F495703

General Info

Members Datasets Scaffolds Average Seq Length
1787 493 3574 122

Family's Representative Sequence

Representative Sequence 3300013297|Ga0157378_10105819|Ga0157378_101058193
Length 134
Sequence LLGRIQQLSNQATQQPFQGATAMIQMGTVLQVADNTGAKKIACIKMLGGSTAGQYARLGDVITASVKEASPDGTVKKVKESRRRDGSYIKFDDNAAVLINDAREPVGTRVFGPVARELRERKFMKIISLAPEVI

Samples

Sample ID Description Type Environment
1 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
4 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
5 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300003371 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM Metagenome Rhizosphere
8 3300003503 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM Metagenome Rhizosphere
9 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
10 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
11 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
12 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
13 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
14 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
15 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
16 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
17 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
18 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
19 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
20 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
21 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
22 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
23 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
24 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
25 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
26 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
27 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
28 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
29 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
30 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
31 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
32 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
33 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
34 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
35 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
36 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
37 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
38 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
39 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
40 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
41 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
42 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
43 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
44 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
45 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
46 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
47 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
48 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
49 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
50 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
51 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
52 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
53 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
54 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
55 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
56 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
57 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
58 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
59 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
60 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
61 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
62 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
63 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
64 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
65 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
66 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
67 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
68 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
69 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
70 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
71 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
72 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
73 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
74 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
75 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
76 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
77 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
78 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
79 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
80 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
81 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
82 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
83 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
84 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
85 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
86 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
87 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
88 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
89 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
90 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
91 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
92 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
93 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
94 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
95 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
96 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
97 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
98 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
99 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
100 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
101 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
102 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
103 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
104 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
105 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
106 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
107 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
108 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
109 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
110 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
111 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
112 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
113 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
114 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
115 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
116 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
117 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
118 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
119 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
120 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
121 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
122 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
123 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
124 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
125 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
126 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
127 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
128 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
129 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
130 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
131 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
132 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
133 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
134 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
135 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
136 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
137 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
138 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
139 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
140 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
141 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
142 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
143 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
144 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
145 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
146 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
147 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
148 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
149 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
150 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
217 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
218 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
219 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
221 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
222 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
223 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
224 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
226 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
227 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
228 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
229 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
230 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
234 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
235 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
236 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
237 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
238 3300030836 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
239 3300030882 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI6 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
240 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
241 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
242 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
243 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
244 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
245 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
246 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
247 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
248 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
249 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
250 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
251 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
252 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
253 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
254 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
255 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
256 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
257 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
258 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
259 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
260 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
261 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
262 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
263 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
264 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
265 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
266 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
267 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
268 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
269 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
270 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
271 3300032120 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
272 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
273 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
274 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
275 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
276 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
277 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
278 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
279 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
280 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
281 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
282 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
283 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
284 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
285 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
286 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
287 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
288 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
289 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
290 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
291 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
292 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
293 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
294 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
295 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
296 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
297 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
298 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
299 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
300 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
301 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
302 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
303 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
304 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
305 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
306 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
307 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
308 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
309 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
310 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
311 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
312 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
313 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
314 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
315 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
316 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
317 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
318 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
319 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
320 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
321 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
322 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
323 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
324 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
325 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
326 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
327 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
328 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
329 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
330 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
331 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
332 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
333 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
334 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
335 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
336 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
337 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
338 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
339 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
340 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
341 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
342 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
343 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
344 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
345 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
346 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
347 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
348 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
349 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
350 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
351 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
352 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
353 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
354 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
355 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
356 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
357 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
358 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
359 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
360 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
361 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
362 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
363 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
364 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
365 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
366 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
367 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
368 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
369 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
370 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
371 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
372 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
373 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
374 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
375 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
376 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
377 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
378 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
379 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
380 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
381 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
382 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
383 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
384 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
385 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
386 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
387 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
388 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
389 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
390 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
391 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
392 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
393 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
394 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
395 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
396 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
397 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
398 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
399 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
400 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
401 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
402 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
403 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
