F495703
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1787 | 493 | 3574 | 122 |
Family's Representative Sequence
| Representative Sequence | 3300013297|Ga0157378_10105819|Ga0157378_101058193 |
| Length | 134 |
| Sequence | LLGRIQQLSNQATQQPFQGATAMIQMGTVLQVADNTGAKKIACIKMLGGSTAGQYARLGDVITASVKEASPDGTVKKVKESRRRDGSYIKFDDNAAVLINDAREPVGTRVFGPVARELRERKFMKIISLAPEVI |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 4 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 5 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 6 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 7 | 3300003371 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM | Metagenome | Rhizosphere |
| 8 | 3300003503 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM | Metagenome | Rhizosphere |
| 9 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 10 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 11 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 12 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 13 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 14 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 15 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 16 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 17 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 18 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 25 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 27 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 29 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 31 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 42 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 53 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 58 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 59 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 60 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 61 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 62 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 65 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 66 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 67 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 68 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 70 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 71 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 75 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 76 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 78 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 79 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 80 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 82 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 83 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 84 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 85 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 86 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 87 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 88 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 89 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 90 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 91 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 92 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 93 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 94 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 95 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 96 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 97 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 98 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 99 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 100 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 102 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 103 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 104 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 105 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 106 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 107 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 108 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 109 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 110 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 112 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 113 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 114 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 129 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300012502 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 | Metagenome | Rhizosphere |
| 132 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 141 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 145 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 147 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 148 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 149 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 150 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 230 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 234 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 235 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 236 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 237 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 238 | 3300030836 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 239 | 3300030882 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI6 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 240 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 241 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 242 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 243 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 244 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 245 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 246 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 247 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 248 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 249 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 250 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 251 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 252 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 253 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 254 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 255 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 256 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 257 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 258 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 259 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 260 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 261 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 262 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 263 | 3300031889 | Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO | Metagenome | Rhizosphere |
| 264 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 265 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 266 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 267 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 268 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 269 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 270 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 271 | 3300032120 | Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 272 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 273 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 274 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 275 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 276 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 277 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 278 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 279 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 280 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 281 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 282 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 283 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 284 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 285 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 286 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 287 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 288 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 289 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 290 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 291 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 292 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 293 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 294 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 295 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 296 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 297 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 298 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 299 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 300 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 301 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 302 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 303 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 304 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 305 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 306 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 307 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 308 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 309 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 310 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 311 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 312 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 313 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 314 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 315 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 316 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 317 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 318 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 319 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 320 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 321 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 322 | 3300038727 | Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 | Metagenome | Unclassified |
| 323 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 324 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 325 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 326 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 327 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 328 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 329 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 330 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 331 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 332 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 333 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 334 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 335 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 336 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 337 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 338 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 339 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 340 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 341 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 342 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 343 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 344 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 402 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 403 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 404 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 405 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 406 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 407 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 408 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 409 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 410 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 411 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 412 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 413 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 414 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 415 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 416 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 417 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 418 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 419 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 420 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 421 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 422 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 423 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 424 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 425 | 3300049162 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 426 | 3300049513 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control | Metagenome | Rhizosphere |
| 427 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 428 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 429 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 430 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 431 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 432 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 433 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 434 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 435 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 436 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 437 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 438 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 439 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 440 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 441 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 442 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 443 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 444 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 445 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 446 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 447 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 448 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 449 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 450 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 451 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 452 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 453 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 454 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 455 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 456 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 457 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 458 | 3300049682 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought | Metagenome | Rhizosphere |
| 459 | 3300049687 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought | Metagenome | Rhizosphere |
| 460 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 461 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 462 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 463 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 464 | 3300049767 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought | Metagenome | Rhizosphere |
| 465 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 466 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 467 | 3300049851 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought | Metagenome | Rhizosphere |
| 468 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 469 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 470 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 471 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 472 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 473 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 474 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 475 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 476 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 477 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 478 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 479 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 480 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 481 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 482 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 483 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 484 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 485 | 3300059477 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 486 | 3300059490 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 487 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 488 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 489 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 490 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 491 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 492 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 493 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.48 |
| Metatranscriptomes | 2.52 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.28 |
| Nodule | 0 |
| Rhizoplane | 4.59 |
| Rhizosphere | 93.12 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.69 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0157378_10105819 | 3300013297 | Bacteria | 2573 |
| 2 | SwRhRL2b_contig_291308 | 2162886007 | Unclassified | 1389 |
| 3 | SwRhRL2b_contig_3903249 | 2162886007 | Bacteria | 1678 |
| 4 | MBSR1b_contig_4233670 | 2162886012 | Bacteria | 831 |
| 5 | JGI24746J21847_1016431 | 3300001977 | Unclassified | 1057 |
| 6 | JGI24742J22300_10007131 | 3300002244 | Bacteria | 1843 |
| 7 | rootL2_10282489 | 3300003322 | Bacteria | 1869 |
| 8 | JGI26145J50221_1001211 | 3300003371 | Bacteria | 2045 |
| 9 | JGI26141J51220_1003121 | 3300003503 | Bacteria | 1020 |
| 10 | JGI25405J52794_10000604 | 3300003911 | Bacteria | 5327 |
| 11 | Ga0058863_10059782 | 3300004799 | Bacteria | 2822 |
| 12 | Ga0058863_11875765 | 3300004799 | Bacteria | 505 |
| 13 | Ga0058861_12030344 | 3300004800 | Bacteria | 2573 |
| 14 | Ga0058860_12230108 | 3300004801 | Bacteria | 926 |
| 15 | Ga0058862_10154497 | 3300004803 | Bacteria | 1389 |
| 16 | Ga0065704_10005699 | 3300005289 | Bacteria | 4814 |
| 17 | Ga0065704_10085970 | 3300005289 | Bacteria | 3168 |
| 18 | Ga0065704_10190762 | 3300005289 | Unclassified | 1191 |
| 19 | Ga0065704_10394263 | 3300005289 | Bacteria | 759 |
| 20 | Ga0065712_10374598 | 3300005290 | Bacteria | 751 |
| 21 | Ga0065715_10121974 | 3300005293 | Bacteria | 2216 |
| 22 | Ga0065715_10445920 | 3300005293 | Bacteria | 831 |
| 23 | Ga0065715_11162660 | 3300005293 | Bacteria | 506 |
| 24 | Ga0065707_10025635 | 3300005295 | Bacteria | 1864 |
| 25 | Ga0070658_10039091 | 3300005327 | Bacteria | 3827 |
| 26 | Ga0070658_11318469 | 3300005327 | Bacteria | 627 |
| 27 | Ga0070676_10018293 | 3300005328 | Bacteria | 3881 |
| 28 | Ga0070676_10026300 | 3300005328 | Bacteria | 3294 |
| 29 | Ga0070676_10541632 | 3300005328 | Bacteria | 832 |
| 30 | Ga0070676_11479038 | 3300005328 | Bacteria | 523 |
| 31 | Ga0070683_100000033 | 3300005329 | Bacteria | 135305 |
| 32 | Ga0070683_100004175 | 3300005329 | Bacteria | 11835 |
| 33 | Ga0070690_100005750 | 3300005330 | Bacteria | 6987 |
| 34 | Ga0070690_100030946 | 3300005330 | Bacteria | 3331 |
| 35 | Ga0070690_100065969 | 3300005330 | Bacteria | 2342 |
| 36 | Ga0070690_100256616 | 3300005330 | Bacteria | 1239 |
| 37 | Ga0070690_100776228 | 3300005330 | Bacteria | 741 |
| 38 | Ga0070670_100006072 | 3300005331 | Bacteria | 10217 |
| 39 | Ga0070670_100029495 | 3300005331 | Bacteria | 4723 |
| 40 | Ga0070670_100218024 | 3300005331 | Bacteria | 1660 |
| 41 | Ga0070670_100303900 | 3300005331 | Bacteria | 1396 |
| 42 | Ga0070670_100324478 | 3300005331 | Bacteria | 1349 |
| 43 | Ga0070670_100546168 | 3300005331 | Bacteria | 1033 |
| 44 | Ga0070670_100676845 | 3300005331 | Bacteria | 927 |
| 45 | Ga0070670_102113790 | 3300005331 | Bacteria | 519 |
| 46 | Ga0070677_10005399 | 3300005333 | Bacteria | 4210 |
| 47 | Ga0068869_100009311 | 3300005334 | Bacteria | 6370 |
| 48 | Ga0068869_100015378 | 3300005334 | Bacteria | 5132 |
| 49 | Ga0068869_100041040 | 3300005334 | Bacteria | 3312 |
| 50 | Ga0068869_100167792 | 3300005334 | Bacteria | 1713 |
| 51 | Ga0068869_100200424 | 3300005334 | Bacteria | 1574 |
| 52 | Ga0068869_100268990 | 3300005334 | Bacteria | 1367 |
| 53 | Ga0068869_100646961 | 3300005334 | Bacteria | 897 |
| 54 | Ga0070666_10001387 | 3300005335 | Bacteria | 14671 |
| 55 | Ga0070666_10001507 | 3300005335 | Bacteria | 14139 |
| 56 | Ga0070666_10011673 | 3300005335 | Bacteria | 5522 |
| 57 | Ga0070666_10040333 | 3300005335 | Bacteria | 3116 |
| 58 | Ga0070666_10162092 | 3300005335 | Bacteria | 1563 |
| 59 | Ga0070666_10521737 | 3300005335 | Bacteria | 862 |
| 60 | Ga0070666_10958131 | 3300005335 | Bacteria | 634 |
| 61 | Ga0070680_100707670 | 3300005336 | Bacteria | 867 |
| 62 | Ga0070682_100256877 | 3300005337 | Bacteria | 1263 |
| 63 | Ga0068868_100000632 | 3300005338 | Bacteria | 23664 |
| 64 | Ga0068868_100906099 | 3300005338 | Bacteria | 802 |
| 65 | Ga0070660_100100051 | 3300005339 | Bacteria | 2296 |
| 66 | Ga0070660_100406772 | 3300005339 | Bacteria | 1126 |
| 67 | Ga0070689_100068193 | 3300005340 | Bacteria | 2774 |
| 68 | Ga0070689_100101559 | 3300005340 | Bacteria | 2276 |
| 69 | Ga0070689_100103520 | 3300005340 | Bacteria | 2256 |
| 70 | Ga0070689_100204302 | 3300005340 | Bacteria | 1614 |
| 71 | Ga0070689_100259633 | 3300005340 | Bacteria | 1435 |
| 72 | Ga0070689_100412269 | 3300005340 | Bacteria | 1144 |
| 73 | Ga0070689_100427886 | 3300005340 | Bacteria | 1123 |
| 74 | Ga0070689_100507022 | 3300005340 | Bacteria | 1034 |
| 75 | Ga0070689_100688822 | 3300005340 | Bacteria | 892 |
| 76 | Ga0070689_100796799 | 3300005340 | Bacteria | 831 |
| 77 | Ga0070689_101067422 | 3300005340 | Bacteria | 721 |
| 78 | Ga0070689_101578820 | 3300005340 | Bacteria | 595 |
| 79 | Ga0070691_10060647 | 3300005341 | Bacteria | 1819 |
| 80 | Ga0070691_10309448 | 3300005341 | Bacteria | 865 |
| 81 | Ga0070691_10961339 | 3300005341 | Bacteria | 531 |
| 82 | Ga0070687_100051489 | 3300005343 | Bacteria | 2132 |
| 83 | Ga0070687_100114596 | 3300005343 | Bacteria | 1531 |
| 84 | Ga0070687_100136833 | 3300005343 | Bacteria | 1421 |
| 85 | Ga0070687_100427962 | 3300005343 | Bacteria | 875 |
| 86 | Ga0070687_100465332 | 3300005343 | Bacteria | 844 |
| 87 | Ga0070687_100515402 | 3300005343 | Bacteria | 808 |
| 88 | Ga0070661_100010686 | 3300005344 | Bacteria | 6387 |
| 89 | Ga0070692_10001104 | 3300005345 | Bacteria | 9415 |
| 90 | Ga0070692_10004482 | 3300005345 | Bacteria | 5844 |
| 91 | Ga0070692_10102494 | 3300005345 | Bacteria | 1571 |
| 92 | Ga0070692_11082159 | 3300005345 | Bacteria | 565 |
| 93 | Ga0070692_11154071 | 3300005345 | Bacteria | 549 |
| 94 | Ga0070668_100028739 | 3300005347 | Bacteria | 4219 |
| 95 | Ga0070668_100117946 | 3300005347 | Bacteria | 2118 |
| 96 | Ga0070669_100025363 | 3300005353 | Bacteria | 4257 |
| 97 | Ga0070669_100097584 | 3300005353 | Bacteria | 2212 |
| 98 | Ga0070669_100278937 | 3300005353 | Bacteria | 1338 |
| 99 | Ga0070669_101569360 | 3300005353 | Bacteria | 573 |
| 100 | Ga0070669_101635007 | 3300005353 | Bacteria | 561 |
| 101 | Ga0070675_100000007 | 3300005354 | Bacteria | 263394 |
