacteria | 4187822 |
| 1739 | 2988731907 | 2988728565 | Bacteria | 6124362 |
| 1740 | 2998140160 | 2998139840 | Bacteria | 6073514 |
| 1741 | 3007254849 | 3007252601 | Bacteria | 4559114 |
| 1742 | 3007316083 | 3007315729 | Bacteria | 5076637 |
| 1743 | 3007398964 | 3007395558 | Bacteria | 6755444 |
| 1744 | 3007419694 | 3007419365 | Bacteria | 7026924 |
| 1745 | 3007517573 | 3007511990 | Bacteria | 6481491 |
| 1746 | 3007614735 | 3007614139 | Bacteria | 6053559 |
| 1747 | 3007623897 | 3007619802 | Bacteria | 6411688 |
| 1748 | 3007722672 | 3007718800 | Bacteria | 5971527 |
| 1749 | 3007807243 | 3007803356 | Bacteria | 5931491 |
| 1750 | 3007859611 | 3007855910 | Bacteria | 5637581 |
| 1751 | 3007864660 | 3007861166 | Bacteria | 6045338 |
| 1752 | 3007871482 | 3007866637 | Bacteria | 5899198 |
| 1753 | 3007874907 | 3007872151 | Bacteria | 5268868 |
| 1754 | 637317461 | 637000220 | Bacteria | 7074893 |
| 1755 | 639787071 | 639633007 | Bacteria | 4376040 |
| 1756 | 8011352618 | 8011350971 | Bacteria | 6158957 |
| 1757 | 8015687974 | 8015687852 | Bacteria | 6613826 |
| 1758 | 8019769359 | 8019769354 | Bacteria | 6924660 |
| 1759 | 8019779552 | 8019775933 | Bacteria | 6858656 |
| 1760 | 8021127612 | 8021120328 | Bacteria | 8782274 |
| 1761 | 8029995093 | 8029995093 | Bacteria | 5990776 |
| 1762 | 8034964435 | 8034962539 | Bacteria | 4884839 |
| 1763 | 8052494513 | 8052494512 | Bacteria | 5765634 |
| 1764 | 8054009138 | 8054002106 | Bacteria | 7987183 |
| 1765 | 8054287042 | 8054285046 | Bacteria | 6919322 |
| 1766 | 8054288070 | 8054285046 | Bacteria | 6919322 |
| 1767 | 8054349199 | 8054347763 | Bacteria | 5901107 |
| 1768 | 8054503659 | 8054503363 | Bacteria | 6101651 |
| 1769 | 8054930045 | 8054929484 | Bacteria | 5599761 |
| 1770 | 8055771072 | 8055770955 | Bacteria | 6827675 |
| 1771 | 8055818023 | 8055817908 | Bacteria | 6609162 |
| 1772 | 8055883537 | 8055878733 | Bacteria | 5907058 |
| 1773 | 8056116464 | 8056115690 | Bacteria | 5527654 |
| 1774 | 8056125766 | 8056120720 | Bacteria | 5758328 |
| 1775 | 8056126172 | 8056125926 | Bacteria | 6228218 |
| 1776 | 8056131991 | 8056131705 | Bacteria | 6107031 |
| 1777 | 8056137530 | 8056137416 | Bacteria | 6147080 |
| 1778 | 8056143395 | 8056143049 | Bacteria | 6307666 |
| 1779 | 8056151111 | 8056148874 | Bacteria | 6479865 |
| 1780 | 8056160150 | 8056155041 | Bacteria | 6486948 |
| 1781 | 8056164020 | 8056161164 | Bacteria | 6106669 |
| 1782 | 8056170889 | 8056166840 | Bacteria | 5820959 |
| 1783 | 8056177023 | 8056172158 | Bacteria | 6133900 |
| 1784 | 8056182375 | 8056177738 | Bacteria | 6748268 |
| 1785 | 8056570888 | 8056569372 | Bacteria | 5997322 |
| 1786 | 8057802354 | 8057798959 | Bacteria | 6713499 |
| 1787 | Ga0207713_1034368 | |||
| 1788 | MRS2a_Contig_849 | |||
| 1789 | SwRhRL2b_contig_2139936 | |||
| 1790 | SwRhRL2b_contig_3821960 | |||
| 1791 | JGI24735J21928_10002975 | |||
| 1792 | JGI25156J39149_1001576 | |||
| 1793 | JGI25162J39368_1003079 | |||
| 1794 | JGI25154J39366_1001005 | |||
| 1795 | JGI25154J39366_1003567 | |||
| 1796 | JGI25157J39369_1000161 | |||
| 1797 | JGI25163J39215_1001189 | |||
| 1798 | JGI25163J39215_1001375 | |||
| 1799 | JGI25164J39214_1001483 | |||
| 1800 | JGI25164J39214_1001780 | |||
| 1801 | JGI25165J46597_1002668 | |||
| 1802 | JGI25165J46597_1003187 | |||
| 1803 | rootH2_10034079 | |||
| 1804 | rootL2_10118786 | |||
| 1805 | JGI25160J50197_1000228 | |||
| 1806 | JGI25161J50226_1000171 | |||
| 1807 | Ga0055538_1000012 | |||
| 1808 | Ga0055539_1000017 | |||
| 1809 | Ga0055539_1000819 | |||
| 1810 | Ga0055533_1000016 | |||
| 1811 | Ga0055533_1000021 | |||
| 1812 | Ga0055533_1000918 | |||
| 1813 | Ga0055532_1000020 | |||
| 1814 | Ga0055532_1000122 | |||
| 1815 | Ga0055525_1000117 | |||
| 1816 | Ga0055525_1000579 | |||
| 1817 | Ga0055527_1000078 | |||
| 1818 | Ga0055527_1004495 | |||
| 1819 | Ga0055535_1000054 | |||
| 1820 | Ga0055535_1000165 | |||
| 1821 | Ga0055535_1006646 | |||
| 1822 | Ga0055542_1001566 | |||
| 1823 | Ga0055529_1000214 | |||
| 1824 | Ga0055529_1000405 | |||
| 1825 | Ga0055536_1009213 | |||
| 1826 | Ga0055536_1009265 | |||
| 1827 | Ga0055530_10004442 | |||
| 1828 | Ga0055530_10004741 | |||
| 1829 | Ga0055540_1000378 | |||
| 1830 | Ga0055540_1003947 | |||
| 1831 | Ga0055540_1004013 | |||
| 1832 | Ga0055540_1014204 | |||
| 1833 | Ga0055531_10001099 | |||
| 1834 | Ga0055541_1000012 | |||
| 1835 | Ga0055543_1000333 | |||
| 1836 | Ga0065714_10007826 | |||
| 1837 | Ga0065714_10008516 | |||
| 1838 | Ga0065714_10009353 | |||
| 1839 | Ga0065714_10067720 | |||
| 1840 | Ga0065714_10069841 | |||
| 1841 | Ga0065714_10069906 | |||
| 1842 | Ga0065714_10111222 | |||
| 1843 | Ga0065704_10008316 | |||
| 1844 | Ga0065704_10071136 | |||
| 1845 | Ga0065704_10078938 | |||
| 1846 | Ga0065704_10102271 | |||
| 1847 | Ga0065712_10000372 | |||
| 1848 | Ga0065712_10081765 | |||
| 1849 | Ga0065715_10030400 | |||
| 1850 | Ga0070658_10003769 | |||
| 1851 | Ga0070676_10006747 | |||
| 1852 | Ga0070690_100004971 | |||
| 1853 | Ga0070670_100037777 | |||
| 1854 | Ga0070670_100051980 | |||
| 1855 | Ga0070670_100095274 | |||
| 1856 | Ga0068869_100017263 | |||
| 1857 | Ga0068869_100161123 | |||
| 1858 | Ga0068868_100023640 | |||
| 1859 | Ga0070660_100003374 | |||
| 1860 | Ga0070661_100000237 | |||
| 1861 | Ga0070669_100000277 | |||
| 1862 | Ga0070669_100014309 | |||
| 1863 | Ga0070675_100044645 | |||
| 1864 | Ga0070673_100003982 | |||
| 1865 | Ga0070659_100012909 | |||
| 1866 | Ga0070667_100244631 | |||
| 1867 | Ga0070714_100183514 | |||
| 1868 | Ga0070711_100021816 | |||
| 1869 | Ga0070700_100040447 | |||
| 1870 | Ga0070678_100132658 | |||
| 1871 | Ga0070662_100019698 | |||
| 1872 | Ga0070662_100020496 | |||
| 1873 | Ga0070662_100095490 | |||
| 1874 | Ga0070662_100133207 | |||
| 1875 | Ga0068867_100005827 | |||
| 1876 | Ga0068853_100000143 | |||
| 1877 | Ga0068853_100071924 | |||
| 1878 | Ga0070695_100106262 | |||
| 1879 | Ga0070696_100000044 | |||
| 1880 | Ga0070665_100001196 | |||
| 1881 | Ga0070665_100032296 | |||
| 1882 | Ga0070665_100293050 | |||
| 1883 | Ga0070665_100317496 | |||
| 1884 | Ga0068855_100001954 | |||
| 1885 | Ga0068855_100019854 | |||
| 1886 | Ga0068855_100045492 | |||
| 1887 | Ga0068855_100062589 | |||
| 1888 | Ga0068855_100121264 | |||
| 1889 | Ga0070664_100003174 | |||
| 1890 | Ga0070664_100025219 | |||
| 1891 | Ga0068857_100012908 | |||
| 1892 | Ga0068857_100125587 | |||
| 1893 | Ga0068854_100008045 | |||
| 1894 | Ga0068854_100069237 | |||
| 1895 | Ga0068856_100001351 | |||
| 1896 | Ga0068859_100294244 | |||
| 1897 | Ga0068861_100053912 | |||
| 1898 | Ga0068851_10000018 | |||
| 1899 | Ga0068851_10002048 | |||
| 1900 | Ga0068860_100155352 | |||
| 1901 | Ga0068862_100127773 | |||
| 1902 | Ga0075365_10005012 | |||
| 1903 | Ga0075363_100006720 | |||
| 1904 | Ga0075364_10030448 | |||
| 1905 | Ga0075364_10181827 | |||
| 1906 | Ga0075364_10183231 | |||
| 1907 | Ga0075432_10005891 | |||
| 1908 | Ga0075432_10010937 | |||
| 1909 | Ga0075362_10035226 | |||
| 1910 | Ga0075367_10073570 | |||
| 1911 | Ga0075369_10001718 | |||
| 1912 | Ga0075369_10034587 | |||
| 1913 | Ga0075366_10001098 | |||
| 1914 | Ga0075366_10069057 | |||
| 1915 | Ga0075370_10000523 | |||
| 1916 | Ga0075430_100010146 | |||
| 1917 | Ga0075430_100011601 | |||
| 1918 | Ga0075430_100046312 | |||
| 1919 | Ga0075431_100000786 | |||
| 1920 | Ga0075431_100011765 | |||
| 1921 | Ga0075429_100001077 | |||
| 1922 | Ga0075429_100050654 | |||
| 1923 | Ga0068865_100008692 | |||
| 1924 | Ga0075436_100155945 | |||
| 1925 | Ga0097620_100294240 | |||
| 1926 | Ga0099823_1016467 | |||
| 1927 | Ga0099823_1032132 | |||
| 1928 | Ga0079104_1005125 | |||
| 1929 | Ga0079104_1006328 | |||
| 1930 | Ga0079104_1024727 | |||
| 1931 | Ga0099826_10003322 | |||
| 1932 | Ga0105251_10000033 | |||