404 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
405 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
406 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
407 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
408 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
409 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
410 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
411 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
412 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
413 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
414 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
415 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
416 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
417 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
418 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
419 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
420 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
421 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
422 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
423 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
424 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
425 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
426 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
427 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
428 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
429 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
430 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
431 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
432 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
433 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
434 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
435 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
436 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
437 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
438 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
439 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
440 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
441 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
442 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
443 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
444 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
445 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
446 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
447 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
448 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
449 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
450 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
451 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
452 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
453 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
454 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
455 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
456 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
457 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
458 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
459 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
460 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
461 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
462 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
463 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
464 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
465 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
466 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
467 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
468 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
469 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
470 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
471 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
472 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
473 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
474 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
475 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
476 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
477 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
478 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
479 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
480 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
481 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
482 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
483 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
484 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
485 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
486 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
487 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
488 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
489 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
490 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
491 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
492 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
493 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.48
Metatranscriptomes 2.52
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.28
Nodule 0
Rhizoplane 4.59
Rhizosphere 93.12
Stem 0
Stem Tuber 0
Unclassified 2.69

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157378_10105819 3300013297 Bacteria 2573
2 SwRhRL2b_contig_291308 2162886007 Unclassified 1389
3 SwRhRL2b_contig_3903249 2162886007 Bacteria 1678
4 MBSR1b_contig_4233670 2162886012 Bacteria 831
5 JGI24746J21847_1016431 3300001977 Unclassified 1057
6 JGI24742J22300_10007131 3300002244 Bacteria 1843
7 rootL2_10282489 3300003322 Bacteria 1869
8 JGI26145J50221_1001211 3300003371 Bacteria 2045
9 JGI26141J51220_1003121 3300003503 Bacteria 1020
10 JGI25405J52794_10000604 3300003911 Bacteria 5327
11 Ga0058863_10059782 3300004799 Bacteria 2822
12 Ga0058863_11875765 3300004799 Bacteria 505
13 Ga0058861_12030344 3300004800 Bacteria 2573
14 Ga0058860_12230108 3300004801 Bacteria 926
15 Ga0058862_10154497 3300004803 Bacteria 1389
16 Ga0065704_10005699 3300005289 Bacteria 4814
17 Ga0065704_10085970 3300005289 Bacteria 3168
18 Ga0065704_10190762 3300005289 Unclassified 1191
19 Ga0065704_10394263 3300005289 Bacteria 759
20 Ga0065712_10374598 3300005290 Bacteria 751
21 Ga0065715_10121974 3300005293 Bacteria 2216
22 Ga0065715_10445920 3300005293 Bacteria 831
23 Ga0065715_11162660 3300005293 Bacteria 506
24 Ga0065707_10025635 3300005295 Bacteria 1864
25 Ga0070658_10039091 3300005327 Bacteria 3827
26 Ga0070658_11318469 3300005327 Bacteria 627
27 Ga0070676_10018293 3300005328 Bacteria 3881
28 Ga0070676_10026300 3300005328 Bacteria 3294
29 Ga0070676_10541632 3300005328 Bacteria 832
30 Ga0070676_11479038 3300005328 Bacteria 523
31 Ga0070683_100000033 3300005329 Bacteria 135305
32 Ga0070683_100004175 3300005329 Bacteria 11835
33 Ga0070690_100005750 3300005330 Bacteria 6987
34 Ga0070690_100030946 3300005330 Bacteria 3331
35 Ga0070690_100065969 3300005330 Bacteria 2342
36 Ga0070690_100256616 3300005330 Bacteria 1239
37 Ga0070690_100776228 3300005330 Bacteria 741
38 Ga0070670_100006072 3300005331 Bacteria 10217
39 Ga0070670_100029495 3300005331 Bacteria 4723
40 Ga0070670_100218024 3300005331 Bacteria 1660
41 Ga0070670_100303900 3300005331 Bacteria 1396
42 Ga0070670_100324478 3300005331 Bacteria 1349
43 Ga0070670_100546168 3300005331 Bacteria 1033
44 Ga0070670_100676845 3300005331 Bacteria 927
45 Ga0070670_102113790 3300005331 Bacteria 519
46 Ga0070677_10005399 3300005333 Bacteria 4210
47 Ga0068869_100009311 3300005334 Bacteria 6370
48 Ga0068869_100015378 3300005334 Bacteria 5132
49 Ga0068869_100041040 3300005334 Bacteria 3312
50 Ga0068869_100167792 3300005334 Bacteria 1713
51 Ga0068869_100200424 3300005334 Bacteria 1574
52 Ga0068869_100268990 3300005334 Bacteria 1367
53 Ga0068869_100646961 3300005334 Bacteria 897
54 Ga0070666_10001387 3300005335 Bacteria 14671
55 Ga0070666_10001507 3300005335 Bacteria 14139
56 Ga0070666_10011673 3300005335 Bacteria 5522
57 Ga0070666_10040333 3300005335 Bacteria 3116
58 Ga0070666_10162092 3300005335 Bacteria 1563
59 Ga0070666_10521737 3300005335 Bacteria 862
60 Ga0070666_10958131 3300005335 Bacteria 634
61 Ga0070680_100707670 3300005336 Bacteria 867
62 Ga0070682_100256877 3300005337 Bacteria 1263
63 Ga0068868_100000632 3300005338 Bacteria 23664
64 Ga0068868_100906099 3300005338 Bacteria 802
65 Ga0070660_100100051 3300005339 Bacteria 2296
66 Ga0070660_100406772 3300005339 Bacteria 1126
67 Ga0070689_100068193 3300005340 Bacteria 2774
68 Ga0070689_100101559 3300005340 Bacteria 2276
69 Ga0070689_100103520 3300005340 Bacteria 2256
70 Ga0070689_100204302 3300005340 Bacteria 1614
71 Ga0070689_100259633 3300005340 Bacteria 1435
72 Ga0070689_100412269 3300005340 Bacteria 1144
73 Ga0070689_100427886 3300005340 Bacteria 1123
74 Ga0070689_100507022 3300005340 Bacteria 1034
75 Ga0070689_100688822 3300005340 Bacteria 892
76 Ga0070689_100796799 3300005340 Bacteria 831
77 Ga0070689_101067422 3300005340 Bacteria 721
78 Ga0070689_101578820 3300005340 Bacteria 595
79 Ga0070691_10060647 3300005341 Bacteria 1819
80 Ga0070691_10309448 3300005341 Bacteria 865
81 Ga0070691_10961339 3300005341 Bacteria 531
82 Ga0070687_100051489 3300005343 Bacteria 2132
83 Ga0070687_100114596 3300005343 Bacteria 1531
84 Ga0070687_100136833 3300005343 Bacteria 1421
85 Ga0070687_100427962 3300005343 Bacteria 875
86 Ga0070687_100465332 3300005343 Bacteria 844
87 Ga0070687_100515402 3300005343 Bacteria 808
88 Ga0070661_100010686 3300005344 Bacteria 6387
89 Ga0070692_10001104 3300005345 Bacteria 9415
90 Ga0070692_10004482 3300005345 Bacteria 5844
91 Ga0070692_10102494 3300005345 Bacteria 1571
92 Ga0070692_11082159 3300005345 Bacteria 565
93 Ga0070692_11154071 3300005345 Bacteria 549
94 Ga0070668_100028739 3300005347 Bacteria 4219
95 Ga0070668_100117946 3300005347 Bacteria 2118
96 Ga0070669_100025363 3300005353 Bacteria 4257
97 Ga0070669_100097584 3300005353 Bacteria 2212
98 Ga0070669_100278937 3300005353 Bacteria 1338
99 Ga0070669_101569360 3300005353 Bacteria 573
100 Ga0070669_101635007 3300005353 Bacteria 561
101 Ga0070675_100000007 3300005354 Bacteria 263394
102 Ga0070675_100032515 3300005354 Bacteria 4223
103 Ga0070675_100092402 3300005354 Bacteria 2536
104 Ga0070675_100105703 3300005354 Bacteria 2375
105 Ga0070675_100123749 3300005354 Bacteria 2199
106 Ga0070675_100183980 3300005354 Bacteria 1808
107 Ga0070675_100185688 3300005354 Bacteria 1799
108 Ga0070675_100318549 3300005354 Bacteria 1373
109 Ga0070675_100342603 3300005354 Bacteria 1324
110 Ga0070675_101193667 3300005354 Bacteria 700
111 Ga0070675_101372066 3300005354 Bacteria 652
112 Ga0070671_100190181 3300005355 Bacteria 1739
113 Ga0070671_100191826 3300005355 Bacteria 1732
114 Ga0070674_100007457 3300005356 Bacteria 6453
115 Ga0070674_100007905 3300005356 Bacteria 6293
116 Ga0070674_100343338 3300005356 Bacteria 1203
117 Ga0070674_100367453 3300005356 Bacteria 1167
118 Ga0070674_100587817 3300005356 Bacteria 939
119 Ga0070674_101389008 3300005356 Bacteria 628
120 Ga0070674_101735933 3300005356 Bacteria 565
121 Ga0070673_100051191 3300005364 Bacteria 3232
122 Ga0070673_100071173 3300005364 Bacteria 2793
123 Ga0070673_100099405 3300005364 Bacteria 2393
124 Ga0070673_100226177 3300005364 Bacteria 1621
125 Ga0070673_100677707 3300005364 Bacteria 945
126 Ga0070673_101809998 3300005364 Bacteria 578
127 Ga0070688_100175984 3300005365 Bacteria 1481
128 Ga0070688_100426728 3300005365 Bacteria 986
129 Ga0070688_100533180 3300005365 Bacteria 890
130 Ga0070688_100874058 3300005365 Bacteria 707
131 Ga0070659_100169875 3300005366 Bacteria 1786
132 Ga0070667_100002921 3300005367 Bacteria 14677
133 Ga0070667_100091951 3300005367 Bacteria 2609
134 Ga0070667_100234407 3300005367 Bacteria 1637
135 Ga0070667_100604574 3300005367 Bacteria 1010
136 Ga0070667_100977738 3300005367 Unclassified 789
137 Ga0070667_101203917 3300005367 Bacteria 709
138 Ga0070703_10097871 3300005406 Bacteria 1029
139 Ga0070709_10019666 3300005434 Bacteria 3908
140 Ga0070709_10075841 3300005434 Bacteria 2182
141 Ga0070709_10133261 3300005434 Bacteria 1699
142 Ga0070709_10444071 3300005434 Bacteria 976
143 Ga0070709_10899752 3300005434 Bacteria 700
144 Ga0070713_100115557 3300005436 Bacteria 2345
145 Ga0070710_10298597 3300005437 Bacteria 1051
146 Ga0070710_10482662 3300005437 Bacteria 845
147 Ga0070701_10014144 3300005438 Bacteria 3651
148 Ga0070701_10085332 3300005438 Bacteria 1719
149 Ga0070701_10562179 3300005438 Bacteria 750
150 Ga0070711_100350307 3300005439 Bacteria 1187
151 Ga0070711_100355922 3300005439 Bacteria 1178
152 Ga0070711_100364914 3300005439 Bacteria 1164
153 Ga0070711_101924400 3300005439 Bacteria 520
154 Ga0070705_100021563 3300005440 Bacteria 3429
155 Ga0070705_100481005 3300005440 Bacteria 938
156 Ga0070700_100000050 3300005441 Bacteria 88421
157 Ga0070700_100105528 3300005441 Bacteria 1863
158 Ga0070700_100699064 3300005441 Bacteria 806
159 Ga0070700_101465297 3300005441 Bacteria 579
160 Ga0070694_100004904 3300005444 Bacteria 8062
161 Ga0070694_100018421 3300005444 Bacteria 4431
162 Ga0070694_100026241 3300005444 Bacteria 3775
163 Ga0070694_100923232 3300005444 Bacteria 722
164 Ga0070694_101063760 3300005444 Bacteria 674
165 Ga0070694_101212678 3300005444 Bacteria 633
166 Ga0070708_100157158 3300005445 Bacteria 2117
167 Ga0070708_100172273 3300005445 Bacteria 2021
168 Ga0070708_100263368 3300005445 Bacteria 1621
169 Ga0070708_100263468 3300005445 Bacteria 1620
170 Ga0070708_101206272 3300005445 Bacteria 708
171 Ga0070708_101221233 3300005445 Bacteria 703
172 Ga0070708_101357583 3300005445 Bacteria 663
173 Ga0070708_101527797 3300005445 Unclassified 622
174 Ga0070708_101802727 3300005445 Bacteria 568
175 Ga0070663_100046825 3300005455 Bacteria 3062
176 Ga0070663_100507789 3300005455 Bacteria 1002
177 Ga0070678_100006394 3300005456 Bacteria 6913
178 Ga0070678_100277422 3300005456 Bacteria 1416
179 Ga0070678_100505663 3300005456 Bacteria 1067
180 Ga0070662_100093375 3300005457 Bacteria 2263
181 Ga0070662_100124500 3300005457 Bacteria 1979
182 Ga0070662_100146168 3300005457 Bacteria 1837
183 Ga0070662_100201195 3300005457 Bacteria 1581
184 Ga0070662_101086956 3300005457 Bacteria 686
185 Ga0070662_101352454 3300005457 Bacteria 613
186 Ga0070681_10212292 3300005458 Bacteria 1851
187 Ga0070681_10388776 3300005458 Bacteria 1306
188 Ga0070681_11357294 3300005458 Bacteria 634
189 Ga0068867_100016292 3300005459 Bacteria 5278
190 Ga0068867_100023693 3300005459 Bacteria 4395
191 Ga0068867_100025055 3300005459 Bacteria 4279
192 Ga0068867_100261944 3300005459 Bacteria 1410
193 Ga0068867_101344521 3300005459 Bacteria 661
194 Ga0070685_10112403 3300005466 Bacteria 1680
195 Ga0070685_10811138 3300005466 Bacteria 690
196 Ga0070706_100005176 3300005467 Bacteria 12446
197 Ga0070706_100021749 3300005467 Bacteria 5905
198 Ga0070706_100060377 3300005467 Bacteria 3500
199 Ga0070706_100084802 3300005467 Unclassified 2935
200 Ga0070706_100143886 3300005467 Bacteria 2226
201 Ga0070706_100152709 3300005467 Bacteria 2156
202 Ga0070706_100160143 3300005467 Bacteria 2101
203 Ga0070706_100185121 3300005467 Bacteria 1946
204 Ga0070706_100253498 3300005467 Bacteria 1643
205 Ga0070706_100290414 3300005467 Bacteria 1526
206 Ga0070707_100006596 3300005468 Bacteria 10769
207 Ga0070707_100084042 3300005468 Bacteria 3076
208 Ga0070707_100222760 3300005468 Bacteria 1837
209 Ga0070707_100271464 3300005468 Bacteria 1649
210 Ga0070707_100459544 3300005468 Bacteria 1234
211 Ga0070707_100574266 3300005468 Bacteria 1090
212 Ga0070707_100613758 3300005468 Bacteria 1050
213 Ga0070707_101381124 3300005468 Bacteria 671
214 Ga0070698_100004976 3300005471 Bacteria 14561
215 Ga0070698_100022395 3300005471 Bacteria 6610
216 Ga0070698_100039505 3300005471 Bacteria 4857
217 Ga0070698_100150648 3300005471 Bacteria 2274
218 Ga0070698_100337116 3300005471 Bacteria 1439
219 Ga0070698_100358829 3300005471 Bacteria 1389
220 Ga0070698_100771513 3300005471 Bacteria 905
221 Ga0070698_101613421 3300005471 Bacteria 601
222 Ga0070699_100242768 3300005518 Bacteria 1608
223 Ga0070699_100270563 3300005518 Bacteria 1520
224 Ga0070699_100331429 3300005518 Bacteria 1369
225 Ga0070699_100372948 3300005518 Bacteria 1288
226 Ga0070699_100894802 3300005518 Bacteria 813
227 Ga0070699_100980595 3300005518 Bacteria 775
228 Ga0070699_100988430 3300005518 Bacteria 771
229 Ga0070699_101044073 3300005518 Bacteria 749
230 Ga0070699_101840844 3300005518 Bacteria 554
231 Ga0070679_100029036 3300005530 Bacteria 5455
232 Ga0070679_101054963 3300005530 Bacteria 757
233 Ga0070679_101391791 3300005530 Bacteria 648
234 Ga0070684_100006540 3300005535 Bacteria 9022
235 Ga0070684_100034321 3300005535 Bacteria 4337
236 Ga0070684_100315549 3300005535 Bacteria 1435
237 Ga0070684_100501115 3300005535 Bacteria 1125
238 Ga0070684_101450530 3300005535 Bacteria 646
239 Ga0070697_100002003 3300005536 Bacteria 15614
240 Ga0070697_100006235 3300005536 Bacteria 9233
241 Ga0070697_100016639 3300005536 Bacteria 5784
242 Ga0070697_100050503 3300005536 Bacteria 3376
243 Ga0070697_100057785 3300005536 Bacteria 3156
244 Ga0070697_100073385 3300005536 Bacteria 2809
245 Ga0070697_100131871 3300005536 Bacteria 2096
246 Ga0070697_100173619 3300005536 Bacteria 1825
247 Ga0070697_100292248 3300005536 Bacteria 1400
248 Ga0070697_100788006 3300005536 Bacteria 841
249 Ga0070697_100935321 3300005536 Bacteria 770
250 Ga0070697_101020950 3300005536 Bacteria 735
251 Ga0070697_101092673 3300005536 Bacteria 710
252 Ga0068853_100010446 3300005539 Bacteria 7515
253 Ga0068853_100558747 3300005539 Bacteria 1085
254 Ga0070672_100005180 3300005543 Bacteria 8619
255 Ga0070672_100057049 3300005543 Bacteria 3065
256 Ga0070672_100074196 3300005543 Bacteria 2713
257 Ga0070672_100078636 3300005543 Bacteria 2639
258 Ga0070672_100083257 3300005543 Bacteria 2567
259 Ga0070672_100189079 3300005543 Bacteria 1718
260 Ga0070672_100222200 3300005543 Bacteria 1584
261 Ga0070672_101545981 3300005543 Bacteria 595
262 Ga0070686_100022242 3300005544 Bacteria 3774
263 Ga0070686_100065761 3300005544 Bacteria 2356
264 Ga0070686_101648143 3300005544 Bacteria 543
265 Ga0070695_100043544 3300005545 Bacteria 2854
266 Ga0070695_100121956 3300005545 Bacteria 1784
267 Ga0070695_100123311 3300005545 Bacteria 1776
268 Ga0070695_100147012 3300005545 Bacteria 1641
269 Ga0070695_100332431 3300005545 Bacteria 1133
270 Ga0070696_100012751 3300005546 Bacteria 5644
271 Ga0070696_100015270 3300005546 Bacteria 5155
272 Ga0070696_100023806 3300005546 Bacteria 4163
273 Ga0070696_100068104 3300005546 Bacteria 2498
274 Ga0070696_100143548 3300005546 Bacteria 1747
275 Ga0070696_100290648 3300005546 Bacteria 1249
276 Ga0070696_101204782 3300005546 Bacteria 640
277 Ga0070693_100037146 3300005547 Bacteria 2714
278 Ga0070693_100063520 3300005547 Bacteria 2152
279 Ga0070665_100022280 3300005548 Bacteria 6375
280 Ga0070665_100027592 3300005548 Bacteria 5718
281 Ga0070665_100425601 3300005548 Bacteria 1336
282 Ga0070665_101177422 3300005548 Bacteria 777
283 Ga0070665_101605544 3300005548 Bacteria 658
284 Ga0070704_100044966 3300005549 Bacteria 3071
285 Ga0070704_100199616 3300005549 Bacteria 1614
286 Ga0070704_100228149 3300005549 Bacteria 1518
287 Ga0070704_100346746 3300005549 Bacteria 1252
288 Ga0070704_100408103 3300005549 Bacteria 1161
289 Ga0068855_100000266 3300005563 Bacteria 65127
290 Ga0068855_100946306 3300005563 Bacteria 908
291 Ga0070664_100005841 3300005564 Bacteria 9927
292 Ga0070664_100436529 3300005564 Bacteria 1201
