F495706
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1788 | 584 | 3577 | 252 |
Family's Representative Sequence
| Representative Sequence | 3300013306|Ga0163162_10250967|Ga0163162_102509672 |
| Length | 285 |
| Sequence | VRAGCPLRDLRDQDERKGTTRFVIFAITDERKNMRIDVVTLFPEFVENCARIGVVGRAQERGLLQVAAWNPRDYAHDNYRRVDDRPFGGGPGMVMLIDPLRETIAAARAAASEPASVIYLSPQGAQLTQEKVRELAQRPRLVLLCGRYEGVDERLIAKVVDEELSIGDYVLSGGELAAAVVIDAIGRLQEGALNDAQSAQQDSFSDGLLDCPHYTRPERHEWGEVPAVLTSGDHAAIGRWRRQQALGRTWLRRPELLGMMTLSKDDQKLLFEFQQLNDNSTDGPR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 2 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 3 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 4 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 5 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 6 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 7 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 8 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 9 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 10 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 11 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 12 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 13 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 14 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 15 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 16 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 17 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 18 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 19 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 20 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 21 | 3300003565 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_16_lowP_mix3_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 22 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 23 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 24 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 25 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 26 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 27 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 28 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 29 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 30 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 31 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 32 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 33 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 34 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 35 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 36 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 37 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 38 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 42 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 44 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 46 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 48 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 50 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 60 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 63 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 65 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 68 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 73 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 74 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 75 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 76 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 77 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 78 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 80 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 81 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 82 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 83 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 85 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 89 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 90 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 91 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 92 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 93 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 94 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 95 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 96 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 97 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 98 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 99 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 100 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 101 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 102 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 103 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 104 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 105 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 106 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 107 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 108 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 109 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 110 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 111 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 112 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 114 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 115 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 116 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 117 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 118 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 119 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 121 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 122 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300012502 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 | Metagenome | Rhizosphere |
| 135 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 145 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 148 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 149 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 150 | 3300015685 | Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 | Metagenome | Unclassified |
| 151 | 3300015687 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 | Metagenome | Rhizosphere |