| 1933 | Ga0105251_10000068 | |||
| 1934 | Ga0105251_10000164 | |||
| 1935 | Ga0105251_10002783 | |||
| 1936 | Ga0105251_10010844 | |||
| 1937 | Ga0105251_10013372 | |||
| 1938 | Ga0105251_10015218 | |||
| 1939 | Ga0105251_10015354 | |||
| 1940 | Ga0105251_10019273 | |||
| 1941 | Ga0105251_10029258 | |||
| 1942 | Ga0105251_10033590 | |||
| 1943 | Ga0105251_10061639 | |||
| 1944 | Ga0105251_10062003 | |||
| 1945 | Ga0105251_10076005 | |||
| 1946 | Ga0105251_10083480 | |||
| 1947 | Ga0105251_10101894 | |||
| 1948 | Ga0105244_10000073 | |||
| 1949 | Ga0105244_10010173 | |||
| 1950 | Ga0105244_10016315 | |||
| 1951 | Ga0105244_10017085 | |||
| 1952 | Ga0105244_10022905 | |||
| 1953 | Ga0105244_10032272 | |||
| 1954 | Ga0105244_10034872 | |||
| 1955 | Ga0105244_10035196 | |||
| 1956 | Ga0105244_10036394 | |||
| 1957 | Ga0105244_10042193 | |||
| 1958 | Ga0105244_10044602 | |||
| 1959 | Ga0105244_10057304 | |||
| 1960 | Ga0105244_10057882 | |||
| 1961 | Ga0105244_10083420 | |||
| 1962 | Ga0105244_10094451 | |||
| 1963 | Ga0105250_10003622 | |||
| 1964 | Ga0105250_10009006 | |||
| 1965 | Ga0105250_10009193 | |||
| 1966 | Ga0105250_10009210 | |||
| 1967 | Ga0105250_10019332 | |||
| 1968 | Ga0105250_10025608 | |||
| 1969 | Ga0105250_10029822 | |||
| 1970 | Ga0105250_10033368 | |||
| 1971 | Ga0105250_10041947 | |||
| 1972 | Ga0105250_10057606 | |||
| 1973 | Ga0105250_10068378 | |||
| 1974 | Ga0105240_10001785 | |||
| 1975 | Ga0105240_10018880 | |||
| 1976 | Ga0105240_10047594 | |||
| 1977 | Ga0105240_10268203 | |||
| 1978 | Ga0105245_10060018 | |||
| 1979 | Ga0114129_10009668 | |||
| 1980 | Ga0114129_10015093 | |||
| 1981 | Ga0105243_10000867 | |||
| 1982 | Ga0105243_10017764 | |||
| 1983 | Ga0105243_10017969 | |||
| 1984 | Ga0105243_10079103 | |||
| 1985 | Ga0105243_10145135 | |||
| 1986 | Ga0105243_10163865 | |||
| 1987 | Ga0105241_10022047 | |||
| 1988 | Ga0105241_10029074 | |||
| 1989 | Ga0105242_10019610 | |||
| 1990 | Ga0105248_10030717 | |||
| 1991 | Ga0105248_10295441 | |||
| 1992 | Ga0105248_10314119 | |||
| 1993 | Ga0105237_10005268 | |||
| 1994 | Ga0105237_10006601 | |||
| 1995 | Ga0105237_10020051 | |||
| 1996 | Ga0105237_10253832 | |||
| 1997 | Ga0105237_10260531 | |||
| 1998 | Ga0105238_10016263 | |||
| 1999 | Ga0105238_10050976 | |||
| 2000 | Ga0105238_10060257 | |||
| 2001 | Ga0105249_10034205 | |||
| 2002 | Ga0105249_10174753 | |||
| 2003 | Ga0105239_10001427 | |||
| 2004 | Ga0105239_10013882 | |||
| 2005 | Ga0105239_10015905 | |||
| 2006 | Ga0105239_10183976 | |||
| 2007 | Ga0105239_10548316 | |||
| 2008 | Ga0105246_10011951 | |||
| 2009 | Ga0105246_10036895 | |||
| 2010 | Ga0105246_10075544 | |||
| 2011 | Ga0157345_1000442 | |||
| 2012 | Ga0157373_10006536 | |||
| 2013 | Ga0157373_10027291 | |||
| 2014 | Ga0157373_10027729 | |||
| 2015 | Ga0157373_10027748 | |||
| 2016 | Ga0157373_10028485 | |||
| 2017 | Ga0157373_10029522 | |||
| 2018 | Ga0157373_10082661 | |||
| 2019 | Ga0157373_10138581 | |||
| 2020 | Ga0157373_10150738 | |||
| 2021 | Ga0157371_10000953 | |||
| 2022 | Ga0157371_10024662 | |||
| 2023 | Ga0157371_10025980 | |||
| 2024 | Ga0157371_10190682 | |||
| 2025 | Ga0157370_10002438 | |||
| 2026 | Ga0157370_10018816 | |||
| 2027 | Ga0157370_10071433 | |||
| 2028 | Ga0157370_10104735 | |||
| 2029 | Ga0157370_10163363 | |||
| 2030 | Ga0157370_10282960 | |||
| 2031 | Ga0157370_10296213 | |||
| 2032 | Ga0157369_10000059 | |||
| 2033 | Ga0157369_10007539 | |||
| 2034 | Ga0157369_10022299 | |||
| 2035 | Ga0157369_10052885 | |||
| 2036 | Ga0157369_10056658 | |||
| 2037 | Ga0157369_10059826 | |||
| 2038 | Ga0157369_10060450 | |||
| 2039 | Ga0157369_10061449 | |||
| 2040 | Ga0157369_10114782 | |||
| 2041 | Ga0157369_10140660 | |||
| 2042 | Ga0157369_10318947 | |||
| 2043 | Ga0157374_10000169 | |||
| 2044 | Ga0157378_10281119 | |||
| 2045 | Ga0163162_10088689 | |||
| 2046 | Ga0163162_10334811 | |||
| 2047 | Ga0157372_10013821 | |||
| 2048 | Ga0157372_10053489 | |||
| 2049 | Ga0157372_10054813 | |||
| 2050 | Ga0157372_10068726 | |||
| 2051 | Ga0157375_10047043 | |||
| 2052 | Ga0157375_10060495 | |||
| 2053 | Ga0157375_10077195 | |||
| 2054 | Ga0157375_10104585 | |||
| 2055 | Ga0157375_10230022 | |||
| 2056 | Ga0163163_10048170 | |||
| 2057 | Ga0182008_10001812 | |||
| 2058 | Ga0182008_10009427 | |||
| 2059 | Ga0182008_10014600 | |||
| 2060 | Ga0182008_10014636 | |||
| 2061 | Ga0182008_10014724 | |||
| 2062 | Ga0182008_10015562 | |||
| 2063 | Ga0182008_10029608 | |||
| 2064 | Ga0182008_10033783 | |||
| 2065 | Ga0182008_10034115 | |||
| 2066 | Ga0182008_10050749 | |||
| 2067 | Ga0182008_10055221 | |||
| 2068 | Ga0182008_10074458 | |||
| 2069 | Ga0157379_10149377 | |||
| 2070 | Ga0182006_1000010 | |||
| 2071 | Ga0182006_1010330 | |||
| 2072 | Ga0182006_1013537 | |||
| 2073 | Ga0182006_1016834 | |||
| 2074 | Ga0182006_1017640 | |||
| 2075 | Ga0182006_1029532 | |||
| 2076 | Ga0182006_1055698 | |||
| 2077 | Ga0182007_10000021 | |||
| 2078 | Ga0182007_10008472 | |||
| 2079 | Ga0182007_10008663 | |||
| 2080 | Ga0182007_10008990 | |||
| 2081 | Ga0182005_1000009 | |||
| 2082 | Ga0182005_1003466 | |||
| 2083 | Ga0182005_1022613 | |||
| 2084 | Ga0182005_1028172 | |||
| 2085 | Ga0163161_10016144 | |||
| 2086 | Ga0163161_10026393 | |||
| 2087 | Ga0163161_10026913 | |||
| 2088 | Ga0163161_10027232 | |||
| 2089 | Ga0163161_10061279 | |||
| 2090 | Ga0163161_10078481 | |||
| 2091 | Ga0163161_10100084 | |||
| 2092 | Ga0163161_10129265 | |||
| 2093 | Ga0163161_10201641 | |||
| 2094 | Ga0163161_10211938 | |||
| 2095 | Ga0206354_11526548 | |||
| 2096 | Ga0206353_11725857 | |||
| 2097 | Ga0213872_10001350 | |||
| 2098 | Ga0213875_10008155 | |||
| 2099 | Ga0209435_100441 | |||
| 2100 | Ga0209760_100230 | |||
| 2101 | Ga0209760_100611 | |||
| 2102 | Ga0209784_100007 | |||
| 2103 | Ga0209566_100009 | |||
| 2104 | Ga0209674_100021 | |||
| 2105 | Ga0209674_100041 | |||
| 2106 | Ga0209674_100130 | |||
| 2107 | Ga0209672_100036 | |||
| 2108 | Ga0209672_100221 | |||
| 2109 | Ga0209147_100009 | |||
| 2110 | Ga0209147_100066 | |||
| 2111 | Ga0209563_100018 | |||
| 2112 | Ga0209563_100043 | |||
| 2113 | Ga0209563_101799 | |||
| 2114 | Ga0207427_100005 | |||
| 2115 | Ga0207427_100006 | |||
| 2116 | Ga0207427_100381 | |||
| 2117 | Ga0209437_100013 | |||
| 2118 | Ga0209437_100018 | |||
| 2119 | Ga0209437_107785 | |||
| 2120 | Ga0209258_100085 | |||
| 2121 | Ga0209258_100237 | |||
| 2122 | Ga0209258_100270 | |||
| 2123 | Ga0209258_100659 | |||
| 2124 | Ga0209646_1000157 | |||
| 2125 | Ga0209646_1000277 | |||
| 2126 | Ga0209026_1000006 | |||
| 2127 | Ga0209677_100012 | |||
| 2128 | Ga0209677_100711 | |||
| 2129 | Ga0209677_101037 | |||
| 2130 | Ga0209677_101090 | |||
| 2131 | Ga0209148_1000198 | |||
| 2132 | Ga0209759_1000194 | |||
| 2133 | Ga0209759_1000424 | |||
| 2134 | Ga0209759_1000691 | |||
| 2135 | Ga0209759_1008092 | |||
| 2136 | Ga0209759_1008780 | |||
| 2137 | Ga0209759_1009425 | |||
| 2138 | Ga0209233_1000021 | |||
| 2139 | Ga0209233_1000022 | |||
| 2140 | Ga0209455_1000195 | |||
| 2141 | Ga0209455_1000289 | |||
| 2142 | Ga0209130_1000440 | |||
| 2143 | Ga0209675_1006200 | |||
| 2144 | Ga0209676_1000015 | |||
| 2145 | Ga0209676_1000157 | |||
| 2146 | Ga0209676_1000222 | |||
| 2147 | Ga0209676_1005209 | |||
| 2148 | Ga0209676_1034513 | |||
| 2149 | Ga0209025_1002963 | |||
| 2150 | Ga0209758_1004418 | |||
| 2151 | Ga0209050_1000030 | |||
| 2152 | Ga0209050_1000061 | |||
| 2153 | Ga0209050_1000296 | |||
| 2154 | Ga0209050_1001068 | |||
| 2155 | Ga0209050_1002164 | |||
| 2156 | Ga0207426_1000428 | |||
| 2157 | Ga0209051_1000143 | |||
| 2158 | Ga0209051_1000295 | |||
| 2159 | Ga0209051_1000572 | |||
| 2160 | Ga0209051_1002845 | |||
| 2161 | Ga0209051_1011071 | |||
| 2162 | Ga0209257_1000422 | |||
| 2163 | Ga0209257_1006394 | |||