293 Ga0070664_100688159 3300005564 Bacteria 952
294 Ga0070664_100756549 3300005564 Bacteria 907
295 Ga0068857_100333822 3300005577 Bacteria 1402
296 Ga0068854_100126246 3300005578 Bacteria 1949
297 Ga0068854_100248683 3300005578 Bacteria 1419
298 Ga0068854_100287407 3300005578 Bacteria 1326
299 Ga0068854_100331794 3300005578 Bacteria 1239
300 Ga0068854_100978744 3300005578 Bacteria 748
301 Ga0068856_100007761 3300005614 Bacteria 10480
302 Ga0068856_100009234 3300005614 Bacteria 9591
303 Ga0068856_100859975 3300005614 Bacteria 926
304 Ga0068856_100867057 3300005614 Unclassified 922
305 Ga0068856_102227847 3300005614 Bacteria 557
306 Ga0070702_100039824 3300005615 Bacteria 2625
307 Ga0070702_100067864 3300005615 Bacteria 2097
308 Ga0070702_100187967 3300005615 Bacteria 1357
309 Ga0070702_100299624 3300005615 Bacteria 1112
310 Ga0070702_100550133 3300005615 Bacteria 857
311 Ga0070702_100565046 3300005615 Bacteria 847
312 Ga0068852_100160088 3300005616 Bacteria 2101
313 Ga0068852_100419281 3300005616 Bacteria 1320
314 Ga0068852_101268419 3300005616 Unclassified 758
315 Ga0068859_100000677 3300005617 Bacteria 34196
316 Ga0068859_100163938 3300005617 Bacteria 2302
317 Ga0068859_100284313 3300005617 Bacteria 1747
318 Ga0068859_100310919 3300005617 Bacteria 1669
319 Ga0068859_100425056 3300005617 Bacteria 1425
320 Ga0068859_100971326 3300005617 Bacteria 932
321 Ga0068859_100995658 3300005617 Bacteria 920
322 Ga0068859_101953714 3300005617 Bacteria 648
323 Ga0068864_100031613 3300005618 Bacteria 4493
324 Ga0068864_100094210 3300005618 Bacteria 2646
325 Ga0068864_100108236 3300005618 Bacteria 2474
326 Ga0068864_100197897 3300005618 Bacteria 1845
327 Ga0068864_100669070 3300005618 Bacteria 1012
328 Ga0068866_10270079 3300005718 Bacteria 1049
329 Ga0068866_10396743 3300005718 Bacteria 889
330 Ga0068866_10972721 3300005718 Unclassified 601
331 Ga0068861_100020829 3300005719 Bacteria 4703
332 Ga0068861_100084086 3300005719 Bacteria 2498
333 Ga0068861_100182569 3300005719 Bacteria 1748
334 Ga0068861_100283062 3300005719 Bacteria 1429
335 Ga0068861_100400314 3300005719 Bacteria 1218
336 Ga0068861_100663397 3300005719 Bacteria 965
337 Ga0068870_10075673 3300005840 Bacteria 1847
338 Ga0068870_10389803 3300005840 Bacteria 904
339 Ga0068870_10612235 3300005840 Bacteria 741
340 Ga0068863_100061234 3300005841 Bacteria 3558
341 Ga0068863_100135598 3300005841 Bacteria 2352
342 Ga0068863_100614434 3300005841 Bacteria 1077
343 Ga0068863_101247584 3300005841 Bacteria 750
344 Ga0068858_100004672 3300005842 Bacteria 13423
345 Ga0068858_100183416 3300005842 Bacteria 1976
346 Ga0068858_100479193 3300005842 Bacteria 1201
347 Ga0068858_100940654 3300005842 Bacteria 846
348 Ga0068858_101981642 3300005842 Bacteria 576
349 Ga0068860_100005124 3300005843 Bacteria 13325
350 Ga0068860_100042506 3300005843 Bacteria 4339
351 Ga0068860_100110903 3300005843 Bacteria 2623
352 Ga0068860_100407065 3300005843 Bacteria 1347
353 Ga0068860_100625000 3300005843 Bacteria 1084
354 Ga0068860_100709199 3300005843 Bacteria 1016
355 Ga0068860_100937514 3300005843 Bacteria 883
356 Ga0068860_101594488 3300005843 Bacteria 675
357 Ga0068860_101787277 3300005843 Bacteria 636
358 Ga0068862_100003143 3300005844 Bacteria 14358
359 Ga0068862_100040470 3300005844 Bacteria 3961
360 Ga0068862_100091874 3300005844 Bacteria 2644
361 Ga0068862_100103172 3300005844 Bacteria 2497
362 Ga0068862_100115629 3300005844 Bacteria 2359
363 Ga0068862_100446059 3300005844 Bacteria 1219
364 Ga0068862_100483215 3300005844 Bacteria 1173
365 Ga0081455_10000422 3300005937 Bacteria 55396
366 Ga0081455_10010015 3300005937 Bacteria 9686
367 Ga0081455_10028987 3300005937 Bacteria 5051
368 Ga0081455_10079207 3300005937 Bacteria 2698
369 Ga0081455_10448240 3300005937 Bacteria 882
370 Ga0081455_10548763 3300005937 Bacteria 765
371 Ga0081540_1027578 3300005983 Bacteria 3213
372 Ga0070717_10000064 3300006028 Bacteria 89273
373 Ga0070717_10417247 3300006028 Bacteria 1207
374 Ga0070717_10756042 3300006028 Bacteria 884
375 Ga0075363_100924436 3300006048 Bacteria 535
376 Ga0075364_11251736 3300006051 Bacteria 503
377 Ga0075432_10006617 3300006058 Bacteria 3943
378 Ga0075432_10058477 3300006058 Bacteria 1369
379 Ga0075432_10395084 3300006058 Bacteria 596
380 Ga0070715_10683641 3300006163 Bacteria 611
381 Ga0070716_100026284 3300006173 Bacteria 3116
382 Ga0070716_100270517 3300006173 Bacteria 1167
383 Ga0070716_100442032 3300006173 Bacteria 946
384 Ga0070716_100815246 3300006173 Bacteria 724
385 Ga0070712_101881419 3300006175 Bacteria 524
386 Ga0097621_100030376 3300006237 Bacteria 4276
387 Ga0097621_100492357 3300006237 Bacteria 1109
388 Ga0097621_101324039 3300006237 Bacteria 681
389 Ga0097621_101458930 3300006237 Bacteria 649
390 Ga0097621_101491088 3300006237 Bacteria 642
391 Ga0068871_100129959 3300006358 Bacteria 2135
392 Ga0068871_100377689 3300006358 Bacteria 1258
393 Ga0068871_100454439 3300006358 Bacteria 1149
394 Ga0068871_100711669 3300006358 Bacteria 921
395 Ga0068871_101018833 3300006358 Bacteria 772
396 Ga0068871_101193520 3300006358 Bacteria 714
397 Ga0068871_101282765 3300006358 Bacteria 688
398 Ga0075428_100002976 3300006844 Bacteria 18459
399 Ga0075428_100003062 3300006844 Bacteria 18244
400 Ga0075428_100032404 3300006844 Bacteria 5773
401 Ga0075428_100069486 3300006844 Bacteria 3850
402 Ga0075428_100209761 3300006844 Bacteria 2105
403 Ga0075428_100307525 3300006844 Bacteria 1704
404 Ga0075428_100371042 3300006844 Bacteria 1534
405 Ga0075430_100002410 3300006846 Bacteria 15562
406 Ga0075430_100006690 3300006846 Bacteria 9725
407 Ga0075430_100040471 3300006846 Bacteria 3945
408 Ga0075430_100299056 3300006846 Bacteria 1331
409 Ga0075430_100517172 3300006846 Unclassified 985
410 Ga0075431_100003027 3300006847 Bacteria 16266
411 Ga0075431_100179475 3300006847 Bacteria 2173
412 Ga0075431_100350728 3300006847 Bacteria 1484
413 Ga0075431_100638920 3300006847 Bacteria 1046
414 Ga0075431_100703020 3300006847 Bacteria 988
415 Ga0075431_100806056 3300006847 Bacteria 912
416 Ga0075431_100841912 3300006847 Bacteria 889
417 Ga0075431_101001326 3300006847 Bacteria 803
418 Ga0075431_101649011 3300006847 Bacteria 599
419 Ga0075433_10002443 3300006852 Bacteria 14147
420 Ga0075433_10005052 3300006852 Bacteria 10341
421 Ga0075433_10065602 3300006852 Bacteria 3184
422 Ga0075433_10084417 3300006852 Bacteria 2803
423 Ga0075433_10088307 3300006852 Bacteria 2739
424 Ga0075433_10111840 3300006852 Bacteria 2423
425 Ga0075433_10163788 3300006852 Bacteria 1979
426 Ga0075433_10187982 3300006852 Bacteria 1837
427 Ga0075433_10447346 3300006852 Bacteria 1139
428 Ga0075433_10773066 3300006852 Bacteria 840
429 Ga0075433_10830830 3300006852 Bacteria 807
430 Ga0075434_100000038 3300006871 Bacteria 59843
431 Ga0075434_100002471 3300006871 Bacteria 16270
432 Ga0075434_100014841 3300006871 Bacteria 7452
433 Ga0075434_100110302 3300006871 Bacteria 2762
434 Ga0075434_100135458 3300006871 Bacteria 2482
435 Ga0075434_100135556 3300006871 Bacteria 2481
436 Ga0075434_100246019 3300006871 Bacteria 1808
437 Ga0075429_100008584 3300006880 Bacteria 8889
438 Ga0075429_100099339 3300006880 Bacteria 2539
439 Ga0075429_100292591 3300006880 Bacteria 1426
440 Ga0075429_100305175 3300006880 Bacteria 1394
441 Ga0075429_100550555 3300006880 Bacteria 1011
442 Ga0068865_100005424 3300006881 Bacteria 7732
443 Ga0068865_100016601 3300006881 Bacteria 4716
444 Ga0075436_100002590 3300006914 Bacteria 12435
445 Ga0075436_100002790 3300006914 Bacteria 11964
446 Ga0075436_100004621 3300006914 Bacteria 9434
447 Ga0075436_100027386 3300006914 Bacteria 3923
448 Ga0075436_100076615 3300006914 Bacteria 2316
449 Ga0075436_100098077 3300006914 Bacteria 2039
450 Ga0075436_100176487 3300006914 Bacteria 1509
451 Ga0075436_100248625 3300006914 Bacteria 1266
452 Ga0075436_100915907 3300006914 Bacteria 656
453 Ga0097620_100000677 3300006931 Bacteria 34196
454 Ga0097620_100163956 3300006931 Bacteria 2302
455 Ga0097620_100284333 3300006931 Bacteria 1747
456 Ga0097620_100310923 3300006931 Bacteria 1669
457 Ga0097620_100425040 3300006931 Bacteria 1425
458 Ga0097620_100971311 3300006931 Bacteria 932
459 Ga0097620_100995693 3300006931 Bacteria 920
460 Ga0097620_101953811 3300006931 Bacteria 648
461 Ga0075435_100002461 3300007076 Bacteria 12304
462 Ga0075435_100027645 3300007076 Bacteria 4440
463 Ga0075435_100088348 3300007076 Bacteria 2554
464 Ga0075435_100236973 3300007076 Bacteria 1551
465 Ga0075435_100242611 3300007076 Bacteria 1533
466 Ga0075435_100300747 3300007076 Bacteria 1372
467 Ga0075435_100488791 3300007076 Bacteria 1064
468 Ga0075435_100747103 3300007076 Bacteria 851
469 Ga0075435_101963034 3300007076 Bacteria 514
470 Ga0099794_10049726 3300007265 Bacteria 2016
471 Ga0099794_10197181 3300007265 Bacteria 1031
472 Ga0099794_10297416 3300007265 Unclassified 836
473 Ga0099795_10020338 3300007788 Bacteria 2160
474 Ga0099795_10424156 3300007788 Bacteria 608
475 Ga0105251_10107526 3300009011 Bacteria 1272
476 Ga0105251_10293874 3300009011 Bacteria 736
477 Ga0105244_10011650 3300009036 Bacteria 5253
478 Ga0105240_10127569 3300009093 Bacteria 3055
479 Ga0105240_10732476 3300009093 Bacteria 1076
480 Ga0111539_10000022 3300009094 Bacteria 240838
481 Ga0111539_10058961 3300009094 Bacteria 4554
482 Ga0111539_10199861 3300009094 Bacteria 2331
483 Ga0111539_10349380 3300009094 Bacteria 1721
484 Ga0111539_10923746 3300009094 Bacteria 1015
485 Ga0111539_10934786 3300009094 Bacteria 1008
486 Ga0111539_11120732 3300009094 Bacteria 914
487 Ga0111539_12242981 3300009094 Bacteria 633
488 Ga0111539_12975874 3300009094 Bacteria 548
489 Ga0105245_10001507 3300009098 Bacteria 21079
490 Ga0105245_10368411 3300009098 Bacteria 1428
491 Ga0105245_11361665 3300009098 Bacteria 759
492 Ga0105245_11449824 3300009098 Bacteria 737
493 Ga0105247_10151259 3300009101 Bacteria 1529
494 Ga0105247_10271221 3300009101 Bacteria 1167
495 Ga0114129_10000247 3300009147 Bacteria 60820
496 Ga0114129_10001417 3300009147 Bacteria 32326
497 Ga0114129_10002852 3300009147 Bacteria 24170
498 Ga0114129_10046019 3300009147 Bacteria 6133
499 Ga0114129_10063914 3300009147 Bacteria 5136
500 Ga0114129_10177970 3300009147 Bacteria 2896
501 Ga0114129_10439907 3300009147 Bacteria 1712
502 Ga0114129_10521343 3300009147 Bacteria 1549
503 Ga0114129_10525620 3300009147 Bacteria 1542
504 Ga0114129_10715113 3300009147 Bacteria 1286
505 Ga0114129_11090486 3300009147 Bacteria 1000
506 Ga0114129_11460040 3300009147 Bacteria 842
507 Ga0114129_11718743 3300009147 Bacteria 765
508 Ga0105243_10000009 3300009148 Bacteria 354419
509 Ga0105243_11007106 3300009148 Bacteria 836
510 Ga0105241_10080778 3300009174 Bacteria 2545
511 Ga0105241_11962224 3300009174 Bacteria 575
512 Ga0105242_10012536 3300009176 Bacteria 6525
513 Ga0105242_10080321 3300009176 Bacteria 2725
514 Ga0105242_10713146 3300009176 Bacteria 983
515 Ga0105242_10748162 3300009176 Bacteria 962
516 Ga0105242_12012325 3300009176 Bacteria 620
517 Ga0105248_10008944 3300009177 Bacteria 11015
518 Ga0105248_10223859 3300009177 Bacteria 2118
519 Ga0105248_10574996 3300009177 Bacteria 1271
520 Ga0105248_10689478 3300009177 Bacteria 1152
521 Ga0105248_10960038 3300009177 Bacteria 965
522 Ga0105248_11517177 3300009177 Bacteria 759
523 Ga0105248_12580991 3300009177 Bacteria 579
524 Ga0105248_12890409 3300009177 Bacteria 548
525 Ga0105248_13041606 3300009177 Bacteria 534
526 Ga0105237_10066336 3300009545 Bacteria 3604
527 Ga0105237_11477833 3300009545 Bacteria 686
528 Ga0105238_10000002 3300009551 Bacteria 772711
529 Ga0105238_10145814 3300009551 Bacteria 2344
530 Ga0105238_10456576 3300009551 Bacteria 1275
531 Ga0105238_11023362 3300009551 Bacteria 847
532 Ga0105249_10026603 3300009553 Bacteria 5216
533 Ga0105249_10725262 3300009553 Bacteria 1055
534 Ga0105249_11281389 3300009553 Unclassified 804
535 Ga0105249_11793297 3300009553 Bacteria 686
536 Ga0105249_12996498 3300009553 Bacteria 542
537 Ga0099796_10090524 3300010159 Bacteria 1137
538 Ga0099796_10554021 3300010159 Bacteria 517
539 Ga0105239_11699799 3300010375 Bacteria 730
540 Ga0105239_12145162 3300010375 Bacteria 649
541 Ga0105239_12558569 3300010375 Bacteria 595
542 Ga0105239_13315569 3300010375 Bacteria 524
543 Ga0105246_10235421 3300011119 Bacteria 1444
544 Ga0157347_1066412 3300012502 Bacteria 525
545 Ga0157373_10325377 3300013100 Bacteria 1094
546 Ga0157373_10638818 3300013100 Bacteria 777
547 Ga0157369_10001943 3300013105 Bacteria 24887
548 Ga0157369_10100872 3300013105 Bacteria 3077
549 Ga0157369_11203607 3300013105 Bacteria 773
550 Ga0157374_10000005 3300013296 Bacteria 646767
551 Ga0157374_10002664 3300013296 Bacteria 15039
552 Ga0157374_10039567 3300013296 Bacteria 4339
553 Ga0157374_10508101 3300013296 Bacteria 1210
554 Ga0157378_10012246 3300013297 Bacteria 7510
555 Ga0157378_10096295 3300013297 Bacteria 2697
556 Ga0157378_10108940 3300013297 Bacteria 2537
557 Ga0157378_10227763 3300013297 Bacteria 1774
558 Ga0157378_10300065 3300013297 Bacteria 1555
559 Ga0157378_10325710 3300013297 Bacteria 1494
560 Ga0157378_11002773 3300013297 Bacteria 869
561 Ga0157378_12184179 3300013297 Bacteria 605
562 Ga0163162_10093242 3300013306 Bacteria 3096
563 Ga0163162_10212271 3300013306 Bacteria 2066
564 Ga0163162_10429766 3300013306 Bacteria 1453
565 Ga0157372_11136133 3300013307 Bacteria 903
566 Ga0157375_10012356 3300013308 Bacteria 7571
567 Ga0157375_10021527 3300013308 Bacteria 5914
568 Ga0157375_10064497 3300013308 Bacteria 3647
569 Ga0157375_10071083 3300013308 Bacteria 3492
570 Ga0157375_10237799 3300013308 Bacteria 1981
571 Ga0157375_10379526 3300013308 Bacteria 1580
572 Ga0157375_10536984 3300013308 Bacteria 1332
573 Ga0157375_10749389 3300013308 Bacteria 1128
574 Ga0157375_10928052 3300013308 Bacteria 1013
575 Ga0157375_11218204 3300013308 Bacteria 883
576 Ga0157375_12260814 3300013308 Bacteria 648
577 Ga0163163_10036365 3300014325 Bacteria 4782
578 Ga0163163_10053167 3300014325 Bacteria 3997
579 Ga0163163_10054913 3300014325 Bacteria 3936
580 Ga0163163_10139935 3300014325 Bacteria 2462
581 Ga0163163_10271121 3300014325 Bacteria 1748
582 Ga0163163_10313241 3300014325 Bacteria 1623
583 Ga0163163_10365909 3300014325 Bacteria 1499
584 Ga0163163_10723073 3300014325 Bacteria 1059
585 Ga0163163_10728194 3300014325 Bacteria 1055
586 Ga0163163_10844320 3300014325 Bacteria 979
587 Ga0163163_10928670 3300014325 Bacteria 933
588 Ga0163163_11145053 3300014325 Bacteria 841
589 Ga0157380_10001355 3300014326 Bacteria 15948
590 Ga0157380_10205467 3300014326 Bacteria 1751
591 Ga0157380_10688406 3300014326 Bacteria 1025
592 Ga0157380_12863327 3300014326 Bacteria 549
593 Ga0157380_13133087 3300014326 Bacteria 528
594 Ga0182008_10834581 3300014497 Bacteria 537
595 Ga0157377_10000001 3300014745 Bacteria 623098
596 Ga0157377_10000414 3300014745 Bacteria 18520
597 Ga0157377_10046193 3300014745 Bacteria 2434
598 Ga0157377_10191602 3300014745 Bacteria 1292
599 Ga0157377_10565156 3300014745 Bacteria 806
600 Ga0157379_10000714 3300014968 Bacteria 26943
601 Ga0157379_10138032 3300014968 Bacteria 2197
602 Ga0157379_10307620 3300014968 Bacteria 1445
603 Ga0157379_10533826 3300014968 Bacteria 1090
604 Ga0157379_10549618 3300014968 Bacteria 1074
605 Ga0157379_11303935 3300014968 Bacteria 701
606 Ga0157379_11498675 3300014968 Bacteria 656
607 Ga0157376_10000003 3300014969 Bacteria 568634
608 Ga0157376_10046438 3300014969 Bacteria 3581
609 Ga0157376_10654389 3300014969 Bacteria 1051
610 Ga0157376_10676509 3300014969 Bacteria 1035
611 Ga0157376_11115777 3300014969 Bacteria 815
612 Ga0157376_11341442 3300014969 Bacteria 746
613 Ga0157376_11493894 3300014969 Bacteria 708
614 Ga0157376_11763036 3300014969 Bacteria 655
615 Ga0182007_10306095 3300015262 Bacteria 585
616 Ga0163161_10063568 3300017792 Bacteria 2691
617 Ga0206356_11765259 3300020070 Bacteria 1730
618 Ga0206352_10878108 3300020078 Bacteria 2719
619 Ga0213873_10000018 3300021358 Bacteria 123140
620 Ga0213873_10000553 3300021358 Bacteria 6058
621 Ga0213876_10000009 3300021384 Bacteria 496136
622 Ga0213876_10000058 3300021384 Bacteria 134080
623 Ga0207666_1001625 3300025271 Bacteria 2664
624 Ga0207697_10009073 3300025315 Bacteria 4310
625 Ga0207697_10068448 3300025315 Bacteria 1485
626 Ga0207655_1019809 3300025728 Bacteria 3494
627 Ga0207653_10128253 3300025885 Unclassified 919
628 Ga0207682_10001734 3300025893 Bacteria 10002
629 Ga0207682_10143047 3300025893 Bacteria 1074
630 Ga0207692_10077477 3300025898 Bacteria 1769
631 Ga0207692_10915755 3300025898 Bacteria 577
632 Ga0207642_10101044 3300025899 Bacteria 1448
633 Ga0207710_10203240 3300025900 Bacteria 979
634 Ga0207710_10504380 3300025900 Bacteria 628
635 Ga0207688_10006667 3300025901 Bacteria 6282
636 Ga0207680_10003484 3300025903 Bacteria 7410
637 Ga0207680_10007364 3300025903 Bacteria 5358
638 Ga0207680_10033943 3300025903 Bacteria 2915
639 Ga0207680_10152895 3300025903 Bacteria 1540
640 Ga0207680_10374993 3300025903 Bacteria 1002
641 Ga0207680_10472711 3300025903 Bacteria 891
642 Ga0207680_10571957 3300025903 Bacteria 807
643 Ga0207680_10793122 3300025903 Bacteria 679
644 Ga0207647_10068009 3300025904 Bacteria 2157
645 Ga0207647_10118635 3300025904 Bacteria 1561
646 Ga0207647_10422104 3300025904 Bacteria 750
647 Ga0207685_10194185 3300025905 Bacteria 949
648 Ga0207685_10353728 3300025905 Unclassified 741
649 Ga0207685_10353837 3300025905 Bacteria 741
650 Ga0207685_10811008 3300025905 Bacteria 516
651 Ga0207699_10068910 3300025906 Bacteria 2155
652 Ga0207699_10096815 3300025906 Bacteria 1864
653 Ga0207699_10205798 3300025906 Bacteria 1336
654 Ga0207699_10276684 3300025906 Bacteria 1165
655 Ga0207699_10423402 3300025906 Bacteria 951
656 Ga0207645_10006128 3300025907 Bacteria 8639
657 Ga0207645_10021058 3300025907 Bacteria 4257
658 Ga0207645_10123441 3300025907 Bacteria 1682
659 Ga0207643_10001235 3300025908 Bacteria 15094
660 Ga0207643_10017199 3300025908 Bacteria 3950
661 Ga0207643_10081943 3300025908 Bacteria 1870
662 Ga0207643_10206890 3300025908 Bacteria 1197
663 Ga0207684_10011604 3300025910 Bacteria 7699
664 Ga0207684_10035936 3300025910 Unclassified 4205
665 Ga0207684_10043926 3300025910 Bacteria 3789
666 Ga0207684_10072862 3300025910 Bacteria 2917
667 Ga0207684_10134177 3300025910 Bacteria 2125
668 Ga0207684_10141204 3300025910 Bacteria 2070
669 Ga0207684_10190569 3300025910 Bacteria 1769
670 Ga0207684_10238580 3300025910 Bacteria 1568
671 Ga0207684_10544790 3300025910 Unclassified 993
672 Ga0207684_11008326 3300025910 Bacteria 696
673 Ga0207654_10623314 3300025911 Bacteria 771
674 Ga0207707_10070280 3300025912 Bacteria 3051
675 Ga0207707_10317843 3300025912 Bacteria 1345
676 Ga0207707_10899627 3300025912 Unclassified 732
677 Ga0207695_10091115 3300025913 Bacteria 3063
678 Ga0207695_10433346 3300025913 Bacteria 1198
679 Ga0207693_10090246 3300025915 Bacteria 2402
680 Ga0207693_10218115 3300025915 Bacteria 1499
681 Ga0207693_10299968 3300025915 Bacteria 1259
682 Ga0207693_10378669 3300025915 Bacteria 1107
683 Ga0207693_11170599 3300025915 Bacteria 581
684 Ga0207663_10052095 3300025916 Bacteria 2552
685 Ga0207663_10173978 3300025916 Bacteria 1532
686 Ga0207663_10383107 3300025916 Bacteria 1072
687 Ga0207660_10774686 3300025917 Bacteria 783
688 Ga0207660_11262676 3300025917 Bacteria 600
689 Ga0207662_10059669 3300025918 Bacteria 2287
690 Ga0207662_10068221 3300025918 Bacteria 2147
691 Ga0207662_10086791 3300025918 Bacteria 1918
692 Ga0207662_10136184 3300025918 Bacteria 1552
693 Ga0207662_10153364 3300025918 Bacteria 1467
694 Ga0207662_11017249 3300025918 Bacteria 589
695 Ga0207657_10064105 3300025919 Bacteria 3138
696 Ga0207657_10489885 3300025919 Bacteria 963
697 Ga0207657_10604040 3300025919 Bacteria 856