| 102 | Ga0070675_100032515 | 3300005354 | Bacteria | 4223 |
| 103 | Ga0070675_100092402 | 3300005354 | Bacteria | 2536 |
| 104 | Ga0070675_100105703 | 3300005354 | Bacteria | 2375 |
| 105 | Ga0070675_100123749 | 3300005354 | Bacteria | 2199 |
| 106 | Ga0070675_100183980 | 3300005354 | Bacteria | 1808 |
| 107 | Ga0070675_100185688 | 3300005354 | Bacteria | 1799 |
| 108 | Ga0070675_100318549 | 3300005354 | Bacteria | 1373 |
| 109 | Ga0070675_100342603 | 3300005354 | Bacteria | 1324 |
| 110 | Ga0070675_101193667 | 3300005354 | Bacteria | 700 |
| 111 | Ga0070675_101372066 | 3300005354 | Bacteria | 652 |
| 112 | Ga0070671_100190181 | 3300005355 | Bacteria | 1739 |
| 113 | Ga0070671_100191826 | 3300005355 | Bacteria | 1732 |
| 114 | Ga0070674_100007457 | 3300005356 | Bacteria | 6453 |
| 115 | Ga0070674_100007905 | 3300005356 | Bacteria | 6293 |
| 116 | Ga0070674_100343338 | 3300005356 | Bacteria | 1203 |
| 117 | Ga0070674_100367453 | 3300005356 | Bacteria | 1167 |
| 118 | Ga0070674_100587817 | 3300005356 | Bacteria | 939 |
| 119 | Ga0070674_101389008 | 3300005356 | Bacteria | 628 |
| 120 | Ga0070674_101735933 | 3300005356 | Bacteria | 565 |
| 121 | Ga0070673_100051191 | 3300005364 | Bacteria | 3232 |
| 122 | Ga0070673_100071173 | 3300005364 | Bacteria | 2793 |
| 123 | Ga0070673_100099405 | 3300005364 | Bacteria | 2393 |
| 124 | Ga0070673_100226177 | 3300005364 | Bacteria | 1621 |
| 125 | Ga0070673_100677707 | 3300005364 | Bacteria | 945 |
| 126 | Ga0070673_101809998 | 3300005364 | Bacteria | 578 |
| 127 | Ga0070688_100175984 | 3300005365 | Bacteria | 1481 |
| 128 | Ga0070688_100426728 | 3300005365 | Bacteria | 986 |
| 129 | Ga0070688_100533180 | 3300005365 | Bacteria | 890 |
| 130 | Ga0070688_100874058 | 3300005365 | Bacteria | 707 |
| 131 | Ga0070659_100169875 | 3300005366 | Bacteria | 1786 |
| 132 | Ga0070667_100002921 | 3300005367 | Bacteria | 14677 |
| 133 | Ga0070667_100091951 | 3300005367 | Bacteria | 2609 |
| 134 | Ga0070667_100234407 | 3300005367 | Bacteria | 1637 |
| 135 | Ga0070667_100604574 | 3300005367 | Bacteria | 1010 |
| 136 | Ga0070667_100977738 | 3300005367 | Unclassified | 789 |
| 137 | Ga0070667_101203917 | 3300005367 | Bacteria | 709 |
| 138 | Ga0070703_10097871 | 3300005406 | Bacteria | 1029 |
| 139 | Ga0070709_10019666 | 3300005434 | Bacteria | 3908 |
| 140 | Ga0070709_10075841 | 3300005434 | Bacteria | 2182 |
| 141 | Ga0070709_10133261 | 3300005434 | Bacteria | 1699 |
| 142 | Ga0070709_10444071 | 3300005434 | Bacteria | 976 |
| 143 | Ga0070709_10899752 | 3300005434 | Bacteria | 700 |
| 144 | Ga0070713_100115557 | 3300005436 | Bacteria | 2345 |
| 145 | Ga0070710_10298597 | 3300005437 | Bacteria | 1051 |
| 146 | Ga0070710_10482662 | 3300005437 | Bacteria | 845 |
| 147 | Ga0070701_10014144 | 3300005438 | Bacteria | 3651 |
| 148 | Ga0070701_10085332 | 3300005438 | Bacteria | 1719 |
| 149 | Ga0070701_10562179 | 3300005438 | Bacteria | 750 |
| 150 | Ga0070711_100350307 | 3300005439 | Bacteria | 1187 |
| 151 | Ga0070711_100355922 | 3300005439 | Bacteria | 1178 |
| 152 | Ga0070711_100364914 | 3300005439 | Bacteria | 1164 |
| 153 | Ga0070711_101924400 | 3300005439 | Bacteria | 520 |
| 154 | Ga0070705_100021563 | 3300005440 | Bacteria | 3429 |
| 155 | Ga0070705_100481005 | 3300005440 | Bacteria | 938 |
| 156 | Ga0070700_100000050 | 3300005441 | Bacteria | 88421 |
| 157 | Ga0070700_100105528 | 3300005441 | Bacteria | 1863 |
| 158 | Ga0070700_100699064 | 3300005441 | Bacteria | 806 |
| 159 | Ga0070700_101465297 | 3300005441 | Bacteria | 579 |
| 160 | Ga0070694_100004904 | 3300005444 | Bacteria | 8062 |
| 161 | Ga0070694_100018421 | 3300005444 | Bacteria | 4431 |
| 162 | Ga0070694_100026241 | 3300005444 | Bacteria | 3775 |
| 163 | Ga0070694_100923232 | 3300005444 | Bacteria | 722 |
| 164 | Ga0070694_101063760 | 3300005444 | Bacteria | 674 |
| 165 | Ga0070694_101212678 | 3300005444 | Bacteria | 633 |
| 166 | Ga0070708_100157158 | 3300005445 | Bacteria | 2117 |
| 167 | Ga0070708_100172273 | 3300005445 | Bacteria | 2021 |
| 168 | Ga0070708_100263368 | 3300005445 | Bacteria | 1621 |
| 169 | Ga0070708_100263468 | 3300005445 | Bacteria | 1620 |
| 170 | Ga0070708_101206272 | 3300005445 | Bacteria | 708 |
| 171 | Ga0070708_101221233 | 3300005445 | Bacteria | 703 |
| 172 | Ga0070708_101357583 | 3300005445 | Bacteria | 663 |
| 173 | Ga0070708_101527797 | 3300005445 | Unclassified | 622 |
| 174 | Ga0070708_101802727 | 3300005445 | Bacteria | 568 |
| 175 | Ga0070663_100046825 | 3300005455 | Bacteria | 3062 |
| 176 | Ga0070663_100507789 | 3300005455 | Bacteria | 1002 |
| 177 | Ga0070678_100006394 | 3300005456 | Bacteria | 6913 |
| 178 | Ga0070678_100277422 | 3300005456 | Bacteria | 1416 |
| 179 | Ga0070678_100505663 | 3300005456 | Bacteria | 1067 |
| 180 | Ga0070662_100093375 | 3300005457 | Bacteria | 2263 |
| 181 | Ga0070662_100124500 | 3300005457 | Bacteria | 1979 |
| 182 | Ga0070662_100146168 | 3300005457 | Bacteria | 1837 |
| 183 | Ga0070662_100201195 | 3300005457 | Bacteria | 1581 |
| 184 | Ga0070662_101086956 | 3300005457 | Bacteria | 686 |
| 185 | Ga0070662_101352454 | 3300005457 | Bacteria | 613 |
| 186 | Ga0070681_10212292 | 3300005458 | Bacteria | 1851 |
| 187 | Ga0070681_10388776 | 3300005458 | Bacteria | 1306 |
| 188 | Ga0070681_11357294 | 3300005458 | Bacteria | 634 |
| 189 | Ga0068867_100016292 | 3300005459 | Bacteria | 5278 |
| 190 | Ga0068867_100023693 | 3300005459 | Bacteria | 4395 |
| 191 | Ga0068867_100025055 | 3300005459 | Bacteria | 4279 |
| 192 | Ga0068867_100261944 | 3300005459 | Bacteria | 1410 |
| 193 | Ga0068867_101344521 | 3300005459 | Bacteria | 661 |
| 194 | Ga0070685_10112403 | 3300005466 | Bacteria | 1680 |
| 195 | Ga0070685_10811138 | 3300005466 | Bacteria | 690 |
| 196 | Ga0070706_100005176 | 3300005467 | Bacteria | 12446 |
| 197 | Ga0070706_100021749 | 3300005467 | Bacteria | 5905 |
| 198 | Ga0070706_100060377 | 3300005467 | Bacteria | 3500 |
| 199 | Ga0070706_100084802 | 3300005467 | Unclassified | 2935 |
| 200 | Ga0070706_100143886 | 3300005467 | Bacteria | 2226 |
| 201 | Ga0070706_100152709 | 3300005467 | Bacteria | 2156 |
| 202 | Ga0070706_100160143 | 3300005467 | Bacteria | 2101 |
| 203 | Ga0070706_100185121 | 3300005467 | Bacteria | 1946 |
| 204 | Ga0070706_100253498 | 3300005467 | Bacteria | 1643 |
| 205 | Ga0070706_100290414 | 3300005467 | Bacteria | 1526 |
| 206 | Ga0070707_100006596 | 3300005468 | Bacteria | 10769 |
| 207 | Ga0070707_100084042 | 3300005468 | Bacteria | 3076 |
| 208 | Ga0070707_100222760 | 3300005468 | Bacteria | 1837 |
| 209 | Ga0070707_100271464 | 3300005468 | Bacteria | 1649 |
| 210 | Ga0070707_100459544 | 3300005468 | Bacteria | 1234 |
| 211 | Ga0070707_100574266 | 3300005468 | Bacteria | 1090 |
| 212 | Ga0070707_100613758 | 3300005468 | Bacteria | 1050 |
| 213 | Ga0070707_101381124 | 3300005468 | Bacteria | 671 |
| 214 | Ga0070698_100004976 | 3300005471 | Bacteria | 14561 |
| 215 | Ga0070698_100022395 | 3300005471 | Bacteria | 6610 |
| 216 | Ga0070698_100039505 | 3300005471 | Bacteria | 4857 |
| 217 | Ga0070698_100150648 | 3300005471 | Bacteria | 2274 |
| 218 | Ga0070698_100337116 | 3300005471 | Bacteria | 1439 |
| 219 | Ga0070698_100358829 | 3300005471 | Bacteria | 1389 |
| 220 | Ga0070698_100771513 | 3300005471 | Bacteria | 905 |
| 221 | Ga0070698_101613421 | 3300005471 | Bacteria | 601 |
| 222 | Ga0070699_100242768 | 3300005518 | Bacteria | 1608 |
| 223 | Ga0070699_100270563 | 3300005518 | Bacteria | 1520 |
| 224 | Ga0070699_100331429 | 3300005518 | Bacteria | 1369 |
| 225 | Ga0070699_100372948 | 3300005518 | Bacteria | 1288 |
| 226 | Ga0070699_100894802 | 3300005518 | Bacteria | 813 |
| 227 | Ga0070699_100980595 | 3300005518 | Bacteria | 775 |
| 228 | Ga0070699_100988430 | 3300005518 | Bacteria | 771 |
| 229 | Ga0070699_101044073 | 3300005518 | Bacteria | 749 |
| 230 | Ga0070699_101840844 | 3300005518 | Bacteria | 554 |
| 231 | Ga0070679_100029036 | 3300005530 | Bacteria | 5455 |
| 232 | Ga0070679_101054963 | 3300005530 | Bacteria | 757 |
| 233 | Ga0070679_101391791 | 3300005530 | Bacteria | 648 |
| 234 | Ga0070684_100006540 | 3300005535 | Bacteria | 9022 |
| 235 | Ga0070684_100034321 | 3300005535 | Bacteria | 4337 |
| 236 | Ga0070684_100315549 | 3300005535 | Bacteria | 1435 |
| 237 | Ga0070684_100501115 | 3300005535 | Bacteria | 1125 |
| 238 | Ga0070684_101450530 | 3300005535 | Bacteria | 646 |
| 239 | Ga0070697_100002003 | 3300005536 | Bacteria | 15614 |
| 240 | Ga0070697_100006235 | 3300005536 | Bacteria | 9233 |
| 241 | Ga0070697_100016639 | 3300005536 | Bacteria | 5784 |
| 242 | Ga0070697_100050503 | 3300005536 | Bacteria | 3376 |
| 243 | Ga0070697_100057785 | 3300005536 | Bacteria | 3156 |
| 244 | Ga0070697_100073385 | 3300005536 | Bacteria | 2809 |
| 245 | Ga0070697_100131871 | 3300005536 | Bacteria | 2096 |
| 246 | Ga0070697_100173619 | 3300005536 | Bacteria | 1825 |
| 247 | Ga0070697_100292248 | 3300005536 | Bacteria | 1400 |
| 248 | Ga0070697_100788006 | 3300005536 | Bacteria | 841 |
| 249 | Ga0070697_100935321 | 3300005536 | Bacteria | 770 |
| 250 | Ga0070697_101020950 | 3300005536 | Bacteria | 735 |
| 251 | Ga0070697_101092673 | 3300005536 | Bacteria | 710 |
| 252 | Ga0068853_100010446 | 3300005539 | Bacteria | 7515 |
| 253 | Ga0068853_100558747 | 3300005539 | Bacteria | 1085 |
| 254 | Ga0070672_100005180 | 3300005543 | Bacteria | 8619 |
| 255 | Ga0070672_100057049 | 3300005543 | Bacteria | 3065 |
| 256 | Ga0070672_100074196 | 3300005543 | Bacteria | 2713 |
| 257 | Ga0070672_100078636 | 3300005543 | Bacteria | 2639 |
| 258 | Ga0070672_100083257 | 3300005543 | Bacteria | 2567 |
| 259 | Ga0070672_100189079 | 3300005543 | Bacteria | 1718 |
| 260 | Ga0070672_100222200 | 3300005543 | Bacteria | 1584 |
| 261 | Ga0070672_101545981 | 3300005543 | Bacteria | 595 |
| 262 | Ga0070686_100022242 | 3300005544 | Bacteria | 3774 |
| 263 | Ga0070686_100065761 | 3300005544 | Bacteria | 2356 |
| 264 | Ga0070686_101648143 | 3300005544 | Bacteria | 543 |
| 265 | Ga0070695_100043544 | 3300005545 | Bacteria | 2854 |
| 266 | Ga0070695_100121956 | 3300005545 | Bacteria | 1784 |
| 267 | Ga0070695_100123311 | 3300005545 | Bacteria | 1776 |
| 268 | Ga0070695_100147012 | 3300005545 | Bacteria | 1641 |
| 269 | Ga0070695_100332431 | 3300005545 | Bacteria | 1133 |
| 270 | Ga0070696_100012751 | 3300005546 | Bacteria | 5644 |
| 271 | Ga0070696_100015270 | 3300005546 | Bacteria | 5155 |
| 272 | Ga0070696_100023806 | 3300005546 | Bacteria | 4163 |
| 273 | Ga0070696_100068104 | 3300005546 | Bacteria | 2498 |
| 274 | Ga0070696_100143548 | 3300005546 | Bacteria | 1747 |
| 275 | Ga0070696_100290648 | 3300005546 | Bacteria | 1249 |
| 276 | Ga0070696_101204782 | 3300005546 | Bacteria | 640 |
| 277 | Ga0070693_100037146 | 3300005547 | Bacteria | 2714 |
| 278 | Ga0070693_100063520 | 3300005547 | Bacteria | 2152 |
| 279 | Ga0070665_100022280 | 3300005548 | Bacteria | 6375 |
| 280 | Ga0070665_100027592 | 3300005548 | Bacteria | 5718 |
| 281 | Ga0070665_100425601 | 3300005548 | Bacteria | 1336 |
| 282 | Ga0070665_101177422 | 3300005548 | Bacteria | 777 |
| 283 | Ga0070665_101605544 | 3300005548 | Bacteria | 658 |
| 284 | Ga0070704_100044966 | 3300005549 | Bacteria | 3071 |
| 285 | Ga0070704_100199616 | 3300005549 | Bacteria | 1614 |
| 286 | Ga0070704_100228149 | 3300005549 | Bacteria | 1518 |
| 287 | Ga0070704_100346746 | 3300005549 | Bacteria | 1252 |
| 288 | Ga0070704_100408103 | 3300005549 | Bacteria | 1161 |
| 289 | Ga0068855_100000266 | 3300005563 | Bacteria | 65127 |
| 290 | Ga0068855_100946306 | 3300005563 | Bacteria | 908 |
| 291 | Ga0070664_100005841 | 3300005564 | Bacteria | 9927 |
| 292 | Ga0070664_100436529 | 3300005564 | Bacteria | 1201 |
| 293 | Ga0070664_100688159 | 3300005564 | Bacteria | 952 |
| 294 | Ga0070664_100756549 | 3300005564 | Bacteria | 907 |
| 295 | Ga0068857_100333822 | 3300005577 | Bacteria | 1402 |
| 296 | Ga0068854_100126246 | 3300005578 | Bacteria | 1949 |
| 297 | Ga0068854_100248683 | 3300005578 | Bacteria | 1419 |
| 298 | Ga0068854_100287407 | 3300005578 | Bacteria | 1326 |
| 299 | Ga0068854_100331794 | 3300005578 | Bacteria | 1239 |
| 300 | Ga0068854_100978744 | 3300005578 | Bacteria | 748 |
| 301 | Ga0068856_100007761 | 3300005614 | Bacteria | 10480 |
| 302 | Ga0068856_100009234 | 3300005614 | Bacteria | 9591 |
| 303 | Ga0068856_100859975 | 3300005614 | Bacteria | 926 |
| 304 | Ga0068856_100867057 | 3300005614 | Unclassified | 922 |
| 305 | Ga0068856_102227847 | 3300005614 | Bacteria | 557 |
| 306 | Ga0070702_100039824 | 3300005615 | Bacteria | 2625 |
| 307 | Ga0070702_100067864 | 3300005615 | Bacteria | 2097 |
| 308 | Ga0070702_100187967 | 3300005615 | Bacteria | 1357 |
| 309 | Ga0070702_100299624 | 3300005615 | Bacteria | 1112 |
| 310 | Ga0070702_100550133 | 3300005615 | Bacteria | 857 |
| 311 | Ga0070702_100565046 | 3300005615 | Bacteria | 847 |
| 312 | Ga0068852_100160088 | 3300005616 | Bacteria | 2101 |
| 313 | Ga0068852_100419281 | 3300005616 | Bacteria | 1320 |
| 314 | Ga0068852_101268419 | 3300005616 | Unclassified | 758 |
| 315 | Ga0068859_100000677 | 3300005617 | Bacteria | 34196 |
| 316 | Ga0068859_100163938 | 3300005617 | Bacteria | 2302 |
| 317 | Ga0068859_100284313 | 3300005617 | Bacteria | 1747 |
| 318 | Ga0068859_100310919 | 3300005617 | Bacteria | 1669 |
| 319 | Ga0068859_100425056 | 3300005617 | Bacteria | 1425 |
| 320 | Ga0068859_100971326 | 3300005617 | Bacteria | 932 |
| 321 | Ga0068859_100995658 | 3300005617 | Bacteria | 920 |
| 322 | Ga0068859_101953714 | 3300005617 | Bacteria | 648 |
| 323 | Ga0068864_100031613 | 3300005618 | Bacteria | 4493 |
| 324 | Ga0068864_100094210 | 3300005618 | Bacteria | 2646 |
| 325 | Ga0068864_100108236 | 3300005618 | Bacteria | 2474 |
| 326 | Ga0068864_100197897 | 3300005618 | Bacteria | 1845 |
| 327 | Ga0068864_100669070 | 3300005618 | Bacteria | 1012 |
| 328 | Ga0068866_10270079 | 3300005718 | Bacteria | 1049 |
| 329 | Ga0068866_10396743 | 3300005718 | Bacteria | 889 |
| 330 | Ga0068866_10972721 | 3300005718 | Unclassified | 601 |
| 331 | Ga0068861_100020829 | 3300005719 | Bacteria | 4703 |
| 332 | Ga0068861_100084086 | 3300005719 | Bacteria | 2498 |
| 333 | Ga0068861_100182569 | 3300005719 | Bacteria | 1748 |
| 334 | Ga0068861_100283062 | 3300005719 | Bacteria | 1429 |
| 335 | Ga0068861_100400314 | 3300005719 | Bacteria | 1218 |
| 336 | Ga0068861_100663397 | 3300005719 | Bacteria | 965 |
| 337 | Ga0068870_10075673 | 3300005840 | Bacteria | 1847 |
| 338 | Ga0068870_10389803 | 3300005840 | Bacteria | 904 |
| 339 | Ga0068870_10612235 | 3300005840 | Bacteria | 741 |
| 340 | Ga0068863_100061234 | 3300005841 | Bacteria | 3558 |
| 341 | Ga0068863_100135598 | 3300005841 | Bacteria | 2352 |
| 342 | Ga0068863_100614434 | 3300005841 | Bacteria | 1077 |
| 343 | Ga0068863_101247584 | 3300005841 | Bacteria | 750 |
| 344 | Ga0068858_100004672 | 3300005842 | Bacteria | 13423 |
| 345 | Ga0068858_100183416 | 3300005842 | Bacteria | 1976 |
| 346 | Ga0068858_100479193 | 3300005842 | Bacteria | 1201 |
| 347 | Ga0068858_100940654 | 3300005842 | Bacteria | 846 |
| 348 | Ga0068858_101981642 | 3300005842 | Bacteria | 576 |
| 349 | Ga0068860_100005124 | 3300005843 | Bacteria | 13325 |
| 350 | Ga0068860_100042506 | 3300005843 | Bacteria | 4339 |
| 351 | Ga0068860_100110903 | 3300005843 | Bacteria | 2623 |
| 352 | Ga0068860_100407065 | 3300005843 | Bacteria | 1347 |
| 353 | Ga0068860_100625000 | 3300005843 | Bacteria | 1084 |
| 354 | Ga0068860_100709199 | 3300005843 | Bacteria | 1016 |
| 355 | Ga0068860_100937514 | 3300005843 | Bacteria | 883 |
| 356 | Ga0068860_101594488 | 3300005843 | Bacteria | 675 |
| 357 | Ga0068860_101787277 | 3300005843 | Bacteria | 636 |
| 358 | Ga0068862_100003143 | 3300005844 | Bacteria | 14358 |
| 359 | Ga0068862_100040470 | 3300005844 | Bacteria | 3961 |
| 360 | Ga0068862_100091874 | 3300005844 | Bacteria | 2644 |
| 361 | Ga0068862_100103172 | 3300005844 | Bacteria | 2497 |
| 362 | Ga0068862_100115629 | 3300005844 | Bacteria | 2359 |
| 363 | Ga0068862_100446059 | 3300005844 | Bacteria | 1219 |
| 364 | Ga0068862_100483215 | 3300005844 | Bacteria | 1173 |
| 365 | Ga0081455_10000422 | 3300005937 | Bacteria | 55396 |
| 366 | Ga0081455_10010015 | 3300005937 | Bacteria | 9686 |
| 367 | Ga0081455_10028987 | 3300005937 | Bacteria | 5051 |
| 368 | Ga0081455_10079207 | 3300005937 | Bacteria | 2698 |
| 369 | Ga0081455_10448240 | 3300005937 | Bacteria | 882 |
| 370 | Ga0081455_10548763 | 3300005937 | Bacteria | 765 |
| 371 | Ga0081540_1027578 | 3300005983 | Bacteria | 3213 |
| 372 | Ga0070717_10000064 | 3300006028 | Bacteria | 89273 |
| 373 | Ga0070717_10417247 | 3300006028 | Bacteria | 1207 |
| 374 | Ga0070717_10756042 | 3300006028 | Bacteria | 884 |
| 375 | Ga0075363_100924436 | 3300006048 | Bacteria | 535 |
| 376 | Ga0075364_11251736 | 3300006051 | Bacteria | 503 |
| 377 | Ga0075432_10006617 | 3300006058 | Bacteria | 3943 |
| 378 | Ga0075432_10058477 | 3300006058 | Bacteria | 1369 |
| 379 | Ga0075432_10395084 | 3300006058 | Bacteria | 596 |
| 380 | Ga0070715_10683641 | 3300006163 | Bacteria | 611 |
| 381 | Ga0070716_100026284 | 3300006173 | Bacteria | 3116 |
| 382 | Ga0070716_100270517 | 3300006173 | Bacteria | 1167 |
| 383 | Ga0070716_100442032 | 3300006173 | Bacteria | 946 |
| 384 | Ga0070716_100815246 | 3300006173 | Bacteria | 724 |
| 385 | Ga0070712_101881419 | 3300006175 | Bacteria | 524 |
| 386 | Ga0097621_100030376 | 3300006237 | Bacteria | 4276 |
| 387 | Ga0097621_100492357 | 3300006237 | Bacteria | 1109 |
| 388 | Ga0097621_101324039 | 3300006237 | Bacteria | 681 |
| 389 | Ga0097621_101458930 | 3300006237 | Bacteria | 649 |
| 390 | Ga0097621_101491088 | 3300006237 | Bacteria | 642 |
| 391 | Ga0068871_100129959 | 3300006358 | Bacteria | 2135 |
| 392 | Ga0068871_100377689 | 3300006358 | Bacteria | 1258 |
| 393 | Ga0068871_100454439 | 3300006358 | Bacteria | 1149 |
| 394 | Ga0068871_100711669 | 3300006358 | Bacteria | 921 |
| 395 | Ga0068871_101018833 | 3300006358 | Bacteria | 772 |
| 396 | Ga0068871_101193520 | 3300006358 | Bacteria | 714 |
| 397 | Ga0068871_101282765 | 3300006358 | Bacteria | 688 |
| 398 | Ga0075428_100002976 | 3300006844 | Bacteria | 18459 |
| 399 | Ga0075428_100003062 | 3300006844 | Bacteria | 18244 |
| 400 | Ga0075428_100032404 | 3300006844 | Bacteria | 5773 |
| 401 | Ga0075428_100069486 | 3300006844 | Bacteria | 3850 |
| 402 | Ga0075428_100209761 | 3300006844 | Bacteria | 2105 |
| 403 | Ga0075428_100307525 | 3300006844 | Bacteria | 1704 |
| 404 | Ga0075428_100371042 | 3300006844 | Bacteria | 1534 |
| 405 | Ga0075430_100002410 | 3300006846 | Bacteria | 15562 |
| 406 | Ga0075430_100006690 | 3300006846 | Bacteria | 9725 |
| 407 | Ga0075430_100040471 | 3300006846 | Bacteria | 3945 |
| 408 | Ga0075430_100299056 | 3300006846 | Bacteria | 1331 |
| 409 | Ga0075430_100517172 | 3300006846 | Unclassified | 985 |
| 410 | Ga0075431_100003027 | 3300006847 | Bacteria | 16266 |
| 411 | Ga0075431_100179475 | 3300006847 | Bacteria | 2173 |
| 412 | Ga0075431_100350728 | 3300006847 | Bacteria | 1484 |
| 413 | Ga0075431_100638920 | 3300006847 | Bacteria | 1046 |
| 414 | Ga0075431_100703020 | 3300006847 | Bacteria | 988 |
| 415 | Ga0075431_100806056 | 3300006847 | Bacteria | 912 |
| 416 | Ga0075431_100841912 | 3300006847 | Bacteria | 889 |
| 417 | Ga0075431_101001326 | 3300006847 | Bacteria | 803 |
| 418 | Ga0075431_101649011 | 3300006847 | Bacteria | 599 |
| 419 | Ga0075433_10002443 | 3300006852 | Bacteria | 14147 |
| 420 | Ga0075433_10005052 | 3300006852 | Bacteria | 10341 |
| 421 | Ga0075433_10065602 | 3300006852 | Bacteria | 3184 |
| 422 | Ga0075433_10084417 | 3300006852 | Bacteria | 2803 |
| 423 | Ga0075433_10088307 | 3300006852 | Bacteria | 2739 |
| 424 | Ga0075433_10111840 | 3300006852 | Bacteria | 2423 |
| 425 | Ga0075433_10163788 | 3300006852 | Bacteria | 1979 |
| 426 | Ga0075433_10187982 | 3300006852 | Bacteria | 1837 |
| 427 | Ga0075433_10447346 | 3300006852 | Bacteria | 1139 |
| 428 | Ga0075433_10773066 | 3300006852 | Bacteria | 840 |
| 429 | Ga0075433_10830830 | 3300006852 | Bacteria | 807 |
| 430 | Ga0075434_100000038 | 3300006871 | Bacteria | 59843 |
| 431 | Ga0075434_100002471 | 3300006871 | Bacteria | 16270 |
| 432 | Ga0075434_100014841 | 3300006871 | Bacteria | 7452 |
| 433 | Ga0075434_100110302 | 3300006871 | Bacteria | 2762 |
| 434 | Ga0075434_100135458 | 3300006871 | Bacteria | 2482 |
| 435 | Ga0075434_100135556 | 3300006871 | Bacteria | 2481 |
| 436 | Ga0075434_100246019 | 3300006871 | Bacteria | 1808 |
| 437 | Ga0075429_100008584 | 3300006880 | Bacteria | 8889 |
| 438 | Ga0075429_100099339 | 3300006880 | Bacteria | 2539 |
| 439 | Ga0075429_100292591 | 3300006880 | Bacteria | 1426 |
| 440 | Ga0075429_100305175 | 3300006880 | Bacteria | 1394 |
| 441 | Ga0075429_100550555 | 3300006880 | Bacteria | 1011 |
| 442 | Ga0068865_100005424 | 3300006881 | Bacteria | 7732 |
| 443 | Ga0068865_100016601 | 3300006881 | Bacteria | 4716 |
| 444 | Ga0075436_100002590 | 3300006914 | Bacteria | 12435 |
| 445 | Ga0075436_100002790 | 3300006914 | Bacteria | 11964 |
| 446 | Ga0075436_100004621 | 3300006914 | Bacteria | 9434 |
| 447 | Ga0075436_100027386 | 3300006914 | Bacteria | 3923 |
| 448 | Ga0075436_100076615 | 3300006914 | Bacteria | 2316 |
| 449 | Ga0075436_100098077 | 3300006914 | Bacteria | 2039 |
| 450 | Ga0075436_100176487 | 3300006914 | Bacteria | 1509 |
| 451 | Ga0075436_100248625 | 3300006914 | Bacteria | 1266 |
| 452 | Ga0075436_100915907 | 3300006914 | Bacteria | 656 |
| 453 | Ga0097620_100000677 | 3300006931 | Bacteria | 34196 |
| 454 | Ga0097620_100163956 | 3300006931 | Bacteria | 2302 |
| 455 | Ga0097620_100284333 | 3300006931 | Bacteria | 1747 |
| 456 | Ga0097620_100310923 | 3300006931 | Bacteria | 1669 |
| 457 | Ga0097620_100425040 | 3300006931 | Bacteria | 1425 |
| 458 | Ga0097620_100971311 | 3300006931 | Bacteria | 932 |
| 459 | Ga0097620_100995693 | 3300006931 | Bacteria | 920 |
| 460 | Ga0097620_101953811 | 3300006931 | Bacteria | 648 |
| 461 | Ga0075435_100002461 | 3300007076 | Bacteria | 12304 |
| 462 | Ga0075435_100027645 | 3300007076 | Bacteria | 4440 |
| 463 | Ga0075435_100088348 | 3300007076 | Bacteria | 2554 |
| 464 | Ga0075435_100236973 | 3300007076 | Bacteria | 1551 |
| 465 | Ga0075435_100242611 | 3300007076 | Bacteria | 1533 |
| 466 | Ga0075435_100300747 | 3300007076 | Bacteria | 1372 |
| 467 | Ga0075435_100488791 | 3300007076 | Bacteria | 1064 |
| 468 | Ga0075435_100747103 | 3300007076 | Bacteria | 851 |
| 469 | Ga0075435_101963034 | 3300007076 | Bacteria | 514 |
| 470 | Ga0099794_10049726 | 3300007265 | Bacteria | 2016 |
| 471 | Ga0099794_10197181 | 3300007265 | Bacteria | 1031 |
| 472 | Ga0099794_10297416 | 3300007265 | Unclassified | 836 |
| 473 | Ga0099795_10020338 | 3300007788 | Bacteria | 2160 |
| 474 | Ga0099795_10424156 | 3300007788 | Bacteria | 608 |
| 475 | Ga0105251_10107526 | 3300009011 | Bacteria | 1272 |
| 476 | Ga0105251_10293874 | 3300009011 | Bacteria | 736 |
| 477 | Ga0105244_10011650 | 3300009036 | Bacteria | 5253 |
| 478 | Ga0105240_10127569 | 3300009093 | Bacteria | 3055 |
| 479 | Ga0105240_10732476 | 3300009093 | Bacteria | 1076 |
| 480 | Ga0111539_10000022 | 3300009094 | Bacteria | 240838 |
| 481 | Ga0111539_10058961 | 3300009094 | Bacteria | 4554 |
| 482 | Ga0111539_10199861 | 3300009094 | Bacteria | 2331 |
| 483 | Ga0111539_10349380 | 3300009094 | Bacteria | 1721 |
| 484 | Ga0111539_10923746 | 3300009094 | Bacteria | 1015 |
| 485 | Ga0111539_10934786 | 3300009094 | Bacteria | 1008 |
| 486 | Ga0111539_11120732 | 3300009094 | Bacteria | 914 |
| 487 | Ga0111539_12242981 | 3300009094 | Bacteria | 633 |
| 488 | Ga0111539_12975874 | 3300009094 | Bacteria | 548 |
| 489 | Ga0105245_10001507 | 3300009098 | Bacteria | 21079 |