| 2164 | Ga0207656_10000009 | |||
| 2165 | Ga0207656_10001119 | |||
| 2166 | Ga0207656_10020296 | |||
| 2167 | Ga0207696_1000055 | |||
| 2168 | Ga0207696_1000127 | |||
| 2169 | Ga0207696_1000151 | |||
| 2170 | Ga0207696_1000165 | |||
| 2171 | Ga0207696_1006896 | |||
| 2172 | Ga0207696_1010951 | |||
| 2173 | Ga0207696_1019707 | |||
| 2174 | Ga0207696_1020824 | |||
| 2175 | Ga0207696_1025011 | |||
| 2176 | Ga0207696_1025475 | |||
| 2177 | Ga0207655_1000135 | |||
| 2178 | Ga0207655_1000548 | |||
| 2179 | Ga0207655_1000667 | |||
| 2180 | Ga0207655_1000754 | |||
| 2181 | Ga0207655_1001354 | |||
| 2182 | Ga0207655_1001521 | |||
| 2183 | Ga0207655_1007039 | |||
| 2184 | Ga0207655_1007611 | |||
| 2185 | Ga0207655_1014954 | |||
| 2186 | Ga0207655_1015759 | |||
| 2187 | Ga0207655_1020097 | |||
| 2188 | Ga0207655_1021272 | |||
| 2189 | Ga0207655_1021500 | |||
| 2190 | Ga0207655_1025941 | |||
| 2191 | Ga0207655_1032556 | |||
| 2192 | Ga0207655_1036360 | |||
| 2193 | Ga0207655_1044563 | |||
| 2194 | Ga0207655_1045529 | |||
| 2195 | Ga0207713_1000103 | |||
| 2196 | Ga0207713_1000126 | |||
| 2197 | Ga0207713_1000325 | |||
| 2198 | Ga0207713_1000716 | |||
| 2199 | Ga0207713_1011815 | |||
| 2200 | Ga0207713_1013444 | |||
| 2201 | Ga0207713_1013814 | |||
| 2202 | Ga0207713_1014219 | |||
| 2203 | Ga0207713_1018465 | |||
| 2204 | Ga0207713_1025165 | |||
| 2205 | Ga0207713_1025439 | |||
| 2206 | Ga0207713_1031704 | |||
| 2207 | Ga0207713_1039008 | |||
| 2208 | Ga0207713_1041563 | |||
| 2209 | Ga0207647_10000091 | |||
| 2210 | Ga0207647_10000272 | |||
| 2211 | Ga0207647_10001804 | |||
| 2212 | Ga0207645_10011652 | |||
| 2213 | Ga0207705_10002361 | |||
| 2214 | Ga0207705_10086015 | |||
| 2215 | Ga0207695_10003498 | |||
| 2216 | Ga0207695_10010947 | |||
| 2217 | Ga0207695_10096044 | |||
| 2218 | Ga0207695_10112070 | |||
| 2219 | Ga0207695_10138817 | |||
| 2220 | Ga0207671_10000876 | |||
| 2221 | Ga0207671_10003791 | |||
| 2222 | Ga0207671_10015444 | |||
| 2223 | Ga0207657_10004644 | |||
| 2224 | Ga0207657_10205738 | |||
| 2225 | Ga0207649_10000007 | |||
| 2226 | Ga0207681_10000291 | |||
| 2227 | Ga0207681_10001552 | |||
| 2228 | Ga0207694_10001660 | |||
| 2229 | Ga0207694_10041592 | |||
| 2230 | Ga0207694_10112983 | |||
| 2231 | Ga0207650_10000308 | |||
| 2232 | Ga0207650_10000407 | |||
| 2233 | Ga0207650_10016920 | |||
| 2234 | Ga0207659_10022325 | |||
| 2235 | Ga0207700_10110379 | |||
| 2236 | Ga0207664_10126972 | |||
| 2237 | Ga0207644_10009545 | |||
| 2238 | Ga0207690_10011023 | |||
| 2239 | Ga0207706_10000050 | |||
| 2240 | Ga0207706_10016345 | |||
| 2241 | Ga0207706_10045896 | |||
| 2242 | Ga0207706_10162278 | |||
| 2243 | Ga0207686_10160735 | |||
| 2244 | Ga0207709_10000107 | |||
| 2245 | Ga0207709_10007573 | |||
| 2246 | Ga0207709_10008362 | |||
| 2247 | Ga0207709_10092703 | |||
| 2248 | Ga0207689_10010915 | |||
| 2249 | Ga0207689_10173882 | |||
| 2250 | Ga0207679_10000013 | |||
| 2251 | Ga0207679_10009846 | |||
| 2252 | Ga0207679_10080874 | |||
| 2253 | Ga0207667_10000379 | |||
| 2254 | Ga0207667_10046021 | |||
| 2255 | Ga0207667_10124367 | |||
| 2256 | Ga0207667_10217556 | |||
| 2257 | Ga0207651_10004392 | |||
| 2258 | Ga0207712_10001134 | |||
| 2259 | Ga0207712_10066761 | |||
| 2260 | Ga0207640_10003822 | |||
| 2261 | Ga0207640_10067306 | |||
| 2262 | Ga0207640_10125902 | |||
| 2263 | Ga0207658_10006370 | |||
| 2264 | Ga0207677_10007314 | |||
| 2265 | Ga0207639_10000079 | |||
| 2266 | Ga0207639_10011033 | |||
| 2267 | Ga0207678_10001000 | |||
| 2268 | Ga0207678_10173025 | |||
| 2269 | Ga0207702_10014223 | |||
| 2270 | Ga0207648_10013130 | |||
| 2271 | Ga0207648_10181471 | |||
| 2272 | Ga0207674_10033449 | |||
| 2273 | Ga0207674_10036724 | |||
| 2274 | Ga0207674_10053121 | |||
| 2275 | Ga0207675_100029012 | |||
| 2276 | Ga0207683_10032577 | |||
| 2277 | Ga0207683_10151050 | |||
| 2278 | Ga0209281_1000091 | |||
| 2279 | Ga0209281_1003801 | |||
| 2280 | Ga0209281_1011417 | |||
| 2281 | Ga0209281_1012731 | |||
| 2282 | Ga0209389_1000065 | |||
| 2283 | Ga0209389_1021659 | |||
| 2284 | Ga0209371_1000073 | |||
| 2285 | Ga0209371_1000775 | |||
| 2286 | Ga0209969_1000072 | |||
| 2287 | Ga0209967_1003726 | |||
| 2288 | Ga0209981_1000108 | |||
| 2289 | Ga0209996_1004305 | |||
| 2290 | Ga0210000_1000423 | |||
| 2291 | Ga0209995_1001435 | |||
| 2292 | Ga0209968_1003403 | |||
| 2293 | Ga0209999_1000212 | |||
| 2294 | Ga0209983_1001173 | |||
| 2295 | Ga0209983_1006675 | |||
| 2296 | Ga0209971_1001954 | |||
| 2297 | Ga0209966_1009664 | |||
| 2298 | Ga0209974_10009674 | |||
| 2299 | Ga0209974_10010740 | |||
| 2300 | Ga0207428_10060798 | |||
| 2301 | Ga0207428_10074405 | |||
| 2302 | Ga0207428_10144090 | |||
| 2303 | Ga0207428_10151253 | |||
| 2304 | Ga0207428_10175230 | |||
| 2305 | Ga0207428_10193243 | |||
| 2306 | Ga0268266_10000006 | |||
| 2307 | Ga0268266_10017690 | |||
| 2308 | Ga0268264_10032366 | |||
| 2309 | Ga0268264_10285339 | |||
| 2310 | Ga0265336_10000189 | |||
| 2311 | Ga0307515_10000104 | |||
| 2312 | Ga0307515_10005049 | |||
| 2313 | Ga0307515_10005461 | |||
| 2314 | Ga0307515_10037602 | |||
| 2315 | Ga0265338_10107072 | |||
| 2316 | Ga0265324_10000255 | |||
| 2317 | Ga0268256_1000247 | |||
| 2318 | Ga0268256_1001404 | |||
| 2319 | Ga0307511_10030120 | |||
| 2320 | Ga0314311_1025917 | |||
| 2321 | Ga0316178_1123526 | |||
| 2322 | Ga0316183_1118649 | |||
| 2323 | Ga0316183_1178545 | |||
| 2324 | Ga0265332_10006593 | |||
| 2325 | Ga0265329_10027195 | |||
| 2326 | Ga0265340_10011527 | |||
| 2327 | Ga0265339_10000801 | |||
| 2328 | Ga0265316_10040536 | |||
| 2329 | Ga0307513_10000034 | |||
| 2330 | Ga0307513_10002789 | |||
| 2331 | Ga0307513_10030775 | |||
| 2332 | Ga0307509_10003313 | |||
| 2333 | Ga0307408_100000028 | |||
| 2334 | Ga0307408_100000338 | |||
| 2335 | Ga0307408_100026625 | |||
| 2336 | Ga0307408_100036015 | |||
| 2337 | Ga0307408_100056151 | |||
| 2338 | Ga0307408_100119184 | |||
| 2339 | Ga0265313_10000307 | |||
| 2340 | Ga0307514_10003090 | |||
| 2341 | Ga0265342_10000100 | |||
| 2342 | Ga0307516_10000897 | |||
| 2343 | Ga0307516_10006945 | |||
| 2344 | Ga0307516_10009346 | |||
| 2345 | Ga0307516_10013621 | |||
| 2346 | Ga0307516_10050576 | |||
| 2347 | Ga0307516_10050777 | |||
| 2348 | Ga0307405_10013526 | |||
| 2349 | Ga0307405_10015744 | |||
| 2350 | Ga0307405_10016560 | |||
| 2351 | Ga0307405_10059682 | |||
| 2352 | Ga0307413_10079353 | |||
| 2353 | Ga0307413_10084560 | |||
| 2354 | Ga0307413_10125521 | |||
| 2355 | Ga0307410_10145750 | |||
| 2356 | Ga0307406_10106134 | |||
| 2357 | Ga0307412_10018660 | |||
| 2358 | Ga0307412_10020551 | |||
| 2359 | Ga0307412_10020661 | |||
| 2360 | Ga0307412_10023350 | |||
| 2361 | Ga0307412_10041635 | |||
| 2362 | Ga0307412_10058169 | |||
| 2363 | Ga0307409_100025004 | |||
| 2364 | Ga0307409_100070387 | |||
| 2365 | Ga0307416_100016949 | |||
| 2366 | Ga0307416_100025732 | |||
| 2367 | Ga0307416_100146046 | |||
| 2368 | Ga0307414_10006140 | |||
| 2369 | Ga0307414_10023837 | |||
| 2370 | Ga0307414_10056148 | |||
| 2371 | Ga0307411_10017935 | |||
| 2372 | Ga0307411_10053502 | |||
| 2373 | Ga0307411_10236690 | |||
| 2374 | Ga0307510_10054664 | |||
| 2375 | Ga0373926_0025936 | |||
| 2376 | Ga0373931_0000552 | |||
| 2377 | Ga0373927_0020208 | |||
| 2378 | Ga0373927_0075028 | |||
| 2379 | Ga0395899_0000036 | |||
| 2380 | Ga0395899_0000714 | |||
| 2381 | Ga0395899_0018524 | |||
| 2382 | Ga0395900_0000071 | |||
| 2383 | Ga0395900_0036795 | |||
| 2384 | Ga0395900_0109555 | |||
| 2385 | Ga0395900_0116347 | |||
| 2386 | Ga0395898_0000115 | |||
| 2387 | Ga0395898_0012451 | |||
| 2388 | Ga0395898_0085204 | |||
| 2389 | Ga0395898_0096604 | |||
| 2390 | Ga0395905_0001506 | |||
| 2391 | Ga0436364_1525509 | |||
| 2392 | Ga0395901_0000004 | |||
| 2393 | Ga0395901_0001368 | |||