698 Ga0207657_10653070 3300025919 Bacteria 819
699 Ga0207649_10268711 3300025920 Bacteria 1235
700 Ga0207649_10724585 3300025920 Bacteria 772
701 Ga0207652_10293903 3300025921 Bacteria 1466
702 Ga0207646_10000343 3300025922 Bacteria 62896
703 Ga0207646_10080346 3300025922 Bacteria 2915
704 Ga0207646_10140516 3300025922 Bacteria 2175
705 Ga0207646_10147358 3300025922 Bacteria 2121
706 Ga0207646_10207606 3300025922 Bacteria 1769
707 Ga0207646_10215582 3300025922 Bacteria 1734
708 Ga0207646_10333027 3300025922 Bacteria 1371
709 Ga0207646_10581853 3300025922 Bacteria 1005
710 Ga0207646_10586794 3300025922 Bacteria 1001
711 Ga0207646_10821657 3300025922 Bacteria 827
712 Ga0207646_11430375 3300025922 Bacteria 601
713 Ga0207681_10002742 3300025923 Bacteria 11146
714 Ga0207681_10152701 3300025923 Bacteria 1732
715 Ga0207681_10287031 3300025923 Bacteria 1297
716 Ga0207681_10767289 3300025923 Bacteria 804
717 Ga0207681_11437631 3300025923 Bacteria 579
718 Ga0207694_10000001 3300025924 Bacteria 4078485
719 Ga0207694_10176365 3300025924 Bacteria 1732
720 Ga0207650_10000082 3300025925 Bacteria 128722
721 Ga0207650_10011593 3300025925 Bacteria 6071
722 Ga0207650_10048909 3300025925 Bacteria 3120
723 Ga0207650_10116501 3300025925 Bacteria 2075
724 Ga0207650_10302623 3300025925 Bacteria 1306
725 Ga0207650_10768909 3300025925 Bacteria 815
726 Ga0207659_10000036 3300025926 Bacteria 103327
727 Ga0207659_10115953 3300025926 Bacteria 2044
728 Ga0207659_10120504 3300025926 Bacteria 2010
729 Ga0207659_10287415 3300025926 Bacteria 1346
730 Ga0207659_10329048 3300025926 Bacteria 1263
731 Ga0207659_10403812 3300025926 Bacteria 1143
732 Ga0207659_10669329 3300025926 Bacteria 888
733 Ga0207659_10779324 3300025926 Bacteria 821
734 Ga0207687_10000005 3300025927 Bacteria 770649
735 Ga0207687_10607398 3300025927 Bacteria 922
736 Ga0207687_11309652 3300025927 Bacteria 623
737 Ga0207687_11549680 3300025927 Bacteria 569
738 Ga0207700_10051399 3300025928 Bacteria 3076
739 Ga0207700_10089784 3300025928 Bacteria 2423
740 Ga0207700_10098343 3300025928 Bacteria 2328
741 Ga0207700_10801507 3300025928 Bacteria 842
742 Ga0207700_10945405 3300025928 Bacteria 771
743 Ga0207644_10055836 3300025931 Bacteria 2848
744 Ga0207644_10259586 3300025931 Bacteria 1389
745 Ga0207644_11465725 3300025931 Bacteria 573
746 Ga0207690_10025055 3300025932 Bacteria 3742
747 Ga0207690_10136438 3300025932 Bacteria 1802
748 Ga0207706_10013582 3300025933 Bacteria 7398
749 Ga0207706_10073033 3300025933 Bacteria 3016
750 Ga0207706_10091565 3300025933 Bacteria 2673
751 Ga0207706_10105904 3300025933 Bacteria 2474
752 Ga0207706_10433223 3300025933 Bacteria 1139
753 Ga0207706_10588375 3300025933 Bacteria 957
754 Ga0207706_10954501 3300025933 Bacteria 722
755 Ga0207686_10001508 3300025934 Bacteria 13115
756 Ga0207686_10217571 3300025934 Bacteria 1377
757 Ga0207709_10000026 3300025935 Bacteria 354467
758 Ga0207709_10210974 3300025935 Bacteria 1394
759 Ga0207709_11215995 3300025935 Bacteria 621
760 Ga0207670_10070690 3300025936 Bacteria 2412
761 Ga0207670_10136374 3300025936 Bacteria 1804
762 Ga0207670_10148699 3300025936 Bacteria 1735
763 Ga0207670_10150696 3300025936 Bacteria 1725
764 Ga0207670_10309877 3300025936 Bacteria 1239
765 Ga0207670_10474085 3300025936 Bacteria 1013
766 Ga0207670_10531204 3300025936 Bacteria 959
767 Ga0207670_10555149 3300025936 Bacteria 939
768 Ga0207670_10850257 3300025936 Bacteria 762
769 Ga0207670_11671863 3300025936 Bacteria 541
770 Ga0207669_10100540 3300025937 Bacteria 1910
771 Ga0207669_10323551 3300025937 Bacteria 1181
772 Ga0207669_10468953 3300025937 Bacteria 1001
773 Ga0207669_10705697 3300025937 Bacteria 829
774 Ga0207669_11881879 3300025937 Bacteria 511
775 Ga0207704_10003857 3300025938 Bacteria 6810
776 Ga0207704_10029913 3300025938 Bacteria 3046
777 Ga0207704_10765814 3300025938 Bacteria 804
778 Ga0207704_11810931 3300025938 Bacteria 525
779 Ga0207665_10006268 3300025939 Bacteria 7894
780 Ga0207665_10009968 3300025939 Bacteria 6235
781 Ga0207665_10018501 3300025939 Bacteria 4577
782 Ga0207665_10026836 3300025939 Bacteria 3803
783 Ga0207665_10251041 3300025939 Bacteria 1307
784 Ga0207665_10305436 3300025939 Bacteria 1190
785 Ga0207665_10457139 3300025939 Bacteria 981
786 Ga0207665_10496467 3300025939 Bacteria 942
787 Ga0207665_10548002 3300025939 Bacteria 898
788 Ga0207665_10864190 3300025939 Unclassified 716
789 Ga0207691_10000326 3300025940 Bacteria 47354
790 Ga0207691_10002644 3300025940 Bacteria 17504
791 Ga0207691_10006947 3300025940 Bacteria 10917
792 Ga0207691_10133717 3300025940 Bacteria 2189
793 Ga0207691_10204635 3300025940 Bacteria 1717
794 Ga0207691_10289454 3300025940 Bacteria 1409
795 Ga0207691_10727844 3300025940 Bacteria 836
796 Ga0207691_11018557 3300025940 Bacteria 691
797 Ga0207711_10007454 3300025941 Bacteria 9155
798 Ga0207711_10197035 3300025941 Bacteria 1837
799 Ga0207711_10389374 3300025941 Bacteria 1294
800 Ga0207711_11458974 3300025941 Bacteria 627
801 Ga0207711_11985335 3300025941 Bacteria 525
802 Ga0207689_10009254 3300025942 Bacteria 8519
803 Ga0207689_10009503 3300025942 Bacteria 8397
804 Ga0207689_10020085 3300025942 Bacteria 5624
805 Ga0207689_10065221 3300025942 Bacteria 2996
806 Ga0207689_10140200 3300025942 Bacteria 1992
807 Ga0207689_10340280 3300025942 Bacteria 1246
808 Ga0207689_10446792 3300025942 Bacteria 1080
809 Ga0207689_11199927 3300025942 Bacteria 639
810 Ga0207689_11416054 3300025942 Bacteria 582
811 Ga0207661_10000006 3300025944 Bacteria 537727
812 Ga0207661_10007008 3300025944 Bacteria 7997
813 Ga0207661_10082186 3300025944 Bacteria 2663
814 Ga0207679_10071083 3300025945 Bacteria 2624
815 Ga0207679_10482510 3300025945 Bacteria 1104
816 Ga0207679_10566129 3300025945 Bacteria 1021
817 Ga0207679_10716020 3300025945 Bacteria 909
818 Ga0207679_11403420 3300025945 Bacteria 641
819 Ga0207679_11573638 3300025945 Bacteria 602
820 Ga0207667_10003431 3300025949 Bacteria 19566
821 Ga0207667_10023566 3300025949 Bacteria 6777
822 Ga0207651_10006583 3300025960 Bacteria 6102
823 Ga0207651_10007125 3300025960 Bacteria 5937
824 Ga0207651_10064605 3300025960 Bacteria 2562
825 Ga0207651_10099429 3300025960 Bacteria 2154
826 Ga0207651_10742043 3300025960 Bacteria 867
827 Ga0207651_10855995 3300025960 Bacteria 808
828 Ga0207651_11107468 3300025960 Bacteria 710
829 Ga0207712_10290886 3300025961 Bacteria 1337
830 Ga0207712_10624678 3300025961 Unclassified 934
831 Ga0207712_10782455 3300025961 Bacteria 838
832 Ga0207712_10943791 3300025961 Bacteria 764
833 Ga0207668_10018999 3300025972 Bacteria 4334
834 Ga0207668_10554333 3300025972 Bacteria 996
835 Ga0207640_10107477 3300025981 Bacteria 1970
836 Ga0207640_10305543 3300025981 Bacteria 1260
837 Ga0207640_10989329 3300025981 Bacteria 739
838 Ga0207658_10001637 3300025986 Bacteria 17158
839 Ga0207658_10055938 3300025986 Bacteria 2926
840 Ga0207658_10351037 3300025986 Bacteria 1284
841 Ga0207677_10000101 3300026023 Bacteria 70739
842 Ga0207677_10218669 3300026023 Bacteria 1526
843 Ga0207677_10291313 3300026023 Bacteria 1345
844 Ga0207677_11090546 3300026023 Bacteria 727
845 Ga0207677_11423989 3300026023 Unclassified 639
846 Ga0207677_11805638 3300026023 Bacteria 568
847 Ga0207703_10007604 3300026035 Bacteria 8591
848 Ga0207703_10316451 3300026035 Bacteria 1428
849 Ga0207703_10392236 3300026035 Bacteria 1286
850 Ga0207703_10410089 3300026035 Bacteria 1259
851 Ga0207703_11039613 3300026035 Bacteria 786
852 Ga0207703_11467887 3300026035 Bacteria 656
853 Ga0207703_11536237 3300026035 Bacteria 641
854 Ga0207639_10000013 3300026041 Bacteria 293084
855 Ga0207639_10189920 3300026041 Bacteria 1754
856 Ga0207639_10492689 3300026041 Bacteria 1118
857 Ga0207678_10049059 3300026067 Bacteria 3648
858 Ga0207678_10190888 3300026067 Bacteria 1751
859 Ga0207678_10222677 3300026067 Bacteria 1615
860 Ga0207678_10759286 3300026067 Bacteria 855
861 Ga0207678_11932014 3300026067 Bacteria 514
862 Ga0207708_10000041 3300026075 Bacteria 126142
863 Ga0207708_10011108 3300026075 Bacteria 6697
864 Ga0207708_10012451 3300026075 Bacteria 6340
865 Ga0207708_10906223 3300026075 Bacteria 763
866 Ga0207702_10001471 3300026078 Bacteria 23360
867 Ga0207702_10011175 3300026078 Bacteria 7488
868 Ga0207702_10182964 3300026078 Bacteria 1931
869 Ga0207702_10332278 3300026078 Bacteria 1450
870 Ga0207702_10808274 3300026078 Bacteria 927
871 Ga0207702_10819429 3300026078 Bacteria 920
872 Ga0207702_11743255 3300026078 Bacteria 615
873 Ga0207641_10037244 3300026088 Bacteria 4061
874 Ga0207641_10048111 3300026088 Bacteria 3598
875 Ga0207641_10137639 3300026088 Bacteria 2199
876 Ga0207641_10147519 3300026088 Bacteria 2128
877 Ga0207641_10465979 3300026088 Bacteria 1223
878 Ga0207641_10611981 3300026088 Bacteria 1067
879 Ga0207641_10648581 3300026088 Bacteria 1037
880 Ga0207641_10688216 3300026088 Bacteria 1006
881 Ga0207648_10011154 3300026089 Bacteria 8479
882 Ga0207648_10024555 3300026089 Bacteria 5379
883 Ga0207648_10035580 3300026089 Bacteria 4388
884 Ga0207648_10043194 3300026089 Bacteria 3957
885 Ga0207648_10307115 3300026089 Bacteria 1423
886 Ga0207648_10359341 3300026089 Bacteria 1314
887 Ga0207676_10098517 3300026095 Bacteria 2417
888 Ga0207676_10177426 3300026095 Bacteria 1862
889 Ga0207676_10214264 3300026095 Bacteria 1711
890 Ga0207676_10500738 3300026095 Bacteria 1153
891 Ga0207676_10736336 3300026095 Bacteria 958
892 Ga0207674_11570213 3300026116 Bacteria 627
893 Ga0207674_11773476 3300026116 Bacteria 585
894 Ga0207675_100002645 3300026118 Bacteria 17685
895 Ga0207675_100002673 3300026118 Bacteria 17594
896 Ga0207675_100013850 3300026118 Bacteria 7520
897 Ga0207675_100060186 3300026118 Bacteria 3545
898 Ga0207675_100109886 3300026118 Bacteria 2602
899 Ga0207675_100361315 3300026118 Bacteria 1424
900 Ga0207675_101074241 3300026118 Bacteria 824
901 Ga0207683_10005107 3300026121 Bacteria 11263
902 Ga0207683_10317284 3300026121 Bacteria 1427
903 Ga0207683_10512688 3300026121 Bacteria 1108
904 Ga0207698_10043801 3300026142 Bacteria 3356
905 Ga0207698_10208854 3300026142 Bacteria 1755
906 Ga0207698_10703309 3300026142 Bacteria 1006
907 Ga0207698_12121934 3300026142 Bacteria 575
908 Ga0209969_1040868 3300027360 Bacteria 720
909 Ga0209981_1011093 3300027378 Bacteria 1241
910 Ga0209996_1014048 3300027395 Bacteria 1087
911 Ga0209179_1027708 3300027512 Bacteria 1144
912 Ga0209968_1002058 3300027526 Bacteria 3059
913 Ga0209982_1007080 3300027552 Bacteria 1638
914 Ga0210002_1020599 3300027617 Bacteria 1062
915 Ga0209983_1000280 3300027665 Bacteria 10618
916 Ga0209588_1025351 3300027671 Bacteria 1876
917 Ga0209588_1032623 3300027671 Bacteria 1669
918 Ga0209588_1218255 3300027671 Bacteria 590
919 Ga0209971_1000384 3300027682 Bacteria 12081
920 Ga0209966_1133005 3300027695 Bacteria 575
921 Ga0209998_10002827 3300027717 Bacteria 3904
922 Ga0209974_10004420 3300027876 Bacteria 5002
923 Ga0209974_10128164 3300027876 Bacteria 903
924 Ga0209974_10197531 3300027876 Bacteria 742
925 Ga0207428_10000030 3300027907 Bacteria 240846
926 Ga0207428_10017611 3300027907 Bacteria 6126
927 Ga0207428_10042290 3300027907 Bacteria 3684
928 Ga0207428_10380583 3300027907 Bacteria 1035
929 Ga0207428_11037160 3300027907 Bacteria 575
930 Ga0207428_11047024 3300027907 Bacteria 572
931 Ga0268266_10000259 3300028379 Bacteria 88660
932 Ga0268266_10015961 3300028379 Bacteria 6425
933 Ga0268266_10047157 3300028379 Bacteria 3690
934 Ga0268266_10309020 3300028379 Bacteria 1477
935 Ga0268265_10009861 3300028380 Bacteria 6450
936 Ga0268265_10034866 3300028380 Bacteria 3671
937 Ga0268265_10037170 3300028380 Bacteria 3572
938 Ga0268265_10045924 3300028380 Bacteria 3262
939 Ga0268265_10220454 3300028380 Bacteria 1659
940 Ga0268265_10485770 3300028380 Bacteria 1161
941 Ga0268265_10490222 3300028380 Bacteria 1156
942 Ga0268265_10490646 3300028380 Bacteria 1156
943 Ga0268265_11237145 3300028380 Bacteria 745
944 Ga0268265_11331701 3300028380 Bacteria 719
945 Ga0268264_10005977 3300028381 Bacteria 10304
946 Ga0268264_10044863 3300028381 Bacteria 3669
947 Ga0268264_10049767 3300028381 Bacteria 3488
948 Ga0268264_10136493 3300028381 Bacteria 2181
949 Ga0268264_10144015 3300028381 Bacteria 2128
950 Ga0268264_10197367 3300028381 Bacteria 1838
951 Ga0268264_10209665 3300028381 Bacteria 1788
952 Ga0268264_10259334 3300028381 Bacteria 1618
953 Ga0268264_10362378 3300028381 Bacteria 1383
954 Ga0268264_10497856 3300028381 Bacteria 1188
955 Ga0268264_11076106 3300028381 Bacteria 812
956 Ga0268264_11085509 3300028381 Bacteria 809
957 Ga0265319_1044281 3300028563 Bacteria 1492
958 Ga0265319_1060122 3300028563 Bacteria 1234
959 Ga0265334_10078109 3300028573 Bacteria 1223
960 Ga0265323_10004178 3300028653 Bacteria 6252
961 Ga0265323_10067614 3300028653 Bacteria 1228
962 Ga0265338_10016967 3300028800 Bacteria 7878
963 Ga0265338_10128873 3300028800 Bacteria 2002
964 Ga0265338_10345344 3300028800 Bacteria 1071
965 Ga0265338_10642953 3300028800 Bacteria 736
966 Ga0265338_11184375 3300028800 Unclassified 513
967 Ga0307511_10002513 3300030521 Bacteria 19146
968 Ga0307511_10231185 3300030521 Unclassified 915
969 Ga0265767_110710 3300030836 Bacteria 616
970 Ga0265767_112437 3300030836 Bacteria 588
971 Ga0265764_113392 3300030882 Bacteria 547
972 Ga0265330_10000541 3300031235 Bacteria 24732
973 Ga0265330_10001334 3300031235 Bacteria 14415
974 Ga0265330_10003060 3300031235 Bacteria 8862
975 Ga0265330_10375265 3300031235 Bacteria 601
976 Ga0265332_10064443 3300031238 Bacteria 1565
977 Ga0265332_10155677 3300031238 Bacteria 955
978 Ga0265328_10051354 3300031239 Bacteria 1514
979 Ga0265320_10307898 3300031240 Bacteria 700
980 Ga0265329_10003473 3300031242 Bacteria 6856
981 Ga0265329_10015790 3300031242 Bacteria 2630
982 Ga0265329_10034598 3300031242 Bacteria 1632
983 Ga0265340_10015118 3300031247 Bacteria 4016
984 Ga0265339_10055328 3300031249 Bacteria 2153
985 Ga0265339_10075819 3300031249 Bacteria 1785
986 Ga0265339_10240841 3300031249 Bacteria 878
987 Ga0265331_10073224 3300031250 Bacteria 1600
988 Ga0265331_10233136 3300031250 Bacteria 827
989 Ga0265316_10000251 3300031344 Bacteria 61672
990 Ga0265316_10000984 3300031344 Bacteria 30933
991 Ga0265316_10014237 3300031344 Bacteria 7014
992 Ga0265316_10018769 3300031344 Bacteria 5936
993 Ga0265316_10028493 3300031344 Bacteria 4607
994 Ga0265316_10048657 3300031344 Unclassified 3345
995 Ga0265316_10169982 3300031344 Bacteria 1626
996 Ga0265316_10388436 3300031344 Bacteria 1006
997 Ga0307408_100164966 3300031548 Bacteria 1763
998 Ga0307408_100236106 3300031548 Unclassified 1500
999 Ga0307408_102138195 3300031548 Bacteria 540
1000 Ga0265313_10122813 3300031595 Bacteria 1131
1001 Ga0307508_10050191 3300031616 Bacteria 3713
1002 Ga0316575_10002995 3300031665 Bacteria 5756
1003 Ga0316575_10014672 3300031665 Bacteria 2945
1004 Ga0316575_10021116 3300031665 Bacteria 2503
1005 Ga0316579_10070932 3300031691 Bacteria 1651
1006 Ga0316579_10157791 3300031691 Bacteria 1096
1007 Ga0265314_10023438 3300031711 Bacteria 4706
1008 Ga0265314_10114121 3300031711 Bacteria 1712
1009 Ga0265342_10008085 3300031712 Bacteria 7603
1010 Ga0265342_10036131 3300031712 Bacteria 3019
1011 Ga0265342_10039697 3300031712 Bacteria 2858
1012 Ga0265342_10085382 3300031712 Bacteria 1817
1013 Ga0265342_10176966 3300031712 Bacteria 1170
1014 Ga0316576_10012802 3300031727 Bacteria 5552
1015 Ga0316576_10031380 3300031727 Bacteria 3770
1016 Ga0316576_10072783 3300031727 Bacteria 2538
1017 Ga0316576_10254444 3300031727 Bacteria 1318
1018 Ga0316576_10343935 3300031727 Bacteria 1110
1019 Ga0316576_10358298 3300031727 Bacteria 1085
1020 Ga0316578_10148460 3300031728 Bacteria 1412
1021 Ga0307516_10003404 3300031730 Bacteria 20479
1022 Ga0307405_10139666 3300031731 Bacteria 1687
1023 Ga0307405_10724904 3300031731 Bacteria 826
1024 Ga0316577_10006446 3300031733 Bacteria 6198
1025 Ga0316577_10035166 3300031733 Bacteria 2800
1026 Ga0316577_10160530 3300031733 Bacteria 1268
1027 Ga0316577_10429752 3300031733 Bacteria 750
1028 Ga0307413_10005834 3300031824 Bacteria 5550
1029 Ga0307413_10371109 3300031824 Bacteria 1111
1030 Ga0307410_10001864 3300031852 Bacteria 9833
1031 Ga0307410_10034138 3300031852 Bacteria 3291
1032 Ga0307410_10371816 3300031852 Bacteria 1148
1033 Ga0326468_10043698 3300031889 Bacteria 651
1034 Ga0307406_10235992 3300031901 Bacteria 1369
1035 Ga0307406_10787551 3300031901 Bacteria 801
1036 Ga0307406_12037644 3300031901 Bacteria 513
1037 Ga0307407_10033183 3300031903 Bacteria 2814
1038 Ga0307407_11490439 3300031903 Bacteria 535
1039 Ga0307412_10233228 3300031911 Bacteria 1419
1040 Ga0307412_10394963 3300031911 Bacteria 1124
1041 Ga0307412_11035527 3300031911 Bacteria 727
1042 Ga0307412_11463688 3300031911 Bacteria 620
1043 Ga0307409_100002915 3300031995 Bacteria 9086
1044 Ga0307409_100048335 3300031995 Bacteria 3236
1045 Ga0307409_100109897 3300031995 Bacteria 2309
1046 Ga0307409_100625568 3300031995 Bacteria 1067
1047 Ga0307409_101589606 3300031995 Bacteria 682
1048 Ga0307409_102225915 3300031995 Bacteria 578
1049 Ga0307416_100018585 3300032002 Bacteria 4902
1050 Ga0307416_100039410 3300032002 Bacteria 3658
1051 Ga0307416_100496117 3300032002 Bacteria 1284
1052 Ga0307416_100807659 3300032002 Bacteria 1034
1053 Ga0307416_101190947 3300032002 Bacteria 867
1054 Ga0307416_101215820 3300032002 Bacteria 859
1055 Ga0307416_101970819 3300032002 Bacteria 687
1056 Ga0307414_10005193 3300032004 Bacteria 7147
1057 Ga0307414_10007281 3300032004 Bacteria 6215
1058 Ga0307414_10028964 3300032004 Bacteria 3599
1059 Ga0307414_10042491 3300032004 Bacteria 3089
1060 Ga0307411_10003742 3300032005 Bacteria 7136
1061 Ga0307411_10008827 3300032005 Bacteria 5250
1062 Ga0307411_11011757 3300032005 Bacteria 745
1063 Ga0307411_11232053 3300032005 Bacteria 679
1064 Ga0316053_117483 3300032120 Unclassified 545
1065 Ga0307415_100056689 3300032126 Bacteria 2688
1066 Ga0307415_100268612 3300032126 Bacteria 1396
1067 Ga0307415_101068181 3300032126 Bacteria 754
1068 Ga0307415_101167579 3300032126 Bacteria 724
1069 Ga0316593_10001783 3300032168 Bacteria 4897
1070 Ga0316593_10002618 3300032168 Bacteria 4311
1071 Ga0316593_10014252 3300032168 Bacteria 2367
1072 Ga0316593_10019333 3300032168 Bacteria 2104
1073 Ga0316593_10019508 3300032168 Bacteria 2096
1074 Ga0316593_10028372 3300032168 Bacteria 1804
1075 Ga0316593_10158812 3300032168 Bacteria 825
1076 Ga0316593_10316334 3300032168 Bacteria 593
1077 Ga0316593_10329705 3300032168 Unclassified 581
1078 Ga0316592_1024201 3300033524 Bacteria 1306
1079 Ga0316588_1007611 3300033528 Bacteria 2203
1080 Ga0316588_1018568 3300033528 Bacteria 1559
1081 Ga0316588_1040523 3300033528 Bacteria 1113
1082 Ga0316588_1051023 3300033528 Bacteria 1003
1083 Ga0316588_1067069 3300033528 Bacteria 879
1084 Ga0316588_1067880 3300033528 Bacteria 874
1085 Ga0316588_1088459 3300033528 Bacteria 771
1086 Ga0316588_1105398 3300033528 Bacteria 707
1087 Ga0316596_1000493 3300033541 Bacteria 6704
1088 Ga0316596_1070869 3300033541 Bacteria 933
1089 Ga0316596_1169994 3300033541 Bacteria 602
1090 Ga0373930_0030179 3300034816 Bacteria 1112
1091 Ga0373948_0130321 3300034817 Bacteria 615
1092 Ga0373948_0132447 3300034817 Bacteria 611
1093 Ga0373958_0009873 3300034819 Bacteria 1581
1094 Ga0373959_0134078 3300034820 Bacteria 615
1095 Ga0373938_0175085 3300034957 Bacteria 583
1096 Ga0373926_0001122 3300035083 Bacteria 7940
1097 Ga0373926_0009400 3300035083 Bacteria 3269
1098 Ga0373926_0258941 3300035083 Bacteria 675
1099 Ga0373929_0094499 3300035085 Bacteria 746
1100 Ga0373934_0104707 3300035086 Bacteria 1145
1101 Ga0373940_0187565 3300035088 Bacteria 675
1102 Ga0373944_0057907 3300035089 Bacteria 1236
1103 Ga0373944_0244742 3300035089 Bacteria 660