| 490 | Ga0105245_10368411 | 3300009098 | Bacteria | 1428 |
| 491 | Ga0105245_11361665 | 3300009098 | Bacteria | 759 |
| 492 | Ga0105245_11449824 | 3300009098 | Bacteria | 737 |
| 493 | Ga0105247_10151259 | 3300009101 | Bacteria | 1529 |
| 494 | Ga0105247_10271221 | 3300009101 | Bacteria | 1167 |
| 495 | Ga0114129_10000247 | 3300009147 | Bacteria | 60820 |
| 496 | Ga0114129_10001417 | 3300009147 | Bacteria | 32326 |
| 497 | Ga0114129_10002852 | 3300009147 | Bacteria | 24170 |
| 498 | Ga0114129_10046019 | 3300009147 | Bacteria | 6133 |
| 499 | Ga0114129_10063914 | 3300009147 | Bacteria | 5136 |
| 500 | Ga0114129_10177970 | 3300009147 | Bacteria | 2896 |
| 501 | Ga0114129_10439907 | 3300009147 | Bacteria | 1712 |
| 502 | Ga0114129_10521343 | 3300009147 | Bacteria | 1549 |
| 503 | Ga0114129_10525620 | 3300009147 | Bacteria | 1542 |
| 504 | Ga0114129_10715113 | 3300009147 | Bacteria | 1286 |
| 505 | Ga0114129_11090486 | 3300009147 | Bacteria | 1000 |
| 506 | Ga0114129_11460040 | 3300009147 | Bacteria | 842 |
| 507 | Ga0114129_11718743 | 3300009147 | Bacteria | 765 |
| 508 | Ga0105243_10000009 | 3300009148 | Bacteria | 354419 |
| 509 | Ga0105243_11007106 | 3300009148 | Bacteria | 836 |
| 510 | Ga0105241_10080778 | 3300009174 | Bacteria | 2545 |
| 511 | Ga0105241_11962224 | 3300009174 | Bacteria | 575 |
| 512 | Ga0105242_10012536 | 3300009176 | Bacteria | 6525 |
| 513 | Ga0105242_10080321 | 3300009176 | Bacteria | 2725 |
| 514 | Ga0105242_10713146 | 3300009176 | Bacteria | 983 |
| 515 | Ga0105242_10748162 | 3300009176 | Bacteria | 962 |
| 516 | Ga0105242_12012325 | 3300009176 | Bacteria | 620 |
| 517 | Ga0105248_10008944 | 3300009177 | Bacteria | 11015 |
| 518 | Ga0105248_10223859 | 3300009177 | Bacteria | 2118 |
| 519 | Ga0105248_10574996 | 3300009177 | Bacteria | 1271 |
| 520 | Ga0105248_10689478 | 3300009177 | Bacteria | 1152 |
| 521 | Ga0105248_10960038 | 3300009177 | Bacteria | 965 |
| 522 | Ga0105248_11517177 | 3300009177 | Bacteria | 759 |
| 523 | Ga0105248_12580991 | 3300009177 | Bacteria | 579 |
| 524 | Ga0105248_12890409 | 3300009177 | Bacteria | 548 |
| 525 | Ga0105248_13041606 | 3300009177 | Bacteria | 534 |
| 526 | Ga0105237_10066336 | 3300009545 | Bacteria | 3604 |
| 527 | Ga0105237_11477833 | 3300009545 | Bacteria | 686 |
| 528 | Ga0105238_10000002 | 3300009551 | Bacteria | 772711 |
| 529 | Ga0105238_10145814 | 3300009551 | Bacteria | 2344 |
| 530 | Ga0105238_10456576 | 3300009551 | Bacteria | 1275 |
| 531 | Ga0105238_11023362 | 3300009551 | Bacteria | 847 |
| 532 | Ga0105249_10026603 | 3300009553 | Bacteria | 5216 |
| 533 | Ga0105249_10725262 | 3300009553 | Bacteria | 1055 |
| 534 | Ga0105249_11281389 | 3300009553 | Unclassified | 804 |
| 535 | Ga0105249_11793297 | 3300009553 | Bacteria | 686 |
| 536 | Ga0105249_12996498 | 3300009553 | Bacteria | 542 |
| 537 | Ga0099796_10090524 | 3300010159 | Bacteria | 1137 |
| 538 | Ga0099796_10554021 | 3300010159 | Bacteria | 517 |
| 539 | Ga0105239_11699799 | 3300010375 | Bacteria | 730 |
| 540 | Ga0105239_12145162 | 3300010375 | Bacteria | 649 |
| 541 | Ga0105239_12558569 | 3300010375 | Bacteria | 595 |
| 542 | Ga0105239_13315569 | 3300010375 | Bacteria | 524 |
| 543 | Ga0105246_10235421 | 3300011119 | Bacteria | 1444 |
| 544 | Ga0157347_1066412 | 3300012502 | Bacteria | 525 |
| 545 | Ga0157373_10325377 | 3300013100 | Bacteria | 1094 |
| 546 | Ga0157373_10638818 | 3300013100 | Bacteria | 777 |
| 547 | Ga0157369_10001943 | 3300013105 | Bacteria | 24887 |
| 548 | Ga0157369_10100872 | 3300013105 | Bacteria | 3077 |
| 549 | Ga0157369_11203607 | 3300013105 | Bacteria | 773 |
| 550 | Ga0157374_10000005 | 3300013296 | Bacteria | 646767 |
| 551 | Ga0157374_10002664 | 3300013296 | Bacteria | 15039 |
| 552 | Ga0157374_10039567 | 3300013296 | Bacteria | 4339 |
| 553 | Ga0157374_10508101 | 3300013296 | Bacteria | 1210 |
| 554 | Ga0157378_10012246 | 3300013297 | Bacteria | 7510 |
| 555 | Ga0157378_10096295 | 3300013297 | Bacteria | 2697 |
| 556 | Ga0157378_10108940 | 3300013297 | Bacteria | 2537 |
| 557 | Ga0157378_10227763 | 3300013297 | Bacteria | 1774 |
| 558 | Ga0157378_10300065 | 3300013297 | Bacteria | 1555 |
| 559 | Ga0157378_10325710 | 3300013297 | Bacteria | 1494 |
| 560 | Ga0157378_11002773 | 3300013297 | Bacteria | 869 |
| 561 | Ga0157378_12184179 | 3300013297 | Bacteria | 605 |
| 562 | Ga0163162_10093242 | 3300013306 | Bacteria | 3096 |
| 563 | Ga0163162_10212271 | 3300013306 | Bacteria | 2066 |
| 564 | Ga0163162_10429766 | 3300013306 | Bacteria | 1453 |
| 565 | Ga0157372_11136133 | 3300013307 | Bacteria | 903 |
| 566 | Ga0157375_10012356 | 3300013308 | Bacteria | 7571 |
| 567 | Ga0157375_10021527 | 3300013308 | Bacteria | 5914 |
| 568 | Ga0157375_10064497 | 3300013308 | Bacteria | 3647 |
| 569 | Ga0157375_10071083 | 3300013308 | Bacteria | 3492 |
| 570 | Ga0157375_10237799 | 3300013308 | Bacteria | 1981 |
| 571 | Ga0157375_10379526 | 3300013308 | Bacteria | 1580 |
| 572 | Ga0157375_10536984 | 3300013308 | Bacteria | 1332 |
| 573 | Ga0157375_10749389 | 3300013308 | Bacteria | 1128 |
| 574 | Ga0157375_10928052 | 3300013308 | Bacteria | 1013 |
| 575 | Ga0157375_11218204 | 3300013308 | Bacteria | 883 |
| 576 | Ga0157375_12260814 | 3300013308 | Bacteria | 648 |
| 577 | Ga0163163_10036365 | 3300014325 | Bacteria | 4782 |
| 578 | Ga0163163_10053167 | 3300014325 | Bacteria | 3997 |
| 579 | Ga0163163_10054913 | 3300014325 | Bacteria | 3936 |
| 580 | Ga0163163_10139935 | 3300014325 | Bacteria | 2462 |
| 581 | Ga0163163_10271121 | 3300014325 | Bacteria | 1748 |
| 582 | Ga0163163_10313241 | 3300014325 | Bacteria | 1623 |
| 583 | Ga0163163_10365909 | 3300014325 | Bacteria | 1499 |
| 584 | Ga0163163_10723073 | 3300014325 | Bacteria | 1059 |
| 585 | Ga0163163_10728194 | 3300014325 | Bacteria | 1055 |
| 586 | Ga0163163_10844320 | 3300014325 | Bacteria | 979 |
| 587 | Ga0163163_10928670 | 3300014325 | Bacteria | 933 |
| 588 | Ga0163163_11145053 | 3300014325 | Bacteria | 841 |
| 589 | Ga0157380_10001355 | 3300014326 | Bacteria | 15948 |
| 590 | Ga0157380_10205467 | 3300014326 | Bacteria | 1751 |
| 591 | Ga0157380_10688406 | 3300014326 | Bacteria | 1025 |
| 592 | Ga0157380_12863327 | 3300014326 | Bacteria | 549 |
| 593 | Ga0157380_13133087 | 3300014326 | Bacteria | 528 |
| 594 | Ga0182008_10834581 | 3300014497 | Bacteria | 537 |
| 595 | Ga0157377_10000001 | 3300014745 | Bacteria | 623098 |
| 596 | Ga0157377_10000414 | 3300014745 | Bacteria | 18520 |
| 597 | Ga0157377_10046193 | 3300014745 | Bacteria | 2434 |
| 598 | Ga0157377_10191602 | 3300014745 | Bacteria | 1292 |
| 599 | Ga0157377_10565156 | 3300014745 | Bacteria | 806 |
| 600 | Ga0157379_10000714 | 3300014968 | Bacteria | 26943 |
| 601 | Ga0157379_10138032 | 3300014968 | Bacteria | 2197 |
| 602 | Ga0157379_10307620 | 3300014968 | Bacteria | 1445 |
| 603 | Ga0157379_10533826 | 3300014968 | Bacteria | 1090 |
| 604 | Ga0157379_10549618 | 3300014968 | Bacteria | 1074 |
| 605 | Ga0157379_11303935 | 3300014968 | Bacteria | 701 |
| 606 | Ga0157379_11498675 | 3300014968 | Bacteria | 656 |
| 607 | Ga0157376_10000003 | 3300014969 | Bacteria | 568634 |
| 608 | Ga0157376_10046438 | 3300014969 | Bacteria | 3581 |
| 609 | Ga0157376_10654389 | 3300014969 | Bacteria | 1051 |
| 610 | Ga0157376_10676509 | 3300014969 | Bacteria | 1035 |
| 611 | Ga0157376_11115777 | 3300014969 | Bacteria | 815 |
| 612 | Ga0157376_11341442 | 3300014969 | Bacteria | 746 |
| 613 | Ga0157376_11493894 | 3300014969 | Bacteria | 708 |
| 614 | Ga0157376_11763036 | 3300014969 | Bacteria | 655 |
| 615 | Ga0182007_10306095 | 3300015262 | Bacteria | 585 |
| 616 | Ga0163161_10063568 | 3300017792 | Bacteria | 2691 |
| 617 | Ga0206356_11765259 | 3300020070 | Bacteria | 1730 |
| 618 | Ga0206352_10878108 | 3300020078 | Bacteria | 2719 |
| 619 | Ga0213873_10000018 | 3300021358 | Bacteria | 123140 |
| 620 | Ga0213873_10000553 | 3300021358 | Bacteria | 6058 |
| 621 | Ga0213876_10000009 | 3300021384 | Bacteria | 496136 |
| 622 | Ga0213876_10000058 | 3300021384 | Bacteria | 134080 |
| 623 | Ga0207666_1001625 | 3300025271 | Bacteria | 2664 |
| 624 | Ga0207697_10009073 | 3300025315 | Bacteria | 4310 |
| 625 | Ga0207697_10068448 | 3300025315 | Bacteria | 1485 |
| 626 | Ga0207655_1019809 | 3300025728 | Bacteria | 3494 |
| 627 | Ga0207653_10128253 | 3300025885 | Unclassified | 919 |
| 628 | Ga0207682_10001734 | 3300025893 | Bacteria | 10002 |
| 629 | Ga0207682_10143047 | 3300025893 | Bacteria | 1074 |
| 630 | Ga0207692_10077477 | 3300025898 | Bacteria | 1769 |
| 631 | Ga0207692_10915755 | 3300025898 | Bacteria | 577 |
| 632 | Ga0207642_10101044 | 3300025899 | Bacteria | 1448 |
| 633 | Ga0207710_10203240 | 3300025900 | Bacteria | 979 |
| 634 | Ga0207710_10504380 | 3300025900 | Bacteria | 628 |
| 635 | Ga0207688_10006667 | 3300025901 | Bacteria | 6282 |
| 636 | Ga0207680_10003484 | 3300025903 | Bacteria | 7410 |
| 637 | Ga0207680_10007364 | 3300025903 | Bacteria | 5358 |
| 638 | Ga0207680_10033943 | 3300025903 | Bacteria | 2915 |
| 639 | Ga0207680_10152895 | 3300025903 | Bacteria | 1540 |
| 640 | Ga0207680_10374993 | 3300025903 | Bacteria | 1002 |
| 641 | Ga0207680_10472711 | 3300025903 | Bacteria | 891 |
| 642 | Ga0207680_10571957 | 3300025903 | Bacteria | 807 |
| 643 | Ga0207680_10793122 | 3300025903 | Bacteria | 679 |
| 644 | Ga0207647_10068009 | 3300025904 | Bacteria | 2157 |
| 645 | Ga0207647_10118635 | 3300025904 | Bacteria | 1561 |
| 646 | Ga0207647_10422104 | 3300025904 | Bacteria | 750 |
| 647 | Ga0207685_10194185 | 3300025905 | Bacteria | 949 |
| 648 | Ga0207685_10353728 | 3300025905 | Unclassified | 741 |
| 649 | Ga0207685_10353837 | 3300025905 | Bacteria | 741 |
| 650 | Ga0207685_10811008 | 3300025905 | Bacteria | 516 |
| 651 | Ga0207699_10068910 | 3300025906 | Bacteria | 2155 |
| 652 | Ga0207699_10096815 | 3300025906 | Bacteria | 1864 |
| 653 | Ga0207699_10205798 | 3300025906 | Bacteria | 1336 |
| 654 | Ga0207699_10276684 | 3300025906 | Bacteria | 1165 |
| 655 | Ga0207699_10423402 | 3300025906 | Bacteria | 951 |
| 656 | Ga0207645_10006128 | 3300025907 | Bacteria | 8639 |
| 657 | Ga0207645_10021058 | 3300025907 | Bacteria | 4257 |
| 658 | Ga0207645_10123441 | 3300025907 | Bacteria | 1682 |
| 659 | Ga0207643_10001235 | 3300025908 | Bacteria | 15094 |
| 660 | Ga0207643_10017199 | 3300025908 | Bacteria | 3950 |
| 661 | Ga0207643_10081943 | 3300025908 | Bacteria | 1870 |
| 662 | Ga0207643_10206890 | 3300025908 | Bacteria | 1197 |
| 663 | Ga0207684_10011604 | 3300025910 | Bacteria | 7699 |
| 664 | Ga0207684_10035936 | 3300025910 | Unclassified | 4205 |
| 665 | Ga0207684_10043926 | 3300025910 | Bacteria | 3789 |
| 666 | Ga0207684_10072862 | 3300025910 | Bacteria | 2917 |
| 667 | Ga0207684_10134177 | 3300025910 | Bacteria | 2125 |
| 668 | Ga0207684_10141204 | 3300025910 | Bacteria | 2070 |
| 669 | Ga0207684_10190569 | 3300025910 | Bacteria | 1769 |
| 670 | Ga0207684_10238580 | 3300025910 | Bacteria | 1568 |
| 671 | Ga0207684_10544790 | 3300025910 | Unclassified | 993 |
| 672 | Ga0207684_11008326 | 3300025910 | Bacteria | 696 |
| 673 | Ga0207654_10623314 | 3300025911 | Bacteria | 771 |
| 674 | Ga0207707_10070280 | 3300025912 | Bacteria | 3051 |
| 675 | Ga0207707_10317843 | 3300025912 | Bacteria | 1345 |
| 676 | Ga0207707_10899627 | 3300025912 | Unclassified | 732 |
| 677 | Ga0207695_10091115 | 3300025913 | Bacteria | 3063 |
| 678 | Ga0207695_10433346 | 3300025913 | Bacteria | 1198 |
| 679 | Ga0207693_10090246 | 3300025915 | Bacteria | 2402 |
| 680 | Ga0207693_10218115 | 3300025915 | Bacteria | 1499 |
| 681 | Ga0207693_10299968 | 3300025915 | Bacteria | 1259 |
| 682 | Ga0207693_10378669 | 3300025915 | Bacteria | 1107 |
| 683 | Ga0207693_11170599 | 3300025915 | Bacteria | 581 |
| 684 | Ga0207663_10052095 | 3300025916 | Bacteria | 2552 |
| 685 | Ga0207663_10173978 | 3300025916 | Bacteria | 1532 |
| 686 | Ga0207663_10383107 | 3300025916 | Bacteria | 1072 |
| 687 | Ga0207660_10774686 | 3300025917 | Bacteria | 783 |
| 688 | Ga0207660_11262676 | 3300025917 | Bacteria | 600 |
| 689 | Ga0207662_10059669 | 3300025918 | Bacteria | 2287 |
| 690 | Ga0207662_10068221 | 3300025918 | Bacteria | 2147 |
| 691 | Ga0207662_10086791 | 3300025918 | Bacteria | 1918 |
| 692 | Ga0207662_10136184 | 3300025918 | Bacteria | 1552 |
| 693 | Ga0207662_10153364 | 3300025918 | Bacteria | 1467 |
| 694 | Ga0207662_11017249 | 3300025918 | Bacteria | 589 |
| 695 | Ga0207657_10064105 | 3300025919 | Bacteria | 3138 |
| 696 | Ga0207657_10489885 | 3300025919 | Bacteria | 963 |
| 697 | Ga0207657_10604040 | 3300025919 | Bacteria | 856 |
| 698 | Ga0207657_10653070 | 3300025919 | Bacteria | 819 |
| 699 | Ga0207649_10268711 | 3300025920 | Bacteria | 1235 |
| 700 | Ga0207649_10724585 | 3300025920 | Bacteria | 772 |
| 701 | Ga0207652_10293903 | 3300025921 | Bacteria | 1466 |
| 702 | Ga0207646_10000343 | 3300025922 | Bacteria | 62896 |
| 703 | Ga0207646_10080346 | 3300025922 | Bacteria | 2915 |
| 704 | Ga0207646_10140516 | 3300025922 | Bacteria | 2175 |
| 705 | Ga0207646_10147358 | 3300025922 | Bacteria | 2121 |
| 706 | Ga0207646_10207606 | 3300025922 | Bacteria | 1769 |
| 707 | Ga0207646_10215582 | 3300025922 | Bacteria | 1734 |
| 708 | Ga0207646_10333027 | 3300025922 | Bacteria | 1371 |
| 709 | Ga0207646_10581853 | 3300025922 | Bacteria | 1005 |
| 710 | Ga0207646_10586794 | 3300025922 | Bacteria | 1001 |
| 711 | Ga0207646_10821657 | 3300025922 | Bacteria | 827 |
| 712 | Ga0207646_11430375 | 3300025922 | Bacteria | 601 |
| 713 | Ga0207681_10002742 | 3300025923 | Bacteria | 11146 |
| 714 | Ga0207681_10152701 | 3300025923 | Bacteria | 1732 |
| 715 | Ga0207681_10287031 | 3300025923 | Bacteria | 1297 |
| 716 | Ga0207681_10767289 | 3300025923 | Bacteria | 804 |
| 717 | Ga0207681_11437631 | 3300025923 | Bacteria | 579 |
| 718 | Ga0207694_10000001 | 3300025924 | Bacteria | 4078485 |
| 719 | Ga0207694_10176365 | 3300025924 | Bacteria | 1732 |
| 720 | Ga0207650_10000082 | 3300025925 | Bacteria | 128722 |
| 721 | Ga0207650_10011593 | 3300025925 | Bacteria | 6071 |
| 722 | Ga0207650_10048909 | 3300025925 | Bacteria | 3120 |
| 723 | Ga0207650_10116501 | 3300025925 | Bacteria | 2075 |
| 724 | Ga0207650_10302623 | 3300025925 | Bacteria | 1306 |
| 725 | Ga0207650_10768909 | 3300025925 | Bacteria | 815 |
| 726 | Ga0207659_10000036 | 3300025926 | Bacteria | 103327 |
| 727 | Ga0207659_10115953 | 3300025926 | Bacteria | 2044 |
| 728 | Ga0207659_10120504 | 3300025926 | Bacteria | 2010 |
| 729 | Ga0207659_10287415 | 3300025926 | Bacteria | 1346 |
| 730 | Ga0207659_10329048 | 3300025926 | Bacteria | 1263 |
| 731 | Ga0207659_10403812 | 3300025926 | Bacteria | 1143 |
| 732 | Ga0207659_10669329 | 3300025926 | Bacteria | 888 |
| 733 | Ga0207659_10779324 | 3300025926 | Bacteria | 821 |
| 734 | Ga0207687_10000005 | 3300025927 | Bacteria | 770649 |
| 735 | Ga0207687_10607398 | 3300025927 | Bacteria | 922 |
| 736 | Ga0207687_11309652 | 3300025927 | Bacteria | 623 |
| 737 | Ga0207687_11549680 | 3300025927 | Bacteria | 569 |
| 738 | Ga0207700_10051399 | 3300025928 | Bacteria | 3076 |
| 739 | Ga0207700_10089784 | 3300025928 | Bacteria | 2423 |
| 740 | Ga0207700_10098343 | 3300025928 | Bacteria | 2328 |
| 741 | Ga0207700_10801507 | 3300025928 | Bacteria | 842 |
| 742 | Ga0207700_10945405 | 3300025928 | Bacteria | 771 |
| 743 | Ga0207644_10055836 | 3300025931 | Bacteria | 2848 |
| 744 | Ga0207644_10259586 | 3300025931 | Bacteria | 1389 |
| 745 | Ga0207644_11465725 | 3300025931 | Bacteria | 573 |
| 746 | Ga0207690_10025055 | 3300025932 | Bacteria | 3742 |
| 747 | Ga0207690_10136438 | 3300025932 | Bacteria | 1802 |
| 748 | Ga0207706_10013582 | 3300025933 | Bacteria | 7398 |
| 749 | Ga0207706_10073033 | 3300025933 | Bacteria | 3016 |
| 750 | Ga0207706_10091565 | 3300025933 | Bacteria | 2673 |
| 751 | Ga0207706_10105904 | 3300025933 | Bacteria | 2474 |
| 752 | Ga0207706_10433223 | 3300025933 | Bacteria | 1139 |
| 753 | Ga0207706_10588375 | 3300025933 | Bacteria | 957 |
| 754 | Ga0207706_10954501 | 3300025933 | Bacteria | 722 |
| 755 | Ga0207686_10001508 | 3300025934 | Bacteria | 13115 |
| 756 | Ga0207686_10217571 | 3300025934 | Bacteria | 1377 |
| 757 | Ga0207709_10000026 | 3300025935 | Bacteria | 354467 |
| 758 | Ga0207709_10210974 | 3300025935 | Bacteria | 1394 |
| 759 | Ga0207709_11215995 | 3300025935 | Bacteria | 621 |
| 760 | Ga0207670_10070690 | 3300025936 | Bacteria | 2412 |
| 761 | Ga0207670_10136374 | 3300025936 | Bacteria | 1804 |
| 762 | Ga0207670_10148699 | 3300025936 | Bacteria | 1735 |
| 763 | Ga0207670_10150696 | 3300025936 | Bacteria | 1725 |
| 764 | Ga0207670_10309877 | 3300025936 | Bacteria | 1239 |
| 765 | Ga0207670_10474085 | 3300025936 | Bacteria | 1013 |
| 766 | Ga0207670_10531204 | 3300025936 | Bacteria | 959 |
| 767 | Ga0207670_10555149 | 3300025936 | Bacteria | 939 |
| 768 | Ga0207670_10850257 | 3300025936 | Bacteria | 762 |
| 769 | Ga0207670_11671863 | 3300025936 | Bacteria | 541 |
| 770 | Ga0207669_10100540 | 3300025937 | Bacteria | 1910 |
| 771 | Ga0207669_10323551 | 3300025937 | Bacteria | 1181 |
| 772 | Ga0207669_10468953 | 3300025937 | Bacteria | 1001 |
| 773 | Ga0207669_10705697 | 3300025937 | Bacteria | 829 |
| 774 | Ga0207669_11881879 | 3300025937 | Bacteria | 511 |
| 775 | Ga0207704_10003857 | 3300025938 | Bacteria | 6810 |
| 776 | Ga0207704_10029913 | 3300025938 | Bacteria | 3046 |
| 777 | Ga0207704_10765814 | 3300025938 | Bacteria | 804 |
| 778 | Ga0207704_11810931 | 3300025938 | Bacteria | 525 |
| 779 | Ga0207665_10006268 | 3300025939 | Bacteria | 7894 |
| 780 | Ga0207665_10009968 | 3300025939 | Bacteria | 6235 |
| 781 | Ga0207665_10018501 | 3300025939 | Bacteria | 4577 |
| 782 | Ga0207665_10026836 | 3300025939 | Bacteria | 3803 |
| 783 | Ga0207665_10251041 | 3300025939 | Bacteria | 1307 |
| 784 | Ga0207665_10305436 | 3300025939 | Bacteria | 1190 |
| 785 | Ga0207665_10457139 | 3300025939 | Bacteria | 981 |
| 786 | Ga0207665_10496467 | 3300025939 | Bacteria | 942 |
| 787 | Ga0207665_10548002 | 3300025939 | Bacteria | 898 |
| 788 | Ga0207665_10864190 | 3300025939 | Unclassified | 716 |
| 789 | Ga0207691_10000326 | 3300025940 | Bacteria | 47354 |
| 790 | Ga0207691_10002644 | 3300025940 | Bacteria | 17504 |
| 791 | Ga0207691_10006947 | 3300025940 | Bacteria | 10917 |
| 792 | Ga0207691_10133717 | 3300025940 | Bacteria | 2189 |
| 793 | Ga0207691_10204635 | 3300025940 | Bacteria | 1717 |
| 794 | Ga0207691_10289454 | 3300025940 | Bacteria | 1409 |
| 795 | Ga0207691_10727844 | 3300025940 | Bacteria | 836 |
| 796 | Ga0207691_11018557 | 3300025940 | Bacteria | 691 |
| 797 | Ga0207711_10007454 | 3300025941 | Bacteria | 9155 |
| 798 | Ga0207711_10197035 | 3300025941 | Bacteria | 1837 |
| 799 | Ga0207711_10389374 | 3300025941 | Bacteria | 1294 |
| 800 | Ga0207711_11458974 | 3300025941 | Bacteria | 627 |
| 801 | Ga0207711_11985335 | 3300025941 | Bacteria | 525 |
| 802 | Ga0207689_10009254 | 3300025942 | Bacteria | 8519 |
| 803 | Ga0207689_10009503 | 3300025942 | Bacteria | 8397 |
| 804 | Ga0207689_10020085 | 3300025942 | Bacteria | 5624 |
| 805 | Ga0207689_10065221 | 3300025942 | Bacteria | 2996 |
| 806 | Ga0207689_10140200 | 3300025942 | Bacteria | 1992 |
| 807 | Ga0207689_10340280 | 3300025942 | Bacteria | 1246 |
| 808 | Ga0207689_10446792 | 3300025942 | Bacteria | 1080 |
| 809 | Ga0207689_11199927 | 3300025942 | Bacteria | 639 |
| 810 | Ga0207689_11416054 | 3300025942 | Bacteria | 582 |
| 811 | Ga0207661_10000006 | 3300025944 | Bacteria | 537727 |
| 812 | Ga0207661_10007008 | 3300025944 | Bacteria | 7997 |
| 813 | Ga0207661_10082186 | 3300025944 | Bacteria | 2663 |
| 814 | Ga0207679_10071083 | 3300025945 | Bacteria | 2624 |
| 815 | Ga0207679_10482510 | 3300025945 | Bacteria | 1104 |
| 816 | Ga0207679_10566129 | 3300025945 | Bacteria | 1021 |
| 817 | Ga0207679_10716020 | 3300025945 | Bacteria | 909 |
| 818 | Ga0207679_11403420 | 3300025945 | Bacteria | 641 |
| 819 | Ga0207679_11573638 | 3300025945 | Bacteria | 602 |
| 820 | Ga0207667_10003431 | 3300025949 | Bacteria | 19566 |
| 821 | Ga0207667_10023566 | 3300025949 | Bacteria | 6777 |
| 822 | Ga0207651_10006583 | 3300025960 | Bacteria | 6102 |
| 823 | Ga0207651_10007125 | 3300025960 | Bacteria | 5937 |
| 824 | Ga0207651_10064605 | 3300025960 | Bacteria | 2562 |
| 825 | Ga0207651_10099429 | 3300025960 | Bacteria | 2154 |
| 826 | Ga0207651_10742043 | 3300025960 | Bacteria | 867 |
| 827 | Ga0207651_10855995 | 3300025960 | Bacteria | 808 |
| 828 | Ga0207651_11107468 | 3300025960 | Bacteria | 710 |
| 829 | Ga0207712_10290886 | 3300025961 | Bacteria | 1337 |
| 830 | Ga0207712_10624678 | 3300025961 | Unclassified | 934 |
| 831 | Ga0207712_10782455 | 3300025961 | Bacteria | 838 |
| 832 | Ga0207712_10943791 | 3300025961 | Bacteria | 764 |
| 833 | Ga0207668_10018999 | 3300025972 | Bacteria | 4334 |
| 834 | Ga0207668_10554333 | 3300025972 | Bacteria | 996 |
| 835 | Ga0207640_10107477 | 3300025981 | Bacteria | 1970 |
| 836 | Ga0207640_10305543 | 3300025981 | Bacteria | 1260 |
| 837 | Ga0207640_10989329 | 3300025981 | Bacteria | 739 |
| 838 | Ga0207658_10001637 | 3300025986 | Bacteria | 17158 |
| 839 | Ga0207658_10055938 | 3300025986 | Bacteria | 2926 |
| 840 | Ga0207658_10351037 | 3300025986 | Bacteria | 1284 |
| 841 | Ga0207677_10000101 | 3300026023 | Bacteria | 70739 |
| 842 | Ga0207677_10218669 | 3300026023 | Bacteria | 1526 |
| 843 | Ga0207677_10291313 | 3300026023 | Bacteria | 1345 |
| 844 | Ga0207677_11090546 | 3300026023 | Bacteria | 727 |
| 845 | Ga0207677_11423989 | 3300026023 | Unclassified | 639 |
| 846 | Ga0207677_11805638 | 3300026023 | Bacteria | 568 |
| 847 | Ga0207703_10007604 | 3300026035 | Bacteria | 8591 |
| 848 | Ga0207703_10316451 | 3300026035 | Bacteria | 1428 |
| 849 | Ga0207703_10392236 | 3300026035 | Bacteria | 1286 |
| 850 | Ga0207703_10410089 | 3300026035 | Bacteria | 1259 |
| 851 | Ga0207703_11039613 | 3300026035 | Bacteria | 786 |
| 852 | Ga0207703_11467887 | 3300026035 | Bacteria | 656 |
| 853 | Ga0207703_11536237 | 3300026035 | Bacteria | 641 |
| 854 | Ga0207639_10000013 | 3300026041 | Bacteria | 293084 |
| 855 | Ga0207639_10189920 | 3300026041 | Bacteria | 1754 |
| 856 | Ga0207639_10492689 | 3300026041 | Bacteria | 1118 |
| 857 | Ga0207678_10049059 | 3300026067 | Bacteria | 3648 |
| 858 | Ga0207678_10190888 | 3300026067 | Bacteria | 1751 |
| 859 | Ga0207678_10222677 | 3300026067 | Bacteria | 1615 |
| 860 | Ga0207678_10759286 | 3300026067 | Bacteria | 855 |
| 861 | Ga0207678_11932014 | 3300026067 | Bacteria | 514 |
| 862 | Ga0207708_10000041 | 3300026075 | Bacteria | 126142 |
| 863 | Ga0207708_10011108 | 3300026075 | Bacteria | 6697 |
| 864 | Ga0207708_10012451 | 3300026075 | Bacteria | 6340 |
| 865 | Ga0207708_10906223 | 3300026075 | Bacteria | 763 |
| 866 | Ga0207702_10001471 | 3300026078 | Bacteria | 23360 |
| 867 | Ga0207702_10011175 | 3300026078 | Bacteria | 7488 |
| 868 | Ga0207702_10182964 | 3300026078 | Bacteria | 1931 |
| 869 | Ga0207702_10332278 | 3300026078 | Bacteria | 1450 |
| 870 | Ga0207702_10808274 | 3300026078 | Bacteria | 927 |
| 871 | Ga0207702_10819429 | 3300026078 | Bacteria | 920 |
| 872 | Ga0207702_11743255 | 3300026078 | Bacteria | 615 |
| 873 | Ga0207641_10037244 | 3300026088 | Bacteria | 4061 |
| 874 | Ga0207641_10048111 | 3300026088 | Bacteria | 3598 |
| 875 | Ga0207641_10137639 | 3300026088 | Bacteria | 2199 |
| 876 | Ga0207641_10147519 | 3300026088 | Bacteria | 2128 |
| 877 | Ga0207641_10465979 | 3300026088 | Bacteria | 1223 |
| 878 | Ga0207641_10611981 | 3300026088 | Bacteria | 1067 |
| 879 | Ga0207641_10648581 | 3300026088 | Bacteria | 1037 |
| 880 | Ga0207641_10688216 | 3300026088 | Bacteria | 1006 |
| 881 | Ga0207648_10011154 | 3300026089 | Bacteria | 8479 |