| 2394 | Ga0395901_0158453 | |||
| 2395 | Ga0436361_0466601 | |||
| 2396 | Ga0436361_1053838 | |||
| 2397 | Ga0439436_0000225 | |||
| 2398 | Ga0439438_002200 | |||
| 2399 | Ga0439438_004067 | |||
| 2400 | Ga0439438_005970 | |||
| 2401 | Ga0439438_005973 | |||
| 2402 | Ga0439438_006320 | |||
| 2403 | Ga0439438_006365 | |||
| 2404 | Ga0439438_006499 | |||
| 2405 | Ga0439438_006519 | |||
| 2406 | Ga0439438_006743 | |||
| 2407 | Ga0439438_006761 | |||
| 2408 | Ga0439438_006831 | |||
| 2409 | Ga0439438_014045 | |||
| 2410 | Ga0439438_022521 | |||
| 2411 | Ga0439439_0030447 | |||
| 2412 | Ga0439447_002459 | |||
| 2413 | Ga0439447_003125 | |||
| 2414 | Ga0439447_004709 | |||
| 2415 | Ga0439447_005458 | |||
| 2416 | Ga0439447_009499 | |||
| 2417 | Ga0439447_014228 | |||
| 2418 | Ga0439447_020490 | |||
| 2419 | Ga0439447_025009 | |||
| 2420 | Ga0439466_0000796 | |||
| 2421 | Ga0439466_0004708 | |||
| 2422 | Ga0439466_0005092 | |||
| 2423 | Ga0439466_0007368 | |||
| 2424 | Ga0439466_0009753 | |||
| 2425 | Ga0439466_0013980 | |||
| 2426 | Ga0439466_0020978 | |||
| 2427 | Ga0439466_0026003 | |||
| 2428 | Ga0439466_0032009 | |||
| 2429 | Ga0439466_0033250 | |||
| 2430 | Ga0439466_0038739 | |||
| 2431 | Ga0439465_0025204 | |||
| 2432 | Ga0439465_0043143 | |||
| 2433 | Ga0451839_1109028 | |||
| 2434 | Ga0451853_0711122 | |||
| 2435 | Ga0439431_0003906 | |||
| 2436 | Ga0439431_0012654 | |||
| 2437 | Ga0439445_0013584 | |||
| 2438 | Ga0439445_0018474 | |||
| 2439 | Ga0439448_0000581 | |||
| 2440 | Ga0439432_001654 | |||
| 2441 | Ga0439432_005913 | |||
| 2442 | Ga0439432_006204 | |||
| 2443 | Ga0439432_006953 | |||
| 2444 | Ga0439432_007015 | |||
| 2445 | Ga0439432_010771 | |||
| 2446 | Ga0439432_017464 | |||
| 2447 | Ga0439449_0000464 | |||
| 2448 | Ga0439449_0005192 | |||
| 2449 | Ga0439451_003295 | |||
| 2450 | Ga0439451_006019 | |||
| 2451 | Ga0439451_008503 | |||
| 2452 | Ga0439452_000130 | |||
| 2453 | Ga0439452_003722 | |||
| 2454 | Ga0439452_005386 | |||
| 2455 | Ga0439452_005491 | |||
| 2456 | Ga0439452_005745 | |||
| 2457 | Ga0439452_009541 | |||
| 2458 | Ga0439452_011783 | |||
| 2459 | Ga0439452_012672 | |||
| 2460 | Ga0439452_019181 | |||
| 2461 | Ga0439452_023796 | |||
| 2462 | Ga0439452_029483 | |||
| 2463 | Ga0439456_000036 | |||
| 2464 | Ga0439456_001886 | |||
| 2465 | Ga0439456_002202 | |||
| 2466 | Ga0439456_010498 | |||
| 2467 | Ga0439456_015419 | |||
| 2468 | Ga0439456_016827 | |||
| 2469 | Ga0439456_017209 | |||
| 2470 | Ga0439462_0001819 | |||
| 2471 | Ga0439463_001273 | |||
| 2472 | Ga0439463_001697 | |||
| 2473 | Ga0439463_002033 | |||
| 2474 | Ga0439463_008109 | |||
| 2475 | Ga0439463_014299 | |||
| 2476 | Ga0439463_017672 | |||
| 2477 | Ga0439463_022200 | |||
| 2478 | Ga0439463_022382 | |||
| 2479 | Ga0450911_000027 | |||
| 2480 | Ga0450911_002156 | |||
| 2481 | Ga0450911_005048 | |||
| 2482 | Ga0450919_002076 | |||
| 2483 | Ga0450922_001625 | |||
| 2484 | Ga0450923_009272 | |||
| 2485 | Ga0450890_003479 | |||
| 2486 | Ga0450898_011868 | |||
| 2487 | Ga0450902_001681 | |||
| 2488 | Ga0450903_008964 | |||
| 2489 | Ga0450904_000135 | |||
| 2490 | Ga0450904_001911 | |||
| 2491 | Ga0450905_000251 | |||
| 2492 | Ga0450906_009115 | |||
| 2493 | Ga0450907_000328 | |||
| 2494 | Ga0450907_012909 | |||
| 2495 | Ga0450910_000604 | |||
| 2496 | Ga0450910_002175 | |||
| 2497 | Ga0450910_003725 | |||
| 2498 | Ga0439446_0000014 | |||
| 2499 | Ga0439446_0021432 | |||
| 2500 | Ga0450908_008616 | |||
| 2501 | Ga0450909_001936 | |||
| 2502 | Ga0450909_005675 | |||
| 2503 | Ga0439434_0002300 | |||
| 2504 | Ga0439464_0020896 | |||
| 2505 | Ga0439460_0002952 | |||
| 2506 | Ga0450916_000275 | |||
| 2507 | Ga0450901_002167 | |||
| 2508 | Ga0451577_0014309 | |||
| 2509 | Ga0451577_0024496 | |||
| 2510 | Ga0451577_0026154 | |||
| 2511 | Ga0439440_0001756 | |||
| 2512 | Ga0439440_0015796 | |||
| 2513 | Ga0466969_0011303 | |||
| 2514 | Ga0466972_0012303 | |||
| 2515 | Ga0453683_0000328 | |||
| 2516 | Ga0453683_0004904 | |||
| 2517 | Ga0453683_0007818 | |||
| 2518 | Ga0466965_0000089 | |||
| 2519 | Ga0466965_0018474 | |||
| 2520 | Ga0466965_0029001 | |||
| 2521 | Ga0466966_0000011 | |||
| 2522 | Ga0466966_0001297 | |||
| 2523 | Ga0466966_0006083 | |||
| 2524 | Ga0466966_0007670 | |||
| 2525 | Ga0466966_0051452 | |||
| 2526 | Ga0466961_0000210 | |||
| 2527 | Ga0466961_0000372 | |||
| 2528 | Ga0466961_0055685 | |||
| 2529 | Ga0466963_0002174 | |||
| 2530 | Ga0466963_0002861 | |||
| 2531 | Ga0466963_0004620 | |||
| 2532 | Ga0466964_0007901 | |||
| 2533 | Ga0466964_0023540 | |||
| 2534 | Ga0453684_0334467 | |||
| 2535 | Ga0466971_0002989 | |||
| 2536 | Ga0466971_0027909 | |||
| 2537 | Ga0466968_0003337 | |||
| 2538 | Ga0466968_0022741 | |||
| 2539 | Ga0466970_0017932 | |||
| 2540 | Ga0466957_0005059 | |||
| 2541 | Ga0466957_0008447 | |||
| 2542 | Ga0466957_0015152 | |||
| 2543 | Ga0466959_0001660 | |||
| 2544 | Ga0466959_0001900 | |||
| 2545 | Ga0466959_0005828 | |||
| 2546 | Ga0466959_0011539 | |||
| 2547 | Ga0451576_0000695 | |||
| 2548 | Ga0451576_0009989 | |||
| 2549 | Ga0451576_0301730 | |||
| 2550 | Ga0466958_0002609 | |||
| 2551 | Ga0466958_0014114 | |||
| 2552 | Ga0466958_0016177 | |||
| 2553 | Ga0466967_0032689 | |||
| 2554 | Ga0466967_0115853 | |||
| 2555 | Ga0495617_006004 | |||
| 2556 | Ga0495617_015682 | |||
| 2557 | Ga0495617_026342 | |||
| 2558 | Ga0495627_000115 | |||
| 2559 | Ga0495627_000869 | |||
| 2560 | Ga0495627_004307 | |||
| 2561 | Ga0495627_008096 | |||
| 2562 | Ga0495627_022986 | |||
| 2563 | Ga0495627_023468 | |||
| 2564 | Ga0495627_027309 | |||
| 2565 | Ga0495627_029811 | |||
| 2566 | Ga0495603_0003108 | |||
| 2567 | Ga0495590_0014737 | |||
| 2568 | Ga0495590_0033615 | |||
| 2569 | Ga0495590_0033893 | |||
| 2570 | Ga0495590_0044684 | |||
| 2571 | Ga0495591_000061 | |||
| 2572 | Ga0495591_000334 | |||
| 2573 | Ga0495591_000628 | |||
| 2574 | Ga0495591_002793 | |||
| 2575 | Ga0495591_004212 | |||
| 2576 | Ga0495591_006168 | |||
| 2577 | Ga0495591_008800 | |||
| 2578 | Ga0495591_009192 | |||
| 2579 | Ga0495591_019015 | |||
| 2580 | Ga0495591_023045 | |||
| 2581 | Ga0495591_023079 | |||
| 2582 | Ga0495591_026451 | |||
| 2583 | Ga0495591_030832 | |||
| 2584 | Ga0495591_031082 | |||
| 2585 | Ga0495591_040254 | |||
| 2586 | Ga0495629_0004392 | |||
| 2587 | Ga0495629_0063569 | |||
| 2588 | Ga0495638_0022540 | |||
| 2589 | Ga0495638_0023306 | |||
| 2590 | Ga0495638_0024472 | |||
| 2591 | Ga0495638_0075785 | |||
| 2592 | Ga0495638_0078804 | |||
| 2593 | Ga0495638_0078998 | |||
| 2594 | Ga0495638_0092394 | |||
| 2595 | Ga0495638_0093145 | |||
| 2596 | Ga0495638_0094204 | |||
| 2597 | Ga0495638_0098647 | |||
| 2598 | Ga0495638_0102624 | |||
| 2599 | Ga0495638_0105579 | |||
| 2600 | Ga0495653_0008489 | |||
| 2601 | Ga0495653_0029892 | |||
| 2602 | Ga0495653_0061267 | |||
| 2603 | Ga0495653_0080332 | |||
| 2604 | Ga0495653_0099975 | |||
| 2605 | Ga0495653_0171227 | |||
| 2606 | Ga0495650_0001603 | |||
| 2607 | Ga0495650_0006532 | |||
| 2608 | Ga0495650_0015289 | |||
| 2609 | Ga0495650_0032641 | |||
| 2610 | Ga0495650_0039947 | |||
| 2611 | Ga0495650_0044138 | |||
| 2612 | Ga0495650_0044202 | |||
| 2613 | Ga0495650_0047490 | |||
| 2614 | Ga0495580_0002591 | |||
| 2615 | Ga0495605_0000376 | |||
| 2616 | Ga0495605_0000441 | |||
| 2617 | Ga0495605_0001221 | |||
| 2618 | Ga0495605_0004763 | |||
| 2619 | Ga0495605_0010819 | |||
| 2620 | Ga0495605_0016196 | |||
| 2621 | Ga0495605_0030882 | |||
| 2622 | Ga0495605_0047069 | |||
| 2623 | Ga0495605_0047337 | |||
| 2624 | Ga0495639_0009832 | |||
| 2625 | Ga0495639_0058928 | |||
| 2626 | Ga0495639_0087005 | |||
| 2627 | Ga0495662_0063874 | |||
| 2628 | Ga0495664_0005113 | |||
| 2629 | Ga0495584_0007969 | |||
| 2630 | Ga0495584_0011920 | |||
| 2631 | Ga0495584_0013290 | |||
| 2632 | Ga0495584_0017193 | |||