| 152 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 153 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 154 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 155 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 156 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 157 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 158 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 159 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 160 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 161 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 162 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 163 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 164 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 165 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 166 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 167 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 168 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 169 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 170 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 171 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 172 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 173 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 174 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 175 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 176 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 177 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 178 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 179 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 180 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 181 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 182 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 183 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 184 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 185 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 186 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 187 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 188 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 189 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 251 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300027424 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 254 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 255 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 256 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 257 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 258 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 259 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 260 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 261 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 262 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 263 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 264 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 265 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 266 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 267 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 268 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 269 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 270 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 271 | 3300030734 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 | Metagenome | Rhizosphere |
| 272 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 273 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 274 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 275 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 276 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 277 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 278 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 279 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 280 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 281 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 282 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 283 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 284 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 285 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 286 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 287 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 288 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 289 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 290 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 291 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 292 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 293 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 294 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 295 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 296 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 297 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 298 | 3300033527 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 299 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 300 | 3300033529 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 301 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 302 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 303 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 304 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 305 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 306 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 307 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 308 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 309 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 310 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 311 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 312 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 313 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 314 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 315 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 316 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 317 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 318 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 319 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 320 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 321 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 322 | 3300038741 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 | Metagenome | Unclassified |
| 323 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 324 | 3300039110 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 | Metagenome | Unclassified |
| 325 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 326 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 327 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 328 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 329 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 330 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 331 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 332 | 3300041464 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaT | Metatranscriptome | Rhizoplane |
| 333 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 334 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 335 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 336 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 337 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 338 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 339 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 340 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 341 | 3300042129 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 | Metagenome | Rhizosphere |
| 342 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 343 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 344 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 345 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 346 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 347 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 348 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 349 | 3300044663 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA2E_TR | Metagenome | Unclassified |
| 350 | 3300044672 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E | Metagenome | Unclassified |
| 351 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 352 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 353 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 354 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 355 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 356 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 357 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 358 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 359 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 360 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 361 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 362 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 363 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 364 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 365 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 366 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 418 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 419 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 420 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 421 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 422 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 423 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 424 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 425 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 426 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 427 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 428 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 429 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 430 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 431 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 432 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 433 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 434 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 435 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 436 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 437 | 3300049128 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 438 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 439 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 440 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 441 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 442 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 443 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 444 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 445 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 446 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 447 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 448 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 449 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 450 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 451 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 452 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 453 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 454 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 455 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 456 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 457 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 458 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 459 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 460 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 461 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 462 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 463 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 464 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 465 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 466 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 467 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 468 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 469 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 470 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 471 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 472 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 473 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 