| 882 | Ga0207648_10024555 | 3300026089 | Bacteria | 5379 |
| 883 | Ga0207648_10035580 | 3300026089 | Bacteria | 4388 |
| 884 | Ga0207648_10043194 | 3300026089 | Bacteria | 3957 |
| 885 | Ga0207648_10307115 | 3300026089 | Bacteria | 1423 |
| 886 | Ga0207648_10359341 | 3300026089 | Bacteria | 1314 |
| 887 | Ga0207676_10098517 | 3300026095 | Bacteria | 2417 |
| 888 | Ga0207676_10177426 | 3300026095 | Bacteria | 1862 |
| 889 | Ga0207676_10214264 | 3300026095 | Bacteria | 1711 |
| 890 | Ga0207676_10500738 | 3300026095 | Bacteria | 1153 |
| 891 | Ga0207676_10736336 | 3300026095 | Bacteria | 958 |
| 892 | Ga0207674_11570213 | 3300026116 | Bacteria | 627 |
| 893 | Ga0207674_11773476 | 3300026116 | Bacteria | 585 |
| 894 | Ga0207675_100002645 | 3300026118 | Bacteria | 17685 |
| 895 | Ga0207675_100002673 | 3300026118 | Bacteria | 17594 |
| 896 | Ga0207675_100013850 | 3300026118 | Bacteria | 7520 |
| 897 | Ga0207675_100060186 | 3300026118 | Bacteria | 3545 |
| 898 | Ga0207675_100109886 | 3300026118 | Bacteria | 2602 |
| 899 | Ga0207675_100361315 | 3300026118 | Bacteria | 1424 |
| 900 | Ga0207675_101074241 | 3300026118 | Bacteria | 824 |
| 901 | Ga0207683_10005107 | 3300026121 | Bacteria | 11263 |
| 902 | Ga0207683_10317284 | 3300026121 | Bacteria | 1427 |
| 903 | Ga0207683_10512688 | 3300026121 | Bacteria | 1108 |
| 904 | Ga0207698_10043801 | 3300026142 | Bacteria | 3356 |
| 905 | Ga0207698_10208854 | 3300026142 | Bacteria | 1755 |
| 906 | Ga0207698_10703309 | 3300026142 | Bacteria | 1006 |
| 907 | Ga0207698_12121934 | 3300026142 | Bacteria | 575 |
| 908 | Ga0209969_1040868 | 3300027360 | Bacteria | 720 |
| 909 | Ga0209981_1011093 | 3300027378 | Bacteria | 1241 |
| 910 | Ga0209996_1014048 | 3300027395 | Bacteria | 1087 |
| 911 | Ga0209179_1027708 | 3300027512 | Bacteria | 1144 |
| 912 | Ga0209968_1002058 | 3300027526 | Bacteria | 3059 |
| 913 | Ga0209982_1007080 | 3300027552 | Bacteria | 1638 |
| 914 | Ga0210002_1020599 | 3300027617 | Bacteria | 1062 |
| 915 | Ga0209983_1000280 | 3300027665 | Bacteria | 10618 |
| 916 | Ga0209588_1025351 | 3300027671 | Bacteria | 1876 |
| 917 | Ga0209588_1032623 | 3300027671 | Bacteria | 1669 |
| 918 | Ga0209588_1218255 | 3300027671 | Bacteria | 590 |
| 919 | Ga0209971_1000384 | 3300027682 | Bacteria | 12081 |
| 920 | Ga0209966_1133005 | 3300027695 | Bacteria | 575 |
| 921 | Ga0209998_10002827 | 3300027717 | Bacteria | 3904 |
| 922 | Ga0209974_10004420 | 3300027876 | Bacteria | 5002 |
| 923 | Ga0209974_10128164 | 3300027876 | Bacteria | 903 |
| 924 | Ga0209974_10197531 | 3300027876 | Bacteria | 742 |
| 925 | Ga0207428_10000030 | 3300027907 | Bacteria | 240846 |
| 926 | Ga0207428_10017611 | 3300027907 | Bacteria | 6126 |
| 927 | Ga0207428_10042290 | 3300027907 | Bacteria | 3684 |
| 928 | Ga0207428_10380583 | 3300027907 | Bacteria | 1035 |
| 929 | Ga0207428_11037160 | 3300027907 | Bacteria | 575 |
| 930 | Ga0207428_11047024 | 3300027907 | Bacteria | 572 |
| 931 | Ga0268266_10000259 | 3300028379 | Bacteria | 88660 |
| 932 | Ga0268266_10015961 | 3300028379 | Bacteria | 6425 |
| 933 | Ga0268266_10047157 | 3300028379 | Bacteria | 3690 |
| 934 | Ga0268266_10309020 | 3300028379 | Bacteria | 1477 |
| 935 | Ga0268265_10009861 | 3300028380 | Bacteria | 6450 |
| 936 | Ga0268265_10034866 | 3300028380 | Bacteria | 3671 |
| 937 | Ga0268265_10037170 | 3300028380 | Bacteria | 3572 |
| 938 | Ga0268265_10045924 | 3300028380 | Bacteria | 3262 |
| 939 | Ga0268265_10220454 | 3300028380 | Bacteria | 1659 |
| 940 | Ga0268265_10485770 | 3300028380 | Bacteria | 1161 |
| 941 | Ga0268265_10490222 | 3300028380 | Bacteria | 1156 |
| 942 | Ga0268265_10490646 | 3300028380 | Bacteria | 1156 |
| 943 | Ga0268265_11237145 | 3300028380 | Bacteria | 745 |
| 944 | Ga0268265_11331701 | 3300028380 | Bacteria | 719 |
| 945 | Ga0268264_10005977 | 3300028381 | Bacteria | 10304 |
| 946 | Ga0268264_10044863 | 3300028381 | Bacteria | 3669 |
| 947 | Ga0268264_10049767 | 3300028381 | Bacteria | 3488 |
| 948 | Ga0268264_10136493 | 3300028381 | Bacteria | 2181 |
| 949 | Ga0268264_10144015 | 3300028381 | Bacteria | 2128 |
| 950 | Ga0268264_10197367 | 3300028381 | Bacteria | 1838 |
| 951 | Ga0268264_10209665 | 3300028381 | Bacteria | 1788 |
| 952 | Ga0268264_10259334 | 3300028381 | Bacteria | 1618 |
| 953 | Ga0268264_10362378 | 3300028381 | Bacteria | 1383 |
| 954 | Ga0268264_10497856 | 3300028381 | Bacteria | 1188 |
| 955 | Ga0268264_11076106 | 3300028381 | Bacteria | 812 |
| 956 | Ga0268264_11085509 | 3300028381 | Bacteria | 809 |
| 957 | Ga0265319_1044281 | 3300028563 | Bacteria | 1492 |
| 958 | Ga0265319_1060122 | 3300028563 | Bacteria | 1234 |
| 959 | Ga0265334_10078109 | 3300028573 | Bacteria | 1223 |
| 960 | Ga0265323_10004178 | 3300028653 | Bacteria | 6252 |
| 961 | Ga0265323_10067614 | 3300028653 | Bacteria | 1228 |
| 962 | Ga0265338_10016967 | 3300028800 | Bacteria | 7878 |
| 963 | Ga0265338_10128873 | 3300028800 | Bacteria | 2002 |
| 964 | Ga0265338_10345344 | 3300028800 | Bacteria | 1071 |
| 965 | Ga0265338_10642953 | 3300028800 | Bacteria | 736 |
| 966 | Ga0265338_11184375 | 3300028800 | Unclassified | 513 |
| 967 | Ga0307511_10002513 | 3300030521 | Bacteria | 19146 |
| 968 | Ga0307511_10231185 | 3300030521 | Unclassified | 915 |
| 969 | Ga0265767_110710 | 3300030836 | Bacteria | 616 |
| 970 | Ga0265767_112437 | 3300030836 | Bacteria | 588 |
| 971 | Ga0265764_113392 | 3300030882 | Bacteria | 547 |
| 972 | Ga0265330_10000541 | 3300031235 | Bacteria | 24732 |
| 973 | Ga0265330_10001334 | 3300031235 | Bacteria | 14415 |
| 974 | Ga0265330_10003060 | 3300031235 | Bacteria | 8862 |
| 975 | Ga0265330_10375265 | 3300031235 | Bacteria | 601 |
| 976 | Ga0265332_10064443 | 3300031238 | Bacteria | 1565 |
| 977 | Ga0265332_10155677 | 3300031238 | Bacteria | 955 |
| 978 | Ga0265328_10051354 | 3300031239 | Bacteria | 1514 |
| 979 | Ga0265320_10307898 | 3300031240 | Bacteria | 700 |
| 980 | Ga0265329_10003473 | 3300031242 | Bacteria | 6856 |
| 981 | Ga0265329_10015790 | 3300031242 | Bacteria | 2630 |
| 982 | Ga0265329_10034598 | 3300031242 | Bacteria | 1632 |
| 983 | Ga0265340_10015118 | 3300031247 | Bacteria | 4016 |
| 984 | Ga0265339_10055328 | 3300031249 | Bacteria | 2153 |
| 985 | Ga0265339_10075819 | 3300031249 | Bacteria | 1785 |
| 986 | Ga0265339_10240841 | 3300031249 | Bacteria | 878 |
| 987 | Ga0265331_10073224 | 3300031250 | Bacteria | 1600 |
| 988 | Ga0265331_10233136 | 3300031250 | Bacteria | 827 |
| 989 | Ga0265316_10000251 | 3300031344 | Bacteria | 61672 |
| 990 | Ga0265316_10000984 | 3300031344 | Bacteria | 30933 |
| 991 | Ga0265316_10014237 | 3300031344 | Bacteria | 7014 |
| 992 | Ga0265316_10018769 | 3300031344 | Bacteria | 5936 |
| 993 | Ga0265316_10028493 | 3300031344 | Bacteria | 4607 |
| 994 | Ga0265316_10048657 | 3300031344 | Unclassified | 3345 |
| 995 | Ga0265316_10169982 | 3300031344 | Bacteria | 1626 |
| 996 | Ga0265316_10388436 | 3300031344 | Bacteria | 1006 |
| 997 | Ga0307408_100164966 | 3300031548 | Bacteria | 1763 |
| 998 | Ga0307408_100236106 | 3300031548 | Unclassified | 1500 |
| 999 | Ga0307408_102138195 | 3300031548 | Bacteria | 540 |
| 1000 | Ga0265313_10122813 | 3300031595 | Bacteria | 1131 |
| 1001 | Ga0307508_10050191 | 3300031616 | Bacteria | 3713 |
| 1002 | Ga0316575_10002995 | 3300031665 | Bacteria | 5756 |
| 1003 | Ga0316575_10014672 | 3300031665 | Bacteria | 2945 |
| 1004 | Ga0316575_10021116 | 3300031665 | Bacteria | 2503 |
| 1005 | Ga0316579_10070932 | 3300031691 | Bacteria | 1651 |
| 1006 | Ga0316579_10157791 | 3300031691 | Bacteria | 1096 |
| 1007 | Ga0265314_10023438 | 3300031711 | Bacteria | 4706 |
| 1008 | Ga0265314_10114121 | 3300031711 | Bacteria | 1712 |
| 1009 | Ga0265342_10008085 | 3300031712 | Bacteria | 7603 |
| 1010 | Ga0265342_10036131 | 3300031712 | Bacteria | 3019 |
| 1011 | Ga0265342_10039697 | 3300031712 | Bacteria | 2858 |
| 1012 | Ga0265342_10085382 | 3300031712 | Bacteria | 1817 |
| 1013 | Ga0265342_10176966 | 3300031712 | Bacteria | 1170 |
| 1014 | Ga0316576_10012802 | 3300031727 | Bacteria | 5552 |
| 1015 | Ga0316576_10031380 | 3300031727 | Bacteria | 3770 |
| 1016 | Ga0316576_10072783 | 3300031727 | Bacteria | 2538 |
| 1017 | Ga0316576_10254444 | 3300031727 | Bacteria | 1318 |
| 1018 | Ga0316576_10343935 | 3300031727 | Bacteria | 1110 |
| 1019 | Ga0316576_10358298 | 3300031727 | Bacteria | 1085 |
| 1020 | Ga0316578_10148460 | 3300031728 | Bacteria | 1412 |
| 1021 | Ga0307516_10003404 | 3300031730 | Bacteria | 20479 |
| 1022 | Ga0307405_10139666 | 3300031731 | Bacteria | 1687 |
| 1023 | Ga0307405_10724904 | 3300031731 | Bacteria | 826 |
| 1024 | Ga0316577_10006446 | 3300031733 | Bacteria | 6198 |
| 1025 | Ga0316577_10035166 | 3300031733 | Bacteria | 2800 |
| 1026 | Ga0316577_10160530 | 3300031733 | Bacteria | 1268 |
| 1027 | Ga0316577_10429752 | 3300031733 | Bacteria | 750 |
| 1028 | Ga0307413_10005834 | 3300031824 | Bacteria | 5550 |
| 1029 | Ga0307413_10371109 | 3300031824 | Bacteria | 1111 |
| 1030 | Ga0307410_10001864 | 3300031852 | Bacteria | 9833 |
| 1031 | Ga0307410_10034138 | 3300031852 | Bacteria | 3291 |
| 1032 | Ga0307410_10371816 | 3300031852 | Bacteria | 1148 |
| 1033 | Ga0326468_10043698 | 3300031889 | Bacteria | 651 |
| 1034 | Ga0307406_10235992 | 3300031901 | Bacteria | 1369 |
| 1035 | Ga0307406_10787551 | 3300031901 | Bacteria | 801 |
| 1036 | Ga0307406_12037644 | 3300031901 | Bacteria | 513 |
| 1037 | Ga0307407_10033183 | 3300031903 | Bacteria | 2814 |
| 1038 | Ga0307407_11490439 | 3300031903 | Bacteria | 535 |
| 1039 | Ga0307412_10233228 | 3300031911 | Bacteria | 1419 |
| 1040 | Ga0307412_10394963 | 3300031911 | Bacteria | 1124 |
| 1041 | Ga0307412_11035527 | 3300031911 | Bacteria | 727 |
| 1042 | Ga0307412_11463688 | 3300031911 | Bacteria | 620 |
| 1043 | Ga0307409_100002915 | 3300031995 | Bacteria | 9086 |
| 1044 | Ga0307409_100048335 | 3300031995 | Bacteria | 3236 |
| 1045 | Ga0307409_100109897 | 3300031995 | Bacteria | 2309 |
| 1046 | Ga0307409_100625568 | 3300031995 | Bacteria | 1067 |
| 1047 | Ga0307409_101589606 | 3300031995 | Bacteria | 682 |
| 1048 | Ga0307409_102225915 | 3300031995 | Bacteria | 578 |
| 1049 | Ga0307416_100018585 | 3300032002 | Bacteria | 4902 |
| 1050 | Ga0307416_100039410 | 3300032002 | Bacteria | 3658 |
| 1051 | Ga0307416_100496117 | 3300032002 | Bacteria | 1284 |
| 1052 | Ga0307416_100807659 | 3300032002 | Bacteria | 1034 |
| 1053 | Ga0307416_101190947 | 3300032002 | Bacteria | 867 |
| 1054 | Ga0307416_101215820 | 3300032002 | Bacteria | 859 |
| 1055 | Ga0307416_101970819 | 3300032002 | Bacteria | 687 |
| 1056 | Ga0307414_10005193 | 3300032004 | Bacteria | 7147 |
| 1057 | Ga0307414_10007281 | 3300032004 | Bacteria | 6215 |
| 1058 | Ga0307414_10028964 | 3300032004 | Bacteria | 3599 |
| 1059 | Ga0307414_10042491 | 3300032004 | Bacteria | 3089 |
| 1060 | Ga0307411_10003742 | 3300032005 | Bacteria | 7136 |
| 1061 | Ga0307411_10008827 | 3300032005 | Bacteria | 5250 |
| 1062 | Ga0307411_11011757 | 3300032005 | Bacteria | 745 |
| 1063 | Ga0307411_11232053 | 3300032005 | Bacteria | 679 |
| 1064 | Ga0316053_117483 | 3300032120 | Unclassified | 545 |
| 1065 | Ga0307415_100056689 | 3300032126 | Bacteria | 2688 |
| 1066 | Ga0307415_100268612 | 3300032126 | Bacteria | 1396 |
| 1067 | Ga0307415_101068181 | 3300032126 | Bacteria | 754 |
| 1068 | Ga0307415_101167579 | 3300032126 | Bacteria | 724 |
| 1069 | Ga0316593_10001783 | 3300032168 | Bacteria | 4897 |
| 1070 | Ga0316593_10002618 | 3300032168 | Bacteria | 4311 |
| 1071 | Ga0316593_10014252 | 3300032168 | Bacteria | 2367 |
| 1072 | Ga0316593_10019333 | 3300032168 | Bacteria | 2104 |
| 1073 | Ga0316593_10019508 | 3300032168 | Bacteria | 2096 |
| 1074 | Ga0316593_10028372 | 3300032168 | Bacteria | 1804 |
| 1075 | Ga0316593_10158812 | 3300032168 | Bacteria | 825 |
| 1076 | Ga0316593_10316334 | 3300032168 | Bacteria | 593 |
| 1077 | Ga0316593_10329705 | 3300032168 | Unclassified | 581 |
| 1078 | Ga0316592_1024201 | 3300033524 | Bacteria | 1306 |
| 1079 | Ga0316588_1007611 | 3300033528 | Bacteria | 2203 |
| 1080 | Ga0316588_1018568 | 3300033528 | Bacteria | 1559 |
| 1081 | Ga0316588_1040523 | 3300033528 | Bacteria | 1113 |
| 1082 | Ga0316588_1051023 | 3300033528 | Bacteria | 1003 |
| 1083 | Ga0316588_1067069 | 3300033528 | Bacteria | 879 |
| 1084 | Ga0316588_1067880 | 3300033528 | Bacteria | 874 |
| 1085 | Ga0316588_1088459 | 3300033528 | Bacteria | 771 |
| 1086 | Ga0316588_1105398 | 3300033528 | Bacteria | 707 |
| 1087 | Ga0316596_1000493 | 3300033541 | Bacteria | 6704 |
| 1088 | Ga0316596_1070869 | 3300033541 | Bacteria | 933 |
| 1089 | Ga0316596_1169994 | 3300033541 | Bacteria | 602 |
| 1090 | Ga0373930_0030179 | 3300034816 | Bacteria | 1112 |
| 1091 | Ga0373948_0130321 | 3300034817 | Bacteria | 615 |
| 1092 | Ga0373948_0132447 | 3300034817 | Bacteria | 611 |
| 1093 | Ga0373958_0009873 | 3300034819 | Bacteria | 1581 |
| 1094 | Ga0373959_0134078 | 3300034820 | Bacteria | 615 |
| 1095 | Ga0373938_0175085 | 3300034957 | Bacteria | 583 |
| 1096 | Ga0373926_0001122 | 3300035083 | Bacteria | 7940 |
| 1097 | Ga0373926_0009400 | 3300035083 | Bacteria | 3269 |
| 1098 | Ga0373926_0258941 | 3300035083 | Bacteria | 675 |
| 1099 | Ga0373929_0094499 | 3300035085 | Bacteria | 746 |
| 1100 | Ga0373934_0104707 | 3300035086 | Bacteria | 1145 |
| 1101 | Ga0373940_0187565 | 3300035088 | Bacteria | 675 |
| 1102 | Ga0373944_0057907 | 3300035089 | Bacteria | 1236 |
| 1103 | Ga0373944_0244742 | 3300035089 | Bacteria | 660 |
| 1104 | Ga0373951_0113679 | 3300035091 | Bacteria | 731 |
| 1105 | Ga0373952_0180221 | 3300035092 | Bacteria | 609 |
| 1106 | Ga0373923_0053759 | 3300035111 | Bacteria | 1694 |
| 1107 | Ga0373923_0090832 | 3300035111 | Bacteria | 1336 |
| 1108 | Ga0373923_0385065 | 3300035111 | Bacteria | 673 |
| 1109 | Ga0373923_0433015 | 3300035111 | Bacteria | 636 |
| 1110 | Ga0373932_0274730 | 3300035112 | Bacteria | 622 |
| 1111 | Ga0373936_0037210 | 3300035113 | Bacteria | 1943 |
| 1112 | Ga0373936_0205470 | 3300035113 | Bacteria | 870 |
| 1113 | Ga0373936_0418617 | 3300035113 | Bacteria | 617 |
| 1114 | Ga0373939_0122999 | 3300035114 | Bacteria | 918 |
| 1115 | Ga0373941_0115498 | 3300035115 | Bacteria | 951 |
| 1116 | Ga0373941_0205636 | 3300035115 | Bacteria | 750 |
| 1117 | Ga0373945_0018377 | 3300035116 | Bacteria | 2378 |
| 1118 | Ga0373945_0062158 | 3300035116 | Bacteria | 1396 |
| 1119 | Ga0373953_0002723 | 3300035117 | Bacteria | 5364 |
| 1120 | Ga0373953_0086762 | 3300035117 | Bacteria | 1306 |
| 1121 | Ga0373953_0118381 | 3300035117 | Bacteria | 1124 |
| 1122 | Ga0373954_0014604 | 3300035118 | Bacteria | 3502 |
| 1123 | Ga0373954_0156125 | 3300035118 | Bacteria | 1116 |
| 1124 | Ga0373954_0163207 | 3300035118 | Bacteria | 1090 |
| 1125 | Ga0373954_0522548 | 3300035118 | Bacteria | 588 |
| 1126 | Ga0373956_0009506 | 3300035119 | Bacteria | 3958 |
| 1127 | Ga0373956_0010739 | 3300035119 | Bacteria | 3760 |
| 1128 | Ga0373956_0108665 | 3300035119 | Bacteria | 1290 |
| 1129 | Ga0373957_0057958 | 3300035120 | Bacteria | 1495 |
| 1130 | Ga0373957_0117503 | 3300035120 | Bacteria | 1075 |
| 1131 | Ga0373957_0154822 | 3300035120 | Bacteria | 942 |
| 1132 | Ga0373960_0231198 | 3300035121 | Bacteria | 665 |
| 1133 | Ga0373943_0011073 | 3300035170 | Bacteria | 4051 |
| 1134 | Ga0373943_0367741 | 3300035170 | Bacteria | 826 |
| 1135 | Ga0373955_0013590 | 3300035172 | Bacteria | 3940 |
| 1136 | Ga0373955_0037811 | 3300035172 | Bacteria | 2568 |
| 1137 | Ga0373955_0058171 | 3300035172 | Bacteria | 2126 |
| 1138 | Ga0373955_0109033 | 3300035172 | Bacteria | 1599 |
| 1139 | Ga0373955_0327525 | 3300035172 | Bacteria | 926 |
| 1140 | Ga0373955_0345873 | 3300035172 | Bacteria | 900 |
| 1141 | Ga0373942_0347133 | 3300035207 | Bacteria | 524 |
| 1142 | Ga0373961_0135251 | 3300035241 | Bacteria | 829 |
| 1143 | Ga0373961_0146509 | 3300035241 | Bacteria | 801 |
| 1144 | Ga0373961_0257992 | 3300035241 | Bacteria | 633 |
| 1145 | Ga0316574_0001004 | 3300035398 | Bacteria | 12720 |
| 1146 | Ga0316574_0022880 | 3300035398 | Bacteria | 3726 |
| 1147 | Ga0316574_0047770 | 3300035398 | Bacteria | 2658 |
| 1148 | Ga0316574_0109331 | 3300035398 | Bacteria | 1772 |
| 1149 | Ga0316574_0140482 | 3300035398 | Bacteria | 1556 |
| 1150 | Ga0316574_0143803 | 3300035398 | Bacteria | 1537 |
| 1151 | Ga0316574_0161536 | 3300035398 | Bacteria | 1443 |
| 1152 | Ga0316574_0833998 | 3300035398 | Bacteria | 560 |
| 1153 | Ga0373924_0126646 | 3300035410 | Bacteria | 1110 |
| 1154 | Ga0373931_0136727 | 3300035691 | Bacteria | 1415 |
| 1155 | Ga0373931_0260324 | 3300035691 | Unclassified | 1058 |
| 1156 | Ga0373931_0303750 | 3300035691 | Bacteria | 986 |
| 1157 | Ga0373931_1274424 | 3300035691 | Bacteria | 505 |
| 1158 | Ga0373935_0051065 | 3300035692 | Bacteria | 2625 |
| 1159 | Ga0373935_0075929 | 3300035692 | Bacteria | 2175 |
| 1160 | Ga0373927_0004438 | 3300035695 | Bacteria | 9831 |
| 1161 | Ga0373927_0005589 | 3300035695 | Bacteria | 8642 |
| 1162 | Ga0373927_0161417 | 3300035695 | Bacteria | 1468 |
| 1163 | Ga0373927_0625416 | 3300035695 | Bacteria | 712 |
| 1164 | Ga0373927_1096771 | 3300035695 | Bacteria | 525 |
| 1165 | Ga0373933_0294661 | 3300035724 | Bacteria | 1050 |
| 1166 | Ga0373933_0373450 | 3300035724 | Bacteria | 928 |
| 1167 | Ga0373947_0007919 | 3300035725 | Bacteria | 6127 |
| 1168 | Ga0373947_0013676 | 3300035725 | Bacteria | 4650 |
| 1169 | Ga0373947_0114040 | 3300035725 | Bacteria | 1711 |
| 1170 | Ga0373947_0223935 | 3300035725 | Bacteria | 1237 |
| 1171 | Ga0373947_0256443 | 3300035725 | Bacteria | 1158 |
| 1172 | Ga0373947_0783854 | 3300035725 | Bacteria | 651 |
| 1173 | Ga0373947_0992452 | 3300035725 | Unclassified | 573 |
| 1174 | Ga0373937_0007252 | 3300036401 | Bacteria | 9594 |
| 1175 | Ga0373937_0025601 | 3300036401 | Bacteria | 5328 |
| 1176 | Ga0373937_0030240 | 3300036401 | Bacteria | 4905 |
| 1177 | Ga0373937_0056404 | 3300036401 | Bacteria | 3608 |
| 1178 | Ga0373937_0076114 | 3300036401 | Bacteria | 3099 |
| 1179 | Ga0373937_0113979 | 3300036401 | Bacteria | 2516 |
| 1180 | Ga0373937_0171110 | 3300036401 | Bacteria | 2038 |
| 1181 | Ga0373937_0431917 | 3300036401 | Bacteria | 1250 |
| 1182 | Ga0373937_0866335 | 3300036401 | Unclassified | 852 |
| 1183 | Ga0373937_1848163 | 3300036401 | Bacteria | 550 |
| 1184 | Ga0373937_2066069 | 3300036401 | Bacteria | 516 |
| 1185 | Ga0316582_0200485 | 3300036647 | Bacteria | 1361 |
| 1186 | Ga0316582_0287953 | 3300036647 | Bacteria | 1128 |
| 1187 | Ga0316582_0643517 | 3300036647 | Bacteria | 729 |
| 1188 | Ga0316582_0705715 | 3300036647 | Unclassified | 693 |
| 1189 | Ga0316584_0351874 | 3300036712 | Bacteria | 1058 |
| 1190 | Ga0316584_0358687 | 3300036712 | Unclassified | 1045 |
| 1191 | Ga0316584_0408499 | 3300036712 | Bacteria | 966 |
| 1192 | Ga0316584_0518106 | 3300036712 | Bacteria | 836 |
| 1193 | Ga0316584_0577819 | 3300036712 | Bacteria | 782 |
| 1194 | Ga0316584_0622151 | 3300036712 | Bacteria | 747 |
| 1195 | Ga0316584_0726414 | 3300036712 | Unclassified | 679 |
| 1196 | Ga0316584_0729147 | 3300036712 | Bacteria | 678 |
| 1197 | Ga0316584_0734471 | 3300036712 | Bacteria | 674 |
| 1198 | Ga0373925_0001662 | 3300037068 | Bacteria | 18731 |
| 1199 | Ga0373925_0001788 | 3300037068 | Bacteria | 17923 |
| 1200 | Ga0373925_0094451 | 3300037068 | Bacteria | 2290 |
| 1201 | Ga0373925_0262346 | 3300037068 | Bacteria | 1388 |
| 1202 | Ga0373925_0263319 | 3300037068 | Bacteria | 1385 |
| 1203 | Ga0373925_0554776 | 3300037068 | Unclassified | 945 |
| 1204 | Ga0373925_0872321 | 3300037068 | Bacteria | 742 |
| 1205 | Ga0395899_0173762 | 3300037312 | Bacteria | 1516 |
| 1206 | Ga0395900_0018609 | 3300037418 | Bacteria | 7084 |
| 1207 | Ga0395900_0954656 | 3300037418 | Bacteria | 779 |
| 1208 | Ga0395900_1480901 | 3300037418 | Unclassified | 591 |
| 1209 | Ga0395900_1668877 | 3300037418 | Bacteria | 548 |
| 1210 | Ga0395898_0564374 | 3300037466 | Bacteria | 1081 |
| 1211 | Ga0395905_0000275 | 3300037471 | Bacteria | 76114 |
| 1212 | Ga0395905_0001744 | 3300037471 | Bacteria | 25404 |
| 1213 | Ga0395905_0082831 | 3300037471 | Bacteria | 3006 |
| 1214 | Ga0395905_0369455 | 3300037471 | Bacteria | 1328 |
| 1215 | Ga0395905_0877384 | 3300037471 | Unclassified | 800 |
| 1216 | Ga0316581_0013010 | 3300037588 | Bacteria | 2354 |
| 1217 | Ga0395901_0113158 | 3300038443 | Bacteria | 2850 |
| 1218 | Ga0400490_17491 | 3300038726 | Bacteria | 28094 |
| 1219 | Ga0400491_12215 | 3300038727 | Bacteria | 7556 |
| 1220 | Ga0400483_126972 | 3300039062 | Bacteria | 3049 |
| 1221 | Ga0400483_247471 | 3300039062 | Bacteria | 2928 |
| 1222 | Ga0400489_10986 | 3300039093 | Bacteria | 1435 |
| 1223 | Ga0400489_86969 | 3300039093 | Bacteria | 10581 |
| 1224 | Ga0436365_0154164 | 3300039437 | Bacteria | 11061 |
| 1225 | Ga0436365_1563210 | 3300039437 | Bacteria | 4201 |
| 1226 | Ga0436365_1839659 | 3300039437 | Bacteria | 4011 |
| 1227 | Ga0436365_1927449 | 3300039437 | Bacteria | 710 |
| 1228 | Ga0436360_0080201 | 3300039438 | Bacteria | 942 |
| 1229 | Ga0436360_0406311 | 3300039438 | Bacteria | 1003 |
| 1230 | Ga0436363_0576030 | 3300039450 | Bacteria | 1107 |
| 1231 | Ga0436363_1475130 | 3300039450 | Bacteria | 615 |
| 1232 | Ga0436362_0225975 | 3300039453 | Bacteria | 2143 |
| 1233 | Ga0436362_1063276 | 3300039453 | Bacteria | 20265 |
| 1234 | Ga0436362_1069013 | 3300039453 | Bacteria | 90804 |
| 1235 | Ga0439461_0064471 | 3300041410 | Bacteria | 838 |
| 1236 | Ga0451793_0687095 | 3300041452 | Unclassified | 1134 |
| 1237 | Ga0451795_0060284 | 3300041456 | Bacteria | 1073 |
| 1238 | Ga0451839_0487727 | 3300041496 | Bacteria | 1989 |
| 1239 | Ga0451851_0850392 | 3300041507 | Bacteria | 930 |
| 1240 | Ga0439433_0112274 | 3300041999 | Bacteria | 683 |
| 1241 | Ga0439451_125562 | 3300042009 | Bacteria | 523 |
| 1242 | Ga0439444_0094397 | 3300042437 | Bacteria | 671 |
| 1243 | Ga0451577_0008700 | 3300042876 | Bacteria | 9846 |
| 1244 | Ga0451577_0012592 | 3300042876 | Bacteria | 7940 |
| 1245 | Ga0451577_0016347 | 3300042876 | Bacteria | 6875 |
| 1246 | Ga0451577_0033756 | 3300042876 | Bacteria | 4614 |
| 1247 | Ga0451577_0134048 | 3300042876 | Bacteria | 2223 |
| 1248 | Ga0451577_0161269 | 3300042876 | Bacteria | 2019 |
| 1249 | Ga0451577_0317597 | 3300042876 | Bacteria | 1412 |
| 1250 | Ga0451577_1403892 | 3300042876 | Bacteria | 619 |
| 1251 | Ga0439440_0013796 | 3300042993 | Bacteria | 1738 |
| 1252 | Ga0453683_0000086 | 3300044673 | Bacteria | 139689 |
| 1253 | Ga0453683_0008784 | 3300044673 | Bacteria | 6768 |
| 1254 | Ga0453683_0054837 | 3300044673 | Bacteria | 2495 |
| 1255 | Ga0453683_0055812 | 3300044673 | Bacteria | 2472 |
| 1256 | Ga0453683_0122574 | 3300044673 | Bacteria | 1637 |
| 1257 | Ga0453683_0216829 | 3300044673 | Bacteria | 1216 |
| 1258 | Ga0466965_0436268 | 3300044683 | Bacteria | 728 |
| 1259 | Ga0453684_0001061 | 3300044712 | Bacteria | 87486 |
| 1260 | Ga0453684_0001518 | 3300044712 | Bacteria | 65070 |
| 1261 | Ga0453684_0006427 | 3300044712 | Bacteria | 22339 |
| 1262 | Ga0453684_0008349 | 3300044712 | Bacteria | 18610 |
| 1263 | Ga0453684_0011806 | 3300044712 | Bacteria | 14554 |
| 1264 | Ga0453684_0019106 | 3300044712 | Bacteria | 10459 |
| 1265 | Ga0453684_0019836 | 3300044712 | Bacteria | 10199 |
| 1266 | Ga0453684_0020573 | 3300044712 | Bacteria | 9941 |
| 1267 | Ga0453684_0033355 | 3300044712 | Bacteria | 7181 |
| 1268 | Ga0453684_0037288 | 3300044712 | Bacteria | 6674 |
| 1269 | Ga0453684_0042819 | 3300044712 | Bacteria | 6096 |
| 1270 | Ga0453684_0044000 | 3300044712 | Bacteria | 5986 |
| 1271 | Ga0453684_0048627 | 3300044712 | Bacteria | 5603 |
| 1272 | Ga0453684_0060385 | 3300044712 | Bacteria | 4877 |
| 1273 | Ga0453684_0062580 | 3300044712 | Bacteria | 4765 |