| 2633 | Ga0495584_0029322 | |||
| 2634 | Ga0495584_0036252 | |||
| 2635 | Ga0495584_0038208 | |||
| 2636 | Ga0495584_0043553 | |||
| 2637 | Ga0495584_0046847 | |||
| 2638 | Ga0495584_0046957 | |||
| 2639 | Ga0495584_0048906 | |||
| 2640 | Ga0495584_0050134 | |||
| 2641 | Ga0495584_0054077 | |||
| 2642 | Ga0495584_0097176 | |||
| 2643 | Ga0495584_0103246 | |||
| 2644 | Ga0495585_0009776 | |||
| 2645 | Ga0495585_0010924 | |||
| 2646 | Ga0495585_0018037 | |||
| 2647 | Ga0495585_0025281 | |||
| 2648 | Ga0495585_0038450 | |||
| 2649 | Ga0495585_0055565 | |||
| 2650 | Ga0495585_0066260 | |||
| 2651 | Ga0495585_0073689 | |||
| 2652 | Ga0495585_0075512 | |||
| 2653 | Ga0495585_0077657 | |||
| 2654 | Ga0495585_0083679 | |||
| 2655 | Ga0495594_0032304 | |||
| 2656 | Ga0495594_0092949 | |||
| 2657 | Ga0495594_0115021 | |||
| 2658 | Ga0495596_0004405 | |||
| 2659 | Ga0495596_0036356 | |||
| 2660 | Ga0495607_0000147 | |||
| 2661 | Ga0495607_0000560 | |||
| 2662 | Ga0495607_0000747 | |||
| 2663 | Ga0495607_0000751 | |||
| 2664 | Ga0495607_0002973 | |||
| 2665 | Ga0495607_0005110 | |||
| 2666 | Ga0495607_0008448 | |||
| 2667 | Ga0495607_0012768 | |||
| 2668 | Ga0495607_0017578 | |||
| 2669 | Ga0495607_0019645 | |||
| 2670 | Ga0495607_0020345 | |||
| 2671 | Ga0495607_0028688 | |||
| 2672 | Ga0495607_0039642 | |||
| 2673 | Ga0495607_0068672 | |||
| 2674 | Ga0495607_0073646 | |||
| 2675 | Ga0495607_0082298 | |||
| 2676 | Ga0495607_0093523 | |||
| 2677 | Ga0495607_0100249 | |||
| 2678 | Ga0495607_0101689 | |||
| 2679 | Ga0495583_0000026 | |||
| 2680 | Ga0495583_0000982 | |||
| 2681 | Ga0495583_0001389 | |||
| 2682 | Ga0495583_0002607 | |||
| 2683 | Ga0495583_0004827 | |||
| 2684 | Ga0495583_0008616 | |||
| 2685 | Ga0495583_0011202 | |||
| 2686 | Ga0495583_0014011 | |||
| 2687 | Ga0495583_0032658 | |||
| 2688 | Ga0495583_0041375 | |||
| 2689 | Ga0495583_0045315 | |||
| 2690 | Ga0495583_0049252 | |||
| 2691 | Ga0495606_0002457 | |||
| 2692 | Ga0495606_0003787 | |||
| 2693 | Ga0495606_0013422 | |||
| 2694 | Ga0495606_0017724 | |||
| 2695 | Ga0495606_0018538 | |||
| 2696 | Ga0495606_0026516 | |||
| 2697 | Ga0495606_0027667 | |||
| 2698 | Ga0495606_0048978 | |||
| 2699 | Ga0495606_0055877 | |||
| 2700 | Ga0495606_0075474 | |||
| 2701 | Ga0495606_0089461 | |||
| 2702 | Ga0495606_0151900 | |||
| 2703 | Ga0495610_0012579 | |||
| 2704 | Ga0495610_0017395 | |||
| 2705 | Ga0495610_0018009 | |||
| 2706 | Ga0495610_0018310 | |||
| 2707 | Ga0495610_0018603 | |||
| 2708 | Ga0495610_0027084 | |||
| 2709 | Ga0495610_0028281 | |||
| 2710 | Ga0495610_0041045 | |||
| 2711 | Ga0495610_0047716 | |||
| 2712 | Ga0495610_0051602 | |||
| 2713 | Ga0495610_0054732 | |||
| 2714 | Ga0495610_0057025 | |||
| 2715 | Ga0495610_0059534 | |||
| 2716 | Ga0495610_0082899 | |||
| 2717 | Ga0495616_0000142 | |||
| 2718 | Ga0495616_0015223 | |||
| 2719 | Ga0495616_0015419 | |||
| 2720 | Ga0495616_0018889 | |||
| 2721 | Ga0495616_0024783 | |||
| 2722 | Ga0495616_0049565 | |||
| 2723 | Ga0495616_0056753 | |||
| 2724 | Ga0495616_0066637 | |||
| 2725 | Ga0495616_0079572 | |||
| 2726 | Ga0495616_0089808 | |||
| 2727 | Ga0495616_0097141 | |||
| 2728 | Ga0495620_0000023 | |||
| 2729 | Ga0495620_0000044 | |||
| 2730 | Ga0495620_0002605 | |||
| 2731 | Ga0495620_0006293 | |||
| 2732 | Ga0495620_0009524 | |||
| 2733 | Ga0495620_0013688 | |||
| 2734 | Ga0495620_0036857 | |||
| 2735 | Ga0495620_0038162 | |||
| 2736 | Ga0495620_0053525 | |||
| 2737 | Ga0495620_0063387 | |||
| 2738 | Ga0495620_0076852 | |||
| 2739 | Ga0495628_0031861 | |||
| 2740 | Ga0495630_0028475 | |||
| 2741 | Ga0495631_0007171 | |||
| 2742 | Ga0495631_0012421 | |||
| 2743 | Ga0495631_0041225 | |||
| 2744 | Ga0495631_0044370 | |||
| 2745 | Ga0495631_0055248 | |||
| 2746 | Ga0495631_0067726 | |||
| 2747 | Ga0495632_0005847 | |||
| 2748 | Ga0495632_0010414 | |||
| 2749 | Ga0495632_0011851 | |||
| 2750 | Ga0495632_0013667 | |||
| 2751 | Ga0495632_0015691 | |||
| 2752 | Ga0495632_0016106 | |||
| 2753 | Ga0495632_0032798 | |||
| 2754 | Ga0495632_0045169 | |||
| 2755 | Ga0495632_0054798 | |||
| 2756 | Ga0495632_0066415 | |||
| 2757 | Ga0495637_0000054 | |||
| 2758 | Ga0495637_0000413 | |||
| 2759 | Ga0495637_0011527 | |||
| 2760 | Ga0495637_0012548 | |||
| 2761 | Ga0495637_0012885 | |||
| 2762 | Ga0495637_0022910 | |||
| 2763 | Ga0495637_0038884 | |||
| 2764 | Ga0495637_0043911 | |||
| 2765 | Ga0495637_0044315 | |||
| 2766 | Ga0495637_0044359 | |||
| 2767 | Ga0495637_0054890 | |||
| 2768 | Ga0495637_0055616 | |||
| 2769 | Ga0495637_0057727 | |||
| 2770 | Ga0495637_0062604 | |||
| 2771 | Ga0495637_0070966 | |||
| 2772 | Ga0495637_0074560 | |||
| 2773 | Ga0495643_0001170 | |||
| 2774 | Ga0495643_0018356 | |||
| 2775 | Ga0495643_0040895 | |||
| 2776 | Ga0495643_0046599 | |||
| 2777 | Ga0495643_0062808 | |||
| 2778 | Ga0495643_0067463 | |||
| 2779 | Ga0495643_0067927 | |||
| 2780 | Ga0495643_0073669 | |||
| 2781 | Ga0495643_0076012 | |||
| 2782 | Ga0495643_0082803 | |||
| 2783 | Ga0495643_0119928 | |||
| 2784 | Ga0495644_0000073 | |||
| 2785 | Ga0495644_0004602 | |||
| 2786 | Ga0495644_0007318 | |||
| 2787 | Ga0495644_0043914 | |||
| 2788 | Ga0495644_0050875 | |||
| 2789 | Ga0495648_0002643 | |||
| 2790 | Ga0495648_0008018 | |||
| 2791 | Ga0495648_0010343 | |||
| 2792 | Ga0495648_0039878 | |||
| 2793 | Ga0495648_0046294 | |||
| 2794 | Ga0495648_0066508 | |||
| 2795 | Ga0495648_0067831 | |||
| 2796 | Ga0495648_0069193 | |||
| 2797 | Ga0495648_0077765 | |||
| 2798 | Ga0495648_0080760 | |||
| 2799 | Ga0495648_0082312 | |||
| 2800 | Ga0495648_0093583 | |||
| 2801 | Ga0495648_0104308 | |||
| 2802 | Ga0495648_0127291 | |||
| 2803 | Ga0495663_0007818 | |||
| 2804 | Ga0495666_0046488 | |||
| 2805 | Ga0495666_0047827 | |||
| 2806 | Ga0495642_0002807 | |||
| 2807 | Ga0495642_0017035 | |||
| 2808 | Ga0495642_0040885 | |||
| 2809 | Ga0495654_0001880 | |||
| 2810 | Ga0495654_0008381 | |||
| 2811 | Ga0495654_0010756 | |||
| 2812 | Ga0495654_0014479 | |||
| 2813 | Ga0495654_0014495 | |||
| 2814 | Ga0495654_0015724 | |||
| 2815 | Ga0495654_0043479 | |||
| 2816 | Ga0495654_0046064 | |||
| 2817 | Ga0495654_0050913 | |||
| 2818 | Ga0495654_0058995 | |||
| 2819 | Ga0495654_0066385 | |||
| 2820 | Ga0495654_0085616 | |||
| 2821 | Ga0495654_0086248 | |||
| 2822 | Ga0495665_0000097 | |||
| 2823 | Ga0495586_0048419 | |||
| 2824 | Ga0495587_0020663 | |||
| 2825 | Ga0495587_0078831 | |||
| 2826 | Ga0495609_0000061 | |||
| 2827 | Ga0495609_0000072 | |||
| 2828 | Ga0495609_0000319 | |||
| 2829 | Ga0495609_0000696 | |||
| 2830 | Ga0495609_0003794 | |||
| 2831 | Ga0495609_0012217 | |||
| 2832 | Ga0495609_0014792 | |||
| 2833 | Ga0495609_0037331 | |||
| 2834 | Ga0495609_0049867 | |||
| 2835 | Ga0495597_0001045 | |||
| 2836 | Ga0495597_0003533 | |||
| 2837 | Ga0495597_0011999 | |||
| 2838 | Ga0495597_0020850 | |||
| 2839 | Ga0495597_0038336 | |||
| 2840 | Ga0495597_0044786 | |||
| 2841 | Ga0495597_0044929 | |||
| 2842 | Ga0495597_0047212 | |||
| 2843 | Ga0495597_0052910 | |||
| 2844 | Ga0495597_0065152 | |||
| 2845 | Ga0495597_0077054 | |||
| 2846 | Ga0495645_0001036 | |||
| 2847 | Ga0495645_0125890 | |||
| 2848 | Ga0495622_0000333 | |||
| 2849 | Ga0495622_0003058 | |||
| 2850 | Ga0495622_0006951 | |||
| 2851 | Ga0495622_0010948 | |||
| 2852 | Ga0495622_0023881 | |||
| 2853 | Ga0495622_0037064 | |||
| 2854 | Ga0495622_0045602 | |||
| 2855 | Ga0495622_0047677 | |||
| 2856 | Ga0495633_0000440 | |||
| 2857 | Ga0495633_0000751 | |||
| 2858 | Ga0495633_0005273 | |||
| 2859 | Ga0495633_0043315 | |||
| 2860 | Ga0495633_0043350 | |||
| 2861 | Ga0495633_0047399 | |||
| 2862 | Ga0495656_0002308 | |||
| 2863 | Ga0495656_0007984 | |||
| 2864 | Ga0495668_0010518 | |||
| 2865 | Ga0495668_0018713 | |||
| 2866 | Ga0495668_0048554 | |||