1104 Ga0373951_0113679 3300035091 Bacteria 731
1105 Ga0373952_0180221 3300035092 Bacteria 609
1106 Ga0373923_0053759 3300035111 Bacteria 1694
1107 Ga0373923_0090832 3300035111 Bacteria 1336
1108 Ga0373923_0385065 3300035111 Bacteria 673
1109 Ga0373923_0433015 3300035111 Bacteria 636
1110 Ga0373932_0274730 3300035112 Bacteria 622
1111 Ga0373936_0037210 3300035113 Bacteria 1943
1112 Ga0373936_0205470 3300035113 Bacteria 870
1113 Ga0373936_0418617 3300035113 Bacteria 617
1114 Ga0373939_0122999 3300035114 Bacteria 918
1115 Ga0373941_0115498 3300035115 Bacteria 951
1116 Ga0373941_0205636 3300035115 Bacteria 750
1117 Ga0373945_0018377 3300035116 Bacteria 2378
1118 Ga0373945_0062158 3300035116 Bacteria 1396
1119 Ga0373953_0002723 3300035117 Bacteria 5364
1120 Ga0373953_0086762 3300035117 Bacteria 1306
1121 Ga0373953_0118381 3300035117 Bacteria 1124
1122 Ga0373954_0014604 3300035118 Bacteria 3502
1123 Ga0373954_0156125 3300035118 Bacteria 1116
1124 Ga0373954_0163207 3300035118 Bacteria 1090
1125 Ga0373954_0522548 3300035118 Bacteria 588
1126 Ga0373956_0009506 3300035119 Bacteria 3958
1127 Ga0373956_0010739 3300035119 Bacteria 3760
1128 Ga0373956_0108665 3300035119 Bacteria 1290
1129 Ga0373957_0057958 3300035120 Bacteria 1495
1130 Ga0373957_0117503 3300035120 Bacteria 1075
1131 Ga0373957_0154822 3300035120 Bacteria 942
1132 Ga0373960_0231198 3300035121 Bacteria 665
1133 Ga0373943_0011073 3300035170 Bacteria 4051
1134 Ga0373943_0367741 3300035170 Bacteria 826
1135 Ga0373955_0013590 3300035172 Bacteria 3940
1136 Ga0373955_0037811 3300035172 Bacteria 2568
1137 Ga0373955_0058171 3300035172 Bacteria 2126
1138 Ga0373955_0109033 3300035172 Bacteria 1599
1139 Ga0373955_0327525 3300035172 Bacteria 926
1140 Ga0373955_0345873 3300035172 Bacteria 900
1141 Ga0373942_0347133 3300035207 Bacteria 524
1142 Ga0373961_0135251 3300035241 Bacteria 829
1143 Ga0373961_0146509 3300035241 Bacteria 801
1144 Ga0373961_0257992 3300035241 Bacteria 633
1145 Ga0316574_0001004 3300035398 Bacteria 12720
1146 Ga0316574_0022880 3300035398 Bacteria 3726
1147 Ga0316574_0047770 3300035398 Bacteria 2658
1148 Ga0316574_0109331 3300035398 Bacteria 1772
1149 Ga0316574_0140482 3300035398 Bacteria 1556
1150 Ga0316574_0143803 3300035398 Bacteria 1537
1151 Ga0316574_0161536 3300035398 Bacteria 1443
1152 Ga0316574_0833998 3300035398 Bacteria 560
1153 Ga0373924_0126646 3300035410 Bacteria 1110
1154 Ga0373931_0136727 3300035691 Bacteria 1415
1155 Ga0373931_0260324 3300035691 Unclassified 1058
1156 Ga0373931_0303750 3300035691 Bacteria 986
1157 Ga0373931_1274424 3300035691 Bacteria 505
1158 Ga0373935_0051065 3300035692 Bacteria 2625
1159 Ga0373935_0075929 3300035692 Bacteria 2175
1160 Ga0373927_0004438 3300035695 Bacteria 9831
1161 Ga0373927_0005589 3300035695 Bacteria 8642
1162 Ga0373927_0161417 3300035695 Bacteria 1468
1163 Ga0373927_0625416 3300035695 Bacteria 712
1164 Ga0373927_1096771 3300035695 Bacteria 525
1165 Ga0373933_0294661 3300035724 Bacteria 1050
1166 Ga0373933_0373450 3300035724 Bacteria 928
1167 Ga0373947_0007919 3300035725 Bacteria 6127
1168 Ga0373947_0013676 3300035725 Bacteria 4650
1169 Ga0373947_0114040 3300035725 Bacteria 1711
1170 Ga0373947_0223935 3300035725 Bacteria 1237
1171 Ga0373947_0256443 3300035725 Bacteria 1158
1172 Ga0373947_0783854 3300035725 Bacteria 651
1173 Ga0373947_0992452 3300035725 Unclassified 573
1174 Ga0373937_0007252 3300036401 Bacteria 9594
1175 Ga0373937_0025601 3300036401 Bacteria 5328
1176 Ga0373937_0030240 3300036401 Bacteria 4905
1177 Ga0373937_0056404 3300036401 Bacteria 3608
1178 Ga0373937_0076114 3300036401 Bacteria 3099
1179 Ga0373937_0113979 3300036401 Bacteria 2516
1180 Ga0373937_0171110 3300036401 Bacteria 2038
1181 Ga0373937_0431917 3300036401 Bacteria 1250
1182 Ga0373937_0866335 3300036401 Unclassified 852
1183 Ga0373937_1848163 3300036401 Bacteria 550
1184 Ga0373937_2066069 3300036401 Bacteria 516
1185 Ga0316582_0200485 3300036647 Bacteria 1361
1186 Ga0316582_0287953 3300036647 Bacteria 1128
1187 Ga0316582_0643517 3300036647 Bacteria 729
1188 Ga0316582_0705715 3300036647 Unclassified 693
1189 Ga0316584_0351874 3300036712 Bacteria 1058
1190 Ga0316584_0358687 3300036712 Unclassified 1045
1191 Ga0316584_0408499 3300036712 Bacteria 966
1192 Ga0316584_0518106 3300036712 Bacteria 836
1193 Ga0316584_0577819 3300036712 Bacteria 782
1194 Ga0316584_0622151 3300036712 Bacteria 747
1195 Ga0316584_0726414 3300036712 Unclassified 679
1196 Ga0316584_0729147 3300036712 Bacteria 678
1197 Ga0316584_0734471 3300036712 Bacteria 674
1198 Ga0373925_0001662 3300037068 Bacteria 18731
1199 Ga0373925_0001788 3300037068 Bacteria 17923
1200 Ga0373925_0094451 3300037068 Bacteria 2290
1201 Ga0373925_0262346 3300037068 Bacteria 1388
1202 Ga0373925_0263319 3300037068 Bacteria 1385
1203 Ga0373925_0554776 3300037068 Unclassified 945
1204 Ga0373925_0872321 3300037068 Bacteria 742
1205 Ga0395899_0173762 3300037312 Bacteria 1516
1206 Ga0395900_0018609 3300037418 Bacteria 7084
1207 Ga0395900_0954656 3300037418 Bacteria 779
1208 Ga0395900_1480901 3300037418 Unclassified 591
1209 Ga0395900_1668877 3300037418 Bacteria 548
1210 Ga0395898_0564374 3300037466 Bacteria 1081
1211 Ga0395905_0000275 3300037471 Bacteria 76114
1212 Ga0395905_0001744 3300037471 Bacteria 25404
1213 Ga0395905_0082831 3300037471 Bacteria 3006
1214 Ga0395905_0369455 3300037471 Bacteria 1328
1215 Ga0395905_0877384 3300037471 Unclassified 800
1216 Ga0316581_0013010 3300037588 Bacteria 2354
1217 Ga0395901_0113158 3300038443 Bacteria 2850
1218 Ga0400490_17491 3300038726 Bacteria 28094
1219 Ga0400491_12215 3300038727 Bacteria 7556
1220 Ga0400483_126972 3300039062 Bacteria 3049
1221 Ga0400483_247471 3300039062 Bacteria 2928
1222 Ga0400489_10986 3300039093 Bacteria 1435
1223 Ga0400489_86969 3300039093 Bacteria 10581
1224 Ga0436365_0154164 3300039437 Bacteria 11061
1225 Ga0436365_1563210 3300039437 Bacteria 4201
1226 Ga0436365_1839659 3300039437 Bacteria 4011
1227 Ga0436365_1927449 3300039437 Bacteria 710
1228 Ga0436360_0080201 3300039438 Bacteria 942
1229 Ga0436360_0406311 3300039438 Bacteria 1003
1230 Ga0436363_0576030 3300039450 Bacteria 1107
1231 Ga0436363_1475130 3300039450 Bacteria 615
1232 Ga0436362_0225975 3300039453 Bacteria 2143
1233 Ga0436362_1063276 3300039453 Bacteria 20265
1234 Ga0436362_1069013 3300039453 Bacteria 90804
1235 Ga0439461_0064471 3300041410 Bacteria 838
1236 Ga0451793_0687095 3300041452 Unclassified 1134
1237 Ga0451795_0060284 3300041456 Bacteria 1073
1238 Ga0451839_0487727 3300041496 Bacteria 1989
1239 Ga0451851_0850392 3300041507 Bacteria 930
1240 Ga0439433_0112274 3300041999 Bacteria 683
1241 Ga0439451_125562 3300042009 Bacteria 523
1242 Ga0439444_0094397 3300042437 Bacteria 671
1243 Ga0451577_0008700 3300042876 Bacteria 9846
1244 Ga0451577_0012592 3300042876 Bacteria 7940
1245 Ga0451577_0016347 3300042876 Bacteria 6875
1246 Ga0451577_0033756 3300042876 Bacteria 4614
1247 Ga0451577_0134048 3300042876 Bacteria 2223
1248 Ga0451577_0161269 3300042876 Bacteria 2019
1249 Ga0451577_0317597 3300042876 Bacteria 1412
1250 Ga0451577_1403892 3300042876 Bacteria 619
1251 Ga0439440_0013796 3300042993 Bacteria 1738
1252 Ga0453683_0000086 3300044673 Bacteria 139689
1253 Ga0453683_0008784 3300044673 Bacteria 6768
1254 Ga0453683_0054837 3300044673 Bacteria 2495
1255 Ga0453683_0055812 3300044673 Bacteria 2472
1256 Ga0453683_0122574 3300044673 Bacteria 1637
1257 Ga0453683_0216829 3300044673 Bacteria 1216
1258 Ga0466965_0436268 3300044683 Bacteria 728
1259 Ga0453684_0001061 3300044712 Bacteria 87486
1260 Ga0453684_0001518 3300044712 Bacteria 65070
1261 Ga0453684_0006427 3300044712 Bacteria 22339
1262 Ga0453684_0008349 3300044712 Bacteria 18610
1263 Ga0453684_0011806 3300044712 Bacteria 14554
1264 Ga0453684_0019106 3300044712 Bacteria 10459
1265 Ga0453684_0019836 3300044712 Bacteria 10199
1266 Ga0453684_0020573 3300044712 Bacteria 9941
1267 Ga0453684_0033355 3300044712 Bacteria 7181
1268 Ga0453684_0037288 3300044712 Bacteria 6674
1269 Ga0453684_0042819 3300044712 Bacteria 6096
1270 Ga0453684_0044000 3300044712 Bacteria 5986
1271 Ga0453684_0048627 3300044712 Bacteria 5603
1272 Ga0453684_0060385 3300044712 Bacteria 4877
1273 Ga0453684_0062580 3300044712 Bacteria 4765
1274 Ga0453684_0075363 3300044712 Bacteria 4241
1275 Ga0453684_0090894 3300044712 Bacteria 3771
1276 Ga0453684_0111000 3300044712 Bacteria 3332
1277 Ga0453684_0240329 3300044712 Bacteria 2085
1278 Ga0453684_0373414 3300044712 Bacteria 1603
1279 Ga0453684_0646837 3300044712 Bacteria 1154
1280 Ga0453684_1257000 3300044712 Bacteria 774
1281 Ga0453684_1813505 3300044712 Bacteria 620
1282 Ga0451576_0004083 3300045051 Bacteria 19291
1283 Ga0451576_0005300 3300045051 Bacteria 16207
1284 Ga0451576_0019582 3300045051 Bacteria 7386
1285 Ga0451576_0093519 3300045051 Bacteria 3126
1286 Ga0451576_0129629 3300045051 Bacteria 2629
1287 Ga0451576_0137895 3300045051 Bacteria 2544
1288 Ga0451576_0196516 3300045051 Bacteria 2107
1289 Ga0451576_0213585 3300045051 Bacteria 2015
1290 Ga0451576_0215670 3300045051 Bacteria 2004
1291 Ga0451576_0312134 3300045051 Bacteria 1645
1292 Ga0451576_0499547 3300045051 Bacteria 1278
1293 Ga0451576_0648915 3300045051 Bacteria 1109
1294 Ga0451576_0682098 3300045051 Bacteria 1079
1295 Ga0451576_1292499 3300045051 Bacteria 761
1296 Ga0451576_2130053 3300045051 Bacteria 576
1297 Ga0466967_0445372 3300045976 Bacteria 1265
1298 Ga0466967_0955867 3300045976 Bacteria 853
1299 Ga0495617_143473 3300046452 Bacteria 762
1300 Ga0495592_0161903 3300046454 Bacteria 1539
1301 Ga0495603_0016598 3300046455 Bacteria 4455
1302 Ga0495603_0334793 3300046455 Bacteria 869
1303 Ga0495629_0007707 3300046459 Bacteria 7921
1304 Ga0495629_0016479 3300046459 Bacteria 5304
1305 Ga0495629_0184529 3300046459 Bacteria 1445
1306 Ga0495629_0419104 3300046459 Bacteria 909
1307 Ga0495641_0041758 3300046461 Bacteria 2129
1308 Ga0495641_0047852 3300046461 Bacteria 1962
1309 Ga0495641_0125788 3300046461 Bacteria 1144
1310 Ga0495641_0141431 3300046461 Bacteria 1075
1311 Ga0495651_0042906 3300046462 Bacteria 3510
1312 Ga0495651_0481615 3300046462 Bacteria 797
1313 Ga0495651_0597215 3300046462 Bacteria 697
1314 Ga0495580_0001448 3300046472 Bacteria 20804
1315 Ga0495580_0002827 3300046472 Bacteria 14922
1316 Ga0495580_0005582 3300046472 Bacteria 10367
1317 Ga0495580_0012791 3300046472 Bacteria 6432
1318 Ga0495580_0050436 3300046472 Bacteria 2943
1319 Ga0495580_0057891 3300046472 Bacteria 2727
1320 Ga0495580_0080283 3300046472 Bacteria 2274
1321 Ga0495580_0121196 3300046472 Bacteria 1816
1322 Ga0495580_0125962 3300046472 Bacteria 1778
1323 Ga0495580_0261064 3300046472 Bacteria 1185
1324 Ga0495580_0411869 3300046472 Bacteria 910
1325 Ga0495580_0584354 3300046472 Unclassified 739
1326 Ga0495580_0654197 3300046472 Bacteria 691
1327 Ga0495580_0921904 3300046472 Unclassified 560
1328 Ga0495582_0000113 3300046473 Bacteria 42436
1329 Ga0495582_0026338 3300046473 Bacteria 3187
1330 Ga0495582_0079298 3300046473 Bacteria 1822
1331 Ga0495582_0295889 3300046473 Bacteria 930
1332 Ga0495582_0417230 3300046473 Bacteria 774
1333 Ga0495639_0020227 3300046475 Bacteria 2908
1334 Ga0495639_0122966 3300046475 Bacteria 1239
1335 Ga0495662_0522177 3300046476 Bacteria 582
1336 Ga0495664_0005945 3300046477 Bacteria 6720
1337 Ga0495584_0399912 3300046491 Bacteria 698
1338 Ga0495585_0380470 3300046492 Bacteria 682
1339 Ga0495585_0494208 3300046492 Bacteria 582
1340 Ga0495594_0021611 3300046499 Bacteria 3435
1341 Ga0495594_0076463 3300046499 Bacteria 1867
1342 Ga0495594_0452844 3300046499 Bacteria 730
1343 Ga0495616_0235832 3300046513 Bacteria 791
1344 Ga0495618_0033948 3300046514 Bacteria 3199
1345 Ga0495618_0047295 3300046514 Bacteria 2716
1346 Ga0495618_0179620 3300046514 Bacteria 1345
1347 Ga0495618_0346716 3300046514 Bacteria 916
1348 Ga0495628_0268257 3300046516 Bacteria 1270
1349 Ga0495628_0573546 3300046516 Bacteria 808
1350 Ga0495630_0003551 3300046517 Bacteria 10859
1351 Ga0495630_0016248 3300046517 Bacteria 5437
1352 Ga0495630_0019992 3300046517 Bacteria 4930
1353 Ga0495630_0776267 3300046517 Bacteria 732
1354 Ga0495630_0982529 3300046517 Unclassified 642
1355 Ga0495666_0137734 3300046526 Bacteria 1139
1356 Ga0495666_0195179 3300046526 Bacteria 932
1357 Ga0495666_0326231 3300046526 Bacteria 693
1358 Ga0495666_0333159 3300046526 Bacteria 684
1359 Ga0495642_0362330 3300046528 Bacteria 638
1360 Ga0495652_0354639 3300046529 Bacteria 1050
1361 Ga0495652_0384663 3300046529 Bacteria 997
1362 Ga0495665_0017070 3300046531 Bacteria 3905
1363 Ga0495665_0038759 3300046531 Bacteria 2540
1364 Ga0495665_0105049 3300046531 Bacteria 1482
1365 Ga0495665_0695753 3300046531 Bacteria 504
1366 Ga0495640_0084228 3300046533 Bacteria 2109
1367 Ga0495640_0194210 3300046533 Bacteria 1289
1368 Ga0495640_0739393 3300046533 Bacteria 589
1369 Ga0495586_0003305 3300046535 Bacteria 8648
1370 Ga0495586_0031142 3300046535 Bacteria 2856
1371 Ga0495586_0031189 3300046535 Bacteria 2853
1372 Ga0495586_0047729 3300046535 Bacteria 2312
1373 Ga0495587_0002355 3300046536 Bacteria 12626
1374 Ga0495587_0019640 3300046536 Bacteria 4180
1375 Ga0495587_0213134 3300046536 Bacteria 1090
1376 Ga0495598_0017282 3300046537 Bacteria 1857
1377 Ga0495645_0630048 3300046543 Bacteria 657
1378 Ga0495645_0654462 3300046543 Bacteria 641
1379 Ga0495622_0267752 3300046557 Bacteria 749
1380 Ga0495633_0069411 3300046558 Bacteria 1645
1381 Ga0495656_0000397 3300046615 Bacteria 14422
1382 Ga0495656_0517719 3300046615 Bacteria 634
1383 Ga0495656_0726992 3300046615 Unclassified 535
1384 Ga0495668_0770055 3300046616 Bacteria 533
1385 Ga0495634_0000649 3300046642 Bacteria 33746
1386 Ga0495634_0165167 3300046642 Bacteria 1394
1387 Ga0495635_0069638 3300046663 Bacteria 2412
1388 Ga0495588_0457836 3300046674 Bacteria 669
1389 Ga0495657_0158952 3300046675 Bacteria 1399
1390 Ga0495657_0273279 3300046675 Unclassified 1013
1391 Ga0495657_0274523 3300046675 Bacteria 1010
1392 Ga0495657_0444406 3300046675 Bacteria 760
1393 Ga0495623_0095320 3300046679 Bacteria 1819
1394 Ga0495647_0004304 3300046681 Bacteria 4612
1395 Ga0495647_0006082 3300046681 Bacteria 3979
1396 Ga0495647_0007570 3300046681 Bacteria 3644
1397 Ga0495647_0040084 3300046681 Bacteria 1778
1398 Ga0495647_0249323 3300046681 Bacteria 790
1399 Ga0495647_0452968 3300046681 Bacteria 594
1400 Ga0495658_0017882 3300046683 Bacteria 3674
1401 Ga0495658_0028263 3300046683 Bacteria 3025
1402 Ga0495658_0056441 3300046683 Bacteria 2240
1403 Ga0495658_0189652 3300046683 Bacteria 1277
1404 Ga0495669_0106398 3300046684 Bacteria 1307
1405 Ga0495669_0505155 3300046684 Bacteria 588
1406 Ga0495613_0042407 3300046689 Bacteria 3367
1407 Ga0495613_0095480 3300046689 Bacteria 2150
1408 Ga0495613_0642490 3300046689 Bacteria 703
1409 Ga0495624_0023361 3300046690 Bacteria 4078
1410 Ga0495670_0019811 3300046691 Bacteria 3315
1411 Ga0495670_0731190 3300046691 Unclassified 540
1412 Ga0495589_0432283 3300046794 Bacteria 603
1413 Ga0495600_0047423 3300046809 Bacteria 2802
1414 Ga0495600_0361141 3300046809 Bacteria 908
1415 Ga0495581_0208241 3300047315 Bacteria 1144
1416 Ga0495581_0262135 3300047315 Bacteria 1010
1417 Ga0495604_0039896 3300047317 Bacteria 3689
1418 Ga0495604_0368503 3300047317 Bacteria 951
1419 Ga0495604_0595068 3300047317 Bacteria 710
1420 Ga0495604_0776194 3300047317 Bacteria 605
1421 Ga0495636_0000893 3300047318 Bacteria 11074
1422 Ga0495636_0044847 3300047318 Bacteria 1842
1423 Ga0495636_0175385 3300047318 Bacteria 971
1424 Ga0495636_0273477 3300047318 Bacteria 785
1425 Ga0495674_0001336 3300047319 Bacteria 24042
1426 Ga0495674_0036483 3300047319 Bacteria 4424
1427 Ga0495674_0094633 3300047319 Bacteria 2548
1428 Ga0495674_0202418 3300047319 Bacteria 1646
1429 Ga0495674_0835104 3300047319 Bacteria 715
1430 Ga0495676_0030282 3300047321 Bacteria 4597
1431 Ga0495676_0588623 3300047321 Bacteria 725
1432 Ga0495680_0202098 3300047322 Bacteria 1425
1433 Ga0495680_0378620 3300047322 Bacteria 981
1434 Ga0495680_1005008 3300047322 Bacteria 533
1435 Ga0495675_0068217 3300047444 Bacteria 2247
1436 Ga0495679_007316 3300047446 Bacteria 4617
1437 Ga0495684_0026659 3300047471 Bacteria 4441
1438 Ga0495684_0054352 3300047471 Bacteria 3054
1439 Ga0495684_0078814 3300047471 Bacteria 2500
1440 Ga0495684_0231057 3300047471 Bacteria 1353
1441 Ga0495684_0260054 3300047471 Bacteria 1259
1442 Ga0495593_0078777 3300047673 Bacteria 1706
1443 Ga0495593_0252399 3300047673 Bacteria 883
1444 Ga0495602_0017278 3300048088 Bacteria 7234
1445 Ga0495602_0227086 3300048088 Bacteria 1405
1446 Ga0495614_0010953 3300048089 Bacteria 3991
1447 Ga0495614_0069510 3300048089 Bacteria 1517
1448 Ga0495615_0003089 3300048090 Bacteria 2754
1449 Ga0496100_0003660 3300048903 Bacteria 8042
1450 Ga0496100_0017930 3300048903 Bacteria 4189
1451 Ga0496100_0998411 3300048903 Bacteria 659
1452 Ga0496101_0025125 3300048904 Bacteria 4129
1453 Ga0496101_0179518 3300048904 Bacteria 1630
1454 Ga0496101_0523564 3300048904 Bacteria 937
1455 Ga0496101_0666373 3300048904 Bacteria 822
1456 Ga0496101_0925184 3300048904 Bacteria 686
1457 Ga0496102_0000916 3300048905 Bacteria 27806
1458 Ga0496102_0003028 3300048905 Bacteria 14227
1459 Ga0496102_0018905 3300048905 Bacteria 6062
1460 Ga0496102_0035581 3300048905 Bacteria 4483
1461 Ga0496102_0146115 3300048905 Bacteria 2219
1462 Ga0496102_0766183 3300048905 Bacteria 888
1463 Ga0496103_0030082 3300048906 Bacteria 3303
1464 Ga0496104_0028984 3300048907 Bacteria 5133
1465 Ga0496104_0036226 3300048907 Bacteria 4612
1466 Ga0496104_0103951 3300048907 Bacteria 2721
1467 Ga0496104_0107857 3300048907 Bacteria 2668
1468 Ga0496104_0322079 3300048907 Bacteria 1459
1469 Ga0496104_0351967 3300048907 Bacteria 1386
1470 Ga0496104_0370528 3300048907 Bacteria 1345
1471 Ga0496105_0078298 3300048908 Bacteria 2730
1472 Ga0496105_0139233 3300048908 Bacteria 1998
1473 Ga0496105_0166096 3300048908 Bacteria 1811
1474 Ga0496105_0213217 3300048908 Bacteria 1573
1475 Ga0496105_0524359 3300048908 Bacteria 927
1476 Ga0496105_0684031 3300048908 Bacteria 789
1477 Ga0496106_0003518 3300048909 Bacteria 11675
1478 Ga0496106_0030306 3300048909 Bacteria 4035
1479 Ga0496106_0087377 3300048909 Bacteria 2402
1480 Ga0496106_0283939 3300048909 Bacteria 1326
1481 Ga0496106_0970159 3300048909 Bacteria 669
1482 Ga0496106_1362863 3300048909 Bacteria 549
1483 Ga0496107_0000796 3300048910 Bacteria 18296
1484 Ga0496107_0067376 3300048910 Bacteria 2597
1485 Ga0496107_0933349 3300048910 Bacteria 632
1486 Ga0496108_0032489 3300048911 Bacteria 4335
1487 Ga0496108_0124186 3300048911 Bacteria 2215
1488 Ga0496108_0286001 3300048911 Bacteria 1435
1489 Ga0496108_0482416 3300048911 Bacteria 1083
1490 Ga0496108_0767720 3300048911 Bacteria 833
1491 Ga0496108_1634796 3300048911 Bacteria 532
1492 Ga0496109_0060025 3300048912 Bacteria 3475
1493 Ga0496109_0087350 3300048912 Bacteria 2880
1494 Ga0496109_0404303 3300048912 Bacteria 1290
1495 Ga0496109_1425728 3300048912 Bacteria 628
1496 Ga0496110_0000091 3300048913 Bacteria 48115
1497 Ga0496110_0004643 3300048913 Bacteria 10677
1498 Ga0496110_0023793 3300048913 Bacteria 5213
1499 Ga0496110_0286750 3300048913 Bacteria 1499
1500 Ga0496110_0587594 3300048913 Bacteria 1011
1501 Ga0496111_0016892 3300048914 Bacteria 5037
1502 Ga0496111_0048928 3300048914 Bacteria 3048
1503 Ga0496111_0225915 3300048914 Bacteria 1391
1504 Ga0496111_0375322 3300048914 Bacteria 1052
1505 Ga0496111_1316029 3300048914 Bacteria 509
1506 Ga0496112_0030222 3300048915 Bacteria 5242
1507 Ga0496112_0356812 3300048915 Bacteria 1404
1508 Ga0496112_0663177 3300048915 Bacteria 972
1509 Ga0496112_0773487 3300048915 Bacteria 886
1510 Ga0496112_1465119 3300048915 Bacteria 597
1511 Ga0496113_0021257 3300048916 Bacteria 4575