| 1274 | Ga0453684_0075363 | 3300044712 | Bacteria | 4241 |
| 1275 | Ga0453684_0090894 | 3300044712 | Bacteria | 3771 |
| 1276 | Ga0453684_0111000 | 3300044712 | Bacteria | 3332 |
| 1277 | Ga0453684_0240329 | 3300044712 | Bacteria | 2085 |
| 1278 | Ga0453684_0373414 | 3300044712 | Bacteria | 1603 |
| 1279 | Ga0453684_0646837 | 3300044712 | Bacteria | 1154 |
| 1280 | Ga0453684_1257000 | 3300044712 | Bacteria | 774 |
| 1281 | Ga0453684_1813505 | 3300044712 | Bacteria | 620 |
| 1282 | Ga0451576_0004083 | 3300045051 | Bacteria | 19291 |
| 1283 | Ga0451576_0005300 | 3300045051 | Bacteria | 16207 |
| 1284 | Ga0451576_0019582 | 3300045051 | Bacteria | 7386 |
| 1285 | Ga0451576_0093519 | 3300045051 | Bacteria | 3126 |
| 1286 | Ga0451576_0129629 | 3300045051 | Bacteria | 2629 |
| 1287 | Ga0451576_0137895 | 3300045051 | Bacteria | 2544 |
| 1288 | Ga0451576_0196516 | 3300045051 | Bacteria | 2107 |
| 1289 | Ga0451576_0213585 | 3300045051 | Bacteria | 2015 |
| 1290 | Ga0451576_0215670 | 3300045051 | Bacteria | 2004 |
| 1291 | Ga0451576_0312134 | 3300045051 | Bacteria | 1645 |
| 1292 | Ga0451576_0499547 | 3300045051 | Bacteria | 1278 |
| 1293 | Ga0451576_0648915 | 3300045051 | Bacteria | 1109 |
| 1294 | Ga0451576_0682098 | 3300045051 | Bacteria | 1079 |
| 1295 | Ga0451576_1292499 | 3300045051 | Bacteria | 761 |
| 1296 | Ga0451576_2130053 | 3300045051 | Bacteria | 576 |
| 1297 | Ga0466967_0445372 | 3300045976 | Bacteria | 1265 |
| 1298 | Ga0466967_0955867 | 3300045976 | Bacteria | 853 |
| 1299 | Ga0495617_143473 | 3300046452 | Bacteria | 762 |
| 1300 | Ga0495592_0161903 | 3300046454 | Bacteria | 1539 |
| 1301 | Ga0495603_0016598 | 3300046455 | Bacteria | 4455 |
| 1302 | Ga0495603_0334793 | 3300046455 | Bacteria | 869 |
| 1303 | Ga0495629_0007707 | 3300046459 | Bacteria | 7921 |
| 1304 | Ga0495629_0016479 | 3300046459 | Bacteria | 5304 |
| 1305 | Ga0495629_0184529 | 3300046459 | Bacteria | 1445 |
| 1306 | Ga0495629_0419104 | 3300046459 | Bacteria | 909 |
| 1307 | Ga0495641_0041758 | 3300046461 | Bacteria | 2129 |
| 1308 | Ga0495641_0047852 | 3300046461 | Bacteria | 1962 |
| 1309 | Ga0495641_0125788 | 3300046461 | Bacteria | 1144 |
| 1310 | Ga0495641_0141431 | 3300046461 | Bacteria | 1075 |
| 1311 | Ga0495651_0042906 | 3300046462 | Bacteria | 3510 |
| 1312 | Ga0495651_0481615 | 3300046462 | Bacteria | 797 |
| 1313 | Ga0495651_0597215 | 3300046462 | Bacteria | 697 |
| 1314 | Ga0495580_0001448 | 3300046472 | Bacteria | 20804 |
| 1315 | Ga0495580_0002827 | 3300046472 | Bacteria | 14922 |
| 1316 | Ga0495580_0005582 | 3300046472 | Bacteria | 10367 |
| 1317 | Ga0495580_0012791 | 3300046472 | Bacteria | 6432 |
| 1318 | Ga0495580_0050436 | 3300046472 | Bacteria | 2943 |
| 1319 | Ga0495580_0057891 | 3300046472 | Bacteria | 2727 |
| 1320 | Ga0495580_0080283 | 3300046472 | Bacteria | 2274 |
| 1321 | Ga0495580_0121196 | 3300046472 | Bacteria | 1816 |
| 1322 | Ga0495580_0125962 | 3300046472 | Bacteria | 1778 |
| 1323 | Ga0495580_0261064 | 3300046472 | Bacteria | 1185 |
| 1324 | Ga0495580_0411869 | 3300046472 | Bacteria | 910 |
| 1325 | Ga0495580_0584354 | 3300046472 | Unclassified | 739 |
| 1326 | Ga0495580_0654197 | 3300046472 | Bacteria | 691 |
| 1327 | Ga0495580_0921904 | 3300046472 | Unclassified | 560 |
| 1328 | Ga0495582_0000113 | 3300046473 | Bacteria | 42436 |
| 1329 | Ga0495582_0026338 | 3300046473 | Bacteria | 3187 |
| 1330 | Ga0495582_0079298 | 3300046473 | Bacteria | 1822 |
| 1331 | Ga0495582_0295889 | 3300046473 | Bacteria | 930 |
| 1332 | Ga0495582_0417230 | 3300046473 | Bacteria | 774 |
| 1333 | Ga0495639_0020227 | 3300046475 | Bacteria | 2908 |
| 1334 | Ga0495639_0122966 | 3300046475 | Bacteria | 1239 |
| 1335 | Ga0495662_0522177 | 3300046476 | Bacteria | 582 |
| 1336 | Ga0495664_0005945 | 3300046477 | Bacteria | 6720 |
| 1337 | Ga0495584_0399912 | 3300046491 | Bacteria | 698 |
| 1338 | Ga0495585_0380470 | 3300046492 | Bacteria | 682 |
| 1339 | Ga0495585_0494208 | 3300046492 | Bacteria | 582 |
| 1340 | Ga0495594_0021611 | 3300046499 | Bacteria | 3435 |
| 1341 | Ga0495594_0076463 | 3300046499 | Bacteria | 1867 |
| 1342 | Ga0495594_0452844 | 3300046499 | Bacteria | 730 |
| 1343 | Ga0495616_0235832 | 3300046513 | Bacteria | 791 |
| 1344 | Ga0495618_0033948 | 3300046514 | Bacteria | 3199 |
| 1345 | Ga0495618_0047295 | 3300046514 | Bacteria | 2716 |
| 1346 | Ga0495618_0179620 | 3300046514 | Bacteria | 1345 |
| 1347 | Ga0495618_0346716 | 3300046514 | Bacteria | 916 |
| 1348 | Ga0495628_0268257 | 3300046516 | Bacteria | 1270 |
| 1349 | Ga0495628_0573546 | 3300046516 | Bacteria | 808 |
| 1350 | Ga0495630_0003551 | 3300046517 | Bacteria | 10859 |
| 1351 | Ga0495630_0016248 | 3300046517 | Bacteria | 5437 |
| 1352 | Ga0495630_0019992 | 3300046517 | Bacteria | 4930 |
| 1353 | Ga0495630_0776267 | 3300046517 | Bacteria | 732 |
| 1354 | Ga0495630_0982529 | 3300046517 | Unclassified | 642 |
| 1355 | Ga0495666_0137734 | 3300046526 | Bacteria | 1139 |
| 1356 | Ga0495666_0195179 | 3300046526 | Bacteria | 932 |
| 1357 | Ga0495666_0326231 | 3300046526 | Bacteria | 693 |
| 1358 | Ga0495666_0333159 | 3300046526 | Bacteria | 684 |
| 1359 | Ga0495642_0362330 | 3300046528 | Bacteria | 638 |
| 1360 | Ga0495652_0354639 | 3300046529 | Bacteria | 1050 |
| 1361 | Ga0495652_0384663 | 3300046529 | Bacteria | 997 |
| 1362 | Ga0495665_0017070 | 3300046531 | Bacteria | 3905 |
| 1363 | Ga0495665_0038759 | 3300046531 | Bacteria | 2540 |
| 1364 | Ga0495665_0105049 | 3300046531 | Bacteria | 1482 |
| 1365 | Ga0495665_0695753 | 3300046531 | Bacteria | 504 |
| 1366 | Ga0495640_0084228 | 3300046533 | Bacteria | 2109 |
| 1367 | Ga0495640_0194210 | 3300046533 | Bacteria | 1289 |
| 1368 | Ga0495640_0739393 | 3300046533 | Bacteria | 589 |
| 1369 | Ga0495586_0003305 | 3300046535 | Bacteria | 8648 |
| 1370 | Ga0495586_0031142 | 3300046535 | Bacteria | 2856 |
| 1371 | Ga0495586_0031189 | 3300046535 | Bacteria | 2853 |
| 1372 | Ga0495586_0047729 | 3300046535 | Bacteria | 2312 |
| 1373 | Ga0495587_0002355 | 3300046536 | Bacteria | 12626 |
| 1374 | Ga0495587_0019640 | 3300046536 | Bacteria | 4180 |
| 1375 | Ga0495587_0213134 | 3300046536 | Bacteria | 1090 |
| 1376 | Ga0495598_0017282 | 3300046537 | Bacteria | 1857 |
| 1377 | Ga0495645_0630048 | 3300046543 | Bacteria | 657 |
| 1378 | Ga0495645_0654462 | 3300046543 | Bacteria | 641 |
| 1379 | Ga0495622_0267752 | 3300046557 | Bacteria | 749 |
| 1380 | Ga0495633_0069411 | 3300046558 | Bacteria | 1645 |
| 1381 | Ga0495656_0000397 | 3300046615 | Bacteria | 14422 |
| 1382 | Ga0495656_0517719 | 3300046615 | Bacteria | 634 |
| 1383 | Ga0495656_0726992 | 3300046615 | Unclassified | 535 |
| 1384 | Ga0495668_0770055 | 3300046616 | Bacteria | 533 |
| 1385 | Ga0495634_0000649 | 3300046642 | Bacteria | 33746 |
| 1386 | Ga0495634_0165167 | 3300046642 | Bacteria | 1394 |
| 1387 | Ga0495635_0069638 | 3300046663 | Bacteria | 2412 |
| 1388 | Ga0495588_0457836 | 3300046674 | Bacteria | 669 |
| 1389 | Ga0495657_0158952 | 3300046675 | Bacteria | 1399 |
| 1390 | Ga0495657_0273279 | 3300046675 | Unclassified | 1013 |
| 1391 | Ga0495657_0274523 | 3300046675 | Bacteria | 1010 |
| 1392 | Ga0495657_0444406 | 3300046675 | Bacteria | 760 |
| 1393 | Ga0495623_0095320 | 3300046679 | Bacteria | 1819 |
| 1394 | Ga0495647_0004304 | 3300046681 | Bacteria | 4612 |
| 1395 | Ga0495647_0006082 | 3300046681 | Bacteria | 3979 |
| 1396 | Ga0495647_0007570 | 3300046681 | Bacteria | 3644 |
| 1397 | Ga0495647_0040084 | 3300046681 | Bacteria | 1778 |
| 1398 | Ga0495647_0249323 | 3300046681 | Bacteria | 790 |
| 1399 | Ga0495647_0452968 | 3300046681 | Bacteria | 594 |
| 1400 | Ga0495658_0017882 | 3300046683 | Bacteria | 3674 |
| 1401 | Ga0495658_0028263 | 3300046683 | Bacteria | 3025 |
| 1402 | Ga0495658_0056441 | 3300046683 | Bacteria | 2240 |
| 1403 | Ga0495658_0189652 | 3300046683 | Bacteria | 1277 |
| 1404 | Ga0495669_0106398 | 3300046684 | Bacteria | 1307 |
| 1405 | Ga0495669_0505155 | 3300046684 | Bacteria | 588 |
| 1406 | Ga0495613_0042407 | 3300046689 | Bacteria | 3367 |
| 1407 | Ga0495613_0095480 | 3300046689 | Bacteria | 2150 |
| 1408 | Ga0495613_0642490 | 3300046689 | Bacteria | 703 |
| 1409 | Ga0495624_0023361 | 3300046690 | Bacteria | 4078 |
| 1410 | Ga0495670_0019811 | 3300046691 | Bacteria | 3315 |
| 1411 | Ga0495670_0731190 | 3300046691 | Unclassified | 540 |
| 1412 | Ga0495589_0432283 | 3300046794 | Bacteria | 603 |
| 1413 | Ga0495600_0047423 | 3300046809 | Bacteria | 2802 |
| 1414 | Ga0495600_0361141 | 3300046809 | Bacteria | 908 |
| 1415 | Ga0495581_0208241 | 3300047315 | Bacteria | 1144 |
| 1416 | Ga0495581_0262135 | 3300047315 | Bacteria | 1010 |
| 1417 | Ga0495604_0039896 | 3300047317 | Bacteria | 3689 |
| 1418 | Ga0495604_0368503 | 3300047317 | Bacteria | 951 |
| 1419 | Ga0495604_0595068 | 3300047317 | Bacteria | 710 |
| 1420 | Ga0495604_0776194 | 3300047317 | Bacteria | 605 |
| 1421 | Ga0495636_0000893 | 3300047318 | Bacteria | 11074 |
| 1422 | Ga0495636_0044847 | 3300047318 | Bacteria | 1842 |
| 1423 | Ga0495636_0175385 | 3300047318 | Bacteria | 971 |
| 1424 | Ga0495636_0273477 | 3300047318 | Bacteria | 785 |
| 1425 | Ga0495674_0001336 | 3300047319 | Bacteria | 24042 |
| 1426 | Ga0495674_0036483 | 3300047319 | Bacteria | 4424 |
| 1427 | Ga0495674_0094633 | 3300047319 | Bacteria | 2548 |
| 1428 | Ga0495674_0202418 | 3300047319 | Bacteria | 1646 |
| 1429 | Ga0495674_0835104 | 3300047319 | Bacteria | 715 |
| 1430 | Ga0495676_0030282 | 3300047321 | Bacteria | 4597 |
| 1431 | Ga0495676_0588623 | 3300047321 | Bacteria | 725 |
| 1432 | Ga0495680_0202098 | 3300047322 | Bacteria | 1425 |
| 1433 | Ga0495680_0378620 | 3300047322 | Bacteria | 981 |
| 1434 | Ga0495680_1005008 | 3300047322 | Bacteria | 533 |
| 1435 | Ga0495675_0068217 | 3300047444 | Bacteria | 2247 |
| 1436 | Ga0495679_007316 | 3300047446 | Bacteria | 4617 |
| 1437 | Ga0495684_0026659 | 3300047471 | Bacteria | 4441 |
| 1438 | Ga0495684_0054352 | 3300047471 | Bacteria | 3054 |
| 1439 | Ga0495684_0078814 | 3300047471 | Bacteria | 2500 |
| 1440 | Ga0495684_0231057 | 3300047471 | Bacteria | 1353 |
| 1441 | Ga0495684_0260054 | 3300047471 | Bacteria | 1259 |
| 1442 | Ga0495593_0078777 | 3300047673 | Bacteria | 1706 |
| 1443 | Ga0495593_0252399 | 3300047673 | Bacteria | 883 |
| 1444 | Ga0495602_0017278 | 3300048088 | Bacteria | 7234 |
| 1445 | Ga0495602_0227086 | 3300048088 | Bacteria | 1405 |
| 1446 | Ga0495614_0010953 | 3300048089 | Bacteria | 3991 |
| 1447 | Ga0495614_0069510 | 3300048089 | Bacteria | 1517 |
| 1448 | Ga0495615_0003089 | 3300048090 | Bacteria | 2754 |
| 1449 | Ga0496100_0003660 | 3300048903 | Bacteria | 8042 |
| 1450 | Ga0496100_0017930 | 3300048903 | Bacteria | 4189 |
| 1451 | Ga0496100_0998411 | 3300048903 | Bacteria | 659 |
| 1452 | Ga0496101_0025125 | 3300048904 | Bacteria | 4129 |
| 1453 | Ga0496101_0179518 | 3300048904 | Bacteria | 1630 |
| 1454 | Ga0496101_0523564 | 3300048904 | Bacteria | 937 |
| 1455 | Ga0496101_0666373 | 3300048904 | Bacteria | 822 |
| 1456 | Ga0496101_0925184 | 3300048904 | Bacteria | 686 |
| 1457 | Ga0496102_0000916 | 3300048905 | Bacteria | 27806 |
| 1458 | Ga0496102_0003028 | 3300048905 | Bacteria | 14227 |
| 1459 | Ga0496102_0018905 | 3300048905 | Bacteria | 6062 |
| 1460 | Ga0496102_0035581 | 3300048905 | Bacteria | 4483 |
| 1461 | Ga0496102_0146115 | 3300048905 | Bacteria | 2219 |
| 1462 | Ga0496102_0766183 | 3300048905 | Bacteria | 888 |
| 1463 | Ga0496103_0030082 | 3300048906 | Bacteria | 3303 |
| 1464 | Ga0496104_0028984 | 3300048907 | Bacteria | 5133 |
| 1465 | Ga0496104_0036226 | 3300048907 | Bacteria | 4612 |
| 1466 | Ga0496104_0103951 | 3300048907 | Bacteria | 2721 |
| 1467 | Ga0496104_0107857 | 3300048907 | Bacteria | 2668 |
| 1468 | Ga0496104_0322079 | 3300048907 | Bacteria | 1459 |
| 1469 | Ga0496104_0351967 | 3300048907 | Bacteria | 1386 |
| 1470 | Ga0496104_0370528 | 3300048907 | Bacteria | 1345 |
| 1471 | Ga0496105_0078298 | 3300048908 | Bacteria | 2730 |
| 1472 | Ga0496105_0139233 | 3300048908 | Bacteria | 1998 |
| 1473 | Ga0496105_0166096 | 3300048908 | Bacteria | 1811 |
| 1474 | Ga0496105_0213217 | 3300048908 | Bacteria | 1573 |
| 1475 | Ga0496105_0524359 | 3300048908 | Bacteria | 927 |
| 1476 | Ga0496105_0684031 | 3300048908 | Bacteria | 789 |
| 1477 | Ga0496106_0003518 | 3300048909 | Bacteria | 11675 |
| 1478 | Ga0496106_0030306 | 3300048909 | Bacteria | 4035 |
| 1479 | Ga0496106_0087377 | 3300048909 | Bacteria | 2402 |
| 1480 | Ga0496106_0283939 | 3300048909 | Bacteria | 1326 |
| 1481 | Ga0496106_0970159 | 3300048909 | Bacteria | 669 |
| 1482 | Ga0496106_1362863 | 3300048909 | Bacteria | 549 |
| 1483 | Ga0496107_0000796 | 3300048910 | Bacteria | 18296 |
| 1484 | Ga0496107_0067376 | 3300048910 | Bacteria | 2597 |
| 1485 | Ga0496107_0933349 | 3300048910 | Bacteria | 632 |
| 1486 | Ga0496108_0032489 | 3300048911 | Bacteria | 4335 |
| 1487 | Ga0496108_0124186 | 3300048911 | Bacteria | 2215 |
| 1488 | Ga0496108_0286001 | 3300048911 | Bacteria | 1435 |
| 1489 | Ga0496108_0482416 | 3300048911 | Bacteria | 1083 |
| 1490 | Ga0496108_0767720 | 3300048911 | Bacteria | 833 |
| 1491 | Ga0496108_1634796 | 3300048911 | Bacteria | 532 |
| 1492 | Ga0496109_0060025 | 3300048912 | Bacteria | 3475 |
| 1493 | Ga0496109_0087350 | 3300048912 | Bacteria | 2880 |
| 1494 | Ga0496109_0404303 | 3300048912 | Bacteria | 1290 |
| 1495 | Ga0496109_1425728 | 3300048912 | Bacteria | 628 |
| 1496 | Ga0496110_0000091 | 3300048913 | Bacteria | 48115 |
| 1497 | Ga0496110_0004643 | 3300048913 | Bacteria | 10677 |
| 1498 | Ga0496110_0023793 | 3300048913 | Bacteria | 5213 |
| 1499 | Ga0496110_0286750 | 3300048913 | Bacteria | 1499 |
| 1500 | Ga0496110_0587594 | 3300048913 | Bacteria | 1011 |
| 1501 | Ga0496111_0016892 | 3300048914 | Bacteria | 5037 |
| 1502 | Ga0496111_0048928 | 3300048914 | Bacteria | 3048 |
| 1503 | Ga0496111_0225915 | 3300048914 | Bacteria | 1391 |
| 1504 | Ga0496111_0375322 | 3300048914 | Bacteria | 1052 |
| 1505 | Ga0496111_1316029 | 3300048914 | Bacteria | 509 |
| 1506 | Ga0496112_0030222 | 3300048915 | Bacteria | 5242 |
| 1507 | Ga0496112_0356812 | 3300048915 | Bacteria | 1404 |
| 1508 | Ga0496112_0663177 | 3300048915 | Bacteria | 972 |
| 1509 | Ga0496112_0773487 | 3300048915 | Bacteria | 886 |
| 1510 | Ga0496112_1465119 | 3300048915 | Bacteria | 597 |
| 1511 | Ga0496113_0021257 | 3300048916 | Bacteria | 4575 |
| 1512 | Ga0496113_0648146 | 3300048916 | Bacteria | 845 |
| 1513 | Ga0496113_0732631 | 3300048916 | Bacteria | 788 |
| 1514 | Ga0496113_0902278 | 3300048916 | Bacteria | 699 |
| 1515 | Ga0496114_0000386 | 3300048917 | Bacteria | 32590 |
| 1516 | Ga0496114_0001141 | 3300048917 | Bacteria | 20073 |
| 1517 | Ga0496114_0004194 | 3300048917 | Bacteria | 11164 |
| 1518 | Ga0496114_0006073 | 3300048917 | Bacteria | 9506 |
| 1519 | Ga0496114_0230229 | 3300048917 | Bacteria | 1628 |
| 1520 | Ga0496114_0320615 | 3300048917 | Bacteria | 1369 |
| 1521 | Ga0496114_0353784 | 3300048917 | Bacteria | 1299 |
| 1522 | Ga0496114_0778035 | 3300048917 | Bacteria | 835 |
| 1523 | Ga0496115_0006616 | 3300048918 | Bacteria | 8497 |
| 1524 | Ga0496115_0047334 | 3300048918 | Bacteria | 3439 |
| 1525 | Ga0496115_0059367 | 3300048918 | Bacteria | 3080 |
| 1526 | Ga0496115_0389278 | 3300048918 | Bacteria | 1132 |
| 1527 | Ga0496115_0443708 | 3300048918 | Bacteria | 1049 |
| 1528 | Ga0496115_0561298 | 3300048918 | Bacteria | 911 |
| 1529 | Ga0496116_0025193 | 3300048919 | Bacteria | 4378 |
| 1530 | Ga0496116_0030225 | 3300048919 | Bacteria | 3895 |
| 1531 | Ga0496117_0001863 | 3300048920 | Bacteria | 28457 |
| 1532 | Ga0496117_0059650 | 3300048920 | Bacteria | 2634 |
| 1533 | Ga0496117_0204017 | 3300048920 | Bacteria | 1115 |
| 1534 | Ga0496122_0008592 | 3300048925 | Bacteria | 10970 |
| 1535 | Ga0496123_0029360 | 3300048926 | Bacteria | 4049 |
| 1536 | Ga0496124_0000001 | 3300048927 | Bacteria | 1747840 |
| 1537 | Ga0496124_0075016 | 3300048927 | Bacteria | 2795 |
| 1538 | Ga0496125_0056825 | 3300048928 | Bacteria | 3174 |
| 1539 | Ga0496125_0384470 | 3300048928 | Bacteria | 826 |
| 1540 | Ga0496126_0096151 | 3300048929 | Bacteria | 2597 |
| 1541 | Ga0496126_0097584 | 3300048929 | Bacteria | 2575 |
| 1542 | Ga0496126_0626774 | 3300048929 | Bacteria | 844 |
| 1543 | Ga0501305_018599 | 3300049161 | Bacteria | 1007 |
| 1544 | Ga0501307_006084 | 3300049162 | Bacteria | 1292 |
| 1545 | Ga0501307_091116 | 3300049162 | Bacteria | 509 |
| 1546 | Ga0501290_028794 | 3300049513 | Bacteria | 788 |
| 1547 | Ga0501298_057336 | 3300049521 | Unclassified | 819 |
| 1548 | Ga0501317_062977 | 3300049533 | Bacteria | 612 |
| 1549 | Ga0501031_0100714 | 3300049568 | Bacteria | 1885 |
| 1550 | Ga0501031_0118379 | 3300049568 | Bacteria | 1731 |
| 1551 | Ga0501032_0175090 | 3300049569 | Bacteria | 1406 |
| 1552 | Ga0501033_0071425 | 3300049570 | Bacteria | 2550 |
| 1553 | Ga0501034_0079903 | 3300049571 | Bacteria | 3274 |
| 1554 | Ga0501034_1384106 | 3300049571 | Bacteria | 579 |
| 1555 | Ga0501036_0014973 | 3300049572 | Bacteria | 6470 |
| 1556 | Ga0501036_0034010 | 3300049572 | Bacteria | 4311 |
| 1557 | Ga0501036_1550544 | 3300049572 | Bacteria | 535 |
| 1558 | Ga0501037_0011186 | 3300049573 | Bacteria | 6604 |
| 1559 | Ga0501037_0700449 | 3300049573 | Bacteria | 674 |
| 1560 | Ga0501038_0000271 | 3300049574 | Bacteria | 43706 |
| 1561 | Ga0501038_0583992 | 3300049574 | Bacteria | 847 |
| 1562 | Ga0501038_0997715 | 3300049574 | Bacteria | 615 |
| 1563 | Ga0501039_0108043 | 3300049575 | Bacteria | 2174 |
| 1564 | Ga0501039_0153331 | 3300049575 | Bacteria | 1810 |
| 1565 | Ga0501039_0306749 | 3300049575 | Bacteria | 1248 |
| 1566 | Ga0501039_0806175 | 3300049575 | Bacteria | 732 |
| 1567 | Ga0501039_0960743 | 3300049575 | Unclassified | 664 |
| 1568 | Ga0501039_1022063 | 3300049575 | Bacteria | 642 |
| 1569 | Ga0501040_0001044 | 3300049576 | Bacteria | 17516 |
| 1570 | Ga0501040_0062391 | 3300049576 | Bacteria | 2564 |
| 1571 | Ga0501040_0088966 | 3300049576 | Bacteria | 2145 |
| 1572 | Ga0501040_0160571 | 3300049576 | Bacteria | 1589 |
| 1573 | Ga0501040_0211230 | 3300049576 | Bacteria | 1380 |
| 1574 | Ga0501040_0230286 | 3300049576 | Bacteria | 1319 |
| 1575 | Ga0501041_0000002 | 3300049577 | Bacteria | 84985 |
| 1576 | Ga0501041_0163295 | 3300049577 | Bacteria | 1393 |
| 1577 | Ga0501042_0000645 | 3300049578 | Bacteria | 18688 |
| 1578 | Ga0501042_0048885 | 3300049578 | Bacteria | 3016 |
| 1579 | Ga0501042_0134671 | 3300049578 | Bacteria | 1781 |
| 1580 | Ga0501043_0085474 | 3300049579 | Bacteria | 2479 |
| 1581 | Ga0501043_0121334 | 3300049579 | Bacteria | 2050 |
| 1582 | Ga0501043_0185513 | 3300049579 | Bacteria | 1620 |
| 1583 | Ga0501046_0051614 | 3300049580 | Bacteria | 3245 |
| 1584 | Ga0501046_0119838 | 3300049580 | Bacteria | 2003 |
| 1585 | Ga0501046_0295744 | 3300049580 | Bacteria | 1183 |
| 1586 | Ga0501046_1237436 | 3300049580 | Bacteria | 512 |
| 1587 | Ga0501047_0468086 | 3300049581 | Bacteria | 1089 |
| 1588 | Ga0501048_0002109 | 3300049582 | Bacteria | 15162 |
| 1589 | Ga0501048_0234505 | 3300049582 | Bacteria | 1302 |
| 1590 | Ga0501048_0241932 | 3300049582 | Bacteria | 1281 |
| 1591 | Ga0501048_0902011 | 3300049582 | Bacteria | 636 |
| 1592 | Ga0501067_0003773 | 3300049583 | Bacteria | 8357 |
| 1593 | Ga0501068_0117831 | 3300049584 | Bacteria | 1654 |
| 1594 | Ga0501068_0225851 | 3300049584 | Bacteria | 1190 |
| 1595 | Ga0501068_0262995 | 3300049584 | Bacteria | 1101 |
| 1596 | Ga0501069_0748886 | 3300049585 | Bacteria | 591 |
| 1597 | Ga0501070_0607196 | 3300049586 | Bacteria | 872 |
| 1598 | Ga0501070_1410966 | 3300049586 | Bacteria | 529 |
| 1599 | Ga0501071_0001937 | 3300049587 | Bacteria | 12334 |
| 1600 | Ga0501071_0145214 | 3300049587 | Bacteria | 1768 |
| 1601 | Ga0501071_0172545 | 3300049587 | Bacteria | 1619 |
| 1602 | Ga0501071_0231051 | 3300049587 | Bacteria | 1393 |
| 1603 | Ga0501072_0000128 | 3300049588 | Bacteria | 56185 |
| 1604 | Ga0501072_0032391 | 3300049588 | Bacteria | 4094 |
| 1605 | Ga0501072_0215997 | 3300049588 | Bacteria | 1528 |
| 1606 | Ga0501073_0003382 | 3300049589 | Bacteria | 11991 |
| 1607 | Ga0501073_0009833 | 3300049589 | Bacteria | 7039 |
| 1608 | Ga0501073_0038469 | 3300049589 | Bacteria | 3393 |
| 1609 | Ga0501073_0207608 | 3300049589 | Bacteria | 1354 |
| 1610 | Ga0501074_0003300 | 3300049590 | Bacteria | 11409 |
| 1611 | Ga0501074_0110042 | 3300049590 | Bacteria | 1971 |
| 1612 | Ga0501074_0281025 | 3300049590 | Bacteria | 1183 |
| 1613 | Ga0501074_0387843 | 3300049590 | Bacteria | 991 |
| 1614 | Ga0501075_0015531 | 3300049591 | Bacteria | 5464 |
| 1615 | Ga0501075_0038544 | 3300049591 | Bacteria | 3573 |
| 1616 | Ga0501075_0090751 | 3300049591 | Bacteria | 2318 |
| 1617 | Ga0501075_0103332 | 3300049591 | Bacteria | 2165 |
| 1618 | Ga0501075_0149057 | 3300049591 | Bacteria | 1783 |
| 1619 | Ga0501075_0536782 | 3300049591 | Bacteria | 893 |
| 1620 | Ga0501076_0000022 | 3300049592 | Bacteria | 83199 |
| 1621 | Ga0501076_0012924 | 3300049592 | Bacteria | 6250 |
| 1622 | Ga0501076_0015095 | 3300049592 | Bacteria | 5833 |
| 1623 | Ga0501076_0019380 | 3300049592 | Bacteria | 5201 |
| 1624 | Ga0501076_0165212 | 3300049592 | Bacteria | 1804 |
| 1625 | Ga0501076_0198838 | 3300049592 | Bacteria | 1636 |
| 1626 | Ga0501076_1433015 | 3300049592 | Bacteria | 567 |
| 1627 | Ga0501076_1586770 | 3300049592 | Bacteria | 537 |
| 1628 | Ga0501077_0000017 | 3300049593 | Bacteria | 86892 |
| 1629 | Ga0501077_0005748 | 3300049593 | Bacteria | 7555 |
| 1630 | Ga0501077_0013601 | 3300049593 | Bacteria | 5102 |
| 1631 | Ga0501077_0138932 | 3300049593 | Bacteria | 1541 |
| 1632 | Ga0501077_0182664 | 3300049593 | Bacteria | 1333 |
| 1633 | Ga0501077_0477644 | 3300049593 | Bacteria | 799 |
| 1634 | Ga0501198_019554 | 3300049649 | Bacteria | 1068 |
| 1635 | Ga0501217_156633 | 3300049661 | Bacteria | 684 |
| 1636 | Ga0501249_047500 | 3300049679 | Bacteria | 982 |
| 1637 | Ga0501252_029041 | 3300049682 | Bacteria | 759 |
| 1638 | Ga0501258_020947 | 3300049687 | Bacteria | 769 |
| 1639 | Ga0501079_0000549 | 3300049741 | Bacteria | 24511 |
| 1640 | Ga0501079_0039652 | 3300049741 | Bacteria | 3632 |
| 1641 | Ga0501079_0219200 | 3300049741 | Bacteria | 1486 |
| 1642 | Ga0501079_0338296 | 3300049741 | Bacteria | 1179 |
| 1643 | Ga0501079_0785145 | 3300049741 | Bacteria | 750 |
| 1644 | Ga0501080_0004016 | 3300049742 | Bacteria | 13028 |
| 1645 | Ga0501080_0054009 | 3300049742 | Bacteria | 3741 |
| 1646 | Ga0501080_0058519 | 3300049742 | Bacteria | 3587 |
| 1647 | Ga0501080_0169697 | 3300049742 | Bacteria | 2013 |
| 1648 | Ga0501080_0430265 | 3300049742 | Bacteria | 1185 |
| 1649 | Ga0501080_1110040 | 3300049742 | Bacteria | 682 |
| 1650 | Ga0501081_0000105 | 3300049743 | Bacteria | 35434 |
| 1651 | Ga0501081_0212764 | 3300049743 | Bacteria | 1404 |
| 1652 | Ga0501081_0438763 | 3300049743 | Bacteria | 969 |
| 1653 | Ga0501081_0921357 | 3300049743 | Bacteria | 659 |
| 1654 | Ga0501083_0098494 | 3300049744 | Bacteria | 1929 |
| 1655 | Ga0501083_0416796 | 3300049744 | Bacteria | 874 |
| 1656 | Ga0501083_0832287 | 3300049744 | Bacteria | 601 |
| 1657 | Ga0501083_0890704 | 3300049744 | Bacteria | 579 |
| 1658 | Ga0501270_003093 | 3300049767 | Unclassified | 1769 |
| 1659 | Ga0501035_0002385 | 3300049822 | Bacteria | 18452 |
| 1660 | Ga0501035_0346800 | 3300049822 | Bacteria | 1243 |
| 1661 | Ga0501035_0386792 | 3300049822 | Bacteria | 1166 |
| 1662 | Ga0501035_0900218 | 3300049822 | Bacteria | 701 |
| 1663 | Ga0501035_1074586 | 3300049822 | Bacteria | 630 |
| 1664 | Ga0501045_0000113 | 3300049824 | Bacteria | 40870 |
| 1665 | Ga0501045_0005535 | 3300049824 | Bacteria | 8737 |
| 1666 | Ga0501045_0093809 | 3300049824 | Bacteria | 2220 |