| 2867 | Ga0495668_0053228 | |||
| 2868 | Ga0495668_0062419 | |||
| 2869 | Ga0495634_0138130 | |||
| 2870 | Ga0495634_0162821 | |||
| 2871 | Ga0495611_0000240 | |||
| 2872 | Ga0495611_0002469 | |||
| 2873 | Ga0495611_0009450 | |||
| 2874 | Ga0495611_0010041 | |||
| 2875 | Ga0495611_0057174 | |||
| 2876 | Ga0495611_0090096 | |||
| 2877 | Ga0495625_0000147 | |||
| 2878 | Ga0495625_0003060 | |||
| 2879 | Ga0495625_0016733 | |||
| 2880 | Ga0495625_0030491 | |||
| 2881 | Ga0495625_0095515 | |||
| 2882 | Ga0495625_0146846 | |||
| 2883 | Ga0495625_0159957 | |||
| 2884 | Ga0495635_0006331 | |||
| 2885 | Ga0495635_0025955 | |||
| 2886 | Ga0495659_0002449 | |||
| 2887 | Ga0495659_0061635 | |||
| 2888 | Ga0495661_0000153 | |||
| 2889 | Ga0495661_0000431 | |||
| 2890 | Ga0495661_0000484 | |||
| 2891 | Ga0495661_0000660 | |||
| 2892 | Ga0495661_0003901 | |||
| 2893 | Ga0495661_0012702 | |||
| 2894 | Ga0495661_0023222 | |||
| 2895 | Ga0495661_0025128 | |||
| 2896 | Ga0495661_0031039 | |||
| 2897 | Ga0495661_0067831 | |||
| 2898 | Ga0495661_0086915 | |||
| 2899 | Ga0495661_0100080 | |||
| 2900 | Ga0495661_0105585 | |||
| 2901 | Ga0495661_0133101 | |||
| 2902 | Ga0495588_0011744 | |||
| 2903 | Ga0495599_0180010 | |||
| 2904 | Ga0495623_0012745 | |||
| 2905 | Ga0495623_0069958 | |||
| 2906 | Ga0495646_0031424 | |||
| 2907 | Ga0495646_0069808 | |||
| 2908 | Ga0495646_0095329 | |||
| 2909 | Ga0495624_0126599 | |||
| 2910 | Ga0495670_0004546 | |||
| 2911 | Ga0495670_0008702 | |||
| 2912 | Ga0495670_0014047 | |||
| 2913 | Ga0495670_0022166 | |||
| 2914 | Ga0495670_0047232 | |||
| 2915 | Ga0495671_0004757 | |||
| 2916 | Ga0495671_0006442 | |||
| 2917 | Ga0495671_0007024 | |||
| 2918 | Ga0495671_0009068 | |||
| 2919 | Ga0495671_0013844 | |||
| 2920 | Ga0495671_0022357 | |||
| 2921 | Ga0495671_0024308 | |||
| 2922 | Ga0495671_0029148 | |||
| 2923 | Ga0495671_0039652 | |||
| 2924 | Ga0495671_0050532 | |||
| 2925 | Ga0495671_0054888 | |||
| 2926 | Ga0495671_0057248 | |||
| 2927 | Ga0495649_0002836 | |||
| 2928 | Ga0495649_0003588 | |||
| 2929 | Ga0495649_0006508 | |||
| 2930 | Ga0495649_0010921 | |||
| 2931 | Ga0495649_0048043 | |||
| 2932 | Ga0495649_0049506 | |||
| 2933 | Ga0495649_0056397 | |||
| 2934 | Ga0495649_0057437 | |||
| 2935 | Ga0495649_0064347 | |||
| 2936 | Ga0495649_0069988 | |||
| 2937 | Ga0495649_0085131 | |||
| 2938 | Ga0495649_0098691 | |||
| 2939 | Ga0495649_0106350 | |||
| 2940 | Ga0495589_0002215 | |||
| 2941 | Ga0495589_0010176 | |||
| 2942 | Ga0495589_0012870 | |||
| 2943 | Ga0495589_0045870 | |||
| 2944 | Ga0495589_0056638 | |||
| 2945 | Ga0495589_0065124 | |||
| 2946 | Ga0495589_0066388 | |||
| 2947 | Ga0495589_0073000 | |||
| 2948 | Ga0495589_0084317 | |||
| 2949 | Ga0495589_0103083 | |||
| 2950 | Ga0495600_0008635 | |||
| 2951 | Ga0495660_0001480 | |||
| 2952 | Ga0495660_0007766 | |||
| 2953 | Ga0495660_0010281 | |||
| 2954 | Ga0495660_0016142 | |||
| 2955 | Ga0495660_0019012 | |||
| 2956 | Ga0495660_0036001 | |||
| 2957 | Ga0495660_0038266 | |||
| 2958 | Ga0495660_0053872 | |||
| 2959 | Ga0495660_0060722 | |||
| 2960 | Ga0495660_0062417 | |||
| 2961 | Ga0495660_0092957 | |||
| 2962 | Ga0495660_0103358 | |||
| 2963 | Ga0495660_0113690 | |||
| 2964 | Ga0495581_0079890 | |||
| 2965 | Ga0495604_0012826 | |||
| 2966 | Ga0495604_0031336 | |||
| 2967 | Ga0495604_0155962 | |||
| 2968 | Ga0495636_0026013 | |||
| 2969 | Ga0495674_0038521 | |||
| 2970 | Ga0495674_0072930 | |||
| 2971 | Ga0495672_0004589 | |||
| 2972 | Ga0495672_0020526 | |||
| 2973 | Ga0495672_0020530 | |||
| 2974 | Ga0495672_0021121 | |||
| 2975 | Ga0495672_0021797 | |||
| 2976 | Ga0495672_0023164 | |||
| 2977 | Ga0495672_0034599 | |||
| 2978 | Ga0495672_0036067 | |||
| 2979 | Ga0495672_0039194 | |||
| 2980 | Ga0495672_0044487 | |||
| 2981 | Ga0495672_0044887 | |||
| 2982 | Ga0495672_0058028 | |||
| 2983 | Ga0495672_0058215 | |||
| 2984 | Ga0495672_0070869 | |||
| 2985 | Ga0495672_0085494 | |||
| 2986 | Ga0495672_0086434 | |||
| 2987 | Ga0495676_0000027 | |||
| 2988 | Ga0495676_0101317 | |||
| 2989 | Ga0495676_0111832 | |||
| 2990 | Ga0495676_0196861 | |||
| 2991 | Ga0495680_0005310 | |||
| 2992 | Ga0495680_0021752 | |||
| 2993 | Ga0495680_0094617 | |||
| 2994 | Ga0495680_0160567 | |||
| 2995 | Ga0495683_0000038 | |||
| 2996 | Ga0495683_0000236 | |||
| 2997 | Ga0495683_0026155 | |||
| 2998 | Ga0495683_0054234 | |||
| 2999 | Ga0495683_0057883 | |||
| 3000 | Ga0495683_0058778 | |||
| 3001 | Ga0495683_0090854 | |||
| 3002 | Ga0495683_0091691 | |||
| 3003 | Ga0495687_000313 | |||
| 3004 | Ga0495687_001285 | |||
| 3005 | Ga0495687_028574 | |||
| 3006 | Ga0495675_0019492 | |||
| 3007 | Ga0495675_0060569 | |||
| 3008 | Ga0495677_0000306 | |||
| 3009 | Ga0495677_0002657 | |||
| 3010 | Ga0495677_0006896 | |||
| 3011 | Ga0495677_0037663 | |||
| 3012 | Ga0495679_000237 | |||
| 3013 | Ga0495679_001014 | |||
| 3014 | Ga0495679_008506 | |||
| 3015 | Ga0495679_009276 | |||
| 3016 | Ga0495679_022332 | |||
| 3017 | Ga0495679_024389 | |||
| 3018 | Ga0495679_042006 | |||
| 3019 | Ga0495679_042152 | |||
| 3020 | Ga0495679_042553 | |||
| 3021 | Ga0495685_000137 | |||
| 3022 | Ga0495673_0001349 | |||
| 3023 | Ga0495673_0001927 | |||
| 3024 | Ga0495673_0001940 | |||
| 3025 | Ga0495673_0007883 | |||
| 3026 | Ga0495673_0010029 | |||
| 3027 | Ga0495673_0012515 | |||
| 3028 | Ga0495673_0013763 | |||
| 3029 | Ga0495673_0014316 | |||
| 3030 | Ga0495673_0014628 | |||
| 3031 | Ga0495673_0024354 | |||
| 3032 | Ga0495673_0047341 | |||
| 3033 | Ga0495673_0053617 | |||
| 3034 | Ga0495673_0063135 | |||
| 3035 | Ga0495673_0077477 | |||
| 3036 | Ga0495681_0002342 | |||
| 3037 | Ga0495681_0016470 | |||
| 3038 | Ga0495681_0018386 | |||
| 3039 | Ga0495681_0033419 | |||
| 3040 | Ga0495681_0035876 | |||
| 3041 | Ga0495681_0036459 | |||
| 3042 | Ga0495681_0037450 | |||
| 3043 | Ga0495681_0051002 | |||
| 3044 | Ga0495681_0051820 | |||
| 3045 | Ga0495681_0055715 | |||
| 3046 | Ga0495681_0056572 | |||
| 3047 | Ga0495681_0066009 | |||
| 3048 | Ga0495681_0070867 | |||
| 3049 | Ga0495681_0087960 | |||
| 3050 | Ga0495686_0000038 | |||
| 3051 | Ga0495686_0013850 | |||
| 3052 | Ga0495686_0063352 | |||
| 3053 | Ga0495686_0068931 | |||
| 3054 | Ga0495686_0094336 | |||
| 3055 | Ga0495686_0134630 | |||
| 3056 | Ga0495593_0000787 | |||
| 3057 | Ga0495593_0030746 | |||
| 3058 | Ga0495593_0103612 | |||
| 3059 | Ga0495602_0022153 | |||
| 3060 | Ga0495602_0182038 | |||
| 3061 | Ga0495626_0000067 | |||
| 3062 | Ga0495626_0006113 | |||
| 3063 | Ga0495626_0006151 | |||
| 3064 | Ga0495626_0012561 | |||
| 3065 | Ga0495626_0014232 | |||
| 3066 | Ga0495626_0038567 | |||
| 3067 | Ga0495626_0040115 | |||
| 3068 | Ga0495626_0045210 | |||
| 3069 | Ga0495626_0062218 | |||
| 3070 | Ga0495626_0067327 | |||
| 3071 | Ga0496100_0073402 | |||
| 3072 | Ga0496100_0084686 | |||
| 3073 | Ga0496102_0043863 | |||
| 3074 | Ga0496102_0063586 | |||
| 3075 | Ga0496102_0072694 | |||
| 3076 | Ga0496102_0102866 | |||
| 3077 | Ga0496104_0031916 | |||
| 3078 | Ga0496104_0123590 | |||
| 3079 | Ga0496105_0000815 | |||
| 3080 | Ga0496105_0085943 | |||
| 3081 | Ga0496107_0048629 | |||
| 3082 | Ga0496110_0068866 | |||
| 3083 | Ga0496112_0069194 | |||
| 3084 | Ga0496112_0225136 | |||
| 3085 | Ga0496112_0283605 | |||
| 3086 | Ga0496113_0013329 | |||
| 3087 | Ga0496114_0017622 | |||
| 3088 | Ga0496114_0184803 | |||
| 3089 | Ga0496115_0050225 | |||
| 3090 | Ga0496115_0099054 | |||
| 3091 | Ga0496116_0010833 | |||
| 3092 | Ga0496116_0018891 | |||
| 3093 | Ga0496116_0019033 | |||
| 3094 | Ga0496116_0021261 | |||
| 3095 | Ga0496116_0027285 | |||
| 3096 | Ga0496116_0068314 | |||
| 3097 | Ga0496116_0071568 | |||
| 3098 | Ga0496116_0087093 | |||
| 3099 | Ga0496116_0098844 | |||
| 3100 | Ga0496117_0000010 | |||
| 3101 | Ga0496117_0003366 | |||
| 3102 | Ga0496117_0005310 | |||