474 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 475 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 476 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 477 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 478 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 479 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 480 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 481 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 482 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 483 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 484 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 485 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 486 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 487 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 488 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 489 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 490 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 491 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 492 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 493 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 494 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 495 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 496 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 497 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 498 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 499 | 3300059605 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 500 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 501 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 502 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 503 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 504 | 2511231006 | Pseudomonas sp. GM17 | Isolate | Nodule |
| 505 | 2511231015 | Pseudomonas sp. GM49 | Isolate | Nodule |
| 506 | 2511231023 | Pseudomonas sp. GM80 | Isolate | Nodule |
| 507 | 2511231031 | Pseudomonas sp. GM16 | Isolate | Nodule |
| 508 | 2512047018 | Pseudomonas chlororaphis chlororaphis GP72 | Isolate | Rhizosphere |
| 509 | 2513237150 | Cupriavidus taiwanensis STM6018 | Isolate | Nodule |
| 510 | 2513237165 | Cupriavidus neocaledonicus STM6070 | Isolate | Nodule |
| 511 | 2524614729 | Arenimonas oryziterrae YC6267, DSM 21050 | Isolate | Rhizosphere |
| 512 | 2537561836 | Rhodanobacter spathiphylli B39 | Isolate | Unclassified |
| 513 | 2554235341 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 514 | 2582580891 | Pseudomonas chlororaphis YL-1 | Isolate | Unclassified |
| 515 | 2593339238 | Luteibacter sp. UNCMF366Tsu5.1 | Isolate | Unclassified |
| 516 | 2593339239 | Luteibacter sp. UNCMF331Sha3.1 | Isolate | Unclassified |
| 517 | 2597489887 | Pseudomonas chlororaphis aureofaciens 30-84 | Isolate | Rhizosphere |
| 518 | 2599185185 | Pseudomonas sp. NFPP07 | Isolate | Rhizoplane |
| 519 | 2599185257 | Pseudomonas sp. NFACC41-3 | Isolate | Rhizoplane |
| 520 | 2600254931 | Pseudomonas sp. NFIX28 | Isolate | Rhizoplane |
| 521 | 2600254954 | Pseudomonas sp. NFACC19-2 | Isolate | Rhizoplane |
| 522 | 2600255389 | Pseudomonas sp. NFPP33 | Isolate | Rhizoplane |
| 523 | 2627854209 | Arenimonas oryziterrae YC6267, DSM 21050 | Isolate | Rhizosphere |
| 524 | 2643221562 | Rhodanobacter sp. Root561 | Isolate | Unclassified |
| 525 | 2643221577 | Rhodanobacter sp. Root627 | Isolate | Unclassified |
| 526 | 2643221603 | Noviherbaspirillum sp. Root189 | Isolate | Unclassified |
| 527 | 2643221685 | Rhodanobacter sp. Root480 | Isolate | Unclassified |
| 528 | 2671180172 | Pseudomonas sp. NFIX51 | Isolate | Rhizoplane |
| 529 | 2687453129 | Halotalea alkalilenta IHB B 13600 | Isolate | Unclassified |
| 530 | 2687453130 | Dyella thiooxydans ATSB10 | Isolate | Unclassified |
| 531 | 2713897148 | Pseudomonas fluorescens SF39a | Isolate | Rhizosphere |
| 532 | 2718217725 | Pseudomonas fluorescens CREA-C16 | Isolate | Rhizosphere |
| 533 | 2718218334 | Luteibacter rhizovicinus LJ96 | Isolate | Rhizosphere |
| 534 | 2734482264 | Dyella sp. AD052 | Isolate | Unclassified |
| 535 | 2738543009 | Luteibacter sp. OK325 | Isolate | Unclassified |
| 536 | 2738543025 | Pseudomonas sp. GV091 | Isolate | Unclassified |
| 537 | 2739367700 | Dyella sp. YR388 | Isolate | Unclassified |
| 538 | 2740892503 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 539 | 2808606379 | Pseudomonas sp. SJZ079 | Isolate | Rhizosphere |
| 540 | 2818991440 | Luteibacter yeojuensis 583 | Isolate | Unclassified |
| 541 | 2823421272 | Pseudomonas mendocina S5.2 | Isolate | Rhizoplane |
| 542 | 2842832357 | Pseudomonas sp. R-72164 | Isolate | Unclassified |
| 543 | 2842843487 | Pseudomonas sp. R-72074 | Isolate | Unclassified |
| 544 | 2842914999 | Luteibacter sp. R-72151 | Isolate | Unclassified |
| 545 | 2842918807 | Luteibacter sp. R-73110 | Isolate | Unclassified |
| 546 | 2846033681 | Chromobacterium sinusclupearum MWU13-2610 | Isolate | Rhizosphere |
| 547 | 2858688981 | Cupriavidus sp. UYMMa02A | Isolate | Unclassified |
| 548 | 2884338543 | Luteibacter pinisoli MAH-14 | Isolate | Rhizosphere |
| 549 | 2884411467 | Dyella sp. AD56 | Isolate | Rhizosphere |
| 550 | 2894414249 | Luteimonas sp. LNNU 24178 | Isolate | Rhizosphere |
| 551 | 2894510363 | Methylomonas sp. Kb3 | Isolate | Unclassified |
| 552 | 2895395659 | Rhodanobacter sp. T12-5 | Isolate | Unclassified |
| 553 | 2901300506 | Cupriavidus sp. UYMSc13B | Isolate | Unclassified |
| 554 | 2904463128 | Luteibacter yeojuensis 3191 | Isolate | Unclassified |
| 555 | 2919085039 | Luteibacter sp. 1214 | Isolate | Unclassified |
| 556 | 2919385768 | Pseudomonas sp. 2957 | Isolate | Unclassified |
| 557 | 2919404418 | Luteibacter sp. 3190 | Isolate | Unclassified |
| 558 | 2919487758 | Pseudomonas koreensis 3441 | Isolate | Unclassified |
| 559 | 2919501602 | Pseudomonas alcaliphila 3512 | Isolate | Unclassified |
| 560 | 2923153595 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 561 | 2926063275 | Pseudomonas sp. 3400 | Isolate | Unclassified |
| 562 | 2928963466 | Dyella japonica 1073 | Isolate | Unclassified |
| 563 | 2939611941 | Rhodanobacter soli 1757 | Isolate | Rhizosphere |
| 564 | 2941471342 | Luteibacter sp. 621 | Isolate | Unclassified |