| 1667 | Ga0501045_0193347 | 3300049824 | Bacteria | 1516 |
| 1668 | Ga0501212_038484 | 3300049851 | Bacteria | 786 |
| 1669 | nmdc:mga00v17_852269_c1 | 3300050491 | Bacteria | 579 |
| 1670 | nmdc:mga05p37_1252235_c1 | 3300050507 | Bacteria | 761 |
| 1671 | nmdc:mga05p37_1701_c1 | 3300050507 | Bacteria | 25630 |
| 1672 | nmdc:mga05p37_1842889_c1 | 3300050507 | Bacteria | 581 |
| 1673 | nmdc:mga05p37_1993750_c1 | 3300050507 | Bacteria | 549 |
| 1674 | nmdc:mga05p37_217608_c1 | 3300050507 | Bacteria | 2306 |
| 1675 | nmdc:mga05p37_2357_c1 | 3300050507 | Bacteria | 21983 |
| 1676 | nmdc:mga05p37_2405_c1 | 3300050507 | Bacteria | 21778 |
| 1677 | nmdc:mga05p37_244065_c1 | 3300050507 | Bacteria | 2157 |
| 1678 | nmdc:mga05p37_28557_c1 | 3300050507 | Bacteria | 6803 |
| 1679 | nmdc:mga05p37_43119_c2 | 3300050507 | Bacteria | 3382 |
| 1680 | nmdc:mga05p37_53231_c1 | 3300050507 | Bacteria | 4977 |
| 1681 | nmdc:mga05p37_5571_c1 | 3300050507 | Bacteria | 14805 |
| 1682 | nmdc:mga09592_1578074_c1 | 3300050508 | Bacteria | 532 |
| 1683 | nmdc:mga09592_194091_c1 | 3300050508 | Bacteria | 1758 |
| 1684 | nmdc:mga09592_47614_c1 | 3300050508 | Bacteria | 3613 |
| 1685 | nmdc:mga09592_7449_c1 | 3300050508 | Bacteria | 8894 |
| 1686 | nmdc:mga09592_845691_c1 | 3300050508 | Bacteria | 772 |
| 1687 | nmdc:mga09592_88599_c1 | 3300050508 | Bacteria | 2643 |
| 1688 | nmdc:mga0qj67_222840_c1 | 3300050509 | Bacteria | 1531 |
| 1689 | nmdc:mga0qj67_263938_c1 | 3300050509 | Bacteria | 1397 |
| 1690 | nmdc:mga0qj67_287621_c1 | 3300050509 | Bacteria | 1332 |
| 1691 | nmdc:mga0qj67_36968_c1 | 3300050509 | Bacteria | 3823 |
| 1692 | nmdc:mga0qj67_610306_c1 | 3300050509 | Bacteria | 872 |
| 1693 | nmdc:mga06r32_1302523_c1 | 3300050510 | Bacteria | 670 |
| 1694 | nmdc:mga06r32_299928_c1 | 3300050510 | Bacteria | 1593 |
| 1695 | nmdc:mga06r32_600_c2 | 3300050510 | Bacteria | 13291 |
| 1696 | nmdc:mga06r32_721966_c1 | 3300050510 | Bacteria | 961 |
| 1697 | nmdc:mga08y16_1403866_c1 | 3300050511 | Bacteria | 661 |
| 1698 | nmdc:mga08y16_158966_c1 | 3300050511 | Bacteria | 2348 |
| 1699 | nmdc:mga08y16_1650152_c1 | 3300050511 | Bacteria | 598 |
| 1700 | nmdc:mga08y16_20950_c1 | 3300050511 | Bacteria | 6902 |
| 1701 | nmdc:mga08y16_24_c1 | 3300050511 | Bacteria | 240846 |
| 1702 | nmdc:mga08y16_421972_c1 | 3300050511 | Bacteria | 1363 |
| 1703 | nmdc:mga08y16_692563_c1 | 3300050511 | Bacteria | 1020 |
| 1704 | nmdc:mga08y16_903961_c1 | 3300050511 | Bacteria | 869 |
| 1705 | nmdc:mga0n895_112230_c1 | 3300050512 | Bacteria | 2743 |
| 1706 | nmdc:mga0n895_116858_c1 | 3300050512 | Bacteria | 2686 |
| 1707 | nmdc:mga0n895_124772_c1 | 3300050512 | Bacteria | 2598 |
| 1708 | nmdc:mga0n895_15345_c1 | 3300050512 | Bacteria | 6981 |
| 1709 | nmdc:mga0n895_157994_c1 | 3300050512 | Bacteria | 2298 |
| 1710 | nmdc:mga0n895_16211_c1 | 3300050512 | Bacteria | 6831 |
| 1711 | nmdc:mga0n895_165230_c1 | 3300050512 | Bacteria | 2245 |
| 1712 | nmdc:mga0n895_248534_c1 | 3300050512 | Bacteria | 1805 |
| 1713 | nmdc:mga0n895_32532_c1 | 3300050512 | Bacteria | 5007 |
| 1714 | nmdc:mga0n895_4227_c1 | 3300050512 | Bacteria | 11739 |
| 1715 | nmdc:mga0rr50_15066_c1 | 3300050513 | Bacteria | 5094 |
| 1716 | nmdc:mga0rr50_1883_c1 | 3300050513 | Bacteria | 11637 |
| 1717 | nmdc:mga0rr50_309450_c1 | 3300050513 | Bacteria | 1323 |
| 1718 | nmdc:mga0rr50_436178_c1 | 3300050513 | Bacteria | 1109 |
| 1719 | nmdc:mga0rr50_451926_c1 | 3300050513 | Bacteria | 1089 |
| 1720 | nmdc:mga0rr50_4708_c1 | 3300050513 | Bacteria | 8045 |
| 1721 | nmdc:mga0rr50_496957_c1 | 3300050513 | Bacteria | 1037 |
| 1722 | nmdc:mga0rr50_603694_c1 | 3300050513 | Unclassified | 936 |
| 1723 | nmdc:mga0rr50_70361_c1 | 3300050513 | Bacteria | 2666 |
| 1724 | nmdc:mga0rr50_98517_c1 | 3300050513 | Bacteria | 2292 |
| 1725 | nmdc:mga08x19_12242_c1 | 3300050514 | Bacteria | 5164 |
| 1726 | nmdc:mga08x19_14593_c1 | 3300050514 | Bacteria | 4766 |
| 1727 | nmdc:mga08x19_20353_c1 | 3300050514 | Bacteria | 4085 |
| 1728 | nmdc:mga08x19_365_c1 | 3300050514 | Bacteria | 32003 |
| 1729 | nmdc:mga08x19_39582_c1 | 3300050514 | Bacteria | 2997 |
| 1730 | nmdc:mga08x19_53364_c1 | 3300050514 | Bacteria | 2601 |
| 1731 | nmdc:mga08x19_59650_c1 | 3300050514 | Bacteria | 2470 |
| 1732 | nmdc:mga08x19_87268_c1 | 3300050514 | Bacteria | 2055 |
| 1733 | nmdc:mga08x19_95363_c1 | 3300050514 | Bacteria | 1968 |
| 1734 | nmdc:mga0a205_10723_c1 | 3300050515 | Bacteria | 8426 |
| 1735 | nmdc:mga0a205_137179_c1 | 3300050515 | Bacteria | 2347 |
| 1736 | nmdc:mga0a205_16417_c1 | 3300050515 | Bacteria | 3641 |
| 1737 | nmdc:mga0a205_245638_c1 | 3300050515 | Bacteria | 1670 |
| 1738 | nmdc:mga0a205_256160_c1 | 3300050515 | Bacteria | 1628 |
| 1739 | nmdc:mga0a205_260474_c1 | 3300050515 | Bacteria | 1612 |
| 1740 | nmdc:mga0a205_263572_c1 | 3300050515 | Bacteria | 1601 |
| 1741 | nmdc:mga0a205_287318_c1 | 3300050515 | Bacteria | 1519 |
| 1742 | nmdc:mga0a205_34611_c1 | 3300050515 | Bacteria | 4846 |
| 1743 | nmdc:mga0a205_357051_c1 | 3300050515 | Bacteria | 1328 |
| 1744 | nmdc:mga0a205_390_c1 | 3300050515 | Bacteria | 33406 |
| 1745 | nmdc:mga0a205_429315_c1 | 3300050515 | Unclassified | 1183 |
| 1746 | nmdc:mga0a205_488289_c1 | 3300050515 | Bacteria | 1089 |
| 1747 | nmdc:mga0a205_63533_c1 | 3300050515 | Bacteria | 3567 |
| 1748 | nmdc:mga0a205_8807_c1 | 3300050515 | Bacteria | 9192 |
| 1749 | Ga0495601_0016503 | 3300053077 | Bacteria | 4476 |
| 1750 | Ga0495601_0460347 | 3300053077 | Bacteria | 822 |
| 1751 | Ga0495601_0493210 | 3300053077 | Bacteria | 791 |
| 1752 | Ga0495601_0562803 | 3300053077 | Bacteria | 733 |
| 1753 | Ga0495612_0246593 | 3300053078 | Bacteria | 794 |
| 1754 | Ga0495595_0015164 | 3300053084 | Bacteria | 3283 |
| 1755 | Ga0495595_0466989 | 3300053084 | Bacteria | 642 |
| 1756 | Ga0495619_0027932 | 3300053085 | Bacteria | 3639 |
| 1757 | Ga0495619_0032380 | 3300053085 | Bacteria | 3392 |
| 1758 | Ga0495619_0100730 | 3300053085 | Bacteria | 1966 |
| 1759 | Ga0495619_0495056 | 3300053085 | Bacteria | 841 |
| 1760 | Ga0495619_0518105 | 3300053085 | Bacteria | 819 |
| 1761 | Ga0500643_000257 | 3300053087 | Bacteria | 48350 |
| 1762 | Ga0500568_0035391 | 3300053139 | Bacteria | 2038 |
| 1763 | Ga0501084_0000159 | 3300054114 | Bacteria | 52081 |
| 1764 | Ga0501084_0071866 | 3300054114 | Bacteria | 2898 |
| 1765 | Ga0501084_0287098 | 3300054114 | Bacteria | 1389 |
| 1766 | Ga0501084_0503695 | 3300054114 | Bacteria | 1023 |
| 1767 | Ga0501084_0505832 | 3300054114 | Bacteria | 1021 |
| 1768 | Ga0501084_1633105 | 3300054114 | Bacteria | 539 |
| 1769 | Ga0587084_041383 | 3300059477 | Bacteria | 784 |
| 1770 | Ga0587066_018738 | 3300059490 | Bacteria | 1118 |
| 1771 | Ga0587073_0040134 | 3300059492 | Bacteria | 1015 |
| 1772 | Ga0587080_092063 | 3300059503 | Bacteria | 637 |
| 1773 | Ga0587091_047439 | 3300059511 | Bacteria | 870 |
| 1774 | Ga0587072_062076 | 3300059643 | Bacteria | 772 |
| 1775 | Ga0587111_0035651 | 3300060346 | Unclassified | 1038 |
| 1776 | Ga0587111_0078441 | 3300060346 | Bacteria | 785 |
| 1777 | Ga0587111_0283623 | 3300060346 | Bacteria | 501 |
| 1778 | Ga0501082_0002410 | 3300060353 | Bacteria | 16410 |
| 1779 | Ga0501082_0485350 | 3300060353 | Bacteria | 1080 |
| 1780 | Ga0501082_0650476 | 3300060353 | Bacteria | 922 |
| 1781 | Ga0530510_0002449 | 3300061734 | Bacteria | 12792 |
| 1782 | Ga0530510_0125550 | 3300061734 | Bacteria | 1886 |
| 1783 | Ga0530510_0194648 | 3300061734 | Bacteria | 1505 |
| 1784 | Ga0530510_0298278 | 3300061734 | Bacteria | 1206 |
| 1785 | Ga0530510_0357705 | 3300061734 | Bacteria | 1097 |
| 1786 | Ga0530510_0392298 | 3300061734 | Bacteria | 1045 |
| 1787 | Ga0530510_0860580 | 3300061734 | Bacteria | 692 |
| 1788 | Ga0157378_10105819 | |||
| 1789 | SwRhRL2b_contig_291308 | |||
| 1790 | SwRhRL2b_contig_3903249 | |||
| 1791 | MBSR1b_contig_4233670 | |||
| 1792 | JGI24746J21847_1016431 | |||
| 1793 | JGI24742J22300_10007131 | |||
| 1794 | rootL2_10282489 | |||
| 1795 | JGI26145J50221_1001211 | |||
| 1796 | JGI26141J51220_1003121 | |||
| 1797 | JGI25405J52794_10000604 | |||
| 1798 | Ga0058863_10059782 | |||
| 1799 | Ga0058863_11875765 | |||
| 1800 | Ga0058861_12030344 | |||
| 1801 | Ga0058860_12230108 | |||
| 1802 | Ga0058862_10154497 | |||
| 1803 | Ga0065704_10005699 | |||
| 1804 | Ga0065704_10085970 | |||
| 1805 | Ga0065704_10190762 | |||
| 1806 | Ga0065704_10394263 | |||
| 1807 | Ga0065712_10374598 | |||
| 1808 | Ga0065715_10121974 | |||
| 1809 | Ga0065715_10445920 | |||
| 1810 | Ga0065715_11162660 | |||
| 1811 | Ga0065707_10025635 | |||
| 1812 | Ga0070658_10039091 | |||
| 1813 | Ga0070658_11318469 | |||
| 1814 | Ga0070676_10018293 | |||
| 1815 | Ga0070676_10026300 | |||
| 1816 | Ga0070676_10541632 | |||
| 1817 | Ga0070676_11479038 | |||
| 1818 | Ga0070683_100000033 | |||
| 1819 | Ga0070683_100004175 | |||
| 1820 | Ga0070690_100005750 | |||
| 1821 | Ga0070690_100030946 | |||
| 1822 | Ga0070690_100065969 | |||
| 1823 | Ga0070690_100256616 | |||
| 1824 | Ga0070690_100776228 | |||
| 1825 | Ga0070670_100006072 | |||
| 1826 | Ga0070670_100029495 | |||
| 1827 | Ga0070670_100218024 | |||
| 1828 | Ga0070670_100303900 | |||
| 1829 | Ga0070670_100324478 | |||
| 1830 | Ga0070670_100546168 | |||
| 1831 | Ga0070670_100676845 | |||
| 1832 | Ga0070670_102113790 | |||
| 1833 | Ga0070677_10005399 | |||
| 1834 | Ga0068869_100009311 | |||
| 1835 | Ga0068869_100015378 | |||
| 1836 | Ga0068869_100041040 | |||
| 1837 | Ga0068869_100167792 | |||
| 1838 | Ga0068869_100200424 | |||
| 1839 | Ga0068869_100268990 | |||
| 1840 | Ga0068869_100646961 | |||
| 1841 | Ga0070666_10001387 | |||
| 1842 | Ga0070666_10001507 | |||
| 1843 | Ga0070666_10011673 | |||
| 1844 | Ga0070666_10040333 | |||
| 1845 | Ga0070666_10162092 | |||
| 1846 | Ga0070666_10521737 | |||
| 1847 | Ga0070666_10958131 | |||
| 1848 | Ga0070680_100707670 | |||
| 1849 | Ga0070682_100256877 | |||
| 1850 | Ga0068868_100000632 | |||
| 1851 | Ga0068868_100906099 | |||
| 1852 | Ga0070660_100100051 | |||
| 1853 | Ga0070660_100406772 | |||
| 1854 | Ga0070689_100068193 | |||
| 1855 | Ga0070689_100101559 | |||
| 1856 | Ga0070689_100103520 | |||
| 1857 | Ga0070689_100204302 | |||
| 1858 | Ga0070689_100259633 | |||
| 1859 | Ga0070689_100412269 | |||
| 1860 | Ga0070689_100427886 | |||
| 1861 | Ga0070689_100507022 | |||
| 1862 | Ga0070689_100688822 | |||
| 1863 | Ga0070689_100796799 | |||
| 1864 | Ga0070689_101067422 | |||
| 1865 | Ga0070689_101578820 | |||
| 1866 | Ga0070691_10060647 | |||
| 1867 | Ga0070691_10309448 | |||
| 1868 | Ga0070691_10961339 | |||
| 1869 | Ga0070687_100051489 | |||
| 1870 | Ga0070687_100114596 | |||
| 1871 | Ga0070687_100136833 | |||
| 1872 | Ga0070687_100427962 | |||
| 1873 | Ga0070687_100465332 | |||
| 1874 | Ga0070687_100515402 | |||
| 1875 | Ga0070661_100010686 | |||
| 1876 | Ga0070692_10001104 | |||
| 1877 | Ga0070692_10004482 | |||
| 1878 | Ga0070692_10102494 | |||
| 1879 | Ga0070692_11082159 | |||
| 1880 | Ga0070692_11154071 | |||
| 1881 | Ga0070668_100028739 | |||
| 1882 | Ga0070668_100117946 | |||
| 1883 | Ga0070669_100025363 | |||
| 1884 | Ga0070669_100097584 | |||
| 1885 | Ga0070669_100278937 | |||
| 1886 | Ga0070669_101569360 | |||
| 1887 | Ga0070669_101635007 | |||
| 1888 | Ga0070675_100000007 | |||
| 1889 | Ga0070675_100032515 | |||
| 1890 | Ga0070675_100092402 | |||
| 1891 | Ga0070675_100105703 | |||
| 1892 | Ga0070675_100123749 | |||
| 1893 | Ga0070675_100183980 | |||
| 1894 | Ga0070675_100185688 | |||
| 1895 | Ga0070675_100318549 | |||
| 1896 | Ga0070675_100342603 | |||
| 1897 | Ga0070675_101193667 | |||
| 1898 | Ga0070675_101372066 | |||
| 1899 | Ga0070671_100190181 | |||
| 1900 | Ga0070671_100191826 | |||
| 1901 | Ga0070674_100007457 | |||
| 1902 | Ga0070674_100007905 | |||
| 1903 | Ga0070674_100343338 | |||
| 1904 | Ga0070674_100367453 | |||
| 1905 | Ga0070674_100587817 | |||
| 1906 | Ga0070674_101389008 | |||
| 1907 | Ga0070674_101735933 | |||
| 1908 | Ga0070673_100051191 | |||
| 1909 | Ga0070673_100071173 | |||
| 1910 | Ga0070673_100099405 | |||
| 1911 | Ga0070673_100226177 | |||
| 1912 | Ga0070673_100677707 | |||
| 1913 | Ga0070673_101809998 | |||
| 1914 | Ga0070688_100175984 | |||
| 1915 | Ga0070688_100426728 | |||
| 1916 | Ga0070688_100533180 | |||
| 1917 | Ga0070688_100874058 | |||
| 1918 | Ga0070659_100169875 | |||
| 1919 | Ga0070667_100002921 | |||
| 1920 | Ga0070667_100091951 | |||
| 1921 | Ga0070667_100234407 | |||
| 1922 | Ga0070667_100604574 | |||
| 1923 | Ga0070667_100977738 | |||
| 1924 | Ga0070667_101203917 | |||
| 1925 | Ga0070703_10097871 | |||
| 1926 | Ga0070709_10019666 | |||
| 1927 | Ga0070709_10075841 | |||
| 1928 | Ga0070709_10133261 | |||
| 1929 | Ga0070709_10444071 | |||
| 1930 | Ga0070709_10899752 | |||
| 1931 | Ga0070713_100115557 | |||
| 1932 | Ga0070710_10298597 | |||
| 1933 | Ga0070710_10482662 | |||
| 1934 | Ga0070701_10014144 | |||
| 1935 | Ga0070701_10085332 | |||
| 1936 | Ga0070701_10562179 | |||
| 1937 | Ga0070711_100350307 | |||
| 1938 | Ga0070711_100355922 | |||
| 1939 | Ga0070711_100364914 | |||
| 1940 | Ga0070711_101924400 | |||
| 1941 | Ga0070705_100021563 | |||
| 1942 | Ga0070705_100481005 | |||
| 1943 | Ga0070700_100000050 | |||
| 1944 | Ga0070700_100105528 | |||
| 1945 | Ga0070700_100699064 | |||
| 1946 | Ga0070700_101465297 | |||
| 1947 | Ga0070694_100004904 | |||
| 1948 | Ga0070694_100018421 | |||
| 1949 | Ga0070694_100026241 | |||
| 1950 | Ga0070694_100923232 | |||
| 1951 | Ga0070694_101063760 | |||
| 1952 | Ga0070694_101212678 | |||
| 1953 | Ga0070708_100157158 | |||
| 1954 | Ga0070708_100172273 | |||
| 1955 | Ga0070708_100263368 | |||
| 1956 | Ga0070708_100263468 | |||
| 1957 | Ga0070708_101206272 | |||
| 1958 | Ga0070708_101221233 | |||
| 1959 | Ga0070708_101357583 | |||
| 1960 | Ga0070708_101527797 | |||
| 1961 | Ga0070708_101802727 | |||
| 1962 | Ga0070663_100046825 | |||
| 1963 | Ga0070663_100507789 | |||
| 1964 | Ga0070678_100006394 | |||
| 1965 | Ga0070678_100277422 | |||
| 1966 | Ga0070678_100505663 | |||
| 1967 | Ga0070662_100093375 | |||
| 1968 | Ga0070662_100124500 | |||
| 1969 | Ga0070662_100146168 | |||
| 1970 | Ga0070662_100201195 | |||
| 1971 | Ga0070662_101086956 | |||
| 1972 | Ga0070662_101352454 | |||
| 1973 | Ga0070681_10212292 | |||
| 1974 | Ga0070681_10388776 | |||
| 1975 | Ga0070681_11357294 | |||
| 1976 | Ga0068867_100016292 | |||
| 1977 | Ga0068867_100023693 | |||
| 1978 | Ga0068867_100025055 | |||
| 1979 | Ga0068867_100261944 | |||
| 1980 | Ga0068867_101344521 | |||
| 1981 | Ga0070685_10112403 | |||
| 1982 | Ga0070685_10811138 | |||
| 1983 | Ga0070706_100005176 | |||
| 1984 | Ga0070706_100021749 | |||
| 1985 | Ga0070706_100060377 | |||
| 1986 | Ga0070706_100084802 | |||
| 1987 | Ga0070706_100143886 | |||
| 1988 | Ga0070706_100152709 | |||
| 1989 | Ga0070706_100160143 | |||
| 1990 | Ga0070706_100185121 | |||
| 1991 | Ga0070706_100253498 | |||
| 1992 | Ga0070706_100290414 | |||
| 1993 | Ga0070707_100006596 | |||
| 1994 | Ga0070707_100084042 | |||
| 1995 | Ga0070707_100222760 | |||
| 1996 | Ga0070707_100271464 | |||
| 1997 | Ga0070707_100459544 | |||
| 1998 | Ga0070707_100574266 | |||
| 1999 | Ga0070707_100613758 | |||
| 2000 | Ga0070707_101381124 | |||
| 2001 | Ga0070698_100004976 | |||
| 2002 | Ga0070698_100022395 | |||
| 2003 | Ga0070698_100039505 | |||
| 2004 | Ga0070698_100150648 | |||
| 2005 | Ga0070698_100337116 | |||
| 2006 | Ga0070698_100358829 | |||
| 2007 | Ga0070698_100771513 | |||
| 2008 | Ga0070698_101613421 | |||
| 2009 | Ga0070699_100242768 | |||
| 2010 | Ga0070699_100270563 | |||
| 2011 | Ga0070699_100331429 | |||
| 2012 | Ga0070699_100372948 | |||
| 2013 | Ga0070699_100894802 | |||
| 2014 | Ga0070699_100980595 | |||
| 2015 | Ga0070699_100988430 | |||
| 2016 | Ga0070699_101044073 | |||
| 2017 | Ga0070699_101840844 | |||
| 2018 | Ga0070679_100029036 | |||
| 2019 | Ga0070679_101054963 | |||
| 2020 | Ga0070679_101391791 | |||
| 2021 | Ga0070684_100006540 | |||
| 2022 | Ga0070684_100034321 | |||
| 2023 | Ga0070684_100315549 | |||
| 2024 | Ga0070684_100501115 | |||
| 2025 | Ga0070684_101450530 | |||
| 2026 | Ga0070697_100002003 | |||
| 2027 | Ga0070697_100006235 | |||
| 2028 | Ga0070697_100016639 | |||
| 2029 | Ga0070697_100050503 | |||
| 2030 | Ga0070697_100057785 | |||
| 2031 | Ga0070697_100073385 | |||
| 2032 | Ga0070697_100131871 | |||
| 2033 | Ga0070697_100173619 | |||
| 2034 | Ga0070697_100292248 | |||
| 2035 | Ga0070697_100788006 | |||
| 2036 | Ga0070697_100935321 | |||
| 2037 | Ga0070697_101020950 | |||
| 2038 | Ga0070697_101092673 | |||
| 2039 | Ga0068853_100010446 | |||
| 2040 | Ga0068853_100558747 | |||
| 2041 | Ga0070672_100005180 | |||
| 2042 | Ga0070672_100057049 | |||
| 2043 | Ga0070672_100074196 | |||
| 2044 | Ga0070672_100078636 | |||
| 2045 | Ga0070672_100083257 | |||
| 2046 | Ga0070672_100189079 | |||
| 2047 | Ga0070672_100222200 | |||
| 2048 | Ga0070672_101545981 | |||
| 2049 | Ga0070686_100022242 | |||
| 2050 | Ga0070686_100065761 | |||
| 2051 | Ga0070686_101648143 | |||
| 2052 | Ga0070695_100043544 | |||
| 2053 | Ga0070695_100121956 | |||
| 2054 | Ga0070695_100123311 | |||
| 2055 | Ga0070695_100147012 | |||
| 2056 | Ga0070695_100332431 | |||
| 2057 | Ga0070696_100012751 | |||
| 2058 | Ga0070696_100015270 | |||
| 2059 | Ga0070696_100023806 | |||
| 2060 | Ga0070696_100068104 | |||
| 2061 | Ga0070696_100143548 | |||
| 2062 | Ga0070696_100290648 | |||
| 2063 | Ga0070696_101204782 | |||
| 2064 | Ga0070693_100037146 | |||
| 2065 | Ga0070693_100063520 | |||
| 2066 | Ga0070665_100022280 | |||
| 2067 | Ga0070665_100027592 | |||
| 2068 | Ga0070665_100425601 | |||
| 2069 | Ga0070665_101177422 | |||
| 2070 | Ga0070665_101605544 | |||
| 2071 | Ga0070704_100044966 | |||
| 2072 | Ga0070704_100199616 | |||
| 2073 | Ga0070704_100228149 | |||
| 2074 | Ga0070704_100346746 | |||
| 2075 | Ga0070704_100408103 | |||
| 2076 | Ga0068855_100000266 | |||
| 2077 | Ga0068855_100946306 | |||
| 2078 | Ga0070664_100005841 | |||
| 2079 | Ga0070664_100436529 | |||
| 2080 | Ga0070664_100688159 | |||
| 2081 | Ga0070664_100756549 | |||
| 2082 | Ga0068857_100333822 | |||
| 2083 | Ga0068854_100126246 | |||
| 2084 | Ga0068854_100248683 | |||
| 2085 | Ga0068854_100287407 | |||
| 2086 | Ga0068854_100331794 | |||
| 2087 | Ga0068854_100978744 | |||
| 2088 | Ga0068856_100007761 | |||
| 2089 | Ga0068856_100009234 | |||
| 2090 | Ga0068856_100859975 | |||
| 2091 | Ga0068856_100867057 | |||
| 2092 | Ga0068856_102227847 | |||
| 2093 | Ga0070702_100039824 | |||
| 2094 | Ga0070702_100067864 | |||
| 2095 | Ga0070702_100187967 | |||
| 2096 | Ga0070702_100299624 | |||
| 2097 | Ga0070702_100550133 | |||
| 2098 | Ga0070702_100565046 | |||
| 2099 | Ga0068852_100160088 | |||
| 2100 | Ga0068852_100419281 | |||
| 2101 | Ga0068852_101268419 | |||
| 2102 | Ga0068859_100000677 | |||
| 2103 | Ga0068859_100163938 | |||
| 2104 | Ga0068859_100284313 | |||
| 2105 | Ga0068859_100310919 | |||
| 2106 | Ga0068859_100425056 | |||
| 2107 | Ga0068859_100971326 | |||
| 2108 | Ga0068859_100995658 | |||
| 2109 | Ga0068859_101953714 | |||
| 2110 | Ga0068864_100031613 | |||
| 2111 | Ga0068864_100094210 | |||
| 2112 | Ga0068864_100108236 | |||
| 2113 | Ga0068864_100197897 | |||
| 2114 | Ga0068864_100669070 | |||
| 2115 | Ga0068866_10270079 | |||
| 2116 | Ga0068866_10396743 | |||
| 2117 | Ga0068866_10972721 | |||
| 2118 | Ga0068861_100020829 | |||
| 2119 | Ga0068861_100084086 | |||
| 2120 | Ga0068861_100182569 | |||
| 2121 | Ga0068861_100283062 | |||
| 2122 | Ga0068861_100400314 | |||
| 2123 | Ga0068861_100663397 | |||
| 2124 | Ga0068870_10075673 | |||
| 2125 | Ga0068870_10389803 | |||
| 2126 | Ga0068870_10612235 | |||
| 2127 | Ga0068863_100061234 | |||
| 2128 | Ga0068863_100135598 | |||
| 2129 | Ga0068863_100614434 | |||
| 2130 | Ga0068863_101247584 | |||
| 2131 | Ga0068858_100004672 | |||
| 2132 | Ga0068858_100183416 | |||
| 2133 | Ga0068858_100479193 | |||
| 2134 | Ga0068858_100940654 | |||
| 2135 | Ga0068858_101981642 | |||
| 2136 | Ga0068860_100005124 | |||
| 2137 | Ga0068860_100042506 | |||
| 2138 | Ga0068860_100110903 | |||
| 2139 | Ga0068860_100407065 | |||
| 2140 | Ga0068860_100625000 | |||
| 2141 | Ga0068860_100709199 | |||
| 2142 | Ga0068860_100937514 | |||
| 2143 | Ga0068860_101594488 | |||
| 2144 | Ga0068860_101787277 | |||
| 2145 | Ga0068862_100003143 | |||
| 2146 | Ga0068862_100040470 | |||
| 2147 | Ga0068862_100091874 | |||
| 2148 | Ga0068862_100103172 | |||
| 2149 | Ga0068862_100115629 | |||
| 2150 | Ga0068862_100446059 | |||
| 2151 | Ga0068862_100483215 | |||
| 2152 | Ga0081455_10000422 | |||
| 2153 | Ga0081455_10010015 | |||
| 2154 | Ga0081455_10028987 | |||
| 2155 | Ga0081455_10079207 | |||
| 2156 | Ga0081455_10448240 | |||
| 2157 | Ga0081455_10548763 | |||
| 2158 | Ga0081540_1027578 | |||
| 2159 | Ga0070717_10000064 | |||
| 2160 | Ga0070717_10417247 | |||
| 2161 | Ga0070717_10756042 | |||
| 2162 | Ga0075363_100924436 | |||
| 2163 | Ga0075364_11251736 | |||
| 2164 | Ga0075432_10006617 | |||
| 2165 | Ga0075432_10058477 | |||
| 2166 | Ga0075432_10395084 | |||
| 2167 | Ga0070715_10683641 | |||
| 2168 | Ga0070716_100026284 | |||
| 2169 | Ga0070716_100270517 | |||
| 2170 | Ga0070716_100442032 | |||
| 2171 | Ga0070716_100815246 | |||
| 2172 | Ga0070712_101881419 | |||
| 2173 | Ga0097621_100030376 | |||
| 2174 | Ga0097621_100492357 | |||
| 2175 | Ga0097621_101324039 | |||
| 2176 | Ga0097621_101458930 | |||
| 2177 | Ga0097621_101491088 | |||
| 2178 | Ga0068871_100129959 | |||
| 2179 | Ga0068871_100377689 | |||
| 2180 | Ga0068871_100454439 | |||
| 2181 | Ga0068871_100711669 | |||
| 2182 | Ga0068871_101018833 | |||
| 2183 | Ga0068871_101193520 | |||
| 2184 | Ga0068871_101282765 | |||
| 2185 | Ga0075428_100002976 | |||
| 2186 | Ga0075428_100003062 | |||
| 2187 | Ga0075428_100032404 | |||
| 2188 | Ga0075428_100069486 | |||
| 2189 | Ga0075428_100209761 | |||
| 2190 | Ga0075428_100307525 | |||
| 2191 | Ga0075428_100371042 | |||
| 2192 | Ga0075430_100002410 | |||
| 2193 | Ga0075430_100006690 | |||
| 2194 | Ga0075430_100040471 | |||
| 2195 | Ga0075430_100299056 | |||
| 2196 | Ga0075430_100517172 | |||
| 2197 | Ga0075431_100003027 | |||
| 2198 | Ga0075431_100179475 | |||
| 2199 | Ga0075431_100350728 | |||
| 2200 | Ga0075431_100638920 | |||
| 2201 | Ga0075431_100703020 | |||
| 2202 | Ga0075431_100806056 | |||
| 2203 | Ga0075431_100841912 | |||
| 2204 | Ga0075431_101001326 | |||
| 2205 | Ga0075431_101649011 | |||
| 2206 | Ga0075433_10002443 | |||
| 2207 | Ga0075433_10005052 | |||
| 2208 | Ga0075433_10065602 | |||
| 2209 | Ga0075433_10084417 | |||
| 2210 | Ga0075433_10088307 | |||
| 2211 | Ga0075433_10111840 | |||
| 2212 | Ga0075433_10163788 | |||
| 2213 | Ga0075433_10187982 | |||
| 2214 | Ga0075433_10447346 | |||
| 2215 | Ga0075433_10773066 | |||
| 2216 | Ga0075433_10830830 | |||
| 2217 | Ga0075434_100000038 | |||
| 2218 | Ga0075434_100002471 | |||
| 2219 | Ga0075434_100014841 | |||
| 2220 | Ga0075434_100110302 | |||
| 2221 | Ga0075434_100135458 | |||
| 2222 | Ga0075434_100135556 | |||
| 2223 | Ga0075434_100246019 | |||
| 2224 | Ga0075429_100008584 | |||
| 2225 | Ga0075429_100099339 | |||
| 2226 | Ga0075429_100292591 | |||
| 2227 | Ga0075429_100305175 | |||
| 2228 | Ga0075429_100550555 | |||
| 2229 | Ga0068865_100005424 | |||
| 2230 | Ga0068865_100016601 | |||
| 2231 | Ga0075436_100002590 | |||
| 2232 | Ga0075436_100002790 | |||
| 2233 | Ga0075436_100004621 | |||
| 2234 | Ga0075436_100027386 | |||
| 2235 | Ga0075436_100076615 | |||
| 2236 | Ga0075436_100098077 | |||
| 2237 | Ga0075436_100176487 | |||
| 2238 | Ga0075436_100248625 | |||
| 2239 | Ga0075436_100915907 | |||
| 2240 | Ga0097620_100000677 | |||
| 2241 | Ga0097620_100163956 | |||