1512 Ga0496113_0648146 3300048916 Bacteria 845
1513 Ga0496113_0732631 3300048916 Bacteria 788
1514 Ga0496113_0902278 3300048916 Bacteria 699
1515 Ga0496114_0000386 3300048917 Bacteria 32590
1516 Ga0496114_0001141 3300048917 Bacteria 20073
1517 Ga0496114_0004194 3300048917 Bacteria 11164
1518 Ga0496114_0006073 3300048917 Bacteria 9506
1519 Ga0496114_0230229 3300048917 Bacteria 1628
1520 Ga0496114_0320615 3300048917 Bacteria 1369
1521 Ga0496114_0353784 3300048917 Bacteria 1299
1522 Ga0496114_0778035 3300048917 Bacteria 835
1523 Ga0496115_0006616 3300048918 Bacteria 8497
1524 Ga0496115_0047334 3300048918 Bacteria 3439
1525 Ga0496115_0059367 3300048918 Bacteria 3080
1526 Ga0496115_0389278 3300048918 Bacteria 1132
1527 Ga0496115_0443708 3300048918 Bacteria 1049
1528 Ga0496115_0561298 3300048918 Bacteria 911
1529 Ga0496116_0025193 3300048919 Bacteria 4378
1530 Ga0496116_0030225 3300048919 Bacteria 3895
1531 Ga0496117_0001863 3300048920 Bacteria 28457
1532 Ga0496117_0059650 3300048920 Bacteria 2634
1533 Ga0496117_0204017 3300048920 Bacteria 1115
1534 Ga0496122_0008592 3300048925 Bacteria 10970
1535 Ga0496123_0029360 3300048926 Bacteria 4049
1536 Ga0496124_0000001 3300048927 Bacteria 1747840
1537 Ga0496124_0075016 3300048927 Bacteria 2795
1538 Ga0496125_0056825 3300048928 Bacteria 3174
1539 Ga0496125_0384470 3300048928 Bacteria 826
1540 Ga0496126_0096151 3300048929 Bacteria 2597
1541 Ga0496126_0097584 3300048929 Bacteria 2575
1542 Ga0496126_0626774 3300048929 Bacteria 844
1543 Ga0501305_018599 3300049161 Bacteria 1007
1544 Ga0501307_006084 3300049162 Bacteria 1292
1545 Ga0501307_091116 3300049162 Bacteria 509
1546 Ga0501290_028794 3300049513 Bacteria 788
1547 Ga0501298_057336 3300049521 Unclassified 819
1548 Ga0501317_062977 3300049533 Bacteria 612
1549 Ga0501031_0100714 3300049568 Bacteria 1885
1550 Ga0501031_0118379 3300049568 Bacteria 1731
1551 Ga0501032_0175090 3300049569 Bacteria 1406
1552 Ga0501033_0071425 3300049570 Bacteria 2550
1553 Ga0501034_0079903 3300049571 Bacteria 3274
1554 Ga0501034_1384106 3300049571 Bacteria 579
1555 Ga0501036_0014973 3300049572 Bacteria 6470
1556 Ga0501036_0034010 3300049572 Bacteria 4311
1557 Ga0501036_1550544 3300049572 Bacteria 535
1558 Ga0501037_0011186 3300049573 Bacteria 6604
1559 Ga0501037_0700449 3300049573 Bacteria 674
1560 Ga0501038_0000271 3300049574 Bacteria 43706
1561 Ga0501038_0583992 3300049574 Bacteria 847
1562 Ga0501038_0997715 3300049574 Bacteria 615
1563 Ga0501039_0108043 3300049575 Bacteria 2174
1564 Ga0501039_0153331 3300049575 Bacteria 1810
1565 Ga0501039_0306749 3300049575 Bacteria 1248
1566 Ga0501039_0806175 3300049575 Bacteria 732
1567 Ga0501039_0960743 3300049575 Unclassified 664
1568 Ga0501039_1022063 3300049575 Bacteria 642
1569 Ga0501040_0001044 3300049576 Bacteria 17516
1570 Ga0501040_0062391 3300049576 Bacteria 2564
1571 Ga0501040_0088966 3300049576 Bacteria 2145
1572 Ga0501040_0160571 3300049576 Bacteria 1589
1573 Ga0501040_0211230 3300049576 Bacteria 1380
1574 Ga0501040_0230286 3300049576 Bacteria 1319
1575 Ga0501041_0000002 3300049577 Bacteria 84985
1576 Ga0501041_0163295 3300049577 Bacteria 1393
1577 Ga0501042_0000645 3300049578 Bacteria 18688
1578 Ga0501042_0048885 3300049578 Bacteria 3016
1579 Ga0501042_0134671 3300049578 Bacteria 1781
1580 Ga0501043_0085474 3300049579 Bacteria 2479
1581 Ga0501043_0121334 3300049579 Bacteria 2050
1582 Ga0501043_0185513 3300049579 Bacteria 1620
1583 Ga0501046_0051614 3300049580 Bacteria 3245
1584 Ga0501046_0119838 3300049580 Bacteria 2003
1585 Ga0501046_0295744 3300049580 Bacteria 1183
1586 Ga0501046_1237436 3300049580 Bacteria 512
1587 Ga0501047_0468086 3300049581 Bacteria 1089
1588 Ga0501048_0002109 3300049582 Bacteria 15162
1589 Ga0501048_0234505 3300049582 Bacteria 1302
1590 Ga0501048_0241932 3300049582 Bacteria 1281
1591 Ga0501048_0902011 3300049582 Bacteria 636
1592 Ga0501067_0003773 3300049583 Bacteria 8357
1593 Ga0501068_0117831 3300049584 Bacteria 1654
1594 Ga0501068_0225851 3300049584 Bacteria 1190
1595 Ga0501068_0262995 3300049584 Bacteria 1101
1596 Ga0501069_0748886 3300049585 Bacteria 591
1597 Ga0501070_0607196 3300049586 Bacteria 872
1598 Ga0501070_1410966 3300049586 Bacteria 529
1599 Ga0501071_0001937 3300049587 Bacteria 12334
1600 Ga0501071_0145214 3300049587 Bacteria 1768
1601 Ga0501071_0172545 3300049587 Bacteria 1619
1602 Ga0501071_0231051 3300049587 Bacteria 1393
1603 Ga0501072_0000128 3300049588 Bacteria 56185
1604 Ga0501072_0032391 3300049588 Bacteria 4094
1605 Ga0501072_0215997 3300049588 Bacteria 1528
1606 Ga0501073_0003382 3300049589 Bacteria 11991
1607 Ga0501073_0009833 3300049589 Bacteria 7039
1608 Ga0501073_0038469 3300049589 Bacteria 3393
1609 Ga0501073_0207608 3300049589 Bacteria 1354
1610 Ga0501074_0003300 3300049590 Bacteria 11409
1611 Ga0501074_0110042 3300049590 Bacteria 1971
1612 Ga0501074_0281025 3300049590 Bacteria 1183
1613 Ga0501074_0387843 3300049590 Bacteria 991
1614 Ga0501075_0015531 3300049591 Bacteria 5464
1615 Ga0501075_0038544 3300049591 Bacteria 3573
1616 Ga0501075_0090751 3300049591 Bacteria 2318
1617 Ga0501075_0103332 3300049591 Bacteria 2165
1618 Ga0501075_0149057 3300049591 Bacteria 1783
1619 Ga0501075_0536782 3300049591 Bacteria 893
1620 Ga0501076_0000022 3300049592 Bacteria 83199
1621 Ga0501076_0012924 3300049592 Bacteria 6250
1622 Ga0501076_0015095 3300049592 Bacteria 5833
1623 Ga0501076_0019380 3300049592 Bacteria 5201
1624 Ga0501076_0165212 3300049592 Bacteria 1804
1625 Ga0501076_0198838 3300049592 Bacteria 1636
1626 Ga0501076_1433015 3300049592 Bacteria 567
1627 Ga0501076_1586770 3300049592 Bacteria 537
1628 Ga0501077_0000017 3300049593 Bacteria 86892
1629 Ga0501077_0005748 3300049593 Bacteria 7555
1630 Ga0501077_0013601 3300049593 Bacteria 5102
1631 Ga0501077_0138932 3300049593 Bacteria 1541
1632 Ga0501077_0182664 3300049593 Bacteria 1333
1633 Ga0501077_0477644 3300049593 Bacteria 799
1634 Ga0501198_019554 3300049649 Bacteria 1068
1635 Ga0501217_156633 3300049661 Bacteria 684
1636 Ga0501249_047500 3300049679 Bacteria 982
1637 Ga0501252_029041 3300049682 Bacteria 759
1638 Ga0501258_020947 3300049687 Bacteria 769
1639 Ga0501079_0000549 3300049741 Bacteria 24511
1640 Ga0501079_0039652 3300049741 Bacteria 3632
1641 Ga0501079_0219200 3300049741 Bacteria 1486
1642 Ga0501079_0338296 3300049741 Bacteria 1179
1643 Ga0501079_0785145 3300049741 Bacteria 750
1644 Ga0501080_0004016 3300049742 Bacteria 13028
1645 Ga0501080_0054009 3300049742 Bacteria 3741
1646 Ga0501080_0058519 3300049742 Bacteria 3587
1647 Ga0501080_0169697 3300049742 Bacteria 2013
1648 Ga0501080_0430265 3300049742 Bacteria 1185
1649 Ga0501080_1110040 3300049742 Bacteria 682
1650 Ga0501081_0000105 3300049743 Bacteria 35434
1651 Ga0501081_0212764 3300049743 Bacteria 1404
1652 Ga0501081_0438763 3300049743 Bacteria 969
1653 Ga0501081_0921357 3300049743 Bacteria 659
1654 Ga0501083_0098494 3300049744 Bacteria 1929
1655 Ga0501083_0416796 3300049744 Bacteria 874
1656 Ga0501083_0832287 3300049744 Bacteria 601
1657 Ga0501083_0890704 3300049744 Bacteria 579
1658 Ga0501270_003093 3300049767 Unclassified 1769
1659 Ga0501035_0002385 3300049822 Bacteria 18452
1660 Ga0501035_0346800 3300049822 Bacteria 1243
1661 Ga0501035_0386792 3300049822 Bacteria 1166
1662 Ga0501035_0900218 3300049822 Bacteria 701
1663 Ga0501035_1074586 3300049822 Bacteria 630
1664 Ga0501045_0000113 3300049824 Bacteria 40870
1665 Ga0501045_0005535 3300049824 Bacteria 8737
1666 Ga0501045_0093809 3300049824 Bacteria 2220
1667 Ga0501045_0193347 3300049824 Bacteria 1516
1668 Ga0501212_038484 3300049851 Bacteria 786
1669 nmdc:mga00v17_852269_c1 3300050491 Bacteria 579
1670 nmdc:mga05p37_1252235_c1 3300050507 Bacteria 761
1671 nmdc:mga05p37_1701_c1 3300050507 Bacteria 25630
1672 nmdc:mga05p37_1842889_c1 3300050507 Bacteria 581
1673 nmdc:mga05p37_1993750_c1 3300050507 Bacteria 549
1674 nmdc:mga05p37_217608_c1 3300050507 Bacteria 2306
1675 nmdc:mga05p37_2357_c1 3300050507 Bacteria 21983
1676 nmdc:mga05p37_2405_c1 3300050507 Bacteria 21778
1677 nmdc:mga05p37_244065_c1 3300050507 Bacteria 2157
1678 nmdc:mga05p37_28557_c1 3300050507 Bacteria 6803
1679 nmdc:mga05p37_43119_c2 3300050507 Bacteria 3382
1680 nmdc:mga05p37_53231_c1 3300050507 Bacteria 4977
1681 nmdc:mga05p37_5571_c1 3300050507 Bacteria 14805
1682 nmdc:mga09592_1578074_c1 3300050508 Bacteria 532
1683 nmdc:mga09592_194091_c1 3300050508 Bacteria 1758
1684 nmdc:mga09592_47614_c1 3300050508 Bacteria 3613
1685 nmdc:mga09592_7449_c1 3300050508 Bacteria 8894
1686 nmdc:mga09592_845691_c1 3300050508 Bacteria 772
1687 nmdc:mga09592_88599_c1 3300050508 Bacteria 2643
1688 nmdc:mga0qj67_222840_c1 3300050509 Bacteria 1531
1689 nmdc:mga0qj67_263938_c1 3300050509 Bacteria 1397
1690 nmdc:mga0qj67_287621_c1 3300050509 Bacteria 1332
1691 nmdc:mga0qj67_36968_c1 3300050509 Bacteria 3823
1692 nmdc:mga0qj67_610306_c1 3300050509 Bacteria 872
1693 nmdc:mga06r32_1302523_c1 3300050510 Bacteria 670
1694 nmdc:mga06r32_299928_c1 3300050510 Bacteria 1593
1695 nmdc:mga06r32_600_c2 3300050510 Bacteria 13291
1696 nmdc:mga06r32_721966_c1 3300050510 Bacteria 961
1697 nmdc:mga08y16_1403866_c1 3300050511 Bacteria 661
1698 nmdc:mga08y16_158966_c1 3300050511 Bacteria 2348
1699 nmdc:mga08y16_1650152_c1 3300050511 Bacteria 598
1700 nmdc:mga08y16_20950_c1 3300050511 Bacteria 6902
1701 nmdc:mga08y16_24_c1 3300050511 Bacteria 240846
1702 nmdc:mga08y16_421972_c1 3300050511 Bacteria 1363
1703 nmdc:mga08y16_692563_c1 3300050511 Bacteria 1020
1704 nmdc:mga08y16_903961_c1 3300050511 Bacteria 869
1705 nmdc:mga0n895_112230_c1 3300050512 Bacteria 2743
1706 nmdc:mga0n895_116858_c1 3300050512 Bacteria 2686
1707 nmdc:mga0n895_124772_c1 3300050512 Bacteria 2598
1708 nmdc:mga0n895_15345_c1 3300050512 Bacteria 6981
1709 nmdc:mga0n895_157994_c1 3300050512 Bacteria 2298
1710 nmdc:mga0n895_16211_c1 3300050512 Bacteria 6831
1711 nmdc:mga0n895_165230_c1 3300050512 Bacteria 2245
1712 nmdc:mga0n895_248534_c1 3300050512 Bacteria 1805
1713 nmdc:mga0n895_32532_c1 3300050512 Bacteria 5007
1714 nmdc:mga0n895_4227_c1 3300050512 Bacteria 11739
1715 nmdc:mga0rr50_15066_c1 3300050513 Bacteria 5094
1716 nmdc:mga0rr50_1883_c1 3300050513 Bacteria 11637
1717 nmdc:mga0rr50_309450_c1 3300050513 Bacteria 1323
1718 nmdc:mga0rr50_436178_c1 3300050513 Bacteria 1109
1719 nmdc:mga0rr50_451926_c1 3300050513 Bacteria 1089
1720 nmdc:mga0rr50_4708_c1 3300050513 Bacteria 8045
1721 nmdc:mga0rr50_496957_c1 3300050513 Bacteria 1037
1722 nmdc:mga0rr50_603694_c1 3300050513 Unclassified 936
1723 nmdc:mga0rr50_70361_c1 3300050513 Bacteria 2666
1724 nmdc:mga0rr50_98517_c1 3300050513 Bacteria 2292
1725 nmdc:mga08x19_12242_c1 3300050514 Bacteria 5164
1726 nmdc:mga08x19_14593_c1 3300050514 Bacteria 4766
1727 nmdc:mga08x19_20353_c1 3300050514 Bacteria 4085
1728 nmdc:mga08x19_365_c1 3300050514 Bacteria 32003
1729 nmdc:mga08x19_39582_c1 3300050514 Bacteria 2997
1730 nmdc:mga08x19_53364_c1 3300050514 Bacteria 2601
1731 nmdc:mga08x19_59650_c1 3300050514 Bacteria 2470
1732 nmdc:mga08x19_87268_c1 3300050514 Bacteria 2055
1733 nmdc:mga08x19_95363_c1 3300050514 Bacteria 1968
1734 nmdc:mga0a205_10723_c1 3300050515 Bacteria 8426
1735 nmdc:mga0a205_137179_c1 3300050515 Bacteria 2347
1736 nmdc:mga0a205_16417_c1 3300050515 Bacteria 3641
1737 nmdc:mga0a205_245638_c1 3300050515 Bacteria 1670
1738 nmdc:mga0a205_256160_c1 3300050515 Bacteria 1628
1739 nmdc:mga0a205_260474_c1 3300050515 Bacteria 1612
1740 nmdc:mga0a205_263572_c1 3300050515 Bacteria 1601
1741 nmdc:mga0a205_287318_c1 3300050515 Bacteria 1519
1742 nmdc:mga0a205_34611_c1 3300050515 Bacteria 4846
1743 nmdc:mga0a205_357051_c1 3300050515 Bacteria 1328
1744 nmdc:mga0a205_390_c1 3300050515 Bacteria 33406
1745 nmdc:mga0a205_429315_c1 3300050515 Unclassified 1183
1746 nmdc:mga0a205_488289_c1 3300050515 Bacteria 1089
1747 nmdc:mga0a205_63533_c1 3300050515 Bacteria 3567
1748 nmdc:mga0a205_8807_c1 3300050515 Bacteria 9192
1749 Ga0495601_0016503 3300053077 Bacteria 4476
1750 Ga0495601_0460347 3300053077 Bacteria 822
1751 Ga0495601_0493210 3300053077 Bacteria 791
1752 Ga0495601_0562803 3300053077 Bacteria 733
1753 Ga0495612_0246593 3300053078 Bacteria 794
1754 Ga0495595_0015164 3300053084 Bacteria 3283
1755 Ga0495595_0466989 3300053084 Bacteria 642
1756 Ga0495619_0027932 3300053085 Bacteria 3639
1757 Ga0495619_0032380 3300053085 Bacteria 3392
1758 Ga0495619_0100730 3300053085 Bacteria 1966
1759 Ga0495619_0495056 3300053085 Bacteria 841
1760 Ga0495619_0518105 3300053085 Bacteria 819
1761 Ga0500643_000257 3300053087 Bacteria 48350
1762 Ga0500568_0035391 3300053139 Bacteria 2038
1763 Ga0501084_0000159 3300054114 Bacteria 52081
1764 Ga0501084_0071866 3300054114 Bacteria 2898
1765 Ga0501084_0287098 3300054114 Bacteria 1389
1766 Ga0501084_0503695 3300054114 Bacteria 1023
1767 Ga0501084_0505832 3300054114 Bacteria 1021
1768 Ga0501084_1633105 3300054114 Bacteria 539
1769 Ga0587084_041383 3300059477 Bacteria 784
1770 Ga0587066_018738 3300059490 Bacteria 1118
1771 Ga0587073_0040134 3300059492 Bacteria 1015
1772 Ga0587080_092063 3300059503 Bacteria 637
1773 Ga0587091_047439 3300059511 Bacteria 870
1774 Ga0587072_062076 3300059643 Bacteria 772
1775 Ga0587111_0035651 3300060346 Unclassified 1038
1776 Ga0587111_0078441 3300060346 Bacteria 785
1777 Ga0587111_0283623 3300060346 Bacteria 501
1778 Ga0501082_0002410 3300060353 Bacteria 16410
1779 Ga0501082_0485350 3300060353 Bacteria 1080
1780 Ga0501082_0650476 3300060353 Bacteria 922
1781 Ga0530510_0002449 3300061734 Bacteria 12792
1782 Ga0530510_0125550 3300061734 Bacteria 1886
1783 Ga0530510_0194648 3300061734 Bacteria 1505
1784 Ga0530510_0298278 3300061734 Bacteria 1206
1785 Ga0530510_0357705 3300061734 Bacteria 1097
1786 Ga0530510_0392298 3300061734 Bacteria 1045
1787 Ga0530510_0860580 3300061734 Bacteria 692
1788 Ga0157378_10105819
1789 SwRhRL2b_contig_291308
1790 SwRhRL2b_contig_3903249
1791 MBSR1b_contig_4233670
1792 JGI24746J21847_1016431
1793 JGI24742J22300_10007131
1794 rootL2_10282489
1795 JGI26145J50221_1001211
1796 JGI26141J51220_1003121
1797 JGI25405J52794_10000604
1798 Ga0058863_10059782
1799 Ga0058863_11875765
1800 Ga0058861_12030344
1801 Ga0058860_12230108
1802 Ga0058862_10154497
1803 Ga0065704_10005699
1804 Ga0065704_10085970
1805 Ga0065704_10190762
1806 Ga0065704_10394263
1807 Ga0065712_10374598
1808 Ga0065715_10121974
1809 Ga0065715_10445920
1810 Ga0065715_11162660
1811 Ga0065707_10025635
1812 Ga0070658_10039091
1813 Ga0070658_11318469
1814 Ga0070676_10018293
1815 Ga0070676_10026300
1816 Ga0070676_10541632
1817 Ga0070676_11479038
1818 Ga0070683_100000033
1819 Ga0070683_100004175
1820 Ga0070690_100005750
1821 Ga0070690_100030946
1822 Ga0070690_100065969
1823 Ga0070690_100256616
1824 Ga0070690_100776228
1825 Ga0070670_100006072
1826 Ga0070670_100029495
1827 Ga0070670_100218024
1828 Ga0070670_100303900
1829 Ga0070670_100324478
1830 Ga0070670_100546168
1831 Ga0070670_100676845
1832 Ga0070670_102113790
1833 Ga0070677_10005399
1834 Ga0068869_100009311
1835 Ga0068869_100015378
1836 Ga0068869_100041040
1837 Ga0068869_100167792
1838 Ga0068869_100200424
1839 Ga0068869_100268990
1840 Ga0068869_100646961
1841 Ga0070666_10001387
1842 Ga0070666_10001507
1843 Ga0070666_10011673
1844 Ga0070666_10040333
1845 Ga0070666_10162092
1846 Ga0070666_10521737
1847 Ga0070666_10958131
1848 Ga0070680_100707670
1849 Ga0070682_100256877
1850 Ga0068868_100000632
1851 Ga0068868_100906099
1852 Ga0070660_100100051
1853 Ga0070660_100406772
1854 Ga0070689_100068193
1855 Ga0070689_100101559
1856 Ga0070689_100103520
1857 Ga0070689_100204302
1858 Ga0070689_100259633
1859 Ga0070689_100412269
1860 Ga0070689_100427886
1861 Ga0070689_100507022
1862 Ga0070689_100688822
1863 Ga0070689_100796799
1864 Ga0070689_101067422
1865 Ga0070689_101578820
1866 Ga0070691_10060647
1867 Ga0070691_10309448
1868 Ga0070691_10961339
1869 Ga0070687_100051489
1870 Ga0070687_100114596
1871 Ga0070687_100136833
1872 Ga0070687_100427962
1873 Ga0070687_100465332
1874 Ga0070687_100515402
1875 Ga0070661_100010686
1876 Ga0070692_10001104
1877 Ga0070692_10004482
1878 Ga0070692_10102494
1879 Ga0070692_11082159
1880 Ga0070692_11154071
1881 Ga0070668_100028739
1882 Ga0070668_100117946
1883 Ga0070669_100025363
1884 Ga0070669_100097584
1885 Ga0070669_100278937
1886 Ga0070669_101569360
1887 Ga0070669_101635007
1888 Ga0070675_100000007
1889 Ga0070675_100032515
1890 Ga0070675_100092402
1891 Ga0070675_100105703
1892 Ga0070675_100123749
1893 Ga0070675_100183980
1894 Ga0070675_100185688
1895 Ga0070675_100318549
1896 Ga0070675_100342603
1897 Ga0070675_101193667
1898 Ga0070675_101372066
1899 Ga0070671_100190181
1900 Ga0070671_100191826
1901 Ga0070674_100007457
1902 Ga0070674_100007905
1903 Ga0070674_100343338
1904 Ga0070674_100367453
1905 Ga0070674_100587817
1906 Ga0070674_101389008
1907 Ga0070674_101735933
1908 Ga0070673_100051191
1909 Ga0070673_100071173
1910 Ga0070673_100099405
1911 Ga0070673_100226177
1912 Ga0070673_100677707
1913 Ga0070673_101809998
1914 Ga0070688_100175984
1915 Ga0070688_100426728
1916 Ga0070688_100533180
1917 Ga0070688_100874058
1918 Ga0070659_100169875
1919 Ga0070667_100002921
1920 Ga0070667_100091951
1921 Ga0070667_100234407
1922 Ga0070667_100604574
1923 Ga0070667_100977738
1924 Ga0070667_101203917
1925 Ga0070703_10097871
1926 Ga0070709_10019666
1927 Ga0070709_10075841
1928 Ga0070709_10133261
1929 Ga0070709_10444071
1930 Ga0070709_10899752
1931 Ga0070713_100115557
1932 Ga0070710_10298597
1933 Ga0070710_10482662
1934 Ga0070701_10014144
1935 Ga0070701_10085332
1936 Ga0070701_10562179
1937 Ga0070711_100350307
1938 Ga0070711_100355922
1939 Ga0070711_100364914
1940 Ga0070711_101924400
1941 Ga0070705_100021563
1942 Ga0070705_100481005
1943 Ga0070700_100000050
1944 Ga0070700_100105528
1945 Ga0070700_100699064
1946 Ga0070700_101465297
1947 Ga0070694_100004904
1948 Ga0070694_100018421
1949 Ga0070694_100026241
1950 Ga0070694_100923232
1951 Ga0070694_101063760
1952 Ga0070694_101212678
1953 Ga0070708_100157158
1954 Ga0070708_100172273
1955 Ga0070708_100263368
1956 Ga0070708_100263468
1957 Ga0070708_101206272
1958 Ga0070708_101221233
1959 Ga0070708_101357583
1960 Ga0070708_101527797
1961 Ga0070708_101802727
1962 Ga0070663_100046825
1963 Ga0070663_100507789
1964 Ga0070678_100006394
1965 Ga0070678_100277422
1966 Ga0070678_100505663
1967 Ga0070662_100093375
1968 Ga0070662_100124500
1969 Ga0070662_100146168
1970 Ga0070662_100201195
1971 Ga0070662_101086956
1972 Ga0070662_101352454
1973 Ga0070681_10212292
1974 Ga0070681_10388776
1975 Ga0070681_11357294
1976 Ga0068867_100016292
1977 Ga0068867_100023693
1978 Ga0068867_100025055
1979 Ga0068867_100261944
1980 Ga0068867_101344521
1981 Ga0070685_10112403
1982 Ga0070685_10811138
1983 Ga0070706_100005176
1984 Ga0070706_100021749
1985 Ga0070706_100060377
1986 Ga0070706_100084802
1987 Ga0070706_100143886
1988 Ga0070706_100152709
1989 Ga0070706_100160143
1990 Ga0070706_100185121
1991 Ga0070706_100253498
1992 Ga0070706_100290414
1993 Ga0070707_100006596
1994 Ga0070707_100084042
1995 Ga0070707_100222760
1996 Ga0070707_100271464
1997 Ga0070707_100459544
1998 Ga0070707_100574266
1999 Ga0070707_100613758
2000 Ga0070707_101381124
2001 Ga0070698_100004976
2002 Ga0070698_100022395
2003 Ga0070698_100039505
2004 Ga0070698_100150648
2005 Ga0070698_100337116
2006 Ga0070698_100358829
2007 Ga0070698_100771513
2008 Ga0070698_101613421
2009 Ga0070699_100242768
2010 Ga0070699_100270563
2011 Ga0070699_100331429
2012 Ga0070699_100372948
2013 Ga0070699_100894802
2014 Ga0070699_100980595
2015 Ga0070699_100988430
2016 Ga0070699_101044073
2017 Ga0070699_101840844
2018 Ga0070679_100029036
2019 Ga0070679_101054963
2020 Ga0070679_101391791
2021 Ga0070684_100006540
2022 Ga0070684_100034321
2023 Ga0070684_100315549