| 565 | 2953994433 | Luteibacter sp. W1I16 | Isolate | Rhizosphere |
| 566 | 2969304461 | Pseudomonas sp. R84 | Isolate | Rhizosphere |
| 567 | 2974289157 | Pseudomonas fluorescens SORGH_AS 191 | Isolate | Unclassified |
| 568 | 2984286254 | Pseudomonas chlororaphis aurantiaca JD37 | Isolate | Rhizosphere |
| 569 | 2998139840 | Pseudomonas iranensis SWRI54 | Isolate | Rhizosphere |
| 570 | 2998344455 | Vogesella urethralis SLBN-145 | Isolate | Rhizosphere |
| 571 | 3007252601 | Pseudomonas punonensis D1-6 | Isolate | Unclassified |
| 572 | 3007315729 | Pseudomonas argentinensis SA190 | Isolate | Unclassified |
| 573 | 3007395558 | Pseudomonas chlororaphis PCL1601 | Isolate | Rhizosphere |
| 574 | 3007419365 | Pseudomonas vanderleydeniana RW8P3 | Isolate | Unclassified |
| 575 | 3007614139 | Pseudomonas sp. PB106 | Isolate | Unclassified |
| 576 | 3007855910 | Pseudomonas khorasanensis SWRI153 | Isolate | Rhizosphere |
| 577 | 3007861166 | Pseudomonas hamedanensis SWRI65 | Isolate | Rhizosphere |
| 578 | 644736347 | Cupriavidus taiwanensis LMG 19424 | Isolate | Nodule |
| 579 | 8002745576 | Marinomonas spartinae USM8 | Isolate | Rhizosphere |
| 580 | 8015687852 | Pseudomonas chlororaphis aurantiaca RP4 | Isolate | Rhizosphere |
| 581 | 8029995093 | Pseudomonas atacamensis SM1 | Isolate | Rhizosphere |
| 582 | 8034962539 | Pseudomonas sediminis PI11 | Isolate | Rhizosphere |
| 583 | 8055770955 | Pseudomonas chlororaphis qlu-1 | Isolate | Rhizosphere |
| 584 | 8056166840 | Pseudomonas triticicola SWRI88 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 91.33 |
| Metatranscriptomes | 4.14 |
| Isolates | 4.53 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 8.72 |
| Nodule | 0.56 |
| Rhizoplane | 1.96 |
| Rhizosphere | 80.82 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.22 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0163162_10250967 | 3300013306 | Bacteria | 1901 |
| 2 | JGI24736J21556_1006935 | 3300001904 | Bacteria | 1908 |
| 3 | JGI24736J21556_1010588 | 3300001904 | Bacteria | 1505 |
| 4 | JGI24741J21665_1001528 | 3300001915 | Bacteria | 6562 |
| 5 | JGI24741J21665_1004362 | 3300001915 | Bacteria | 3153 |
| 6 | JGI24741J21665_1009278 | 3300001915 | Bacteria | 1815 |
| 7 | JGI24740J21852_10001136 | 3300001979 | Bacteria | 12037 |
| 8 | JGI24740J21852_10003252 | 3300001979 | Bacteria | 7177 |
| 9 | JGI24740J21852_10003557 | 3300001979 | Bacteria | 6822 |
| 10 | JGI24739J22299_10002603 | 3300001989 | Bacteria | 6946 |
| 11 | JGI24739J22299_10007598 | 3300001989 | Bacteria | 4061 |
| 12 | JGI24737J22298_10000899 | 3300001990 | Bacteria | 10568 |
| 13 | JGI24735J21928_10011929 | 3300002067 | Bacteria | 2750 |
| 14 | JGI24744J21845_10016356 | 3300002077 | Bacteria | 1477 |
| 15 | JGI25156J39149_1004589 | 3300002705 | Bacteria | 4170 |
| 16 | JGI25156J39149_1010939 | 3300002705 | Bacteria | 2092 |
| 17 | JGI25162J39368_1000029 | 3300002737 | Bacteria | 220066 |
| 18 | JGI25162J39368_1000257 | 3300002737 | Bacteria | 50817 |
| 19 | JGI25162J39368_1000686 | 3300002737 | Bacteria | 23602 |
| 20 | JGI25162J39368_1005350 | 3300002737 | Bacteria | 2556 |
| 21 | JGI25162J39368_1006243 | 3300002737 | Bacteria | 2102 |
| 22 | JGI25154J39366_1002591 | 3300002738 | Bacteria | 4526 |
| 23 | JGI25157J39369_1000996 | 3300002741 | Bacteria | 13204 |
| 24 | JGI25157J39369_1001342 | 3300002741 | Bacteria | 9721 |
| 25 | JGI25157J39369_1001369 | 3300002741 | Bacteria | 9520 |
| 26 | JGI25157J39369_1002698 | 3300002741 | Bacteria | 4121 |
| 27 | JGI25163J39215_1000989 | 3300002771 | Bacteria | 6283 |
| 28 | JGI25164J39214_1000045 | 3300002772 | Bacteria | 125909 |
| 29 | JGI25164J39214_1000202 | 3300002772 | Bacteria | 50817 |
| 30 | JGI25164J39214_1001231 | 3300002772 | Bacteria | 6840 |
| 31 | JGI25151J46595_10002568 | 3300003187 | Bacteria | 10754 |
| 32 | JGI25151J46595_10011802 | 3300003187 | Bacteria | 4003 |
| 33 | JGI25151J46595_10024630 | 3300003187 | Bacteria | 2460 |
| 34 | JGI25165J46597_1000072 | 3300003214 | Bacteria | 192184 |
| 35 | JGI25165J46597_1000361 | 3300003214 | Bacteria | 50817 |
| 36 | JGI25165J46597_1002202 | 3300003214 | Bacteria | 6896 |
| 37 | JGI25153J46596_10043492 | 3300003215 | Bacteria | 1359 |
| 38 | rootH1_10003782 | 3300003316 | Bacteria | 1149 |
| 39 | rootH1_10003782 | 3300003323 | Bacteria | 43069 |
| 40 | rootH1_10052609 | 3300003316 | Bacteria | 2418 |
| 41 | rootH2_10001711 | 3300003320 | Bacteria | 8039 |
| 42 | rootL2_10105381 | 3300003322 | Bacteria | 1321 |
| 43 | Ga0006560J51390_1028717 | 3300003565 | Bacteria | 1532 |
| 44 | Ga0006562J51391_1014503 | 3300003578 | Bacteria | 8470 |
| 45 | Ga0006562J51391_1014504 | 3300003578 | Bacteria | 8150 |
| 46 | Ga0055538_1001576 | 3300003751 | Bacteria | 4171 |
| 47 | Ga0055533_1000617 | 3300003756 | Bacteria | 12010 |
| 48 | Ga0055533_1001801 | 3300003756 | Bacteria | 5386 |
| 49 | Ga0055525_1000027 | 3300003759 | Bacteria | 340506 |
| 50 | Ga0055527_1000293 | 3300003760 | Bacteria | 28864 |
| 51 | Ga0055527_1000294 | 3300003760 | Bacteria | 28742 |
| 52 | Ga0055527_1000694 | 3300003760 | Bacteria | 9781 |
| 53 | Ga0055535_1000623 | 3300003761 | Bacteria | 28693 |
| 54 | Ga0055535_1001746 | 3300003761 | Bacteria | 9711 |
| 55 | Ga0055535_1002327 | 3300003761 | Bacteria | 6896 |
| 56 | Ga0055535_1009433 | 3300003761 | Bacteria | 1683 |
| 57 | Ga0055535_1009450 | 3300003761 | Bacteria | 1680 |
| 58 | Ga0055542_1000329 | 3300003762 | Bacteria | 50369 |
| 59 | Ga0055542_1000649 | 3300003762 | Bacteria | 28693 |
| 60 | Ga0055542_1006140 | 3300003762 | Bacteria | 2606 |
| 61 | Ga0055542_1006760 | 3300003762 | Bacteria | 2412 |
| 62 | Ga0055542_1010547 | 3300003762 | Bacteria | 1683 |
| 63 | Ga0055542_1010580 | 3300003762 | Bacteria | 1680 |
| 64 | Ga0055529_1001508 | 3300003763 | Bacteria | 6779 |
| 65 | Ga0055529_1002348 | 3300003763 | Bacteria | 3743 |
| 66 | Ga0055529_1005126 | 3300003763 | Bacteria | 1927 |
| 67 | Ga0055529_1006206 | 3300003763 | Bacteria | 1683 |
| 68 | Ga0055529_1006222 | 3300003763 | Bacteria | 1680 |
| 69 | Ga0055526_1000580 | 3300003771 | Bacteria | 28731 |
| 70 | Ga0055526_1018820 | 3300003771 | Bacteria | 2553 |
| 71 | Ga0055526_1026663 | 3300003771 | Bacteria | 1813 |
| 72 | Ga0055537_1000822 | 3300003773 | Bacteria | 15242 |