| 2242 | Ga0097620_100284333 | |||
| 2243 | Ga0097620_100310923 | |||
| 2244 | Ga0097620_100425040 | |||
| 2245 | Ga0097620_100971311 | |||
| 2246 | Ga0097620_100995693 | |||
| 2247 | Ga0097620_101953811 | |||
| 2248 | Ga0075435_100002461 | |||
| 2249 | Ga0075435_100027645 | |||
| 2250 | Ga0075435_100088348 | |||
| 2251 | Ga0075435_100236973 | |||
| 2252 | Ga0075435_100242611 | |||
| 2253 | Ga0075435_100300747 | |||
| 2254 | Ga0075435_100488791 | |||
| 2255 | Ga0075435_100747103 | |||
| 2256 | Ga0075435_101963034 | |||
| 2257 | Ga0099794_10049726 | |||
| 2258 | Ga0099794_10197181 | |||
| 2259 | Ga0099794_10297416 | |||
| 2260 | Ga0099795_10020338 | |||
| 2261 | Ga0099795_10424156 | |||
| 2262 | Ga0105251_10107526 | |||
| 2263 | Ga0105251_10293874 | |||
| 2264 | Ga0105244_10011650 | |||
| 2265 | Ga0105240_10127569 | |||
| 2266 | Ga0105240_10732476 | |||
| 2267 | Ga0111539_10000022 | |||
| 2268 | Ga0111539_10058961 | |||
| 2269 | Ga0111539_10199861 | |||
| 2270 | Ga0111539_10349380 | |||
| 2271 | Ga0111539_10923746 | |||
| 2272 | Ga0111539_10934786 | |||
| 2273 | Ga0111539_11120732 | |||
| 2274 | Ga0111539_12242981 | |||
| 2275 | Ga0111539_12975874 | |||
| 2276 | Ga0105245_10001507 | |||
| 2277 | Ga0105245_10368411 | |||
| 2278 | Ga0105245_11361665 | |||
| 2279 | Ga0105245_11449824 | |||
| 2280 | Ga0105247_10151259 | |||
| 2281 | Ga0105247_10271221 | |||
| 2282 | Ga0114129_10000247 | |||
| 2283 | Ga0114129_10001417 | |||
| 2284 | Ga0114129_10002852 | |||
| 2285 | Ga0114129_10046019 | |||
| 2286 | Ga0114129_10063914 | |||
| 2287 | Ga0114129_10177970 | |||
| 2288 | Ga0114129_10439907 | |||
| 2289 | Ga0114129_10521343 | |||
| 2290 | Ga0114129_10525620 | |||
| 2291 | Ga0114129_10715113 | |||
| 2292 | Ga0114129_11090486 | |||
| 2293 | Ga0114129_11460040 | |||
| 2294 | Ga0114129_11718743 | |||
| 2295 | Ga0105243_10000009 | |||
| 2296 | Ga0105243_11007106 | |||
| 2297 | Ga0105241_10080778 | |||
| 2298 | Ga0105241_11962224 | |||
| 2299 | Ga0105242_10012536 | |||
| 2300 | Ga0105242_10080321 | |||
| 2301 | Ga0105242_10713146 | |||
| 2302 | Ga0105242_10748162 | |||
| 2303 | Ga0105242_12012325 | |||
| 2304 | Ga0105248_10008944 | |||
| 2305 | Ga0105248_10223859 | |||
| 2306 | Ga0105248_10574996 | |||
| 2307 | Ga0105248_10689478 | |||
| 2308 | Ga0105248_10960038 | |||
| 2309 | Ga0105248_11517177 | |||
| 2310 | Ga0105248_12580991 | |||
| 2311 | Ga0105248_12890409 | |||
| 2312 | Ga0105248_13041606 | |||
| 2313 | Ga0105237_10066336 | |||
| 2314 | Ga0105237_11477833 | |||
| 2315 | Ga0105238_10000002 | |||
| 2316 | Ga0105238_10145814 | |||
| 2317 | Ga0105238_10456576 | |||
| 2318 | Ga0105238_11023362 | |||
| 2319 | Ga0105249_10026603 | |||
| 2320 | Ga0105249_10725262 | |||
| 2321 | Ga0105249_11281389 | |||
| 2322 | Ga0105249_11793297 | |||
| 2323 | Ga0105249_12996498 | |||
| 2324 | Ga0099796_10090524 | |||
| 2325 | Ga0099796_10554021 | |||
| 2326 | Ga0105239_11699799 | |||
| 2327 | Ga0105239_12145162 | |||
| 2328 | Ga0105239_12558569 | |||
| 2329 | Ga0105239_13315569 | |||
| 2330 | Ga0105246_10235421 | |||
| 2331 | Ga0157347_1066412 | |||
| 2332 | Ga0157373_10325377 | |||
| 2333 | Ga0157373_10638818 | |||
| 2334 | Ga0157369_10001943 | |||
| 2335 | Ga0157369_10100872 | |||
| 2336 | Ga0157369_11203607 | |||
| 2337 | Ga0157374_10000005 | |||
| 2338 | Ga0157374_10002664 | |||
| 2339 | Ga0157374_10039567 | |||
| 2340 | Ga0157374_10508101 | |||
| 2341 | Ga0157378_10012246 | |||
| 2342 | Ga0157378_10096295 | |||
| 2343 | Ga0157378_10108940 | |||
| 2344 | Ga0157378_10227763 | |||
| 2345 | Ga0157378_10300065 | |||
| 2346 | Ga0157378_10325710 | |||
| 2347 | Ga0157378_11002773 | |||
| 2348 | Ga0157378_12184179 | |||
| 2349 | Ga0163162_10093242 | |||
| 2350 | Ga0163162_10212271 | |||
| 2351 | Ga0163162_10429766 | |||
| 2352 | Ga0157372_11136133 | |||
| 2353 | Ga0157375_10012356 | |||
| 2354 | Ga0157375_10021527 | |||
| 2355 | Ga0157375_10064497 | |||
| 2356 | Ga0157375_10071083 | |||
| 2357 | Ga0157375_10237799 | |||
| 2358 | Ga0157375_10379526 | |||
| 2359 | Ga0157375_10536984 | |||
| 2360 | Ga0157375_10749389 | |||
| 2361 | Ga0157375_10928052 | |||
| 2362 | Ga0157375_11218204 | |||
| 2363 | Ga0157375_12260814 | |||
| 2364 | Ga0163163_10036365 | |||
| 2365 | Ga0163163_10053167 | |||
| 2366 | Ga0163163_10054913 | |||
| 2367 | Ga0163163_10139935 | |||
| 2368 | Ga0163163_10271121 | |||
| 2369 | Ga0163163_10313241 | |||
| 2370 | Ga0163163_10365909 | |||
| 2371 | Ga0163163_10723073 | |||
| 2372 | Ga0163163_10728194 | |||
| 2373 | Ga0163163_10844320 | |||
| 2374 | Ga0163163_10928670 | |||
| 2375 | Ga0163163_11145053 | |||
| 2376 | Ga0157380_10001355 | |||
| 2377 | Ga0157380_10205467 | |||
| 2378 | Ga0157380_10688406 | |||
| 2379 | Ga0157380_12863327 | |||
| 2380 | Ga0157380_13133087 | |||
| 2381 | Ga0182008_10834581 | |||
| 2382 | Ga0157377_10000001 | |||
| 2383 | Ga0157377_10000414 | |||
| 2384 | Ga0157377_10046193 | |||
| 2385 | Ga0157377_10191602 | |||
| 2386 | Ga0157377_10565156 | |||
| 2387 | Ga0157379_10000714 | |||
| 2388 | Ga0157379_10138032 | |||
| 2389 | Ga0157379_10307620 | |||
| 2390 | Ga0157379_10533826 | |||
| 2391 | Ga0157379_10549618 | |||
| 2392 | Ga0157379_11303935 | |||
| 2393 | Ga0157379_11498675 | |||
| 2394 | Ga0157376_10000003 | |||
| 2395 | Ga0157376_10046438 | |||
| 2396 | Ga0157376_10654389 | |||
| 2397 | Ga0157376_10676509 | |||
| 2398 | Ga0157376_11115777 | |||
| 2399 | Ga0157376_11341442 | |||
| 2400 | Ga0157376_11493894 | |||
| 2401 | Ga0157376_11763036 | |||
| 2402 | Ga0182007_10306095 | |||
| 2403 | Ga0163161_10063568 | |||
| 2404 | Ga0206356_11765259 | |||
| 2405 | Ga0206352_10878108 | |||
| 2406 | Ga0213873_10000018 | |||
| 2407 | Ga0213873_10000553 | |||
| 2408 | Ga0213876_10000009 | |||
| 2409 | Ga0213876_10000058 | |||
| 2410 | Ga0207666_1001625 | |||
| 2411 | Ga0207697_10009073 | |||
| 2412 | Ga0207697_10068448 | |||
| 2413 | Ga0207655_1019809 | |||
| 2414 | Ga0207653_10128253 | |||
| 2415 | Ga0207682_10001734 | |||
| 2416 | Ga0207682_10143047 | |||
| 2417 | Ga0207692_10077477 | |||
| 2418 | Ga0207692_10915755 | |||
| 2419 | Ga0207642_10101044 | |||
| 2420 | Ga0207710_10203240 | |||
| 2421 | Ga0207710_10504380 | |||
| 2422 | Ga0207688_10006667 | |||
| 2423 | Ga0207680_10003484 | |||
| 2424 | Ga0207680_10007364 | |||
| 2425 | Ga0207680_10033943 | |||
| 2426 | Ga0207680_10152895 | |||
| 2427 | Ga0207680_10374993 | |||
| 2428 | Ga0207680_10472711 | |||
| 2429 | Ga0207680_10571957 | |||
| 2430 | Ga0207680_10793122 | |||
| 2431 | Ga0207647_10068009 | |||
| 2432 | Ga0207647_10118635 | |||
| 2433 | Ga0207647_10422104 | |||
| 2434 | Ga0207685_10194185 | |||
| 2435 | Ga0207685_10353728 | |||
| 2436 | Ga0207685_10353837 | |||
| 2437 | Ga0207685_10811008 | |||
| 2438 | Ga0207699_10068910 | |||
| 2439 | Ga0207699_10096815 | |||
| 2440 | Ga0207699_10205798 | |||
| 2441 | Ga0207699_10276684 | |||
| 2442 | Ga0207699_10423402 | |||
| 2443 | Ga0207645_10006128 | |||
| 2444 | Ga0207645_10021058 | |||
| 2445 | Ga0207645_10123441 | |||
| 2446 | Ga0207643_10001235 | |||
| 2447 | Ga0207643_10017199 | |||
| 2448 | Ga0207643_10081943 | |||
| 2449 | Ga0207643_10206890 | |||
| 2450 | Ga0207684_10011604 | |||
| 2451 | Ga0207684_10035936 | |||
| 2452 | Ga0207684_10043926 | |||
| 2453 | Ga0207684_10072862 | |||
| 2454 | Ga0207684_10134177 | |||
| 2455 | Ga0207684_10141204 | |||
| 2456 | Ga0207684_10190569 | |||
| 2457 | Ga0207684_10238580 | |||
| 2458 | Ga0207684_10544790 | |||
| 2459 | Ga0207684_11008326 | |||
| 2460 | Ga0207654_10623314 | |||
| 2461 | Ga0207707_10070280 | |||
| 2462 | Ga0207707_10317843 | |||
| 2463 | Ga0207707_10899627 | |||
| 2464 | Ga0207695_10091115 | |||
| 2465 | Ga0207695_10433346 | |||
| 2466 | Ga0207693_10090246 | |||
| 2467 | Ga0207693_10218115 | |||
| 2468 | Ga0207693_10299968 | |||
| 2469 | Ga0207693_10378669 | |||
| 2470 | Ga0207693_11170599 | |||
| 2471 | Ga0207663_10052095 | |||
| 2472 | Ga0207663_10173978 | |||
| 2473 | Ga0207663_10383107 | |||
| 2474 | Ga0207660_10774686 | |||
| 2475 | Ga0207660_11262676 | |||
| 2476 | Ga0207662_10059669 | |||
| 2477 | Ga0207662_10068221 | |||
| 2478 | Ga0207662_10086791 | |||
| 2479 | Ga0207662_10136184 | |||
| 2480 | Ga0207662_10153364 | |||
| 2481 | Ga0207662_11017249 | |||
| 2482 | Ga0207657_10064105 | |||
| 2483 | Ga0207657_10489885 | |||
| 2484 | Ga0207657_10604040 | |||
| 2485 | Ga0207657_10653070 | |||
| 2486 | Ga0207649_10268711 | |||
| 2487 | Ga0207649_10724585 | |||
| 2488 | Ga0207652_10293903 | |||
| 2489 | Ga0207646_10000343 | |||
| 2490 | Ga0207646_10080346 | |||
| 2491 | Ga0207646_10140516 | |||
| 2492 | Ga0207646_10147358 | |||
| 2493 | Ga0207646_10207606 | |||
| 2494 | Ga0207646_10215582 | |||
| 2495 | Ga0207646_10333027 | |||
| 2496 | Ga0207646_10581853 | |||
| 2497 | Ga0207646_10586794 | |||
| 2498 | Ga0207646_10821657 | |||
| 2499 | Ga0207646_11430375 | |||
| 2500 | Ga0207681_10002742 | |||
| 2501 | Ga0207681_10152701 | |||
| 2502 | Ga0207681_10287031 | |||
| 2503 | Ga0207681_10767289 | |||
| 2504 | Ga0207681_11437631 | |||
| 2505 | Ga0207694_10000001 | |||
| 2506 | Ga0207694_10176365 | |||
| 2507 | Ga0207650_10000082 | |||
| 2508 | Ga0207650_10011593 | |||
| 2509 | Ga0207650_10048909 | |||
| 2510 | Ga0207650_10116501 | |||
| 2511 | Ga0207650_10302623 | |||
| 2512 | Ga0207650_10768909 | |||
| 2513 | Ga0207659_10000036 | |||
| 2514 | Ga0207659_10115953 | |||
| 2515 | Ga0207659_10120504 | |||
| 2516 | Ga0207659_10287415 | |||
| 2517 | Ga0207659_10329048 | |||
| 2518 | Ga0207659_10403812 | |||
| 2519 | Ga0207659_10669329 | |||
| 2520 | Ga0207659_10779324 | |||
| 2521 | Ga0207687_10000005 | |||
| 2522 | Ga0207687_10607398 | |||
| 2523 | Ga0207687_11309652 | |||
| 2524 | Ga0207687_11549680 | |||
| 2525 | Ga0207700_10051399 | |||
| 2526 | Ga0207700_10089784 | |||
| 2527 | Ga0207700_10098343 | |||
| 2528 | Ga0207700_10801507 | |||
| 2529 | Ga0207700_10945405 | |||
| 2530 | Ga0207644_10055836 | |||
| 2531 | Ga0207644_10259586 | |||
| 2532 | Ga0207644_11465725 | |||
| 2533 | Ga0207690_10025055 | |||
| 2534 | Ga0207690_10136438 | |||
| 2535 | Ga0207706_10013582 | |||
| 2536 | Ga0207706_10073033 | |||
| 2537 | Ga0207706_10091565 | |||
| 2538 | Ga0207706_10105904 | |||
| 2539 | Ga0207706_10433223 | |||
| 2540 | Ga0207706_10588375 | |||
| 2541 | Ga0207706_10954501 | |||
| 2542 | Ga0207686_10001508 | |||
| 2543 | Ga0207686_10217571 | |||
| 2544 | Ga0207709_10000026 | |||
| 2545 | Ga0207709_10210974 | |||
| 2546 | Ga0207709_11215995 | |||
| 2547 | Ga0207670_10070690 | |||
| 2548 | Ga0207670_10136374 | |||
| 2549 | Ga0207670_10148699 | |||
| 2550 | Ga0207670_10150696 | |||
| 2551 | Ga0207670_10309877 | |||
| 2552 | Ga0207670_10474085 | |||
| 2553 | Ga0207670_10531204 | |||
| 2554 | Ga0207670_10555149 | |||
| 2555 | Ga0207670_10850257 | |||
| 2556 | Ga0207670_11671863 | |||
| 2557 | Ga0207669_10100540 | |||
| 2558 | Ga0207669_10323551 | |||
| 2559 | Ga0207669_10468953 | |||
| 2560 | Ga0207669_10705697 | |||
| 2561 | Ga0207669_11881879 | |||
| 2562 | Ga0207704_10003857 | |||
| 2563 | Ga0207704_10029913 | |||
| 2564 | Ga0207704_10765814 | |||
| 2565 | Ga0207704_11810931 | |||
| 2566 | Ga0207665_10006268 | |||
| 2567 | Ga0207665_10009968 | |||
| 2568 | Ga0207665_10018501 | |||
| 2569 | Ga0207665_10026836 | |||
| 2570 | Ga0207665_10251041 | |||
| 2571 | Ga0207665_10305436 | |||
| 2572 | Ga0207665_10457139 | |||
| 2573 | Ga0207665_10496467 | |||
| 2574 | Ga0207665_10548002 | |||
| 2575 | Ga0207665_10864190 | |||
| 2576 | Ga0207691_10000326 | |||
| 2577 | Ga0207691_10002644 | |||
| 2578 | Ga0207691_10006947 | |||
| 2579 | Ga0207691_10133717 | |||
| 2580 | Ga0207691_10204635 | |||
| 2581 | Ga0207691_10289454 | |||
| 2582 | Ga0207691_10727844 | |||
| 2583 | Ga0207691_11018557 | |||
| 2584 | Ga0207711_10007454 | |||
| 2585 | Ga0207711_10197035 | |||
| 2586 | Ga0207711_10389374 | |||
| 2587 | Ga0207711_11458974 | |||
| 2588 | Ga0207711_11985335 | |||
| 2589 | Ga0207689_10009254 | |||
| 2590 | Ga0207689_10009503 | |||
| 2591 | Ga0207689_10020085 | |||
| 2592 | Ga0207689_10065221 | |||
| 2593 | Ga0207689_10140200 | |||
| 2594 | Ga0207689_10340280 | |||
| 2595 | Ga0207689_10446792 | |||
| 2596 | Ga0207689_11199927 | |||
| 2597 | Ga0207689_11416054 | |||
| 2598 | Ga0207661_10000006 | |||
| 2599 | Ga0207661_10007008 | |||
| 2600 | Ga0207661_10082186 | |||
| 2601 | Ga0207679_10071083 | |||
| 2602 | Ga0207679_10482510 | |||
| 2603 | Ga0207679_10566129 | |||
| 2604 | Ga0207679_10716020 | |||
| 2605 | Ga0207679_11403420 | |||
| 2606 | Ga0207679_11573638 | |||
| 2607 | Ga0207667_10003431 | |||
| 2608 | Ga0207667_10023566 | |||
| 2609 | Ga0207651_10006583 | |||
| 2610 | Ga0207651_10007125 | |||
| 2611 | Ga0207651_10064605 | |||
| 2612 | Ga0207651_10099429 | |||
| 2613 | Ga0207651_10742043 | |||
| 2614 | Ga0207651_10855995 | |||
| 2615 | Ga0207651_11107468 | |||
| 2616 | Ga0207712_10290886 | |||
| 2617 | Ga0207712_10624678 | |||
| 2618 | Ga0207712_10782455 | |||
| 2619 | Ga0207712_10943791 | |||
| 2620 | Ga0207668_10018999 | |||
| 2621 | Ga0207668_10554333 | |||
| 2622 | Ga0207640_10107477 | |||
| 2623 | Ga0207640_10305543 | |||
| 2624 | Ga0207640_10989329 | |||
| 2625 | Ga0207658_10001637 | |||
| 2626 | Ga0207658_10055938 | |||
| 2627 | Ga0207658_10351037 | |||
| 2628 | Ga0207677_10000101 | |||
| 2629 | Ga0207677_10218669 | |||
| 2630 | Ga0207677_10291313 | |||
| 2631 | Ga0207677_11090546 | |||
| 2632 | Ga0207677_11423989 | |||
| 2633 | Ga0207677_11805638 | |||
| 2634 | Ga0207703_10007604 | |||
| 2635 | Ga0207703_10316451 | |||
| 2636 | Ga0207703_10392236 | |||
| 2637 | Ga0207703_10410089 | |||
| 2638 | Ga0207703_11039613 | |||
| 2639 | Ga0207703_11467887 | |||
| 2640 | Ga0207703_11536237 | |||
| 2641 | Ga0207639_10000013 | |||
| 2642 | Ga0207639_10189920 | |||
| 2643 | Ga0207639_10492689 | |||
| 2644 | Ga0207678_10049059 | |||
| 2645 | Ga0207678_10190888 | |||
| 2646 | Ga0207678_10222677 | |||
| 2647 | Ga0207678_10759286 | |||
| 2648 | Ga0207678_11932014 | |||
| 2649 | Ga0207708_10000041 | |||
| 2650 | Ga0207708_10011108 | |||
| 2651 | Ga0207708_10012451 | |||
| 2652 | Ga0207708_10906223 | |||
| 2653 | Ga0207702_10001471 | |||
| 2654 | Ga0207702_10011175 | |||
| 2655 | Ga0207702_10182964 | |||
| 2656 | Ga0207702_10332278 | |||
| 2657 | Ga0207702_10808274 | |||
| 2658 | Ga0207702_10819429 | |||
| 2659 | Ga0207702_11743255 | |||
| 2660 | Ga0207641_10037244 | |||
| 2661 | Ga0207641_10048111 | |||
| 2662 | Ga0207641_10137639 | |||
| 2663 | Ga0207641_10147519 | |||
| 2664 | Ga0207641_10465979 | |||
| 2665 | Ga0207641_10611981 | |||
| 2666 | Ga0207641_10648581 | |||
| 2667 | Ga0207641_10688216 | |||
| 2668 | Ga0207648_10011154 | |||
| 2669 | Ga0207648_10024555 | |||
| 2670 | Ga0207648_10035580 | |||
| 2671 | Ga0207648_10043194 | |||
| 2672 | Ga0207648_10307115 | |||
| 2673 | Ga0207648_10359341 | |||
| 2674 | Ga0207676_10098517 | |||
| 2675 | Ga0207676_10177426 | |||
| 2676 | Ga0207676_10214264 | |||
| 2677 | Ga0207676_10500738 | |||
| 2678 | Ga0207676_10736336 | |||
| 2679 | Ga0207674_11570213 | |||
| 2680 | Ga0207674_11773476 | |||
| 2681 | Ga0207675_100002645 | |||
| 2682 | Ga0207675_100002673 | |||
| 2683 | Ga0207675_100013850 | |||
| 2684 | Ga0207675_100060186 | |||
| 2685 | Ga0207675_100109886 | |||
| 2686 | Ga0207675_100361315 | |||
| 2687 | Ga0207675_101074241 | |||
| 2688 | Ga0207683_10005107 | |||
| 2689 | Ga0207683_10317284 | |||
| 2690 | Ga0207683_10512688 | |||
| 2691 | Ga0207698_10043801 | |||
| 2692 | Ga0207698_10208854 | |||
| 2693 | Ga0207698_10703309 | |||
| 2694 | Ga0207698_12121934 | |||
| 2695 | Ga0209969_1040868 | |||
| 2696 | Ga0209981_1011093 | |||
| 2697 | Ga0209996_1014048 | |||
| 2698 | Ga0209179_1027708 | |||
| 2699 | Ga0209968_1002058 | |||
| 2700 | Ga0209982_1007080 | |||
| 2701 | Ga0210002_1020599 | |||
| 2702 | Ga0209983_1000280 | |||
| 2703 | Ga0209588_1025351 | |||
| 2704 | Ga0209588_1032623 | |||
| 2705 | Ga0209588_1218255 | |||
| 2706 | Ga0209971_1000384 | |||
| 2707 | Ga0209966_1133005 | |||
| 2708 | Ga0209998_10002827 | |||
| 2709 | Ga0209974_10004420 | |||
| 2710 | Ga0209974_10128164 | |||
| 2711 | Ga0209974_10197531 | |||
| 2712 | Ga0207428_10000030 | |||
| 2713 | Ga0207428_10017611 | |||
| 2714 | Ga0207428_10042290 | |||
| 2715 | Ga0207428_10380583 | |||
| 2716 | Ga0207428_11037160 | |||
| 2717 | Ga0207428_11047024 | |||
| 2718 | Ga0268266_10000259 | |||
| 2719 | Ga0268266_10015961 | |||
| 2720 | Ga0268266_10047157 | |||
| 2721 | Ga0268266_10309020 | |||
| 2722 | Ga0268265_10009861 | |||
| 2723 | Ga0268265_10034866 | |||
| 2724 | Ga0268265_10037170 | |||
| 2725 | Ga0268265_10045924 | |||
| 2726 | Ga0268265_10220454 | |||
| 2727 | Ga0268265_10485770 | |||
| 2728 | Ga0268265_10490222 | |||
| 2729 | Ga0268265_10490646 | |||
| 2730 | Ga0268265_11237145 | |||
| 2731 | Ga0268265_11331701 | |||
| 2732 | Ga0268264_10005977 | |||
| 2733 | Ga0268264_10044863 | |||
| 2734 | Ga0268264_10049767 | |||
| 2735 | Ga0268264_10136493 | |||
| 2736 | Ga0268264_10144015 | |||
| 2737 | Ga0268264_10197367 | |||
| 2738 | Ga0268264_10209665 | |||
| 2739 | Ga0268264_10259334 | |||
| 2740 | Ga0268264_10362378 | |||
| 2741 | Ga0268264_10497856 | |||
| 2742 | Ga0268264_11076106 | |||
| 2743 | Ga0268264_11085509 | |||
| 2744 | Ga0265319_1044281 | |||
| 2745 | Ga0265319_1060122 | |||
| 2746 | Ga0265334_10078109 | |||
| 2747 | Ga0265323_10004178 | |||
| 2748 | Ga0265323_10067614 | |||
| 2749 | Ga0265338_10016967 | |||
| 2750 | Ga0265338_10128873 | |||
| 2751 | Ga0265338_10345344 | |||
| 2752 | Ga0265338_10642953 | |||
| 2753 | Ga0265338_11184375 | |||
| 2754 | Ga0307511_10002513 | |||
| 2755 | Ga0307511_10231185 | |||
| 2756 | Ga0265767_110710 | |||
| 2757 | Ga0265767_112437 | |||
| 2758 | Ga0265764_113392 | |||
| 2759 | Ga0265330_10000541 | |||
| 2760 | Ga0265330_10001334 | |||
| 2761 | Ga0265330_10003060 | |||
| 2762 | Ga0265330_10375265 | |||
| 2763 | Ga0265332_10064443 | |||
| 2764 | Ga0265332_10155677 | |||
| 2765 | Ga0265328_10051354 | |||
| 2766 | Ga0265320_10307898 | |||
| 2767 | Ga0265329_10003473 | |||
| 2768 | Ga0265329_10015790 | |||
| 2769 | Ga0265329_10034598 | |||
| 2770 | Ga0265340_10015118 | |||
| 2771 | Ga0265339_10055328 | |||
| 2772 | Ga0265339_10075819 | |||
| 2773 | Ga0265339_10240841 | |||
| 2774 | Ga0265331_10073224 | |||
| 2775 | Ga0265331_10233136 | |||
| 2776 | Ga0265316_10000251 | |||
| 2777 | Ga0265316_10000984 | |||
| 2778 | Ga0265316_10014237 | |||
| 2779 | Ga0265316_10018769 | |||
| 2780 | Ga0265316_10028493 | |||
| 2781 | Ga0265316_10048657 | |||
| 2782 | Ga0265316_10169982 | |||
| 2783 | Ga0265316_10388436 | |||
| 2784 | Ga0307408_100164966 | |||
| 2785 | Ga0307408_100236106 | |||
| 2786 | Ga0307408_102138195 | |||
| 2787 | Ga0265313_10122813 | |||
| 2788 | Ga0307508_10050191 | |||
| 2789 | Ga0316575_10002995 | |||
| 2790 | Ga0316575_10014672 | |||
| 2791 | Ga0316575_10021116 | |||
| 2792 | Ga0316579_10070932 | |||
| 2793 | Ga0316579_10157791 | |||
| 2794 | Ga0265314_10023438 | |||
| 2795 | Ga0265314_10114121 | |||
| 2796 | Ga0265342_10008085 | |||
| 2797 | Ga0265342_10036131 | |||
| 2798 | Ga0265342_10039697 | |||
| 2799 | Ga0265342_10085382 | |||
| 2800 | Ga0265342_10176966 | |||
| 2801 | Ga0316576_10012802 | |||
| 2802 | Ga0316576_10031380 | |||
| 2803 | Ga0316576_10072783 | |||
| 2804 | Ga0316576_10254444 | |||
| 2805 | Ga0316576_10343935 | |||
| 2806 | Ga0316576_10358298 | |||
| 2807 | Ga0316578_10148460 | |||
| 2808 | Ga0307516_10003404 | |||
| 2809 | Ga0307405_10139666 | |||
| 2810 | Ga0307405_10724904 | |||
| 2811 | Ga0316577_10006446 | |||
| 2812 | Ga0316577_10035166 | |||
| 2813 | Ga0316577_10160530 | |||
| 2814 | Ga0316577_10429752 | |||
| 2815 | Ga0307413_10005834 | |||
| 2816 | Ga0307413_10371109 | |||
| 2817 | Ga0307410_10001864 | |||
| 2818 | Ga0307410_10034138 | |||
| 2819 | Ga0307410_10371816 | |||
| 2820 | Ga0326468_10043698 | |||
| 2821 | Ga0307406_10235992 | |||
| 2822 | Ga0307406_10787551 | |||
| 2823 | Ga0307406_12037644 | |||
| 2824 | Ga0307407_10033183 | |||
| 2825 | Ga0307407_11490439 | |||
| 2826 | Ga0307412_10233228 | |||
| 2827 | Ga0307412_10394963 | |||
| 2828 | Ga0307412_11035527 | |||
| 2829 | Ga0307412_11463688 | |||
| 2830 | Ga0307409_100002915 | |||
| 2831 | Ga0307409_100048335 | |||
| 2832 | Ga0307409_100109897 | |||
| 2833 | Ga0307409_100625568 | |||
| 2834 | Ga0307409_101589606 | |||
| 2835 | Ga0307409_102225915 | |||
| 2836 | Ga0307416_100018585 | |||
| 2837 | Ga0307416_100039410 | |||
| 2838 | Ga0307416_100496117 | |||
| 2839 | Ga0307416_100807659 | |||
| 2840 | Ga0307416_101190947 | |||
| 2841 | Ga0307416_101215820 | |||
| 2842 | Ga0307416_101970819 | |||
| 2843 | Ga0307414_10005193 | |||
| 2844 | Ga0307414_10007281 | |||
| 2845 | Ga0307414_10028964 | |||
| 2846 | Ga0307414_10042491 | |||
| 2847 | Ga0307411_10003742 | |||
| 2848 | Ga0307411_10008827 | |||
| 2849 | Ga0307411_11011757 | |||
| 2850 | Ga0307411_11232053 | |||
| 2851 | Ga0316053_117483 | |||
| 2852 | Ga0307415_100056689 | |||
| 2853 | Ga0307415_100268612 | |||
| 2854 | Ga0307415_101068181 | |||
| 2855 | Ga0307415_101167579 | |||
| 2856 | Ga0316593_10001783 | |||
| 2857 | Ga0316593_10002618 | |||
| 2858 | Ga0316593_10014252 | |||
| 2859 | Ga0316593_10019333 | |||
| 2860 | Ga0316593_10019508 | |||
| 2861 | Ga0316593_10028372 | |||
| 2862 | Ga0316593_10158812 | |||
| 2863 | Ga0316593_10316334 | |||
| 2864 | Ga0316593_10329705 | |||
| 2865 | Ga0316592_1024201 | |||
| 2866 | Ga0316588_1007611 | |||
| 2867 | Ga0316588_1018568 | |||
| 2868 | Ga0316588_1040523 | |||
| 2869 | Ga0316588_1051023 | |||
| 2870 | Ga0316588_1067069 | |||
| 2871 | Ga0316588_1067880 | |||
| 2872 | Ga0316588_1088459 | |||
| 2873 | Ga0316588_1105398 | |||
| 2874 | Ga0316596_1000493 | |||
| 2875 | Ga0316596_1070869 | |||
| 2876 | Ga0316596_1169994 | |||
| 2877 | Ga0373930_0030179 | |||
| 2878 | Ga0373948_0130321 | |||
| 2879 | Ga0373948_0132447 | |||
| 2880 | Ga0373958_0009873 | |||
| 2881 | Ga0373959_0134078 | |||
| 2882 | Ga0373938_0175085 | |||
| 2883 | Ga0373926_0001122 | |||
| 2884 | Ga0373926_0009400 | |||
| 2885 | Ga0373926_0258941 | |||
| 2886 | Ga0373929_0094499 | |||
| 2887 | Ga0373934_0104707 | |||
| 2888 | Ga0373940_0187565 | |||
| 2889 | Ga0373944_0057907 | |||
| 2890 | Ga0373944_0244742 | |||
| 2891 | Ga0373951_0113679 | |||
| 2892 | Ga0373952_0180221 | |||
| 2893 | Ga0373923_0053759 | |||
| 2894 | Ga0373923_0090832 | |||
| 2895 | Ga0373923_0385065 | |||
| 2896 | Ga0373923_0433015 | |||
| 2897 | Ga0373932_0274730 | |||
| 2898 | Ga0373936_0037210 | |||
| 2899 | Ga0373936_0205470 | |||
| 2900 | Ga0373936_0418617 | |||
| 2901 | Ga0373939_0122999 | |||
| 2902 | Ga0373941_0115498 | |||
| 2903 | Ga0373941_0205636 | |||
| 2904 | Ga0373945_0018377 | |||
| 2905 | Ga0373945_0062158 | |||
| 2906 | Ga0373953_0002723 | |||
| 2907 | Ga0373953_0086762 | |||
| 2908 | Ga0373953_0118381 | |||
| 2909 | Ga0373954_0014604 | |||
| 2910 | Ga0373954_0156125 | |||
| 2911 | Ga0373954_0163207 | |||
| 2912 | Ga0373954_0522548 | |||
| 2913 | Ga0373956_0009506 | |||
| 2914 | Ga0373956_0010739 | |||
| 2915 | Ga0373956_0108665 | |||
| 2916 | Ga0373957_0057958 | |||
| 2917 | Ga0373957_0117503 | |||
| 2918 | Ga0373957_0154822 | |||
| 2919 | Ga0373960_0231198 | |||
| 2920 | Ga0373943_0011073 | |||
| 2921 | Ga0373943_0367741 | |||
| 2922 | Ga0373955_0013590 | |||
| 2923 | Ga0373955_0037811 | |||
| 2924 | Ga0373955_0058171 | |||
| 2925 | Ga0373955_0109033 | |||
| 2926 | Ga0373955_0327525 | |||
| 2927 | Ga0373955_0345873 | |||
| 2928 | Ga0373942_0347133 | |||
| 2929 | Ga0373961_0135251 | |||
| 2930 | Ga0373961_0146509 | |||
| 2931 | Ga0373961_0257992 | |||
| 2932 | Ga0316574_0001004 | |||
| 2933 | Ga0316574_0022880 | |||
| 2934 | Ga0316574_0047770 | |||
| 2935 | Ga0316574_0109331 | |||