2024 Ga0070684_100501115
2025 Ga0070684_101450530
2026 Ga0070697_100002003
2027 Ga0070697_100006235
2028 Ga0070697_100016639
2029 Ga0070697_100050503
2030 Ga0070697_100057785
2031 Ga0070697_100073385
2032 Ga0070697_100131871
2033 Ga0070697_100173619
2034 Ga0070697_100292248
2035 Ga0070697_100788006
2036 Ga0070697_100935321
2037 Ga0070697_101020950
2038 Ga0070697_101092673
2039 Ga0068853_100010446
2040 Ga0068853_100558747
2041 Ga0070672_100005180
2042 Ga0070672_100057049
2043 Ga0070672_100074196
2044 Ga0070672_100078636
2045 Ga0070672_100083257
2046 Ga0070672_100189079
2047 Ga0070672_100222200
2048 Ga0070672_101545981
2049 Ga0070686_100022242
2050 Ga0070686_100065761
2051 Ga0070686_101648143
2052 Ga0070695_100043544
2053 Ga0070695_100121956
2054 Ga0070695_100123311
2055 Ga0070695_100147012
2056 Ga0070695_100332431
2057 Ga0070696_100012751
2058 Ga0070696_100015270
2059 Ga0070696_100023806
2060 Ga0070696_100068104
2061 Ga0070696_100143548
2062 Ga0070696_100290648
2063 Ga0070696_101204782
2064 Ga0070693_100037146
2065 Ga0070693_100063520
2066 Ga0070665_100022280
2067 Ga0070665_100027592
2068 Ga0070665_100425601
2069 Ga0070665_101177422
2070 Ga0070665_101605544
2071 Ga0070704_100044966
2072 Ga0070704_100199616
2073 Ga0070704_100228149
2074 Ga0070704_100346746
2075 Ga0070704_100408103
2076 Ga0068855_100000266
2077 Ga0068855_100946306
2078 Ga0070664_100005841
2079 Ga0070664_100436529
2080 Ga0070664_100688159
2081 Ga0070664_100756549
2082 Ga0068857_100333822
2083 Ga0068854_100126246
2084 Ga0068854_100248683
2085 Ga0068854_100287407
2086 Ga0068854_100331794
2087 Ga0068854_100978744
2088 Ga0068856_100007761
2089 Ga0068856_100009234
2090 Ga0068856_100859975
2091 Ga0068856_100867057
2092 Ga0068856_102227847
2093 Ga0070702_100039824
2094 Ga0070702_100067864
2095 Ga0070702_100187967
2096 Ga0070702_100299624
2097 Ga0070702_100550133
2098 Ga0070702_100565046
2099 Ga0068852_100160088
2100 Ga0068852_100419281
2101 Ga0068852_101268419
2102 Ga0068859_100000677
2103 Ga0068859_100163938
2104 Ga0068859_100284313
2105 Ga0068859_100310919
2106 Ga0068859_100425056
2107 Ga0068859_100971326
2108 Ga0068859_100995658
2109 Ga0068859_101953714
2110 Ga0068864_100031613
2111 Ga0068864_100094210
2112 Ga0068864_100108236
2113 Ga0068864_100197897
2114 Ga0068864_100669070
2115 Ga0068866_10270079
2116 Ga0068866_10396743
2117 Ga0068866_10972721
2118 Ga0068861_100020829
2119 Ga0068861_100084086
2120 Ga0068861_100182569
2121 Ga0068861_100283062
2122 Ga0068861_100400314
2123 Ga0068861_100663397
2124 Ga0068870_10075673
2125 Ga0068870_10389803
2126 Ga0068870_10612235
2127 Ga0068863_100061234
2128 Ga0068863_100135598
2129 Ga0068863_100614434
2130 Ga0068863_101247584
2131 Ga0068858_100004672
2132 Ga0068858_100183416
2133 Ga0068858_100479193
2134 Ga0068858_100940654
2135 Ga0068858_101981642
2136 Ga0068860_100005124
2137 Ga0068860_100042506
2138 Ga0068860_100110903
2139 Ga0068860_100407065
2140 Ga0068860_100625000
2141 Ga0068860_100709199
2142 Ga0068860_100937514
2143 Ga0068860_101594488
2144 Ga0068860_101787277
2145 Ga0068862_100003143
2146 Ga0068862_100040470
2147 Ga0068862_100091874
2148 Ga0068862_100103172
2149 Ga0068862_100115629
2150 Ga0068862_100446059
2151 Ga0068862_100483215
2152 Ga0081455_10000422
2153 Ga0081455_10010015
2154 Ga0081455_10028987
2155 Ga0081455_10079207
2156 Ga0081455_10448240
2157 Ga0081455_10548763
2158 Ga0081540_1027578
2159 Ga0070717_10000064
2160 Ga0070717_10417247
2161 Ga0070717_10756042
2162 Ga0075363_100924436
2163 Ga0075364_11251736
2164 Ga0075432_10006617
2165 Ga0075432_10058477
2166 Ga0075432_10395084
2167 Ga0070715_10683641
2168 Ga0070716_100026284
2169 Ga0070716_100270517
2170 Ga0070716_100442032
2171 Ga0070716_100815246
2172 Ga0070712_101881419
2173 Ga0097621_100030376
2174 Ga0097621_100492357
2175 Ga0097621_101324039
2176 Ga0097621_101458930
2177 Ga0097621_101491088
2178 Ga0068871_100129959
2179 Ga0068871_100377689
2180 Ga0068871_100454439
2181 Ga0068871_100711669
2182 Ga0068871_101018833
2183 Ga0068871_101193520
2184 Ga0068871_101282765
2185 Ga0075428_100002976
2186 Ga0075428_100003062
2187 Ga0075428_100032404
2188 Ga0075428_100069486
2189 Ga0075428_100209761
2190 Ga0075428_100307525
2191 Ga0075428_100371042
2192 Ga0075430_100002410
2193 Ga0075430_100006690
2194 Ga0075430_100040471
2195 Ga0075430_100299056
2196 Ga0075430_100517172
2197 Ga0075431_100003027
2198 Ga0075431_100179475
2199 Ga0075431_100350728
2200 Ga0075431_100638920
2201 Ga0075431_100703020
2202 Ga0075431_100806056
2203 Ga0075431_100841912
2204 Ga0075431_101001326
2205 Ga0075431_101649011
2206 Ga0075433_10002443
2207 Ga0075433_10005052
2208 Ga0075433_10065602
2209 Ga0075433_10084417
2210 Ga0075433_10088307
2211 Ga0075433_10111840
2212 Ga0075433_10163788
2213 Ga0075433_10187982
2214 Ga0075433_10447346
2215 Ga0075433_10773066
2216 Ga0075433_10830830
2217 Ga0075434_100000038
2218 Ga0075434_100002471
2219 Ga0075434_100014841
2220 Ga0075434_100110302
2221 Ga0075434_100135458
2222 Ga0075434_100135556
2223 Ga0075434_100246019
2224 Ga0075429_100008584
2225 Ga0075429_100099339
2226 Ga0075429_100292591
2227 Ga0075429_100305175
2228 Ga0075429_100550555
2229 Ga0068865_100005424
2230 Ga0068865_100016601
2231 Ga0075436_100002590
2232 Ga0075436_100002790
2233 Ga0075436_100004621
2234 Ga0075436_100027386
2235 Ga0075436_100076615
2236 Ga0075436_100098077
2237 Ga0075436_100176487
2238 Ga0075436_100248625
2239 Ga0075436_100915907
2240 Ga0097620_100000677
2241 Ga0097620_100163956
2242 Ga0097620_100284333
2243 Ga0097620_100310923
2244 Ga0097620_100425040
2245 Ga0097620_100971311
2246 Ga0097620_100995693
2247 Ga0097620_101953811
2248 Ga0075435_100002461
2249 Ga0075435_100027645
2250 Ga0075435_100088348
2251 Ga0075435_100236973
2252 Ga0075435_100242611
2253 Ga0075435_100300747
2254 Ga0075435_100488791
2255 Ga0075435_100747103
2256 Ga0075435_101963034
2257 Ga0099794_10049726
2258 Ga0099794_10197181
2259 Ga0099794_10297416
2260 Ga0099795_10020338
2261 Ga0099795_10424156
2262 Ga0105251_10107526
2263 Ga0105251_10293874
2264 Ga0105244_10011650
2265 Ga0105240_10127569
2266 Ga0105240_10732476
2267 Ga0111539_10000022
2268 Ga0111539_10058961
2269 Ga0111539_10199861
2270 Ga0111539_10349380
2271 Ga0111539_10923746
2272 Ga0111539_10934786
2273 Ga0111539_11120732
2274 Ga0111539_12242981
2275 Ga0111539_12975874
2276 Ga0105245_10001507
2277 Ga0105245_10368411
2278 Ga0105245_11361665
2279 Ga0105245_11449824
2280 Ga0105247_10151259
2281 Ga0105247_10271221
2282 Ga0114129_10000247
2283 Ga0114129_10001417
2284 Ga0114129_10002852
2285 Ga0114129_10046019
2286 Ga0114129_10063914
2287 Ga0114129_10177970
2288 Ga0114129_10439907
2289 Ga0114129_10521343
2290 Ga0114129_10525620
2291 Ga0114129_10715113
2292 Ga0114129_11090486
2293 Ga0114129_11460040
2294 Ga0114129_11718743
2295 Ga0105243_10000009
2296 Ga0105243_11007106
2297 Ga0105241_10080778
2298 Ga0105241_11962224
2299 Ga0105242_10012536
2300 Ga0105242_10080321
2301 Ga0105242_10713146
2302 Ga0105242_10748162
2303 Ga0105242_12012325
2304 Ga0105248_10008944
2305 Ga0105248_10223859
2306 Ga0105248_10574996
2307 Ga0105248_10689478
2308 Ga0105248_10960038
2309 Ga0105248_11517177
2310 Ga0105248_12580991
2311 Ga0105248_12890409
2312 Ga0105248_13041606
2313 Ga0105237_10066336
2314 Ga0105237_11477833
2315 Ga0105238_10000002
2316 Ga0105238_10145814
2317 Ga0105238_10456576
2318 Ga0105238_11023362
2319 Ga0105249_10026603
2320 Ga0105249_10725262
2321 Ga0105249_11281389
2322 Ga0105249_11793297
2323 Ga0105249_12996498
2324 Ga0099796_10090524
2325 Ga0099796_10554021
2326 Ga0105239_11699799
2327 Ga0105239_12145162
2328 Ga0105239_12558569
2329 Ga0105239_13315569
2330 Ga0105246_10235421
2331 Ga0157347_1066412
2332 Ga0157373_10325377
2333 Ga0157373_10638818
2334 Ga0157369_10001943
2335 Ga0157369_10100872
2336 Ga0157369_11203607
2337 Ga0157374_10000005
2338 Ga0157374_10002664
2339 Ga0157374_10039567
2340 Ga0157374_10508101
2341 Ga0157378_10012246
2342 Ga0157378_10096295
2343 Ga0157378_10108940
2344 Ga0157378_10227763
2345 Ga0157378_10300065
2346 Ga0157378_10325710
2347 Ga0157378_11002773
2348 Ga0157378_12184179
2349 Ga0163162_10093242
2350 Ga0163162_10212271
2351 Ga0163162_10429766
2352 Ga0157372_11136133
2353 Ga0157375_10012356
2354 Ga0157375_10021527
2355 Ga0157375_10064497
2356 Ga0157375_10071083
2357 Ga0157375_10237799
2358 Ga0157375_10379526
2359 Ga0157375_10536984
2360 Ga0157375_10749389
2361 Ga0157375_10928052
2362 Ga0157375_11218204
2363 Ga0157375_12260814
2364 Ga0163163_10036365
2365 Ga0163163_10053167
2366 Ga0163163_10054913
2367 Ga0163163_10139935
2368 Ga0163163_10271121
2369 Ga0163163_10313241
2370 Ga0163163_10365909
2371 Ga0163163_10723073
2372 Ga0163163_10728194
2373 Ga0163163_10844320
2374 Ga0163163_10928670
2375 Ga0163163_11145053
2376 Ga0157380_10001355
2377 Ga0157380_10205467
2378 Ga0157380_10688406
2379 Ga0157380_12863327
2380 Ga0157380_13133087
2381 Ga0182008_10834581
2382 Ga0157377_10000001
2383 Ga0157377_10000414
2384 Ga0157377_10046193
2385 Ga0157377_10191602
2386 Ga0157377_10565156
2387 Ga0157379_10000714
2388 Ga0157379_10138032
2389 Ga0157379_10307620
2390 Ga0157379_10533826
2391 Ga0157379_10549618
2392 Ga0157379_11303935
2393 Ga0157379_11498675
2394 Ga0157376_10000003
2395 Ga0157376_10046438
2396 Ga0157376_10654389
2397 Ga0157376_10676509
2398 Ga0157376_11115777
2399 Ga0157376_11341442
2400 Ga0157376_11493894
2401 Ga0157376_11763036
2402 Ga0182007_10306095
2403 Ga0163161_10063568
2404 Ga0206356_11765259
2405 Ga0206352_10878108
2406 Ga0213873_10000018
2407 Ga0213873_10000553
2408 Ga0213876_10000009
2409 Ga0213876_10000058
2410 Ga0207666_1001625
2411 Ga0207697_10009073
2412 Ga0207697_10068448
2413 Ga0207655_1019809
2414 Ga0207653_10128253
2415 Ga0207682_10001734
2416 Ga0207682_10143047
2417 Ga0207692_10077477
2418 Ga0207692_10915755
2419 Ga0207642_10101044
2420 Ga0207710_10203240
2421 Ga0207710_10504380
2422 Ga0207688_10006667
2423 Ga0207680_10003484
2424 Ga0207680_10007364
2425 Ga0207680_10033943
2426 Ga0207680_10152895
2427 Ga0207680_10374993
2428 Ga0207680_10472711
2429 Ga0207680_10571957
2430 Ga0207680_10793122
2431 Ga0207647_10068009
2432 Ga0207647_10118635
2433 Ga0207647_10422104
2434 Ga0207685_10194185
2435 Ga0207685_10353728
2436 Ga0207685_10353837
2437 Ga0207685_10811008
2438 Ga0207699_10068910
2439 Ga0207699_10096815
2440 Ga0207699_10205798
2441 Ga0207699_10276684
2442 Ga0207699_10423402
2443 Ga0207645_10006128
2444 Ga0207645_10021058
2445 Ga0207645_10123441
2446 Ga0207643_10001235
2447 Ga0207643_10017199
2448 Ga0207643_10081943
2449 Ga0207643_10206890
2450 Ga0207684_10011604
2451 Ga0207684_10035936
2452 Ga0207684_10043926
2453 Ga0207684_10072862
2454 Ga0207684_10134177
2455 Ga0207684_10141204
2456 Ga0207684_10190569
2457 Ga0207684_10238580
2458 Ga0207684_10544790
2459 Ga0207684_11008326
2460 Ga0207654_10623314
2461 Ga0207707_10070280
2462 Ga0207707_10317843
2463 Ga0207707_10899627
2464 Ga0207695_10091115
2465 Ga0207695_10433346
2466 Ga0207693_10090246
2467 Ga0207693_10218115
2468 Ga0207693_10299968
2469 Ga0207693_10378669
2470 Ga0207693_11170599
2471 Ga0207663_10052095
2472 Ga0207663_10173978
2473 Ga0207663_10383107
2474 Ga0207660_10774686
2475 Ga0207660_11262676
2476 Ga0207662_10059669
2477 Ga0207662_10068221
2478 Ga0207662_10086791
2479 Ga0207662_10136184
2480 Ga0207662_10153364
2481 Ga0207662_11017249
2482 Ga0207657_10064105
2483 Ga0207657_10489885
2484 Ga0207657_10604040
2485 Ga0207657_10653070
2486 Ga0207649_10268711
2487 Ga0207649_10724585
2488 Ga0207652_10293903
2489 Ga0207646_10000343
2490 Ga0207646_10080346
2491 Ga0207646_10140516
2492 Ga0207646_10147358
2493 Ga0207646_10207606
2494 Ga0207646_10215582
2495 Ga0207646_10333027
2496 Ga0207646_10581853
2497 Ga0207646_10586794
2498 Ga0207646_10821657
2499 Ga0207646_11430375
2500 Ga0207681_10002742
2501 Ga0207681_10152701
2502 Ga0207681_10287031
2503 Ga0207681_10767289
2504 Ga0207681_11437631
2505 Ga0207694_10000001
2506 Ga0207694_10176365
2507 Ga0207650_10000082
2508 Ga0207650_10011593
2509 Ga0207650_10048909
2510 Ga0207650_10116501
2511 Ga0207650_10302623
2512 Ga0207650_10768909
2513 Ga0207659_10000036
2514 Ga0207659_10115953
2515 Ga0207659_10120504
2516 Ga0207659_10287415
2517 Ga0207659_10329048
2518 Ga0207659_10403812
2519 Ga0207659_10669329
2520 Ga0207659_10779324
2521 Ga0207687_10000005
2522 Ga0207687_10607398
2523 Ga0207687_11309652
2524 Ga0207687_11549680
2525 Ga0207700_10051399
2526 Ga0207700_10089784
2527 Ga0207700_10098343
2528 Ga0207700_10801507
2529 Ga0207700_10945405
2530 Ga0207644_10055836
2531 Ga0207644_10259586
2532 Ga0207644_11465725
2533 Ga0207690_10025055
2534 Ga0207690_10136438
2535 Ga0207706_10013582
2536 Ga0207706_10073033
2537 Ga0207706_10091565
2538 Ga0207706_10105904
2539 Ga0207706_10433223
2540 Ga0207706_10588375
2541 Ga0207706_10954501
2542 Ga0207686_10001508
2543 Ga0207686_10217571
2544 Ga0207709_10000026
2545 Ga0207709_10210974
2546 Ga0207709_11215995
2547 Ga0207670_10070690
2548 Ga0207670_10136374
2549 Ga0207670_10148699
2550 Ga0207670_10150696
2551 Ga0207670_10309877
2552 Ga0207670_10474085
2553 Ga0207670_10531204
2554 Ga0207670_10555149
2555 Ga0207670_10850257
2556 Ga0207670_11671863
2557 Ga0207669_10100540
2558 Ga0207669_10323551
2559 Ga0207669_10468953
2560 Ga0207669_10705697
2561 Ga0207669_11881879
2562 Ga0207704_10003857
2563 Ga0207704_10029913
2564 Ga0207704_10765814
2565 Ga0207704_11810931
2566 Ga0207665_10006268
2567 Ga0207665_10009968
2568 Ga0207665_10018501
2569 Ga0207665_10026836
2570 Ga0207665_10251041
2571 Ga0207665_10305436
2572 Ga0207665_10457139
2573 Ga0207665_10496467
2574 Ga0207665_10548002
2575 Ga0207665_10864190
2576 Ga0207691_10000326
2577 Ga0207691_10002644
2578 Ga0207691_10006947
2579 Ga0207691_10133717
2580 Ga0207691_10204635
2581 Ga0207691_10289454
2582 Ga0207691_10727844
2583 Ga0207691_11018557
2584 Ga0207711_10007454
2585 Ga0207711_10197035
2586 Ga0207711_10389374
2587 Ga0207711_11458974
2588 Ga0207711_11985335
2589 Ga0207689_10009254
2590 Ga0207689_10009503
2591 Ga0207689_10020085
2592 Ga0207689_10065221
2593 Ga0207689_10140200
2594 Ga0207689_10340280
2595 Ga0207689_10446792
2596 Ga0207689_11199927
2597 Ga0207689_11416054
2598 Ga0207661_10000006
2599 Ga0207661_10007008
2600 Ga0207661_10082186
2601 Ga0207679_10071083
2602 Ga0207679_10482510
2603 Ga0207679_10566129
2604 Ga0207679_10716020
2605 Ga0207679_11403420
2606 Ga0207679_11573638
2607 Ga0207667_10003431
2608 Ga0207667_10023566
2609 Ga0207651_10006583
2610 Ga0207651_10007125
2611 Ga0207651_10064605
2612 Ga0207651_10099429
2613 Ga0207651_10742043
2614 Ga0207651_10855995
2615 Ga0207651_11107468
2616 Ga0207712_10290886
2617 Ga0207712_10624678
2618 Ga0207712_10782455
2619 Ga0207712_10943791
2620 Ga0207668_10018999
2621 Ga0207668_10554333
2622 Ga0207640_10107477
2623 Ga0207640_10305543
2624 Ga0207640_10989329
2625 Ga0207658_10001637
2626 Ga0207658_10055938
2627 Ga0207658_10351037
2628 Ga0207677_10000101
2629 Ga0207677_10218669
2630 Ga0207677_10291313
2631 Ga0207677_11090546
2632 Ga0207677_11423989
2633 Ga0207677_11805638
2634 Ga0207703_10007604
2635 Ga0207703_10316451
2636 Ga0207703_10392236
2637 Ga0207703_10410089
2638 Ga0207703_11039613
2639 Ga0207703_11467887
2640 Ga0207703_11536237
2641 Ga0207639_10000013
2642 Ga0207639_10189920
2643 Ga0207639_10492689
2644 Ga0207678_10049059
2645 Ga0207678_10190888
2646 Ga0207678_10222677
2647 Ga0207678_10759286
2648 Ga0207678_11932014
2649 Ga0207708_10000041
2650 Ga0207708_10011108
2651 Ga0207708_10012451
2652 Ga0207708_10906223
2653 Ga0207702_10001471
2654 Ga0207702_10011175
2655 Ga0207702_10182964
2656 Ga0207702_10332278
2657 Ga0207702_10808274
2658 Ga0207702_10819429
2659 Ga0207702_11743255
2660 Ga0207641_10037244
2661 Ga0207641_10048111
2662 Ga0207641_10137639
2663 Ga0207641_10147519
2664 Ga0207641_10465979
2665 Ga0207641_10611981
2666 Ga0207641_10648581
2667 Ga0207641_10688216
2668 Ga0207648_10011154
2669 Ga0207648_10024555
2670 Ga0207648_10035580
2671 Ga0207648_10043194
2672 Ga0207648_10307115
2673 Ga0207648_10359341
2674 Ga0207676_10098517
2675 Ga0207676_10177426
2676 Ga0207676_10214264
2677 Ga0207676_10500738
2678 Ga0207676_10736336
2679 Ga0207674_11570213
2680 Ga0207674_11773476
2681 Ga0207675_100002645
2682 Ga0207675_100002673
2683 Ga0207675_100013850
2684 Ga0207675_100060186
2685 Ga0207675_100109886
2686 Ga0207675_100361315
2687 Ga0207675_101074241
2688 Ga0207683_10005107
2689 Ga0207683_10317284
2690 Ga0207683_10512688
2691 Ga0207698_10043801
2692 Ga0207698_10208854
2693 Ga0207698_10703309
2694 Ga0207698_12121934
2695 Ga0209969_1040868
2696 Ga0209981_1011093
2697 Ga0209996_1014048
2698 Ga0209179_1027708
2699 Ga0209968_1002058
2700 Ga0209982_1007080
2701 Ga0210002_1020599
2702 Ga0209983_1000280
2703 Ga0209588_1025351
2704 Ga0209588_1032623
2705 Ga0209588_1218255
2706 Ga0209971_1000384
2707 Ga0209966_1133005
2708 Ga0209998_10002827
2709 Ga0209974_10004420
2710 Ga0209974_10128164
2711 Ga0209974_10197531
2712 Ga0207428_10000030
2713 Ga0207428_10017611
2714 Ga0207428_10042290
2715 Ga0207428_10380583
2716 Ga0207428_11037160
2717 Ga0207428_11047024
2718 Ga0268266_10000259
2719 Ga0268266_10015961
2720 Ga0268266_10047157
2721 Ga0268266_10309020
2722 Ga0268265_10009861
2723 Ga0268265_10034866
2724 Ga0268265_10037170
2725 Ga0268265_10045924
2726 Ga0268265_10220454
2727 Ga0268265_10485770
2728 Ga0268265_10490222
2729 Ga0268265_10490646
2730 Ga0268265_11237145
2731 Ga0268265_11331701
2732 Ga0268264_10005977
2733 Ga0268264_10044863
2734 Ga0268264_10049767
2735 Ga0268264_10136493
2736 Ga0268264_10144015
2737 Ga0268264_10197367
2738 Ga0268264_10209665
2739 Ga0268264_10259334
2740 Ga0268264_10362378
2741 Ga0268264_10497856
2742 Ga0268264_11076106
2743 Ga0268264_11085509
2744 Ga0265319_1044281
2745 Ga0265319_1060122
2746 Ga0265334_10078109
2747 Ga0265323_10004178
2748 Ga0265323_10067614
2749 Ga0265338_10016967
2750 Ga0265338_10128873
2751 Ga0265338_10345344
2752 Ga0265338_10642953
2753 Ga0265338_11184375
2754 Ga0307511_10002513
2755 Ga0307511_10231185
2756 Ga0265767_110710
2757 Ga0265767_112437
2758 Ga0265764_113392
2759 Ga0265330_10000541
2760 Ga0265330_10001334
2761 Ga0265330_10003060
2762 Ga0265330_10375265
2763 Ga0265332_10064443
2764 Ga0265332_10155677
2765 Ga0265328_10051354
2766 Ga0265320_10307898
2767 Ga0265329_10003473
2768 Ga0265329_10015790
2769 Ga0265329_10034598
2770 Ga0265340_10015118
2771 Ga0265339_10055328
2772 Ga0265339_10075819
2773 Ga0265339_10240841
2774 Ga0265331_10073224
2775 Ga0265331_10233136
2776 Ga0265316_10000251
2777 Ga0265316_10000984
2778 Ga0265316_10014237
2779 Ga0265316_10018769
2780 Ga0265316_10028493
2781 Ga0265316_10048657
2782 Ga0265316_10169982
2783 Ga0265316_10388436
2784 Ga0307408_100164966
2785 Ga0307408_100236106
2786 Ga0307408_102138195
2787 Ga0265313_10122813
2788 Ga0307508_10050191
2789 Ga0316575_10002995
2790 Ga0316575_10014672
2791 Ga0316575_10021116
2792 Ga0316579_10070932
2793 Ga0316579_10157791
2794 Ga0265314_10023438
2795 Ga0265314_10114121
2796 Ga0265342_10008085
2797 Ga0265342_10036131
2798 Ga0265342_10039697
2799 Ga0265342_10085382
2800 Ga0265342_10176966
2801 Ga0316576_10012802
2802 Ga0316576_10031380
2803 Ga0316576_10072783
2804 Ga0316576_10254444
2805 Ga0316576_10343935
2806 Ga0316576_10358298
2807 Ga0316578_10148460
2808 Ga0307516_10003404
2809 Ga0307405_10139666
2810 Ga0307405_10724904
2811 Ga0316577_10006446
2812 Ga0316577_10035166
2813 Ga0316577_10160530
2814 Ga0316577_10429752
2815 Ga0307413_10005834
2816 Ga0307413_10371109
2817 Ga0307410_10001864
2818 Ga0307410_10034138
2819 Ga0307410_10371816
2820 Ga0326468_10043698
2821 Ga0307406_10235992
2822 Ga0307406_10787551
2823 Ga0307406_12037644
2824 Ga0307407_10033183
2825 Ga0307407_11490439
2826 Ga0307412_10233228
2827 Ga0307412_10394963
2828 Ga0307412_11035527
2829 Ga0307412_11463688
2830 Ga0307409_100002915