| 73 | Ga0055524_1001415 | 3300003775 | Bacteria | 13811 |
| 74 | Ga0055524_1003597 | 3300003775 | Bacteria | 7473 |
| 75 | Ga0055524_1013467 | 3300003775 | Bacteria | 3082 |
| 76 | Ga0055536_1000020 | 3300003781 | Bacteria | 199649 |
| 77 | Ga0055534_1000601 | 3300003784 | Bacteria | 18680 |
| 78 | Ga0055534_1001148 | 3300003784 | Bacteria | 11208 |
| 79 | Ga0055534_1003594 | 3300003784 | Bacteria | 4820 |
| 80 | Ga0055528_1000050 | 3300003790 | Bacteria | 93078 |
| 81 | Ga0055540_1025844 | 3300003792 | Bacteria | 1430 |
| 82 | Ga0065165_1000587 | 3300005262 | Bacteria | 53507 |
| 83 | Ga0065165_1003615 | 3300005262 | Bacteria | 10615 |
| 84 | Ga0070658_10004423 | 3300005327 | Bacteria | 11448 |
| 85 | Ga0070658_10079714 | 3300005327 | Bacteria | 2689 |
| 86 | Ga0070658_10131004 | 3300005327 | Bacteria | 2090 |
| 87 | Ga0070658_10297438 | 3300005327 | Bacteria | 1376 |
| 88 | Ga0070658_10325742 | 3300005327 | Bacteria | 1312 |
| 89 | Ga0070658_10400607 | 3300005327 | Bacteria | 1179 |
| 90 | Ga0070658_10518964 | 3300005327 | Bacteria | 1030 |
| 91 | Ga0070658_10694702 | 3300005327 | Bacteria | 883 |
| 92 | Ga0070676_10000078 | 3300005328 | Bacteria | 33251 |
| 93 | Ga0070676_10059283 | 3300005328 | Bacteria | 2270 |
| 94 | Ga0070683_100119371 | 3300005329 | Bacteria | 2490 |
| 95 | Ga0070683_100128406 | 3300005329 | Bacteria | 2398 |
| 96 | Ga0070683_100184171 | 3300005329 | Bacteria | 1982 |
| 97 | Ga0070683_100187357 | 3300005329 | Bacteria | 1964 |
| 98 | Ga0070683_100318777 | 3300005329 | Bacteria | 1479 |
| 99 | Ga0070683_100343947 | 3300005329 | Bacteria | 1420 |
| 100 | Ga0070690_100204832 | 3300005330 | Bacteria | 1374 |
| 101 | Ga0070690_100205152 | 3300005330 | Bacteria | 1373 |
| 102 | Ga0070670_100009753 | 3300005331 | Bacteria | 8201 |
| 103 | Ga0070670_100150273 | 3300005331 | Bacteria | 2016 |
| 104 | Ga0070670_100366514 | 3300005331 | Bacteria | 1267 |
| 105 | Ga0068869_100000679 | 3300005334 | Bacteria | 19236 |
| 106 | Ga0068869_100046919 | 3300005334 | Bacteria | 3117 |
| 107 | Ga0068869_100223687 | 3300005334 | Bacteria | 1493 |
| 108 | Ga0070666_10000005 | 3300005335 | Bacteria | 343092 |
| 109 | Ga0070666_10000109 | 3300005335 | Bacteria | 56796 |
| 110 | Ga0070666_10003252 | 3300005335 | Bacteria | 9869 |
| 111 | Ga0070666_10216277 | 3300005335 | Bacteria | 1351 |
| 112 | Ga0070680_100002566 | 3300005336 | Bacteria | 13435 |
| 113 | Ga0070680_100035951 | 3300005336 | Bacteria | 4000 |
| 114 | Ga0070680_100085679 | 3300005336 | Bacteria | 2603 |
| 115 | Ga0070680_100100598 | 3300005336 | Bacteria | 2399 |
| 116 | Ga0070680_100150299 | 3300005336 | Bacteria | 1955 |
| 117 | Ga0070680_100227890 | 3300005336 | Bacteria | 1573 |
| 118 | Ga0070680_100600616 | 3300005336 | Bacteria | 944 |
| 119 | Ga0070682_100001048 | 3300005337 | Bacteria | 15991 |
| 120 | Ga0070682_100005998 | 3300005337 | Bacteria | 6800 |
| 121 | Ga0070682_100011654 | 3300005337 | Bacteria | 5029 |
| 122 | Ga0070682_100014093 | 3300005337 | Bacteria | 4616 |
| 123 | Ga0070682_100026910 | 3300005337 | Bacteria | 3446 |
| 124 | Ga0070682_100103446 | 3300005337 | Bacteria | 1884 |
| 125 | Ga0070682_100265407 | 3300005337 | Bacteria | 1244 |
| 126 | Ga0068868_100005961 | 3300005338 | Bacteria | 8596 |
| 127 | Ga0068868_100045091 | 3300005338 | Bacteria | 3449 |
| 128 | Ga0068868_100145667 | 3300005338 | Bacteria | 1947 |
| 129 | Ga0068868_100183755 | 3300005338 | Bacteria | 1736 |
| 130 | Ga0070660_100000369 | 3300005339 | Bacteria | 30058 |
| 131 | Ga0070660_100035972 | 3300005339 | Bacteria | 3749 |
| 132 | Ga0070660_100166347 | 3300005339 | Bacteria | 1779 |
| 133 | Ga0070660_100206953 | 3300005339 | Bacteria | 1592 |
| 134 | Ga0070689_100000503 | 3300005340 | Bacteria | 23097 |
| 135 | Ga0070689_100463040 | 3300005340 | Bacteria | 1081 |
| 136 | Ga0070691_10003685 | 3300005341 | Bacteria | 6921 |
| 137 | Ga0070691_10004460 | 3300005341 | Bacteria | 6359 |
| 138 | Ga0070691_10103569 | 3300005341 | Bacteria | 1416 |
| 139 | Ga0070691_10119729 | 3300005341 | Bacteria | 1324 |
| 140 | Ga0070691_10122129 | 3300005341 | Bacteria | 1312 |
| 141 | Ga0070661_100000449 | 3300005344 | Bacteria | 31415 |
| 142 | Ga0070661_100011087 | 3300005344 | Bacteria | 6277 |
| 143 | Ga0070661_100027110 | 3300005344 | Bacteria | 4124 |
| 144 | Ga0070661_100031058 | 3300005344 | Bacteria | 3862 |
| 145 | Ga0070661_100037672 | 3300005344 | Bacteria | 3518 |
| 146 | Ga0070661_100043927 | 3300005344 | Bacteria | 3264 |
| 147 | Ga0070661_100132250 | 3300005344 | Bacteria | 1875 |
| 148 | Ga0070661_100165830 | 3300005344 | Bacteria | 1675 |
| 149 | Ga0070661_100673044 | 3300005344 | Bacteria | 841 |
| 150 | Ga0070692_10001584 | 3300005345 | Bacteria | 8354 |
| 151 | Ga0070692_10015943 | 3300005345 | Bacteria | 3565 |
| 152 | Ga0070692_10018107 | 3300005345 | Bacteria | 3381 |
| 153 | Ga0070692_10088543 | 3300005345 | Bacteria | 1679 |
| 154 | Ga0070668_100013598 | 3300005347 | Bacteria | 6077 |
| 155 | Ga0070668_100030062 | 3300005347 | Bacteria | 4129 |
| 156 | Ga0070668_100068441 | 3300005347 | Bacteria | 2759 |
| 157 | Ga0070668_100112657 | 3300005347 | Bacteria | 2166 |
| 158 | Ga0070668_100193652 | 3300005347 | Bacteria | 1666 |
| 159 | Ga0070668_100421454 | 3300005347 | Bacteria | 1143 |
| 160 | Ga0070669_100068181 | 3300005353 | Bacteria | 2625 |
| 161 | Ga0070669_100071564 | 3300005353 | Bacteria | 2566 |
| 162 | Ga0070669_100197913 | 3300005353 | Bacteria | 1580 |
| 163 | Ga0070675_100067894 | 3300005354 | Bacteria | 2951 |
| 164 | Ga0070675_100106792 | 3300005354 | Bacteria | 2363 |
| 165 | Ga0070675_100293549 | 3300005354 | Bacteria | 1431 |
| 166 | Ga0070671_100070009 | 3300005355 | Bacteria | 2926 |
| 167 | Ga0070671_100141142 | 3300005355 | Bacteria | 2033 |
| 168 | Ga0070671_100183076 | 3300005355 | Bacteria | 1774 |
| 169 | Ga0070674_100231432 | 3300005356 | Bacteria | 1442 |
| 170 | Ga0070674_100520571 | 3300005356 | Bacteria | 993 |
| 171 | Ga0070673_100033543 | 3300005364 | Bacteria | 3878 |
| 172 | Ga0070673_100073836 | 3300005364 | Bacteria | 2747 |
| 173 | Ga0070673_100266670 | 3300005364 | Bacteria | 1498 |
| 174 | Ga0070688_100109365 | 3300005365 | Bacteria | 1836 |
| 175 | Ga0070688_100376323 | 3300005365 | Bacteria | 1046 |
| 176 | Ga0070659_100003864 | 3300005366 | Bacteria | 10672 |