| 3103 | Ga0496117_0012326 | |||
| 3104 | Ga0496117_0017657 | |||
| 3105 | Ga0496117_0018561 | |||
| 3106 | Ga0496117_0021375 | |||
| 3107 | Ga0496117_0036019 | |||
| 3108 | Ga0496117_0041901 | |||
| 3109 | Ga0496117_0065170 | |||
| 3110 | Ga0496117_0086704 | |||
| 3111 | Ga0496117_0118446 | |||
| 3112 | Ga0496117_0123064 | |||
| 3113 | Ga0496117_0142633 | |||
| 3114 | Ga0496118_0000009 | |||
| 3115 | Ga0496118_0006189 | |||
| 3116 | Ga0496118_0018449 | |||
| 3117 | Ga0496118_0047077 | |||
| 3118 | Ga0496118_0052825 | |||
| 3119 | Ga0496118_0053499 | |||
| 3120 | Ga0496118_0056677 | |||
| 3121 | Ga0496118_0072522 | |||
| 3122 | Ga0496118_0075320 | |||
| 3123 | Ga0496118_0102993 | |||
| 3124 | Ga0496118_0104470 | |||
| 3125 | Ga0496118_0122374 | |||
| 3126 | Ga0496118_0143486 | |||
| 3127 | Ga0496119_0000704 | |||
| 3128 | Ga0496119_0039239 | |||
| 3129 | Ga0496119_0091843 | |||
| 3130 | Ga0496119_0119688 | |||
| 3131 | Ga0496120_0010286 | |||
| 3132 | Ga0496120_0014369 | |||
| 3133 | Ga0496120_0095490 | |||
| 3134 | Ga0496120_0098621 | |||
| 3135 | Ga0496121_0003788 | |||
| 3136 | Ga0496121_0004345 | |||
| 3137 | Ga0496121_0005540 | |||
| 3138 | Ga0496121_0027165 | |||
| 3139 | Ga0496121_0036800 | |||
| 3140 | Ga0496121_0057144 | |||
| 3141 | Ga0496121_0068129 | |||
| 3142 | Ga0496121_0071640 | |||
| 3143 | Ga0496121_0115269 | |||
| 3144 | Ga0496121_0117093 | |||
| 3145 | Ga0496121_0127966 | |||
| 3146 | Ga0496121_0130009 | |||
| 3147 | Ga0496121_0151242 | |||
| 3148 | Ga0496122_0000079 | |||
| 3149 | Ga0496122_0000517 | |||
| 3150 | Ga0496122_0000890 | |||
| 3151 | Ga0496122_0002629 | |||
| 3152 | Ga0496122_0023593 | |||
| 3153 | Ga0496122_0033075 | |||
| 3154 | Ga0496122_0035281 | |||
| 3155 | Ga0496122_0048232 | |||
| 3156 | Ga0496122_0052604 | |||
| 3157 | Ga0496122_0075993 | |||
| 3158 | Ga0496122_0077637 | |||
| 3159 | Ga0496122_0088531 | |||
| 3160 | Ga0496122_0099104 | |||
| 3161 | Ga0496122_0126604 | |||
| 3162 | Ga0496123_0000073 | |||
| 3163 | Ga0496123_0000243 | |||
| 3164 | Ga0496123_0001424 | |||
| 3165 | Ga0496123_0004921 | |||
| 3166 | Ga0496123_0011862 | |||
| 3167 | Ga0496123_0028664 | |||
| 3168 | Ga0496123_0055107 | |||
| 3169 | Ga0496123_0059953 | |||
| 3170 | Ga0496123_0086238 | |||
| 3171 | Ga0496123_0089243 | |||
| 3172 | Ga0496124_0000511 | |||
| 3173 | Ga0496124_0025306 | |||
| 3174 | Ga0496124_0034546 | |||
| 3175 | Ga0496124_0038300 | |||
| 3176 | Ga0496124_0038315 | |||
| 3177 | Ga0496124_0081795 | |||
| 3178 | Ga0496124_0093927 | |||
| 3179 | Ga0496124_0101317 | |||
| 3180 | Ga0496124_0133275 | |||
| 3181 | Ga0496124_0164269 | |||
| 3182 | Ga0496124_0169101 | |||
| 3183 | Ga0496124_0170017 | |||
| 3184 | Ga0496125_0002177 | |||
| 3185 | Ga0496125_0005766 | |||
| 3186 | Ga0496125_0038819 | |||
| 3187 | Ga0496125_0039957 | |||
| 3188 | Ga0496125_0040272 | |||
| 3189 | Ga0496125_0077667 | |||
| 3190 | Ga0496125_0098581 | |||
| 3191 | Ga0496125_0109797 | |||
| 3192 | Ga0496125_0140093 | |||
| 3193 | Ga0496125_0167344 | |||
| 3194 | Ga0496126_0000838 | |||
| 3195 | Ga0496126_0044107 | |||
| 3196 | Ga0496126_0045063 | |||
| 3197 | Ga0496126_0196546 | |||
| 3198 | Ga0496126_0224693 | |||
| 3199 | Ga0495678_000054 | |||
| 3200 | Ga0495678_000078 | |||
| 3201 | Ga0495678_010708 | |||
| 3202 | Ga0495678_011987 | |||
| 3203 | Ga0495678_028649 | |||
| 3204 | Ga0495678_030698 | |||
| 3205 | Ga0495678_039949 | |||
| 3206 | Ga0495678_042583 | |||
| 3207 | Ga0495678_063478 | |||
| 3208 | Ga0495678_068624 | |||
| 3209 | Ga0495682_0000069 | |||
| 3210 | Ga0495682_0003335 | |||
| 3211 | Ga0495682_0003684 | |||
| 3212 | Ga0495682_0028634 | |||
| 3213 | Ga0501031_0005889 | |||
| 3214 | Ga0501031_0058010 | |||
| 3215 | Ga0501032_0000449 | |||
| 3216 | Ga0501033_0001574 | |||
| 3217 | Ga0501033_0092876 | |||
| 3218 | Ga0501034_0000164 | |||
| 3219 | Ga0501034_0007896 | |||
| 3220 | Ga0501034_0023202 | |||
| 3221 | Ga0501034_0229789 | |||
| 3222 | Ga0501036_0001261 | |||
| 3223 | Ga0501037_0001265 | |||
| 3224 | Ga0501037_0066044 | |||
| 3225 | Ga0501038_0012053 | |||
| 3226 | Ga0501039_0064436 | |||
| 3227 | Ga0501039_0104851 | |||
| 3228 | Ga0501040_0000307 | |||
| 3229 | Ga0501040_0001449 | |||
| 3230 | Ga0501041_0034738 | |||
| 3231 | Ga0501042_0000603 | |||
| 3232 | Ga0501043_0003265 | |||
| 3233 | Ga0501046_0001788 | |||
| 3234 | Ga0501047_0003908 | |||
| 3235 | Ga0501076_0020900 | |||
| 3236 | Ga0501077_0083312 | |||
| 3237 | Ga0501222_007907 | |||
| 3238 | Ga0501235_023389 | |||
| 3239 | Ga0501240_008426 | |||
| 3240 | Ga0501079_0012489 | |||
| 3241 | Ga0501079_0050515 | |||
| 3242 | Ga0501081_0002881 | |||
| 3243 | Ga0501241_004320 | |||
| 3244 | Ga0501262_007974 | |||
| 3245 | Ga0501269_002975 | |||
| 3246 | Ga0501282_000230 | |||
| 3247 | Ga0501035_0185893 | |||
| 3248 | Ga0501044_0120768 | |||
| 3249 | Ga0501045_0008665 | |||
| 3250 | Ga0501226_000348 | |||
| 3251 | nmdc:mga03683_41472_c1 | |||
| 3252 | nmdc:mga00v17_154487_c1 | |||
| 3253 | nmdc:mga0k408_107519_c1 | |||
| 3254 | nmdc:mga0k408_272_c2 | |||
| 3255 | nmdc:mga0k408_59276_c1 | |||
| 3256 | nmdc:mga0k408_7263_c2 | |||
| 3257 | nmdc:mga07m45_10124_c1 | |||
| 3258 | nmdc:mga07m45_136_c1 | |||
| 3259 | nmdc:mga07m45_37979_c1 | |||
| 3260 | nmdc:mga07m45_55694_c1 | |||
| 3261 | nmdc:mga05p37_24610_c1 | |||
| 3262 | nmdc:mga05p37_75674_c1 | |||
| 3263 | nmdc:mga09592_20902_c1 | |||
| 3264 | nmdc:mga09592_365_c1 | |||
| 3265 | nmdc:mga0qj67_112046_c1 | |||
| 3266 | nmdc:mga0qj67_15012_c1 | |||
| 3267 | nmdc:mga0qj67_7700_c1 | |||
| 3268 | nmdc:mga06r32_112366_c1 | |||
| 3269 | nmdc:mga06r32_25761_c1 | |||
| 3270 | nmdc:mga08y16_237961_c1 | |||
| 3271 | nmdc:mga0sz30_14524_c1 | |||
| 3272 | Ga0500635_0000210 | |||
| 3273 | Ga0495619_0027728 | |||
| 3274 | Ga0500644_0003052 | |||
| 3275 | Ga0500572_013953 | |||
| 3276 | Ga0500595_000950 | |||
| 3277 | Ga0500618_002869 | |||
| 3278 | Ga0500618_003991 | |||
| 3279 | Ga0500559_0076107 | |||
| 3280 | Ga0500573_0088086 | |||
| 3281 | Ga0500590_007334 | |||
| 3282 | Ga0500619_003055 | |||
| 3283 | Ga0500634_0015573 | |||
| 3284 | Ga0500587_000416 | |||
| 3285 | Ga0501084_0001517 | |||
| 3286 | Ga0500661_002235 | |||
| 3287 | Ga0501082_0013114 | |||
| 3288 | Ga0466962_0003526 | |||
| 3289 | Ga0466962_0005762 | |||
| 3290 | Ga0466962_0010726 | |||
| 3291 | Ga0466962_0112944 | |||
| 3292 | Ga0530510_0138360 | |||
| 3293 | 2511246917 | |||
| 3294 | 2511253735 | |||
| 3295 | 2511264687 | |||
| 3296 | 2511273726 | |||
| 3297 | 2511279643 | |||
| 3298 | 2511289598 | |||
| 3299 | 2511294698 | |||
| 3300 | 2511298841 | |||
| 3301 | 2511317061 | |||
| 3302 | 2511322157 | |||
| 3303 | 2511324578 | |||
| 3304 | 2511332314 | |||
| 3305 | 2511337755 | |||
| 3306 | 2511347348 | |||
| 3307 | 2511352476 | |||
| 3308 | 2511359234 | |||
| 3309 | 2511360727 | |||
| 3310 | 2511368853 | |||
| 3311 | 2511376680 | |||
| 3312 | 2511412356 | |||
| 3313 | 2511822129 | |||
| 3314 | 2512035257 | |||
| 3315 | 2512325200 | |||
| 3316 | 2515689207 | |||
| 3317 | 2516022186 | |||
| 3318 | 2523107502 | |||
| 3319 | 2554812815 | |||
| 3320 | 2555245343 | |||
| 3321 | 2555667058 | |||
| 3322 | 2563062658 | |||
| 3323 | 2574433309 | |||
| 3324 | 2583152962 | |||
| 3325 | 2583795298 | |||
| 3326 | 2597855310 | |||
| 3327 | 2597861309 | |||
| 3328 | 2597867056 | |||
| 3329 | 2599104457 | |||
| 3330 | 2599327947 | |||
| 3331 | 2599355532 | |||
| 3332 | 2599363065 | |||
| 3333 | 2599368629 | |||
| 3334 | 2599376174 | |||
| 3335 | 2599380638 | |||
| 3336 | 2599387846 | |||
| 3337 | 2599395032 | |||
| 3338 | 2599401197 | |||
| 3339 | 2599406797 | |||
| 3340 | 2599449470 | |||
| 3341 | 2599462366 | |||
| 3342 | 2599468211 | |||
| 3343 | 2599487436 | |||
| 3344 | 2599491383 | |||
| 3345 | 2599503899 | |||
| 3346 | 2599506135 | |||