2831 Ga0307409_100048335
2832 Ga0307409_100109897
2833 Ga0307409_100625568
2834 Ga0307409_101589606
2835 Ga0307409_102225915
2836 Ga0307416_100018585
2837 Ga0307416_100039410
2838 Ga0307416_100496117
2839 Ga0307416_100807659
2840 Ga0307416_101190947
2841 Ga0307416_101215820
2842 Ga0307416_101970819
2843 Ga0307414_10005193
2844 Ga0307414_10007281
2845 Ga0307414_10028964
2846 Ga0307414_10042491
2847 Ga0307411_10003742
2848 Ga0307411_10008827
2849 Ga0307411_11011757
2850 Ga0307411_11232053
2851 Ga0316053_117483
2852 Ga0307415_100056689
2853 Ga0307415_100268612
2854 Ga0307415_101068181
2855 Ga0307415_101167579
2856 Ga0316593_10001783
2857 Ga0316593_10002618
2858 Ga0316593_10014252
2859 Ga0316593_10019333
2860 Ga0316593_10019508
2861 Ga0316593_10028372
2862 Ga0316593_10158812
2863 Ga0316593_10316334
2864 Ga0316593_10329705
2865 Ga0316592_1024201
2866 Ga0316588_1007611
2867 Ga0316588_1018568
2868 Ga0316588_1040523
2869 Ga0316588_1051023
2870 Ga0316588_1067069
2871 Ga0316588_1067880
2872 Ga0316588_1088459
2873 Ga0316588_1105398
2874 Ga0316596_1000493
2875 Ga0316596_1070869
2876 Ga0316596_1169994
2877 Ga0373930_0030179
2878 Ga0373948_0130321
2879 Ga0373948_0132447
2880 Ga0373958_0009873
2881 Ga0373959_0134078
2882 Ga0373938_0175085
2883 Ga0373926_0001122
2884 Ga0373926_0009400
2885 Ga0373926_0258941
2886 Ga0373929_0094499
2887 Ga0373934_0104707
2888 Ga0373940_0187565
2889 Ga0373944_0057907
2890 Ga0373944_0244742
2891 Ga0373951_0113679
2892 Ga0373952_0180221
2893 Ga0373923_0053759
2894 Ga0373923_0090832
2895 Ga0373923_0385065
2896 Ga0373923_0433015
2897 Ga0373932_0274730
2898 Ga0373936_0037210
2899 Ga0373936_0205470
2900 Ga0373936_0418617
2901 Ga0373939_0122999
2902 Ga0373941_0115498
2903 Ga0373941_0205636
2904 Ga0373945_0018377
2905 Ga0373945_0062158
2906 Ga0373953_0002723
2907 Ga0373953_0086762
2908 Ga0373953_0118381
2909 Ga0373954_0014604
2910 Ga0373954_0156125
2911 Ga0373954_0163207
2912 Ga0373954_0522548
2913 Ga0373956_0009506
2914 Ga0373956_0010739
2915 Ga0373956_0108665
2916 Ga0373957_0057958
2917 Ga0373957_0117503
2918 Ga0373957_0154822
2919 Ga0373960_0231198
2920 Ga0373943_0011073
2921 Ga0373943_0367741
2922 Ga0373955_0013590
2923 Ga0373955_0037811
2924 Ga0373955_0058171
2925 Ga0373955_0109033
2926 Ga0373955_0327525
2927 Ga0373955_0345873
2928 Ga0373942_0347133
2929 Ga0373961_0135251
2930 Ga0373961_0146509
2931 Ga0373961_0257992
2932 Ga0316574_0001004
2933 Ga0316574_0022880
2934 Ga0316574_0047770
2935 Ga0316574_0109331
2936 Ga0316574_0140482
2937 Ga0316574_0143803
2938 Ga0316574_0161536
2939 Ga0316574_0833998
2940 Ga0373924_0126646
2941 Ga0373931_0136727
2942 Ga0373931_0260324
2943 Ga0373931_0303750
2944 Ga0373931_1274424
2945 Ga0373935_0051065
2946 Ga0373935_0075929
2947 Ga0373927_0004438
2948 Ga0373927_0005589
2949 Ga0373927_0161417
2950 Ga0373927_0625416
2951 Ga0373927_1096771
2952 Ga0373933_0294661
2953 Ga0373933_0373450
2954 Ga0373947_0007919
2955 Ga0373947_0013676
2956 Ga0373947_0114040
2957 Ga0373947_0223935
2958 Ga0373947_0256443
2959 Ga0373947_0783854
2960 Ga0373947_0992452
2961 Ga0373937_0007252
2962 Ga0373937_0025601
2963 Ga0373937_0030240
2964 Ga0373937_0056404
2965 Ga0373937_0076114
2966 Ga0373937_0113979
2967 Ga0373937_0171110
2968 Ga0373937_0431917
2969 Ga0373937_0866335
2970 Ga0373937_1848163
2971 Ga0373937_2066069
2972 Ga0316582_0200485
2973 Ga0316582_0287953
2974 Ga0316582_0643517
2975 Ga0316582_0705715
2976 Ga0316584_0351874
2977 Ga0316584_0358687
2978 Ga0316584_0408499
2979 Ga0316584_0518106
2980 Ga0316584_0577819
2981 Ga0316584_0622151
2982 Ga0316584_0726414
2983 Ga0316584_0729147
2984 Ga0316584_0734471
2985 Ga0373925_0001662
2986 Ga0373925_0001788
2987 Ga0373925_0094451
2988 Ga0373925_0262346
2989 Ga0373925_0263319
2990 Ga0373925_0554776
2991 Ga0373925_0872321
2992 Ga0395899_0173762
2993 Ga0395900_0018609
2994 Ga0395900_0954656
2995 Ga0395900_1480901
2996 Ga0395900_1668877
2997 Ga0395898_0564374
2998 Ga0395905_0000275
2999 Ga0395905_0001744
3000 Ga0395905_0082831
3001 Ga0395905_0369455
3002 Ga0395905_0877384
3003 Ga0316581_0013010
3004 Ga0395901_0113158
3005 Ga0400490_17491
3006 Ga0400491_12215
3007 Ga0400483_126972
3008 Ga0400483_247471
3009 Ga0400489_10986
3010 Ga0400489_86969
3011 Ga0436365_0154164
3012 Ga0436365_1563210
3013 Ga0436365_1839659
3014 Ga0436365_1927449
3015 Ga0436360_0080201
3016 Ga0436360_0406311
3017 Ga0436363_0576030
3018 Ga0436363_1475130
3019 Ga0436362_0225975
3020 Ga0436362_1063276
3021 Ga0436362_1069013
3022 Ga0439461_0064471
3023 Ga0451793_0687095
3024 Ga0451795_0060284
3025 Ga0451839_0487727
3026 Ga0451851_0850392
3027 Ga0439433_0112274
3028 Ga0439451_125562
3029 Ga0439444_0094397
3030 Ga0451577_0008700
3031 Ga0451577_0012592
3032 Ga0451577_0016347
3033 Ga0451577_0033756
3034 Ga0451577_0134048
3035 Ga0451577_0161269
3036 Ga0451577_0317597
3037 Ga0451577_1403892
3038 Ga0439440_0013796
3039 Ga0453683_0000086
3040 Ga0453683_0008784
3041 Ga0453683_0054837
3042 Ga0453683_0055812
3043 Ga0453683_0122574
3044 Ga0453683_0216829
3045 Ga0466965_0436268
3046 Ga0453684_0001061
3047 Ga0453684_0001518
3048 Ga0453684_0006427
3049 Ga0453684_0008349
3050 Ga0453684_0011806
3051 Ga0453684_0019106
3052 Ga0453684_0019836
3053 Ga0453684_0020573
3054 Ga0453684_0033355
3055 Ga0453684_0037288
3056 Ga0453684_0042819
3057 Ga0453684_0044000
3058 Ga0453684_0048627
3059 Ga0453684_0060385
3060 Ga0453684_0062580
3061 Ga0453684_0075363
3062 Ga0453684_0090894
3063 Ga0453684_0111000
3064 Ga0453684_0240329
3065 Ga0453684_0373414
3066 Ga0453684_0646837
3067 Ga0453684_1257000
3068 Ga0453684_1813505
3069 Ga0451576_0004083
3070 Ga0451576_0005300
3071 Ga0451576_0019582
3072 Ga0451576_0093519
3073 Ga0451576_0129629
3074 Ga0451576_0137895
3075 Ga0451576_0196516
3076 Ga0451576_0213585
3077 Ga0451576_0215670
3078 Ga0451576_0312134
3079 Ga0451576_0499547
3080 Ga0451576_0648915
3081 Ga0451576_0682098
3082 Ga0451576_1292499
3083 Ga0451576_2130053
3084 Ga0466967_0445372
3085 Ga0466967_0955867
3086 Ga0495617_143473
3087 Ga0495592_0161903
3088 Ga0495603_0016598
3089 Ga0495603_0334793
3090 Ga0495629_0007707
3091 Ga0495629_0016479
3092 Ga0495629_0184529
3093 Ga0495629_0419104
3094 Ga0495641_0041758
3095 Ga0495641_0047852
3096 Ga0495641_0125788
3097 Ga0495641_0141431
3098 Ga0495651_0042906
3099 Ga0495651_0481615
3100 Ga0495651_0597215
3101 Ga0495580_0001448
3102 Ga0495580_0002827
3103 Ga0495580_0005582
3104 Ga0495580_0012791
3105 Ga0495580_0050436
3106 Ga0495580_0057891
3107 Ga0495580_0080283
3108 Ga0495580_0121196
3109 Ga0495580_0125962
3110 Ga0495580_0261064
3111 Ga0495580_0411869
3112 Ga0495580_0584354
3113 Ga0495580_0654197
3114 Ga0495580_0921904
3115 Ga0495582_0000113
3116 Ga0495582_0026338
3117 Ga0495582_0079298
3118 Ga0495582_0295889
3119 Ga0495582_0417230
3120 Ga0495639_0020227
3121 Ga0495639_0122966
3122 Ga0495662_0522177
3123 Ga0495664_0005945
3124 Ga0495584_0399912
3125 Ga0495585_0380470
3126 Ga0495585_0494208
3127 Ga0495594_0021611
3128 Ga0495594_0076463
3129 Ga0495594_0452844
3130 Ga0495616_0235832
3131 Ga0495618_0033948
3132 Ga0495618_0047295
3133 Ga0495618_0179620
3134 Ga0495618_0346716
3135 Ga0495628_0268257
3136 Ga0495628_0573546
3137 Ga0495630_0003551
3138 Ga0495630_0016248
3139 Ga0495630_0019992
3140 Ga0495630_0776267
3141 Ga0495630_0982529
3142 Ga0495666_0137734
3143 Ga0495666_0195179
3144 Ga0495666_0326231
3145 Ga0495666_0333159
3146 Ga0495642_0362330
3147 Ga0495652_0354639
3148 Ga0495652_0384663
3149 Ga0495665_0017070
3150 Ga0495665_0038759
3151 Ga0495665_0105049
3152 Ga0495665_0695753
3153 Ga0495640_0084228
3154 Ga0495640_0194210
3155 Ga0495640_0739393
3156 Ga0495586_0003305
3157 Ga0495586_0031142
3158 Ga0495586_0031189
3159 Ga0495586_0047729
3160 Ga0495587_0002355
3161 Ga0495587_0019640
3162 Ga0495587_0213134
3163 Ga0495598_0017282
3164 Ga0495645_0630048
3165 Ga0495645_0654462
3166 Ga0495622_0267752
3167 Ga0495633_0069411
3168 Ga0495656_0000397
3169 Ga0495656_0517719
3170 Ga0495656_0726992
3171 Ga0495668_0770055
3172 Ga0495634_0000649
3173 Ga0495634_0165167
3174 Ga0495635_0069638
3175 Ga0495588_0457836
3176 Ga0495657_0158952
3177 Ga0495657_0273279
3178 Ga0495657_0274523
3179 Ga0495657_0444406
3180 Ga0495623_0095320
3181 Ga0495647_0004304
3182 Ga0495647_0006082
3183 Ga0495647_0007570
3184 Ga0495647_0040084
3185 Ga0495647_0249323
3186 Ga0495647_0452968
3187 Ga0495658_0017882
3188 Ga0495658_0028263
3189 Ga0495658_0056441
3190 Ga0495658_0189652
3191 Ga0495669_0106398
3192 Ga0495669_0505155
3193 Ga0495613_0042407
3194 Ga0495613_0095480
3195 Ga0495613_0642490
3196 Ga0495624_0023361
3197 Ga0495670_0019811
3198 Ga0495670_0731190
3199 Ga0495589_0432283
3200 Ga0495600_0047423
3201 Ga0495600_0361141
3202 Ga0495581_0208241
3203 Ga0495581_0262135
3204 Ga0495604_0039896
3205 Ga0495604_0368503
3206 Ga0495604_0595068
3207 Ga0495604_0776194
3208 Ga0495636_0000893
3209 Ga0495636_0044847
3210 Ga0495636_0175385
3211 Ga0495636_0273477
3212 Ga0495674_0001336
3213 Ga0495674_0036483
3214 Ga0495674_0094633
3215 Ga0495674_0202418
3216 Ga0495674_0835104
3217 Ga0495676_0030282
3218 Ga0495676_0588623
3219 Ga0495680_0202098
3220 Ga0495680_0378620
3221 Ga0495680_1005008
3222 Ga0495675_0068217
3223 Ga0495679_007316
3224 Ga0495684_0026659
3225 Ga0495684_0054352
3226 Ga0495684_0078814
3227 Ga0495684_0231057
3228 Ga0495684_0260054
3229 Ga0495593_0078777
3230 Ga0495593_0252399
3231 Ga0495602_0017278
3232 Ga0495602_0227086
3233 Ga0495614_0010953
3234 Ga0495614_0069510
3235 Ga0495615_0003089
3236 Ga0496100_0003660
3237 Ga0496100_0017930
3238 Ga0496100_0998411
3239 Ga0496101_0025125
3240 Ga0496101_0179518
3241 Ga0496101_0523564
3242 Ga0496101_0666373
3243 Ga0496101_0925184
3244 Ga0496102_0000916
3245 Ga0496102_0003028
3246 Ga0496102_0018905
3247 Ga0496102_0035581
3248 Ga0496102_0146115
3249 Ga0496102_0766183
3250 Ga0496103_0030082
3251 Ga0496104_0028984
3252 Ga0496104_0036226
3253 Ga0496104_0103951
3254 Ga0496104_0107857
3255 Ga0496104_0322079
3256 Ga0496104_0351967
3257 Ga0496104_0370528
3258 Ga0496105_0078298
3259 Ga0496105_0139233
3260 Ga0496105_0166096
3261 Ga0496105_0213217
3262 Ga0496105_0524359
3263 Ga0496105_0684031
3264 Ga0496106_0003518
3265 Ga0496106_0030306
3266 Ga0496106_0087377
3267 Ga0496106_0283939
3268 Ga0496106_0970159
3269 Ga0496106_1362863
3270 Ga0496107_0000796
3271 Ga0496107_0067376
3272 Ga0496107_0933349
3273 Ga0496108_0032489
3274 Ga0496108_0124186
3275 Ga0496108_0286001
3276 Ga0496108_0482416
3277 Ga0496108_0767720
3278 Ga0496108_1634796
3279 Ga0496109_0060025
3280 Ga0496109_0087350
3281 Ga0496109_0404303
3282 Ga0496109_1425728
3283 Ga0496110_0000091
3284 Ga0496110_0004643
3285 Ga0496110_0023793
3286 Ga0496110_0286750
3287 Ga0496110_0587594
3288 Ga0496111_0016892
3289 Ga0496111_0048928
3290 Ga0496111_0225915
3291 Ga0496111_0375322
3292 Ga0496111_1316029
3293 Ga0496112_0030222
3294 Ga0496112_0356812
3295 Ga0496112_0663177
3296 Ga0496112_0773487
3297 Ga0496112_1465119
3298 Ga0496113_0021257
3299 Ga0496113_0648146
3300 Ga0496113_0732631
3301 Ga0496113_0902278
3302 Ga0496114_0000386
3303 Ga0496114_0001141
3304 Ga0496114_0004194
3305 Ga0496114_0006073
3306 Ga0496114_0230229
3307 Ga0496114_0320615
3308 Ga0496114_0353784
3309 Ga0496114_0778035
3310 Ga0496115_0006616
3311 Ga0496115_0047334
3312 Ga0496115_0059367
3313 Ga0496115_0389278
3314 Ga0496115_0443708
3315 Ga0496115_0561298
3316 Ga0496116_0025193
3317 Ga0496116_0030225
3318 Ga0496117_0001863
3319 Ga0496117_0059650
3320 Ga0496117_0204017
3321 Ga0496122_0008592
3322 Ga0496123_0029360
3323 Ga0496124_0000001
3324 Ga0496124_0075016
3325 Ga0496125_0056825
3326 Ga0496125_0384470
3327 Ga0496126_0096151
3328 Ga0496126_0097584
3329 Ga0496126_0626774
3330 Ga0501305_018599
3331 Ga0501307_006084
3332 Ga0501307_091116
3333 Ga0501290_028794
3334 Ga0501298_057336
3335 Ga0501317_062977
3336 Ga0501031_0100714
3337 Ga0501031_0118379
3338 Ga0501032_0175090
3339 Ga0501033_0071425
3340 Ga0501034_0079903
3341 Ga0501034_1384106
3342 Ga0501036_0014973
3343 Ga0501036_0034010
3344 Ga0501036_1550544
3345 Ga0501037_0011186
3346 Ga0501037_0700449
3347 Ga0501038_0000271
3348 Ga0501038_0583992
3349 Ga0501038_0997715
3350 Ga0501039_0108043
3351 Ga0501039_0153331
3352 Ga0501039_0306749
3353 Ga0501039_0806175
3354 Ga0501039_0960743
3355 Ga0501039_1022063
3356 Ga0501040_0001044
3357 Ga0501040_0062391
3358 Ga0501040_0088966
3359 Ga0501040_0160571
3360 Ga0501040_0211230
3361 Ga0501040_0230286
3362 Ga0501041_0000002
3363 Ga0501041_0163295
3364 Ga0501042_0000645
3365 Ga0501042_0048885
3366 Ga0501042_0134671
3367 Ga0501043_0085474
3368 Ga0501043_0121334
3369 Ga0501043_0185513
3370 Ga0501046_0051614
3371 Ga0501046_0119838
3372 Ga0501046_0295744
3373 Ga0501046_1237436
3374 Ga0501047_0468086
3375 Ga0501048_0002109
3376 Ga0501048_0234505
3377 Ga0501048_0241932
3378 Ga0501048_0902011
3379 Ga0501067_0003773
3380 Ga0501068_0117831
3381 Ga0501068_0225851
3382 Ga0501068_0262995
3383 Ga0501069_0748886
3384 Ga0501070_0607196
3385 Ga0501070_1410966
3386 Ga0501071_0001937
3387 Ga0501071_0145214
3388 Ga0501071_0172545
3389 Ga0501071_0231051
3390 Ga0501072_0000128
3391 Ga0501072_0032391
3392 Ga0501072_0215997
3393 Ga0501073_0003382
3394 Ga0501073_0009833
3395 Ga0501073_0038469
3396 Ga0501073_0207608
3397 Ga0501074_0003300
3398 Ga0501074_0110042
3399 Ga0501074_0281025
3400 Ga0501074_0387843
3401 Ga0501075_0015531
3402 Ga0501075_0038544
3403 Ga0501075_0090751
3404 Ga0501075_0103332
3405 Ga0501075_0149057
3406 Ga0501075_0536782
3407 Ga0501076_0000022
3408 Ga0501076_0012924
3409 Ga0501076_0015095
3410 Ga0501076_0019380
3411 Ga0501076_0165212
3412 Ga0501076_0198838
3413 Ga0501076_1433015
3414 Ga0501076_1586770
3415 Ga0501077_0000017
3416 Ga0501077_0005748
3417 Ga0501077_0013601
3418 Ga0501077_0138932
3419 Ga0501077_0182664
3420 Ga0501077_0477644
3421 Ga0501198_019554
3422 Ga0501217_156633
3423 Ga0501249_047500
3424 Ga0501252_029041
3425 Ga0501258_020947
3426 Ga0501079_0000549
3427 Ga0501079_0039652
3428 Ga0501079_0219200
3429 Ga0501079_0338296
3430 Ga0501079_0785145
3431 Ga0501080_0004016
3432 Ga0501080_0054009
3433 Ga0501080_0058519
3434 Ga0501080_0169697
3435 Ga0501080_0430265
3436 Ga0501080_1110040
3437 Ga0501081_0000105
3438 Ga0501081_0212764
3439 Ga0501081_0438763
3440 Ga0501081_0921357
3441 Ga0501083_0098494
3442 Ga0501083_0416796
3443 Ga0501083_0832287
3444 Ga0501083_0890704
3445 Ga0501270_003093
3446 Ga0501035_0002385
3447 Ga0501035_0346800
3448 Ga0501035_0386792
3449 Ga0501035_0900218
3450 Ga0501035_1074586
3451 Ga0501045_0000113
3452 Ga0501045_0005535
3453 Ga0501045_0093809
3454 Ga0501045_0193347
3455 Ga0501212_038484
3456 nmdc:mga00v17_852269_c1
3457 nmdc:mga05p37_1252235_c1
3458 nmdc:mga05p37_1701_c1
3459 nmdc:mga05p37_1842889_c1
3460 nmdc:mga05p37_1993750_c1
3461 nmdc:mga05p37_217608_c1
3462 nmdc:mga05p37_2357_c1
3463 nmdc:mga05p37_2405_c1
3464 nmdc:mga05p37_244065_c1
3465 nmdc:mga05p37_28557_c1
3466 nmdc:mga05p37_43119_c2
3467 nmdc:mga05p37_53231_c1
3468 nmdc:mga05p37_5571_c1
3469 nmdc:mga09592_1578074_c1
3470 nmdc:mga09592_194091_c1
3471 nmdc:mga09592_47614_c1
3472 nmdc:mga09592_7449_c1
3473 nmdc:mga09592_845691_c1
3474 nmdc:mga09592_88599_c1
3475 nmdc:mga0qj67_222840_c1
3476 nmdc:mga0qj67_263938_c1
3477 nmdc:mga0qj67_287621_c1
3478 nmdc:mga0qj67_36968_c1
3479 nmdc:mga0qj67_610306_c1
3480 nmdc:mga06r32_1302523_c1
3481 nmdc:mga06r32_299928_c1
3482 nmdc:mga06r32_600_c2
3483 nmdc:mga06r32_721966_c1
3484 nmdc:mga08y16_1403866_c1
3485 nmdc:mga08y16_158966_c1
3486 nmdc:mga08y16_1650152_c1
3487 nmdc:mga08y16_20950_c1
3488 nmdc:mga08y16_24_c1
3489 nmdc:mga08y16_421972_c1
3490 nmdc:mga08y16_692563_c1
3491 nmdc:mga08y16_903961_c1
3492 nmdc:mga0n895_112230_c1
3493 nmdc:mga0n895_116858_c1
3494 nmdc:mga0n895_124772_c1
3495 nmdc:mga0n895_15345_c1
3496 nmdc:mga0n895_157994_c1
3497 nmdc:mga0n895_16211_c1
3498 nmdc:mga0n895_165230_c1
3499 nmdc:mga0n895_248534_c1
3500 nmdc:mga0n895_32532_c1
3501 nmdc:mga0n895_4227_c1
3502 nmdc:mga0rr50_15066_c1
3503 nmdc:mga0rr50_1883_c1
3504 nmdc:mga0rr50_309450_c1
3505 nmdc:mga0rr50_436178_c1
3506 nmdc:mga0rr50_451926_c1
3507 nmdc:mga0rr50_4708_c1
3508 nmdc:mga0rr50_496957_c1
3509 nmdc:mga0rr50_603694_c1
3510 nmdc:mga0rr50_70361_c1
3511 nmdc:mga0rr50_98517_c1
3512 nmdc:mga08x19_12242_c1
3513 nmdc:mga08x19_14593_c1
3514 nmdc:mga08x19_20353_c1
3515 nmdc:mga08x19_365_c1
3516 nmdc:mga08x19_39582_c1
3517 nmdc:mga08x19_53364_c1
3518 nmdc:mga08x19_59650_c1
3519 nmdc:mga08x19_87268_c1
3520 nmdc:mga08x19_95363_c1
3521 nmdc:mga0a205_10723_c1
3522 nmdc:mga0a205_137179_c1
3523 nmdc:mga0a205_16417_c1
3524 nmdc:mga0a205_245638_c1
3525 nmdc:mga0a205_256160_c1
3526 nmdc:mga0a205_260474_c1
3527 nmdc:mga0a205_263572_c1
3528 nmdc:mga0a205_287318_c1
3529 nmdc:mga0a205_34611_c1
3530 nmdc:mga0a205_357051_c1
3531 nmdc:mga0a205_390_c1
3532 nmdc:mga0a205_429315_c1
3533 nmdc:mga0a205_488289_c1
3534 nmdc:mga0a205_63533_c1
3535 nmdc:mga0a205_8807_c1
3536 Ga0495601_0016503
3537 Ga0495601_0460347
3538 Ga0495601_0493210
3539 Ga0495601_0562803
3540 Ga0495612_0246593
3541 Ga0495595_0015164
3542 Ga0495595_0466989
3543 Ga0495619_0027932
3544 Ga0495619_0032380
3545 Ga0495619_0100730
3546 Ga0495619_0495056
3547 Ga0495619_0518105
3548 Ga0500643_000257
3549 Ga0500568_0035391
3550 Ga0501084_0000159
3551 Ga0501084_0071866
3552 Ga0501084_0287098
3553 Ga0501084_0503695
3554 Ga0501084_0505832
3555 Ga0501084_1633105
3556 Ga0587084_041383
3557 Ga0587066_018738
3558 Ga0587073_0040134
3559 Ga0587080_092063
3560 Ga0587091_047439
3561 Ga0587072_062076
3562 Ga0587111_0035651
3563 Ga0587111_0078441
3564 Ga0587111_0283623
3565 Ga0501082_0002410
3566 Ga0501082_0485350
3567 Ga0501082_0650476
3568 Ga0530510_0002449
3569 Ga0530510_0125550
3570 Ga0530510_0194648
3571 Ga0530510_0298278
3572 Ga0530510_0357705
3573 Ga0530510_0392298
3574 Ga0530510_0860580

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00238

Ribosomal_L14

Ribosomal protein L14p/L23e

23

134

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
4v9a-assembly1.cif.gz_BN crystal structure of the 70s ribosome with tetracycline. 0.9959 1 122
7y41-assembly1.cif.gz_L mycobacterium smegmatis 50s ribosomal subunit from log phase of growth 0.9906 1 122
8fn2-assembly1.cif.gz_M the structure of a 50s ribosomal subunit in the lyme disease pathogen borreliella burgdorferi 0.9879 1 122
6n1d-assembly2.cif.gz_BL14 x-ray crystal complex showing spontaneous ribosomal translocation of mrna and trnas into a chimeric hybrid state 0.9875 1 122
8cvm-assembly1.cif.gz_j cutibacterium acnes 50s ribosomal subunit with p-site trna and sarecycline bound in the local refined map 0.9874 1 122
ID Description Score Start End Superfamily
6ddgW00 Mainly Beta;Beta Barrel;Ribosomal Protein L14;Ribosomal protein L14/L23 0.9827 2 121 2.40.150.20
6ddgW00 Mainly Beta;Beta Barrel;Ribosomal Protein L14;Ribosomal protein L14/L23 0.9747 2 121 2.40.150.20
3i1nK00 Mainly Beta;Beta Barrel;Ribosomal Protein L14;Ribosomal protein L14/L23 0.9509 1 121 2.40.150.20
1vw4I00 Mainly Beta;Beta Barrel;Ribosomal Protein L14;Ribosomal protein L14/L23 0.9437 1 122 2.40.150.20
1vw4I00 Mainly Beta;Beta Barrel;Ribosomal Protein L14;Ribosomal protein L14/L23 0.9362 1 122 2.40.150.20
ID Description Score Start End GO Terms
AF-A0A1M3KUM1-F1-model_v4 Large ribosomal subunit protein uL14 1.002 1 122 GO:0003735
GO:0006412
GO:0022625
GO:0070180
AF-A0A434CQN6-F1-model_v4 50S ribosomal protein L14 1.002 1 65 GO:0003735
GO:0006412
GO:0022625
GO:0070180
AF-W4SMQ2-F1-model_v4 50S ribosomal protein L14 1.002 1 61 GO:0003735
GO:0006412
GO:0022625
GO:0070180
AF-A0A1T4WGJ1-F1-model_v4 Large ribosomal subunit protein uL14 1.001 1 122 GO:0003735
GO:0006412
GO:0022625
GO:0070180
AF-E5Y766-F1-model_v4 Large ribosomal subunit protein uL14 1 1 122 GO:0003735
GO:0006412
GO:0022625
GO:0070180

Map