| 177 | Ga0070659_100035435 | 3300005366 | Bacteria | 3886 |
| 178 | Ga0070659_100109214 | 3300005366 | Bacteria | 2232 |
| 179 | Ga0070659_100179434 | 3300005366 | Bacteria | 1737 |
| 180 | Ga0070659_100196476 | 3300005366 | Bacteria | 1659 |
| 181 | Ga0070659_100277474 | 3300005366 | Bacteria | 1394 |
| 182 | Ga0070659_100283525 | 3300005366 | Bacteria | 1378 |
| 183 | Ga0070667_100000005 | 3300005367 | Bacteria | 347268 |
| 184 | Ga0070667_100011088 | 3300005367 | Bacteria | 7456 |
| 185 | Ga0070667_100018821 | 3300005367 | Bacteria | 5728 |
| 186 | Ga0070667_100036335 | 3300005367 | Bacteria | 4130 |
| 187 | Ga0070667_100258782 | 3300005367 | Bacteria | 1558 |
| 188 | Ga0070667_100307674 | 3300005367 | Bacteria | 1428 |
| 189 | Ga0070667_100321454 | 3300005367 | Bacteria | 1396 |
| 190 | Ga0070667_100334108 | 3300005367 | Bacteria | 1369 |
| 191 | Ga0070703_10012638 | 3300005406 | Bacteria | 2393 |
| 192 | Ga0070714_100035856 | 3300005435 | Bacteria | 4158 |
| 193 | Ga0070714_100115600 | 3300005435 | Bacteria | 2381 |
| 194 | Ga0070713_100002641 | 3300005436 | Bacteria | 11680 |
| 195 | Ga0070711_100190947 | 3300005439 | Bacteria | 1574 |
| 196 | Ga0070705_100000292 | 3300005440 | Bacteria | 29837 |
| 197 | Ga0070694_100088104 | 3300005444 | Bacteria | 2173 |
| 198 | Ga0070694_100115209 | 3300005444 | Bacteria | 1920 |
| 199 | Ga0070708_100018903 | 3300005445 | Bacteria | 5774 |
| 200 | Ga0070708_100323608 | 3300005445 | Bacteria | 1452 |
| 201 | Ga0070708_100414067 | 3300005445 | Bacteria | 1271 |
| 202 | Ga0070708_100644124 | 3300005445 | Bacteria | 999 |
| 203 | Ga0070663_100001614 | 3300005455 | Bacteria | 12448 |
| 204 | Ga0070663_100002590 | 3300005455 | Bacteria | 10218 |
| 205 | Ga0070663_100003691 | 3300005455 | Bacteria | 8879 |
| 206 | Ga0070663_100003836 | 3300005455 | Bacteria | 8749 |
| 207 | Ga0070663_100023092 | 3300005455 | Bacteria | 4164 |
| 208 | Ga0070663_100027969 | 3300005455 | Bacteria | 3834 |
| 209 | Ga0070663_100094637 | 3300005455 | Bacteria | 2219 |
| 210 | Ga0070663_100226957 | 3300005455 | Bacteria | 1469 |
| 211 | Ga0070663_100287362 | 3300005455 | Bacteria | 1312 |
| 212 | Ga0070663_100411181 | 3300005455 | Bacteria | 1108 |
| 213 | Ga0070663_100795687 | 3300005455 | Bacteria | 810 |
| 214 | Ga0070678_100032720 | 3300005456 | Bacteria | 3602 |
| 215 | Ga0070678_100068406 | 3300005456 | Bacteria | 2647 |
| 216 | Ga0070662_100001136 | 3300005457 | Bacteria | 16279 |
| 217 | Ga0070662_100043134 | 3300005457 | Bacteria | 3226 |
| 218 | Ga0070662_100050898 | 3300005457 | Bacteria | 2989 |
| 219 | Ga0070662_100066979 | 3300005457 | Bacteria | 2636 |
| 220 | Ga0070662_100143413 | 3300005457 | Bacteria | 1853 |
| 221 | Ga0070662_100171880 | 3300005457 | Bacteria | 1702 |
| 222 | Ga0070681_10000122 | 3300005458 | Bacteria | 58332 |
| 223 | Ga0070681_10003994 | 3300005458 | Bacteria | 13915 |
| 224 | Ga0070681_10004905 | 3300005458 | Bacteria | 12843 |
| 225 | Ga0070681_10044503 | 3300005458 | Bacteria | 4443 |
| 226 | Ga0070681_10114722 | 3300005458 | Bacteria | 2632 |
| 227 | Ga0070681_10121667 | 3300005458 | Bacteria | 2544 |
| 228 | Ga0070681_10187020 | 3300005458 | Bacteria | 1991 |
| 229 | Ga0070681_10348376 | 3300005458 | Bacteria | 1391 |
| 230 | Ga0070681_10415251 | 3300005458 | Bacteria | 1257 |
| 231 | Ga0070681_10453641 | 3300005458 | Bacteria | 1194 |
| 232 | Ga0068867_100002791 | 3300005459 | Bacteria | 12281 |
| 233 | Ga0068867_100014624 | 3300005459 | Bacteria | 5561 |
| 234 | Ga0068867_100117777 | 3300005459 | Bacteria | 2048 |
| 235 | Ga0068867_100273716 | 3300005459 | Bacteria | 1382 |
| 236 | Ga0068867_100285344 | 3300005459 | Bacteria | 1355 |
| 237 | Ga0070685_10007066 | 3300005466 | Bacteria | 5733 |
| 238 | Ga0070685_10052180 | 3300005466 | Bacteria | 2366 |
| 239 | Ga0070706_100015314 | 3300005467 | Bacteria | 7080 |
| 240 | Ga0070706_100054339 | 3300005467 | Bacteria | 3696 |
| 241 | Ga0070706_100067931 | 3300005467 | Bacteria | 3296 |
| 242 | Ga0070707_100080966 | 3300005468 | Bacteria | 3135 |
| 243 | Ga0070698_100012924 | 3300005471 | Bacteria | 8839 |
| 244 | Ga0070698_100041165 | 3300005471 | Bacteria | 4744 |
| 245 | Ga0070699_100024294 | 3300005518 | Bacteria | 5221 |
| 246 | Ga0070699_100032858 | 3300005518 | Bacteria | 4482 |
| 247 | Ga0070699_100102912 | 3300005518 | Bacteria | 2504 |
| 248 | Ga0070679_100001153 | 3300005530 | Bacteria | 23132 |
| 249 | Ga0070679_100001205 | 3300005530 | Bacteria | 22763 |
| 250 | Ga0070679_100006031 | 3300005530 | Bacteria | 11275 |
| 251 | Ga0070679_100029564 | 3300005530 | Bacteria | 5406 |
| 252 | Ga0070679_100082714 | 3300005530 | Bacteria | 3200 |
| 253 | Ga0070679_100157157 | 3300005530 | Bacteria | 2248 |
| 254 | Ga0070679_100434738 | 3300005530 | Bacteria | 1257 |
| 255 | Ga0070684_100004922 | 3300005535 | Bacteria | 10196 |
| 256 | Ga0070684_100131879 | 3300005535 | Bacteria | 2254 |
| 257 | Ga0070684_100256986 | 3300005535 | Bacteria | 1597 |
| 258 | Ga0070697_100000561 | 3300005536 | Bacteria | 27986 |
| 259 | Ga0070697_100017353 | 3300005536 | Bacteria | 5662 |
| 260 | Ga0070697_100031854 | 3300005536 | Bacteria | 4243 |
| 261 | Ga0070697_100228890 | 3300005536 | Bacteria | 1585 |
| 262 | Ga0068853_100003605 | 3300005539 | Bacteria | 11857 |
| 263 | Ga0068853_100015685 | 3300005539 | Bacteria | 6223 |
| 264 | Ga0068853_100030340 | 3300005539 | Bacteria | 4566 |
| 265 | Ga0068853_100030487 | 3300005539 | Bacteria | 4555 |
| 266 | Ga0068853_100060929 | 3300005539 | Bacteria | 3262 |
| 267 | Ga0068853_100062449 | 3300005539 | Bacteria | 3224 |
| 268 | Ga0068853_100097425 | 3300005539 | Bacteria | 2596 |
| 269 | Ga0068853_100098452 | 3300005539 | Bacteria | 2582 |
| 270 | Ga0068853_100136503 | 3300005539 | Bacteria | 2199 |
| 271 | Ga0068853_100139695 | 3300005539 | Bacteria | 2174 |
| 272 | Ga0068853_100307837 | 3300005539 | Bacteria | 1466 |
| 273 | Ga0068853_100487258 | 3300005539 | Bacteria | 1163 |
| 274 | Ga0070672_100015511 | 3300005543 | Bacteria | 5428 |
| 275 | Ga0070672_100022870 | 3300005543 | Bacteria | 4599 |
| 276 | Ga0070672_100071348 | 3300005543 | Bacteria | 2763 |
| 277 | Ga0070672_100107701 | 3300005543 | Bacteria | 2268 |
| 278 | Ga0070672_100161959 | 3300005543 | Bacteria | 1857 |