| 3347 | 2599516474 | |||
| 3348 | 2599516516 | |||
| 3349 | 2599616160 | |||
| 3350 | 2599773707 | |||
| 3351 | 2599804208 | |||
| 3352 | 2599879431 | |||
| 3353 | 2599888001 | |||
| 3354 | 2599895864 | |||
| 3355 | 2599899308 | |||
| 3356 | 2599946263 | |||
| 3357 | 2599948623 | |||
| 3358 | 2599957438 | |||
| 3359 | 2599963638 | |||
| 3360 | 2599969790 | |||
| 3361 | 2599975241 | |||
| 3362 | 2599981311 | |||
| 3363 | 2599986863 | |||
| 3364 | 2599991258 | |||
| 3365 | 2599997300 | |||
| 3366 | 2600000911 | |||
| 3367 | 2600007370 | |||
| 3368 | 2600015109 | |||
| 3369 | 2600021343 | |||
| 3370 | 2600026735 | |||
| 3371 | 2600032303 | |||
| 3372 | 2600038549 | |||
| 3373 | 2600043950 | |||
| 3374 | 2600050133 | |||
| 3375 | 2600056415 | |||
| 3376 | 2600062396 | |||
| 3377 | 2600065204 | |||
| 3378 | 2600074282 | |||
| 3379 | 2600080410 | |||
| 3380 | 2600214988 | |||
| 3381 | 2600361663 | |||
| 3382 | 2600363079 | |||
| 3383 | 2600446315 | |||
| 3384 | 2601627796 | |||
| 3385 | 2601666688 | |||
| 3386 | 2601693383 | |||
| 3387 | 2601775154 | |||
| 3388 | 2601798100 | |||
| 3389 | 2602012657 | |||
| 3390 | 2606076988 | |||
| 3391 | 2606129766 | |||
| 3392 | 2608383279 | |||
| 3393 | 2621296435 | |||
| 3394 | 2624477895 | |||
| 3395 | 2624489466 | |||
| 3396 | 2643843455 | |||
| 3397 | 2643873598 | |||
| 3398 | 2643954642 | |||
| 3399 | 2644022909 | |||
| 3400 | 2644184081 | |||
| 3401 | 2644282757 | |||
| 3402 | 2644624385 | |||
| 3403 | 2652547685 | |||
| 3404 | 2671091812 | |||
| 3405 | 2671099706 | |||
| 3406 | 2671129520 | |||
| 3407 | 2671771217 | |||
| 3408 | 2677900361 | |||
| 3409 | 2678266611 | |||
| 3410 | 2713476895 | |||
| 3411 | 2715749420 | |||
| 3412 | 2715754422 | |||
| 3413 | 2723246212 | |||
| 3414 | 2738673381 | |||
| 3415 | 2738690686 | |||
| 3416 | 2738751774 | |||
| 3417 | 2738807655 | |||
| 3418 | 2738860815 | |||
| 3419 | 2738895015 | |||
| 3420 | 2739202319 | |||
| 3421 | 2739262751 | |||
| 3422 | 2739266460 | |||
| 3423 | 2739312071 | |||
| 3424 | 2743740879 | |||
| 3425 | 2745007841 | |||
| 3426 | 2765581323 | |||
| 3427 | 2774117948 | |||
| 3428 | 2774136620 | |||
| 3429 | 2784261386 | |||
| 3430 | 2784316434 | |||
| 3431 | 2792833856 | |||
| 3432 | 2794593680 | |||
| 3433 | 2807410852 | |||
| 3434 | 2807459193 | |||
| 3435 | 2808858367 | |||
| 3436 | 2808905784 | |||
| 3437 | 2808923866 | |||
| 3438 | 2808928028 | |||
| 3439 | 2808938456 | |||
| 3440 | 2808942097 | |||
| 3441 | 2808946279 | |||
| 3442 | 2808950790 | |||
| 3443 | 2808960755 | |||
| 3444 | 2808966808 | |||
| 3445 | 2808980035 | |||
| 3446 | 2808995755 | |||
| 3447 | 2809001682 | |||
| 3448 | 2809217649 | |||
| 3449 | 2812369902 | |||
| 3450 | 2817488086 | |||
| 3451 | 2819624681 | |||
| 3452 | 2819655550 | |||
| 3453 | 2819704853 | |||
| 3454 | 2823421462 | |||
| 3455 | 2825654600 | |||
| 3456 | 2826581587 | |||
| 3457 | 2834031344 | |||
| 3458 | 2842715346 | |||
| 3459 | 2842821296 | |||
| 3460 | 2842832047 | |||
| 3461 | 2842833869 | |||
| 3462 | 2842838318 | |||
| 3463 | 2842846097 | |||
| 3464 | 2842851885 | |||
| 3465 | 2842856066 | |||
| 3466 | 2844667546 | |||
| 3467 | 2846956770 | |||
| 3468 | 2852616741 | |||
| 3469 | 2852662697 | |||
| 3470 | 2852671709 | |||
| 3471 | 2857548453 | |||
| 3472 | 2860345335 | |||
| 3473 | 2860868109 | |||
| 3474 | 2873320507 | |||
| 3475 | 2878029838 | |||
| 3476 | 2880230789 | |||
| 3477 | 2885084512 | |||
| 3478 | 2885275516 | |||
| 3479 | 2897806792 | |||
| 3480 | 2900642114 | |||
| 3481 | 2900642757 | |||
| 3482 | 2904518522 | |||
| 3483 | 2904542372 | |||
| 3484 | 2904553326 | |||
| 3485 | 2904622198 | |||
| 3486 | 2904705613 | |||
| 3487 | 2908446699 | |||
| 3488 | 2912963897 | |||
| 3489 | 2913036967 | |||
| 3490 | 2917070796 | |||
| 3491 | 2919069657 | |||
| 3492 | 2919156202 | |||
| 3493 | 2919388753 | |||
| 3494 | 2919457987 | |||
| 3495 | 2919487136 | |||
| 3496 | 2919493004 | |||
| 3497 | 2919503096 | |||
| 3498 | 2919702329 | |||
| 3499 | 2923153711 | |||
| 3500 | 2923523988 | |||
| 3501 | 2923589465 | |||
| 3502 | 2926064770 | |||
| 3503 | 2928110629 | |||
| 3504 | 2928140145 | |||
| 3505 | 2928505638 | |||
| 3506 | 2929144474 | |||
| 3507 | 2929189992 | |||
| 3508 | 2931372180 | |||
| 3509 | 2931391054 | |||
| 3510 | 2931398534 | |||
| 3511 | 2932413046 | |||
| 3512 | 2932420561 | |||
| 3513 | 2932424593 | |||
| 3514 | 2935357869 | |||
| 3515 | 2939642688 | |||
| 3516 | 2939654505 | |||
| 3517 | 2945930490 | |||
| 3518 | 2945967267 | |||
| 3519 | 2946012835 | |||
| 3520 | 2947234818 | |||
| 3521 | 2969304596 | |||
| 3522 | 2974293650 | |||
| 3523 | 2984292402 | |||
| 3524 | 2987606793 | |||
| 3525 | 2988731907 | |||
| 3526 | 2998140160 | |||
| 3527 | 3007254849 | |||
| 3528 | 3007316083 | |||
| 3529 | 3007398964 | |||
| 3530 | 3007419694 | |||
| 3531 | 3007517573 | |||
| 3532 | 3007614735 | |||
| 3533 | 3007623897 | |||
| 3534 | 3007722672 | |||
| 3535 | 3007807243 | |||
| 3536 | 3007859611 | |||
| 3537 | 3007864660 | |||
| 3538 | 3007871482 | |||
| 3539 | 3007874907 | |||
| 3540 | 637317461 | |||
| 3541 | 639787071 | |||
| 3542 | 8011352618 | |||
| 3543 | 8015687974 | |||
| 3544 | 8019769359 | |||
| 3545 | 8019779552 | |||
| 3546 | 8021127612 | |||
| 3547 | 8029995093 | |||
| 3548 | 8034964435 | |||
| 3549 | 8052494513 | |||
| 3550 | 8054009138 | |||
| 3551 | 8054287042 | |||
| 3552 | 8054288070 | |||
| 3553 | 8054349199 | |||
| 3554 | 8054503659 | |||
| 3555 | 8054930045 | |||
| 3556 | 8055771072 | |||
| 3557 | 8055818023 | |||
| 3558 | 8055883537 | |||
| 3559 | 8056116464 | |||
| 3560 | 8056125766 | |||
| 3561 | 8056126172 | |||
| 3562 | 8056131991 | |||
| 3563 | 8056137530 | |||
| 3564 | 8056143395 | |||
| 3565 | 8056151111 | |||
| 3566 | 8056160150 | |||
| 3567 | 8056164020 | |||
| 3568 | 8056170889 | |||
| 3569 | 8056177023 | |||
| 3570 | 8056182375 | |||
| 3571 | 8056570888 | |||
| 3572 | 8057802354 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4hl6-assembly2.cif.gz_C | yfde from escherichia coli | 0.9566 | 1 | 388 |
| 5yit-assembly2.cif.gz_D | crystal structure of hypothetical protein (rv3272) from mycobacterium tuberculosis | 0.9536 | 1 | 381 |
| 5yit-assembly1.cif.gz_B | crystal structure of hypothetical protein (rv3272) from mycobacterium tuberculosis | 0.95 | 1 | 380 |
| 5yx6-assembly2.cif.gz_D | crystal structure of rv3272 from m. tuberculosis orthorhombic form | 0.9491 | 1 | 381 |
| 4hl6-assembly2.cif.gz_C | yfde from escherichia coli | 0.9491 | 1 | 388 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4ed9A02 | Alpha Beta;2-Layer Sandwich;formyl-coa transferase, domain 3;formyl-coa transferase, domain 3 | 0.9834 | 235 | 326 | 3.30.1540.10 |
| af_Q4V9F2_1_227_3.40.50.10540 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Crotonobetainyl-coa:carnitine coa-transferase; domain 1 | 0.976 | 24 | 245 | 3.40.50.10540 |
| 4ed9A02 | Alpha Beta;2-Layer Sandwich;formyl-coa transferase, domain 3;formyl-coa transferase, domain 3 | 0.973 | 235 | 326 | 3.30.1540.10 |
| af_Q9VDL4_46_327_3.40.50.10540 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Crotonobetainyl-coa:carnitine coa-transferase; domain 1 | 0.9728 | 1 | 292 | 3.40.50.10540 |
| af_Q68FU4_261_348_3.30.1540.10 | Alpha Beta;2-Layer Sandwich;formyl-coa transferase, domain 3;formyl-coa transferase, domain 3 | 0.9718 | 237 | 323 | 3.30.1540.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A654DDV5-F1-model_v4 | CoA-transferase family III | 0.9868 | 2 | 405 |
GO:0008410
|
| AF-A0A836ZHQ8-F1-model_v4 | deleted | 0.9867 | 104 | 258 |
|
| AF-A0A318LDB7-F1-model_v4 | Formyl-CoA transferase | 0.9865 | 1 | 405 |
GO:0008410
|
| AF-A0A0Q8Q6C9-F1-model_v4 | CoA-transferase | 0.9855 | 2 | 392 |
GO:0008410
|
| AF-A0A7R6PCK0-F1-model_v4 | CoA transferase | 0.9838 | 1 | 404 |
GO:0008410
|