| 2936 | Ga0316574_0140482 | |||
| 2937 | Ga0316574_0143803 | |||
| 2938 | Ga0316574_0161536 | |||
| 2939 | Ga0316574_0833998 | |||
| 2940 | Ga0373924_0126646 | |||
| 2941 | Ga0373931_0136727 | |||
| 2942 | Ga0373931_0260324 | |||
| 2943 | Ga0373931_0303750 | |||
| 2944 | Ga0373931_1274424 | |||
| 2945 | Ga0373935_0051065 | |||
| 2946 | Ga0373935_0075929 | |||
| 2947 | Ga0373927_0004438 | |||
| 2948 | Ga0373927_0005589 | |||
| 2949 | Ga0373927_0161417 | |||
| 2950 | Ga0373927_0625416 | |||
| 2951 | Ga0373927_1096771 | |||
| 2952 | Ga0373933_0294661 | |||
| 2953 | Ga0373933_0373450 | |||
| 2954 | Ga0373947_0007919 | |||
| 2955 | Ga0373947_0013676 | |||
| 2956 | Ga0373947_0114040 | |||
| 2957 | Ga0373947_0223935 | |||
| 2958 | Ga0373947_0256443 | |||
| 2959 | Ga0373947_0783854 | |||
| 2960 | Ga0373947_0992452 | |||
| 2961 | Ga0373937_0007252 | |||
| 2962 | Ga0373937_0025601 | |||
| 2963 | Ga0373937_0030240 | |||
| 2964 | Ga0373937_0056404 | |||
| 2965 | Ga0373937_0076114 | |||
| 2966 | Ga0373937_0113979 | |||
| 2967 | Ga0373937_0171110 | |||
| 2968 | Ga0373937_0431917 | |||
| 2969 | Ga0373937_0866335 | |||
| 2970 | Ga0373937_1848163 | |||
| 2971 | Ga0373937_2066069 | |||
| 2972 | Ga0316582_0200485 | |||
| 2973 | Ga0316582_0287953 | |||
| 2974 | Ga0316582_0643517 | |||
| 2975 | Ga0316582_0705715 | |||
| 2976 | Ga0316584_0351874 | |||
| 2977 | Ga0316584_0358687 | |||
| 2978 | Ga0316584_0408499 | |||
| 2979 | Ga0316584_0518106 | |||
| 2980 | Ga0316584_0577819 | |||
| 2981 | Ga0316584_0622151 | |||
| 2982 | Ga0316584_0726414 | |||
| 2983 | Ga0316584_0729147 | |||
| 2984 | Ga0316584_0734471 | |||
| 2985 | Ga0373925_0001662 | |||
| 2986 | Ga0373925_0001788 | |||
| 2987 | Ga0373925_0094451 | |||
| 2988 | Ga0373925_0262346 | |||
| 2989 | Ga0373925_0263319 | |||
| 2990 | Ga0373925_0554776 | |||
| 2991 | Ga0373925_0872321 | |||
| 2992 | Ga0395899_0173762 | |||
| 2993 | Ga0395900_0018609 | |||
| 2994 | Ga0395900_0954656 | |||
| 2995 | Ga0395900_1480901 | |||
| 2996 | Ga0395900_1668877 | |||
| 2997 | Ga0395898_0564374 | |||
| 2998 | Ga0395905_0000275 | |||
| 2999 | Ga0395905_0001744 | |||
| 3000 | Ga0395905_0082831 | |||
| 3001 | Ga0395905_0369455 | |||
| 3002 | Ga0395905_0877384 | |||
| 3003 | Ga0316581_0013010 | |||
| 3004 | Ga0395901_0113158 | |||
| 3005 | Ga0400490_17491 | |||
| 3006 | Ga0400491_12215 | |||
| 3007 | Ga0400483_126972 | |||
| 3008 | Ga0400483_247471 | |||
| 3009 | Ga0400489_10986 | |||
| 3010 | Ga0400489_86969 | |||
| 3011 | Ga0436365_0154164 | |||
| 3012 | Ga0436365_1563210 | |||
| 3013 | Ga0436365_1839659 | |||
| 3014 | Ga0436365_1927449 | |||
| 3015 | Ga0436360_0080201 | |||
| 3016 | Ga0436360_0406311 | |||
| 3017 | Ga0436363_0576030 | |||
| 3018 | Ga0436363_1475130 | |||
| 3019 | Ga0436362_0225975 | |||
| 3020 | Ga0436362_1063276 | |||
| 3021 | Ga0436362_1069013 | |||
| 3022 | Ga0439461_0064471 | |||
| 3023 | Ga0451793_0687095 | |||
| 3024 | Ga0451795_0060284 | |||
| 3025 | Ga0451839_0487727 | |||
| 3026 | Ga0451851_0850392 | |||
| 3027 | Ga0439433_0112274 | |||
| 3028 | Ga0439451_125562 | |||
| 3029 | Ga0439444_0094397 | |||
| 3030 | Ga0451577_0008700 | |||
| 3031 | Ga0451577_0012592 | |||
| 3032 | Ga0451577_0016347 | |||
| 3033 | Ga0451577_0033756 | |||
| 3034 | Ga0451577_0134048 | |||
| 3035 | Ga0451577_0161269 | |||
| 3036 | Ga0451577_0317597 | |||
| 3037 | Ga0451577_1403892 | |||
| 3038 | Ga0439440_0013796 | |||
| 3039 | Ga0453683_0000086 | |||
| 3040 | Ga0453683_0008784 | |||
| 3041 | Ga0453683_0054837 | |||
| 3042 | Ga0453683_0055812 | |||
| 3043 | Ga0453683_0122574 | |||
| 3044 | Ga0453683_0216829 | |||
| 3045 | Ga0466965_0436268 | |||
| 3046 | Ga0453684_0001061 | |||
| 3047 | Ga0453684_0001518 | |||
| 3048 | Ga0453684_0006427 | |||
| 3049 | Ga0453684_0008349 | |||
| 3050 | Ga0453684_0011806 | |||
| 3051 | Ga0453684_0019106 | |||
| 3052 | Ga0453684_0019836 | |||
| 3053 | Ga0453684_0020573 | |||
| 3054 | Ga0453684_0033355 | |||
| 3055 | Ga0453684_0037288 | |||
| 3056 | Ga0453684_0042819 | |||
| 3057 | Ga0453684_0044000 | |||
| 3058 | Ga0453684_0048627 | |||
| 3059 | Ga0453684_0060385 | |||
| 3060 | Ga0453684_0062580 | |||
| 3061 | Ga0453684_0075363 | |||
| 3062 | Ga0453684_0090894 | |||
| 3063 | Ga0453684_0111000 | |||
| 3064 | Ga0453684_0240329 | |||
| 3065 | Ga0453684_0373414 | |||
| 3066 | Ga0453684_0646837 | |||
| 3067 | Ga0453684_1257000 | |||
| 3068 | Ga0453684_1813505 | |||
| 3069 | Ga0451576_0004083 | |||
| 3070 | Ga0451576_0005300 | |||
| 3071 | Ga0451576_0019582 | |||
| 3072 | Ga0451576_0093519 | |||
| 3073 | Ga0451576_0129629 | |||
| 3074 | Ga0451576_0137895 | |||
| 3075 | Ga0451576_0196516 | |||
| 3076 | Ga0451576_0213585 | |||
| 3077 | Ga0451576_0215670 | |||
| 3078 | Ga0451576_0312134 | |||
| 3079 | Ga0451576_0499547 | |||
| 3080 | Ga0451576_0648915 | |||
| 3081 | Ga0451576_0682098 | |||
| 3082 | Ga0451576_1292499 | |||
| 3083 | Ga0451576_2130053 | |||
| 3084 | Ga0466967_0445372 | |||
| 3085 | Ga0466967_0955867 | |||
| 3086 | Ga0495617_143473 | |||
| 3087 | Ga0495592_0161903 | |||
| 3088 | Ga0495603_0016598 | |||
| 3089 | Ga0495603_0334793 | |||
| 3090 | Ga0495629_0007707 | |||
| 3091 | Ga0495629_0016479 | |||
| 3092 | Ga0495629_0184529 | |||
| 3093 | Ga0495629_0419104 | |||
| 3094 | Ga0495641_0041758 | |||
| 3095 | Ga0495641_0047852 | |||
| 3096 | Ga0495641_0125788 | |||
| 3097 | Ga0495641_0141431 | |||
| 3098 | Ga0495651_0042906 | |||
| 3099 | Ga0495651_0481615 | |||
| 3100 | Ga0495651_0597215 | |||
| 3101 | Ga0495580_0001448 | |||
| 3102 | Ga0495580_0002827 | |||
| 3103 | Ga0495580_0005582 | |||
| 3104 | Ga0495580_0012791 | |||
| 3105 | Ga0495580_0050436 | |||
| 3106 | Ga0495580_0057891 | |||
| 3107 | Ga0495580_0080283 | |||
| 3108 | Ga0495580_0121196 | |||
| 3109 | Ga0495580_0125962 | |||
| 3110 | Ga0495580_0261064 | |||
| 3111 | Ga0495580_0411869 | |||
| 3112 | Ga0495580_0584354 | |||
| 3113 | Ga0495580_0654197 | |||
| 3114 | Ga0495580_0921904 | |||
| 3115 | Ga0495582_0000113 | |||
| 3116 | Ga0495582_0026338 | |||
| 3117 | Ga0495582_0079298 | |||
| 3118 | Ga0495582_0295889 | |||
| 3119 | Ga0495582_0417230 | |||
| 3120 | Ga0495639_0020227 | |||
| 3121 | Ga0495639_0122966 | |||
| 3122 | Ga0495662_0522177 | |||
| 3123 | Ga0495664_0005945 | |||
| 3124 | Ga0495584_0399912 | |||
| 3125 | Ga0495585_0380470 | |||
| 3126 | Ga0495585_0494208 | |||
| 3127 | Ga0495594_0021611 | |||
| 3128 | Ga0495594_0076463 | |||
| 3129 | Ga0495594_0452844 | |||
| 3130 | Ga0495616_0235832 | |||
| 3131 | Ga0495618_0033948 | |||
| 3132 | Ga0495618_0047295 | |||
| 3133 | Ga0495618_0179620 | |||
| 3134 | Ga0495618_0346716 | |||
| 3135 | Ga0495628_0268257 | |||
| 3136 | Ga0495628_0573546 | |||
| 3137 | Ga0495630_0003551 | |||
| 3138 | Ga0495630_0016248 | |||
| 3139 | Ga0495630_0019992 | |||
| 3140 | Ga0495630_0776267 | |||
| 3141 | Ga0495630_0982529 | |||
| 3142 | Ga0495666_0137734 | |||
| 3143 | Ga0495666_0195179 | |||
| 3144 | Ga0495666_0326231 | |||
| 3145 | Ga0495666_0333159 | |||
| 3146 | Ga0495642_0362330 | |||
| 3147 | Ga0495652_0354639 | |||
| 3148 | Ga0495652_0384663 | |||
| 3149 | Ga0495665_0017070 | |||
| 3150 | Ga0495665_0038759 | |||
| 3151 | Ga0495665_0105049 | |||
| 3152 | Ga0495665_0695753 | |||
| 3153 | Ga0495640_0084228 | |||
| 3154 | Ga0495640_0194210 | |||
| 3155 | Ga0495640_0739393 | |||
| 3156 | Ga0495586_0003305 | |||
| 3157 | Ga0495586_0031142 | |||
| 3158 | Ga0495586_0031189 | |||
| 3159 | Ga0495586_0047729 | |||
| 3160 | Ga0495587_0002355 | |||
| 3161 | Ga0495587_0019640 | |||
| 3162 | Ga0495587_0213134 | |||
| 3163 | Ga0495598_0017282 | |||
| 3164 | Ga0495645_0630048 | |||
| 3165 | Ga0495645_0654462 | |||
| 3166 | Ga0495622_0267752 | |||
| 3167 | Ga0495633_0069411 | |||
| 3168 | Ga0495656_0000397 | |||
| 3169 | Ga0495656_0517719 | |||
| 3170 | Ga0495656_0726992 | |||
| 3171 | Ga0495668_0770055 | |||
| 3172 | Ga0495634_0000649 | |||
| 3173 | Ga0495634_0165167 | |||
| 3174 | Ga0495635_0069638 | |||
| 3175 | Ga0495588_0457836 | |||
| 3176 | Ga0495657_0158952 | |||
| 3177 | Ga0495657_0273279 | |||
| 3178 | Ga0495657_0274523 | |||
| 3179 | Ga0495657_0444406 | |||
| 3180 | Ga0495623_0095320 | |||
| 3181 | Ga0495647_0004304 | |||
| 3182 | Ga0495647_0006082 | |||
| 3183 | Ga0495647_0007570 | |||
| 3184 | Ga0495647_0040084 | |||
| 3185 | Ga0495647_0249323 | |||
| 3186 | Ga0495647_0452968 | |||
| 3187 | Ga0495658_0017882 | |||
| 3188 | Ga0495658_0028263 | |||
| 3189 | Ga0495658_0056441 | |||
| 3190 | Ga0495658_0189652 | |||
| 3191 | Ga0495669_0106398 | |||
| 3192 | Ga0495669_0505155 | |||
| 3193 | Ga0495613_0042407 | |||
| 3194 | Ga0495613_0095480 | |||
| 3195 | Ga0495613_0642490 | |||
| 3196 | Ga0495624_0023361 | |||
| 3197 | Ga0495670_0019811 | |||
| 3198 | Ga0495670_0731190 | |||
| 3199 | Ga0495589_0432283 | |||
| 3200 | Ga0495600_0047423 | |||
| 3201 | Ga0495600_0361141 | |||
| 3202 | Ga0495581_0208241 | |||
| 3203 | Ga0495581_0262135 | |||
| 3204 | Ga0495604_0039896 | |||
| 3205 | Ga0495604_0368503 | |||
| 3206 | Ga0495604_0595068 | |||
| 3207 | Ga0495604_0776194 | |||
| 3208 | Ga0495636_0000893 | |||
| 3209 | Ga0495636_0044847 | |||
| 3210 | Ga0495636_0175385 | |||
| 3211 | Ga0495636_0273477 | |||
| 3212 | Ga0495674_0001336 | |||
| 3213 | Ga0495674_0036483 | |||
| 3214 | Ga0495674_0094633 | |||
| 3215 | Ga0495674_0202418 | |||
| 3216 | Ga0495674_0835104 | |||
| 3217 | Ga0495676_0030282 | |||
| 3218 | Ga0495676_0588623 | |||
| 3219 | Ga0495680_0202098 | |||
| 3220 | Ga0495680_0378620 | |||
| 3221 | Ga0495680_1005008 | |||
| 3222 | Ga0495675_0068217 | |||
| 3223 | Ga0495679_007316 | |||
| 3224 | Ga0495684_0026659 | |||
| 3225 | Ga0495684_0054352 | |||
| 3226 | Ga0495684_0078814 | |||
| 3227 | Ga0495684_0231057 | |||
| 3228 | Ga0495684_0260054 | |||
| 3229 | Ga0495593_0078777 | |||
| 3230 | Ga0495593_0252399 | |||
| 3231 | Ga0495602_0017278 | |||
| 3232 | Ga0495602_0227086 | |||
| 3233 | Ga0495614_0010953 | |||
| 3234 | Ga0495614_0069510 | |||
| 3235 | Ga0495615_0003089 | |||
| 3236 | Ga0496100_0003660 | |||
| 3237 | Ga0496100_0017930 | |||
| 3238 | Ga0496100_0998411 | |||
| 3239 | Ga0496101_0025125 | |||
| 3240 | Ga0496101_0179518 | |||
| 3241 | Ga0496101_0523564 | |||
| 3242 | Ga0496101_0666373 | |||
| 3243 | Ga0496101_0925184 | |||
| 3244 | Ga0496102_0000916 | |||
| 3245 | Ga0496102_0003028 | |||
| 3246 | Ga0496102_0018905 | |||
| 3247 | Ga0496102_0035581 | |||
| 3248 | Ga0496102_0146115 | |||
| 3249 | Ga0496102_0766183 | |||
| 3250 | Ga0496103_0030082 | |||
| 3251 | Ga0496104_0028984 | |||
| 3252 | Ga0496104_0036226 | |||
| 3253 | Ga0496104_0103951 | |||
| 3254 | Ga0496104_0107857 | |||
| 3255 | Ga0496104_0322079 | |||
| 3256 | Ga0496104_0351967 | |||
| 3257 | Ga0496104_0370528 | |||
| 3258 | Ga0496105_0078298 | |||
| 3259 | Ga0496105_0139233 | |||
| 3260 | Ga0496105_0166096 | |||
| 3261 | Ga0496105_0213217 | |||
| 3262 | Ga0496105_0524359 | |||
| 3263 | Ga0496105_0684031 | |||
| 3264 | Ga0496106_0003518 | |||
| 3265 | Ga0496106_0030306 | |||
| 3266 | Ga0496106_0087377 | |||
| 3267 | Ga0496106_0283939 | |||
| 3268 | Ga0496106_0970159 | |||
| 3269 | Ga0496106_1362863 | |||
| 3270 | Ga0496107_0000796 | |||
| 3271 | Ga0496107_0067376 | |||
| 3272 | Ga0496107_0933349 | |||
| 3273 | Ga0496108_0032489 | |||
| 3274 | Ga0496108_0124186 | |||
| 3275 | Ga0496108_0286001 | |||
| 3276 | Ga0496108_0482416 | |||
| 3277 | Ga0496108_0767720 | |||
| 3278 | Ga0496108_1634796 | |||
| 3279 | Ga0496109_0060025 | |||
| 3280 | Ga0496109_0087350 | |||
| 3281 | Ga0496109_0404303 | |||
| 3282 | Ga0496109_1425728 | |||
| 3283 | Ga0496110_0000091 | |||
| 3284 | Ga0496110_0004643 | |||
| 3285 | Ga0496110_0023793 | |||
| 3286 | Ga0496110_0286750 | |||
| 3287 | Ga0496110_0587594 | |||
| 3288 | Ga0496111_0016892 | |||
| 3289 | Ga0496111_0048928 | |||
| 3290 | Ga0496111_0225915 | |||
| 3291 | Ga0496111_0375322 | |||
| 3292 | Ga0496111_1316029 | |||
| 3293 | Ga0496112_0030222 | |||
| 3294 | Ga0496112_0356812 | |||
| 3295 | Ga0496112_0663177 | |||
| 3296 | Ga0496112_0773487 | |||
| 3297 | Ga0496112_1465119 | |||
| 3298 | Ga0496113_0021257 | |||
| 3299 | Ga0496113_0648146 | |||
| 3300 | Ga0496113_0732631 | |||
| 3301 | Ga0496113_0902278 | |||
| 3302 | Ga0496114_0000386 | |||
| 3303 | Ga0496114_0001141 | |||
| 3304 | Ga0496114_0004194 | |||
| 3305 | Ga0496114_0006073 | |||
| 3306 | Ga0496114_0230229 | |||
| 3307 | Ga0496114_0320615 | |||
| 3308 | Ga0496114_0353784 | |||
| 3309 | Ga0496114_0778035 | |||
| 3310 | Ga0496115_0006616 | |||
| 3311 | Ga0496115_0047334 | |||
| 3312 | Ga0496115_0059367 | |||
| 3313 | Ga0496115_0389278 | |||
| 3314 | Ga0496115_0443708 | |||
| 3315 | Ga0496115_0561298 | |||
| 3316 | Ga0496116_0025193 | |||
| 3317 | Ga0496116_0030225 | |||
| 3318 | Ga0496117_0001863 | |||
| 3319 | Ga0496117_0059650 | |||
| 3320 | Ga0496117_0204017 | |||
| 3321 | Ga0496122_0008592 | |||
| 3322 | Ga0496123_0029360 | |||
| 3323 | Ga0496124_0000001 | |||
| 3324 | Ga0496124_0075016 | |||
| 3325 | Ga0496125_0056825 | |||
| 3326 | Ga0496125_0384470 | |||
| 3327 | Ga0496126_0096151 | |||
| 3328 | Ga0496126_0097584 | |||
| 3329 | Ga0496126_0626774 | |||
| 3330 | Ga0501305_018599 | |||
| 3331 | Ga0501307_006084 | |||
| 3332 | Ga0501307_091116 | |||
| 3333 | Ga0501290_028794 | |||
| 3334 | Ga0501298_057336 | |||
| 3335 | Ga0501317_062977 | |||
| 3336 | Ga0501031_0100714 | |||
| 3337 | Ga0501031_0118379 | |||
| 3338 | Ga0501032_0175090 | |||
| 3339 | Ga0501033_0071425 | |||
| 3340 | Ga0501034_0079903 | |||
| 3341 | Ga0501034_1384106 | |||
| 3342 | Ga0501036_0014973 | |||
| 3343 | Ga0501036_0034010 | |||
| 3344 | Ga0501036_1550544 | |||
| 3345 | Ga0501037_0011186 | |||
| 3346 | Ga0501037_0700449 | |||
| 3347 | Ga0501038_0000271 | |||
| 3348 | Ga0501038_0583992 | |||
| 3349 | Ga0501038_0997715 | |||
| 3350 | Ga0501039_0108043 | |||
| 3351 | Ga0501039_0153331 | |||
| 3352 | Ga0501039_0306749 | |||
| 3353 | Ga0501039_0806175 | |||
| 3354 | Ga0501039_0960743 | |||
| 3355 | Ga0501039_1022063 | |||
| 3356 | Ga0501040_0001044 | |||
| 3357 | Ga0501040_0062391 | |||
| 3358 | Ga0501040_0088966 | |||
| 3359 | Ga0501040_0160571 | |||
| 3360 | Ga0501040_0211230 | |||
| 3361 | Ga0501040_0230286 | |||
| 3362 | Ga0501041_0000002 | |||
| 3363 | Ga0501041_0163295 | |||
| 3364 | Ga0501042_0000645 | |||
| 3365 | Ga0501042_0048885 | |||
| 3366 | Ga0501042_0134671 | |||
| 3367 | Ga0501043_0085474 | |||
| 3368 | Ga0501043_0121334 | |||
| 3369 | Ga0501043_0185513 | |||
| 3370 | Ga0501046_0051614 | |||
| 3371 | Ga0501046_0119838 | |||
| 3372 | Ga0501046_0295744 | |||
| 3373 | Ga0501046_1237436 | |||
| 3374 | Ga0501047_0468086 | |||
| 3375 | Ga0501048_0002109 | |||
| 3376 | Ga0501048_0234505 | |||
| 3377 | Ga0501048_0241932 | |||
| 3378 | Ga0501048_0902011 | |||
| 3379 | Ga0501067_0003773 | |||
| 3380 | Ga0501068_0117831 | |||
| 3381 | Ga0501068_0225851 | |||
| 3382 | Ga0501068_0262995 | |||
| 3383 | Ga0501069_0748886 | |||
| 3384 | Ga0501070_0607196 | |||
| 3385 | Ga0501070_1410966 | |||
| 3386 | Ga0501071_0001937 | |||
| 3387 | Ga0501071_0145214 | |||
| 3388 | Ga0501071_0172545 | |||
| 3389 | Ga0501071_0231051 | |||
| 3390 | Ga0501072_0000128 | |||
| 3391 | Ga0501072_0032391 | |||
| 3392 | Ga0501072_0215997 | |||
| 3393 | Ga0501073_0003382 | |||
| 3394 | Ga0501073_0009833 | |||
| 3395 | Ga0501073_0038469 | |||
| 3396 | Ga0501073_0207608 | |||
| 3397 | Ga0501074_0003300 | |||
| 3398 | Ga0501074_0110042 | |||
| 3399 | Ga0501074_0281025 | |||
| 3400 | Ga0501074_0387843 | |||
| 3401 | Ga0501075_0015531 | |||
| 3402 | Ga0501075_0038544 | |||
| 3403 | Ga0501075_0090751 | |||
| 3404 | Ga0501075_0103332 | |||
| 3405 | Ga0501075_0149057 | |||
| 3406 | Ga0501075_0536782 | |||
| 3407 | Ga0501076_0000022 | |||
| 3408 | Ga0501076_0012924 | |||
| 3409 | Ga0501076_0015095 | |||
| 3410 | Ga0501076_0019380 | |||
| 3411 | Ga0501076_0165212 | |||
| 3412 | Ga0501076_0198838 | |||
| 3413 | Ga0501076_1433015 | |||
| 3414 | Ga0501076_1586770 | |||
| 3415 | Ga0501077_0000017 | |||
| 3416 | Ga0501077_0005748 | |||
| 3417 | Ga0501077_0013601 | |||
| 3418 | Ga0501077_0138932 | |||
| 3419 | Ga0501077_0182664 | |||
| 3420 | Ga0501077_0477644 | |||
| 3421 | Ga0501198_019554 | |||
| 3422 | Ga0501217_156633 | |||
| 3423 | Ga0501249_047500 | |||
| 3424 | Ga0501252_029041 | |||
| 3425 | Ga0501258_020947 | |||
| 3426 | Ga0501079_0000549 | |||
| 3427 | Ga0501079_0039652 | |||
| 3428 | Ga0501079_0219200 | |||
| 3429 | Ga0501079_0338296 | |||
| 3430 | Ga0501079_0785145 | |||
| 3431 | Ga0501080_0004016 | |||
| 3432 | Ga0501080_0054009 | |||
| 3433 | Ga0501080_0058519 | |||
| 3434 | Ga0501080_0169697 | |||
| 3435 | Ga0501080_0430265 | |||
| 3436 | Ga0501080_1110040 | |||
| 3437 | Ga0501081_0000105 | |||
| 3438 | Ga0501081_0212764 | |||
| 3439 | Ga0501081_0438763 | |||
| 3440 | Ga0501081_0921357 | |||
| 3441 | Ga0501083_0098494 | |||
| 3442 | Ga0501083_0416796 | |||
| 3443 | Ga0501083_0832287 | |||
| 3444 | Ga0501083_0890704 | |||
| 3445 | Ga0501270_003093 | |||
| 3446 | Ga0501035_0002385 | |||
| 3447 | Ga0501035_0346800 | |||
| 3448 | Ga0501035_0386792 | |||
| 3449 | Ga0501035_0900218 | |||
| 3450 | Ga0501035_1074586 | |||
| 3451 | Ga0501045_0000113 | |||
| 3452 | Ga0501045_0005535 | |||
| 3453 | Ga0501045_0093809 | |||
| 3454 | Ga0501045_0193347 | |||
| 3455 | Ga0501212_038484 | |||
| 3456 | nmdc:mga00v17_852269_c1 | |||
| 3457 | nmdc:mga05p37_1252235_c1 | |||
| 3458 | nmdc:mga05p37_1701_c1 | |||
| 3459 | nmdc:mga05p37_1842889_c1 | |||
| 3460 | nmdc:mga05p37_1993750_c1 | |||
| 3461 | nmdc:mga05p37_217608_c1 | |||
| 3462 | nmdc:mga05p37_2357_c1 | |||
| 3463 | nmdc:mga05p37_2405_c1 | |||
| 3464 | nmdc:mga05p37_244065_c1 | |||
| 3465 | nmdc:mga05p37_28557_c1 | |||
| 3466 | nmdc:mga05p37_43119_c2 | |||
| 3467 | nmdc:mga05p37_53231_c1 | |||
| 3468 | nmdc:mga05p37_5571_c1 | |||
| 3469 | nmdc:mga09592_1578074_c1 | |||
| 3470 | nmdc:mga09592_194091_c1 | |||
| 3471 | nmdc:mga09592_47614_c1 | |||
| 3472 | nmdc:mga09592_7449_c1 | |||
| 3473 | nmdc:mga09592_845691_c1 | |||
| 3474 | nmdc:mga09592_88599_c1 | |||
| 3475 | nmdc:mga0qj67_222840_c1 | |||
| 3476 | nmdc:mga0qj67_263938_c1 | |||
| 3477 | nmdc:mga0qj67_287621_c1 | |||
| 3478 | nmdc:mga0qj67_36968_c1 | |||
| 3479 | nmdc:mga0qj67_610306_c1 | |||
| 3480 | nmdc:mga06r32_1302523_c1 | |||
| 3481 | nmdc:mga06r32_299928_c1 | |||
| 3482 | nmdc:mga06r32_600_c2 | |||
| 3483 | nmdc:mga06r32_721966_c1 | |||
| 3484 | nmdc:mga08y16_1403866_c1 | |||
| 3485 | nmdc:mga08y16_158966_c1 | |||
| 3486 | nmdc:mga08y16_1650152_c1 | |||
| 3487 | nmdc:mga08y16_20950_c1 | |||
| 3488 | nmdc:mga08y16_24_c1 | |||
| 3489 | nmdc:mga08y16_421972_c1 | |||
| 3490 | nmdc:mga08y16_692563_c1 | |||
| 3491 | nmdc:mga08y16_903961_c1 | |||
| 3492 | nmdc:mga0n895_112230_c1 | |||
| 3493 | nmdc:mga0n895_116858_c1 | |||
| 3494 | nmdc:mga0n895_124772_c1 | |||
| 3495 | nmdc:mga0n895_15345_c1 | |||
| 3496 | nmdc:mga0n895_157994_c1 | |||
| 3497 | nmdc:mga0n895_16211_c1 | |||
| 3498 | nmdc:mga0n895_165230_c1 | |||
| 3499 | nmdc:mga0n895_248534_c1 | |||
| 3500 | nmdc:mga0n895_32532_c1 | |||
| 3501 | nmdc:mga0n895_4227_c1 | |||
| 3502 | nmdc:mga0rr50_15066_c1 | |||
| 3503 | nmdc:mga0rr50_1883_c1 | |||
| 3504 | nmdc:mga0rr50_309450_c1 | |||
| 3505 | nmdc:mga0rr50_436178_c1 | |||
| 3506 | nmdc:mga0rr50_451926_c1 | |||
| 3507 | nmdc:mga0rr50_4708_c1 | |||
| 3508 | nmdc:mga0rr50_496957_c1 | |||
| 3509 | nmdc:mga0rr50_603694_c1 | |||
| 3510 | nmdc:mga0rr50_70361_c1 | |||
| 3511 | nmdc:mga0rr50_98517_c1 | |||
| 3512 | nmdc:mga08x19_12242_c1 | |||
| 3513 | nmdc:mga08x19_14593_c1 | |||
| 3514 | nmdc:mga08x19_20353_c1 | |||
| 3515 | nmdc:mga08x19_365_c1 | |||
| 3516 | nmdc:mga08x19_39582_c1 | |||
| 3517 | nmdc:mga08x19_53364_c1 | |||
| 3518 | nmdc:mga08x19_59650_c1 | |||
| 3519 | nmdc:mga08x19_87268_c1 | |||
| 3520 | nmdc:mga08x19_95363_c1 | |||
| 3521 | nmdc:mga0a205_10723_c1 | |||
| 3522 | nmdc:mga0a205_137179_c1 | |||
| 3523 | nmdc:mga0a205_16417_c1 | |||
| 3524 | nmdc:mga0a205_245638_c1 | |||
| 3525 | nmdc:mga0a205_256160_c1 | |||
| 3526 | nmdc:mga0a205_260474_c1 | |||
| 3527 | nmdc:mga0a205_263572_c1 | |||
| 3528 | nmdc:mga0a205_287318_c1 | |||
| 3529 | nmdc:mga0a205_34611_c1 | |||
| 3530 | nmdc:mga0a205_357051_c1 | |||
| 3531 | nmdc:mga0a205_390_c1 | |||
| 3532 | nmdc:mga0a205_429315_c1 | |||
| 3533 | nmdc:mga0a205_488289_c1 | |||
| 3534 | nmdc:mga0a205_63533_c1 | |||
| 3535 | nmdc:mga0a205_8807_c1 | |||
| 3536 | Ga0495601_0016503 | |||
| 3537 | Ga0495601_0460347 | |||
| 3538 | Ga0495601_0493210 | |||
| 3539 | Ga0495601_0562803 | |||
| 3540 | Ga0495612_0246593 | |||
| 3541 | Ga0495595_0015164 | |||
| 3542 | Ga0495595_0466989 | |||
| 3543 | Ga0495619_0027932 | |||
| 3544 | Ga0495619_0032380 | |||
| 3545 | Ga0495619_0100730 | |||
| 3546 | Ga0495619_0495056 | |||
| 3547 | Ga0495619_0518105 | |||
| 3548 | Ga0500643_000257 | |||
| 3549 | Ga0500568_0035391 | |||
| 3550 | Ga0501084_0000159 | |||
| 3551 | Ga0501084_0071866 | |||
| 3552 | Ga0501084_0287098 | |||
| 3553 | Ga0501084_0503695 | |||
| 3554 | Ga0501084_0505832 | |||
| 3555 | Ga0501084_1633105 | |||
| 3556 | Ga0587084_041383 | |||
| 3557 | Ga0587066_018738 | |||
| 3558 | Ga0587073_0040134 | |||
| 3559 | Ga0587080_092063 | |||
| 3560 | Ga0587091_047439 | |||
| 3561 | Ga0587072_062076 | |||
| 3562 | Ga0587111_0035651 | |||
| 3563 | Ga0587111_0078441 | |||
| 3564 | Ga0587111_0283623 | |||
| 3565 | Ga0501082_0002410 | |||
| 3566 | Ga0501082_0485350 | |||
| 3567 | Ga0501082_0650476 | |||
| 3568 | Ga0530510_0002449 | |||
| 3569 | Ga0530510_0125550 | |||
| 3570 | Ga0530510_0194648 | |||
| 3571 | Ga0530510_0298278 | |||
| 3572 | Ga0530510_0357705 | |||
| 3573 | Ga0530510_0392298 | |||
| 3574 | Ga0530510_0860580 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4v9a-assembly1.cif.gz_BN | crystal structure of the 70s ribosome with tetracycline. | 0.9959 | 1 | 122 |
| 7y41-assembly1.cif.gz_L | mycobacterium smegmatis 50s ribosomal subunit from log phase of growth | 0.9906 | 1 | 122 |
| 8fn2-assembly1.cif.gz_M | the structure of a 50s ribosomal subunit in the lyme disease pathogen borreliella burgdorferi | 0.9879 | 1 | 122 |
| 6n1d-assembly2.cif.gz_BL14 | x-ray crystal complex showing spontaneous ribosomal translocation of mrna and trnas into a chimeric hybrid state | 0.9875 | 1 | 122 |
| 8cvm-assembly1.cif.gz_j | cutibacterium acnes 50s ribosomal subunit with p-site trna and sarecycline bound in the local refined map | 0.9874 | 1 | 122 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 6ddgW00 | Mainly Beta;Beta Barrel;Ribosomal Protein L14;Ribosomal protein L14/L23 | 0.9827 | 2 | 121 | 2.40.150.20 |
| 6ddgW00 | Mainly Beta;Beta Barrel;Ribosomal Protein L14;Ribosomal protein L14/L23 | 0.9747 | 2 | 121 | 2.40.150.20 |
| 3i1nK00 | Mainly Beta;Beta Barrel;Ribosomal Protein L14;Ribosomal protein L14/L23 | 0.9509 | 1 | 121 | 2.40.150.20 |
| 1vw4I00 | Mainly Beta;Beta Barrel;Ribosomal Protein L14;Ribosomal protein L14/L23 | 0.9437 | 1 | 122 | 2.40.150.20 |
| 1vw4I00 | Mainly Beta;Beta Barrel;Ribosomal Protein L14;Ribosomal protein L14/L23 | 0.9362 | 1 | 122 | 2.40.150.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1M3KUM1-F1-model_v4 | Large ribosomal subunit protein uL14 | 1.002 | 1 | 122 |
GO:0003735
GO:0006412 GO:0022625 GO:0070180 |
| AF-A0A434CQN6-F1-model_v4 | 50S ribosomal protein L14 | 1.002 | 1 | 65 |
GO:0003735
GO:0006412 GO:0022625 GO:0070180 |
| AF-W4SMQ2-F1-model_v4 | 50S ribosomal protein L14 | 1.002 | 1 | 61 |
GO:0003735
GO:0006412 GO:0022625 GO:0070180 |
| AF-A0A1T4WGJ1-F1-model_v4 | Large ribosomal subunit protein uL14 | 1.001 | 1 | 122 |
GO:0003735
GO:0006412 GO:0022625 GO:0070180 |
| AF-E5Y766-F1-model_v4 | Large ribosomal subunit protein uL14 | 1 | 1 | 122 |
GO:0003735
GO:0006412 GO:0022625 GO:0070180 |