| 279 | Ga0070672_100288116 | 3300005543 | Bacteria | 1390 |
| 280 | Ga0070695_100018060 | 3300005545 | Bacteria | 4282 |
| 281 | Ga0070695_100092135 | 3300005545 | Bacteria | 2025 |
| 282 | Ga0070695_100120739 | 3300005545 | Bacteria | 1792 |
| 283 | Ga0070696_100000277 | 3300005546 | Bacteria | 30739 |
| 284 | Ga0070696_100002542 | 3300005546 | Bacteria | 12087 |
| 285 | Ga0070696_100014375 | 3300005546 | Bacteria | 5311 |
| 286 | Ga0070696_100031811 | 3300005546 | Bacteria | 3618 |
| 287 | Ga0070696_100043559 | 3300005546 | Bacteria | 3105 |
| 288 | Ga0070696_100044652 | 3300005546 | Bacteria | 3068 |
| 289 | Ga0070696_100069181 | 3300005546 | Bacteria | 2480 |
| 290 | Ga0070696_100210264 | 3300005546 | Bacteria | 1456 |
| 291 | Ga0070693_100000692 | 3300005547 | Bacteria | 14930 |
| 292 | Ga0070693_100012046 | 3300005547 | Bacteria | 4367 |
| 293 | Ga0070693_100020805 | 3300005547 | Bacteria | 3468 |
| 294 | Ga0070693_100029136 | 3300005547 | Bacteria | 3008 |
| 295 | Ga0070693_100081272 | 3300005547 | Bacteria | 1932 |
| 296 | Ga0070693_100204112 | 3300005547 | Bacteria | 1285 |
| 297 | Ga0070665_100000057 | 3300005548 | Bacteria | 237271 |
| 298 | Ga0070665_100000838 | 3300005548 | Bacteria | 40099 |
| 299 | Ga0070665_100041503 | 3300005548 | Bacteria | 4625 |
| 300 | Ga0070665_100146563 | 3300005548 | Bacteria | 2363 |
| 301 | Ga0070665_100217554 | 3300005548 | Bacteria | 1911 |
| 302 | Ga0070665_100250182 | 3300005548 | Bacteria | 1773 |
| 303 | Ga0070665_100317672 | 3300005548 | Bacteria | 1562 |
| 304 | Ga0070665_100499306 | 3300005548 | Bacteria | 1228 |
| 305 | Ga0070704_100000361 | 3300005549 | Bacteria | 20630 |
| 306 | Ga0068855_100000559 | 3300005563 | Bacteria | 45612 |
| 307 | Ga0068855_100002399 | 3300005563 | Bacteria | 23114 |
| 308 | Ga0068855_100024413 | 3300005563 | Bacteria | 7232 |
| 309 | Ga0068855_100034536 | 3300005563 | Bacteria | 6029 |
| 310 | Ga0068855_100100139 | 3300005563 | Bacteria | 3337 |
| 311 | Ga0068855_100155534 | 3300005563 | Bacteria | 2598 |
| 312 | Ga0068855_100159346 | 3300005563 | Bacteria | 2563 |
| 313 | Ga0068855_100293923 | 3300005563 | Bacteria | 1800 |
| 314 | Ga0068855_100360132 | 3300005563 | Bacteria | 1601 |
| 315 | Ga0070664_100002942 | 3300005564 | Bacteria | 13771 |
| 316 | Ga0070664_100060997 | 3300005564 | Bacteria | 3213 |
| 317 | Ga0070664_100074821 | 3300005564 | Bacteria | 2907 |
| 318 | Ga0068857_100000591 | 3300005577 | Bacteria | 26568 |
| 319 | Ga0068857_100005102 | 3300005577 | Bacteria | 11164 |
| 320 | Ga0068857_100026022 | 3300005577 | Bacteria | 5153 |
| 321 | Ga0068857_100040303 | 3300005577 | Bacteria | 4141 |
| 322 | Ga0068857_100244529 | 3300005577 | Bacteria | 1643 |
| 323 | Ga0068857_100284186 | 3300005577 | Bacteria | 1522 |
| 324 | Ga0068857_100454352 | 3300005577 | Bacteria | 1198 |
| 325 | Ga0068854_100000497 | 3300005578 | Bacteria | 23919 |
| 326 | Ga0068854_100010672 | 3300005578 | Bacteria | 5962 |
| 327 | Ga0068854_100047075 | 3300005578 | Bacteria | 3073 |
| 328 | Ga0068854_100204707 | 3300005578 | Bacteria | 1553 |
| 329 | Ga0068854_100226578 | 3300005578 | Bacteria | 1481 |
| 330 | Ga0068856_100000940 | 3300005614 | Bacteria | 31221 |
| 331 | Ga0068856_100001887 | 3300005614 | Bacteria | 21829 |
| 332 | Ga0068856_100008425 | 3300005614 | Bacteria | 10039 |
| 333 | Ga0068856_100049386 | 3300005614 | Bacteria | 4147 |
| 334 | Ga0068856_100055647 | 3300005614 | Bacteria | 3904 |
| 335 | Ga0068856_100126308 | 3300005614 | Bacteria | 2561 |
| 336 | Ga0068856_100144506 | 3300005614 | Bacteria | 2386 |
| 337 | Ga0068856_100219979 | 3300005614 | Bacteria | 1914 |
| 338 | Ga0068856_100221061 | 3300005614 | Bacteria | 1909 |
| 339 | Ga0068856_100310128 | 3300005614 | Bacteria | 1595 |
| 340 | Ga0068856_100323501 | 3300005614 | Bacteria | 1559 |
| 341 | Ga0068856_100547304 | 3300005614 | Bacteria | 1178 |
| 342 | Ga0070702_100279397 | 3300005615 | Bacteria | 1146 |
| 343 | Ga0068852_100020193 | 3300005616 | Bacteria | 5293 |
| 344 | Ga0068852_100038168 | 3300005616 | Bacteria | 4035 |
| 345 | Ga0068852_100056139 | 3300005616 | Bacteria | 3402 |
| 346 | Ga0068852_100167375 | 3300005616 | Bacteria | 2058 |
| 347 | Ga0068852_100189399 | 3300005616 | Bacteria | 1940 |
| 348 | Ga0068852_100298511 | 3300005616 | Bacteria | 1558 |
| 349 | Ga0068852_100345723 | 3300005616 | Bacteria | 1451 |
| 350 | Ga0068852_100354288 | 3300005616 | Bacteria | 1434 |
| 351 | Ga0068852_100424242 | 3300005616 | Bacteria | 1312 |
| 352 | Ga0068852_100435473 | 3300005616 | Bacteria | 1295 |
| 353 | Ga0068859_100001188 | 3300005617 | Bacteria | 26597 |
| 354 | Ga0068859_100003247 | 3300005617 | Bacteria | 16553 |
| 355 | Ga0068859_100038947 | 3300005617 | Bacteria | 4768 |
| 356 | Ga0068859_100183596 | 3300005617 | Bacteria | 2175 |
| 357 | Ga0068859_100583789 | 3300005617 | Bacteria | 1211 |
| 358 | Ga0068864_100015261 | 3300005618 | Bacteria | 6388 |
| 359 | Ga0068864_100137235 | 3300005618 | Bacteria | 2203 |
| 360 | Ga0068864_100171677 | 3300005618 | Bacteria | 1977 |
| 361 | Ga0068864_100208859 | 3300005618 | Bacteria | 1797 |
| 362 | Ga0068861_100006592 | 3300005719 | Bacteria | 7925 |
| 363 | Ga0068861_100054679 | 3300005719 | Bacteria | 3042 |
| 364 | Ga0068861_100271260 | 3300005719 | Bacteria | 1457 |
| 365 | Ga0068851_10001445 | 3300005834 | Bacteria | 10399 |
| 366 | Ga0068851_10016464 | 3300005834 | Bacteria | 3537 |
| 367 | Ga0068851_10139662 | 3300005834 | Bacteria | 1317 |
| 368 | Ga0068851_10248850 | 3300005834 | Bacteria | 1007 |
| 369 | Ga0068870_10000438 | 3300005840 | Bacteria | 15777 |
| 370 | Ga0068863_100010303 | 3300005841 | Bacteria | 9082 |
| 371 | Ga0068863_100090958 | 3300005841 | Bacteria | 2894 |
| 372 | Ga0068863_100235473 | 3300005841 | Bacteria | 1767 |
| 373 | Ga0068863_100518929 | 3300005841 | Bacteria | 1175 |
| 374 | Ga0068863_100660228 | 3300005841 | Bacteria | 1037 |
| 375 | Ga0068858_100001163 | 3300005842 | Bacteria | 27276 |
| 376 | Ga0068858_100023895 | 3300005842 | Bacteria | 5695 |
| 377 | Ga0068858_100024853 | 3300005842 | Bacteria | 5578 |
| 378 | Ga0068858_100038899 | 3300005842 | Bacteria | 4412 |
| 379 | Ga0068858_100220414 | 3300005842 | Bacteria | 1796 |
| 380 | Ga0068858_100361783 | 3300005842 | Bacteria | 1391 |
| 381 | Ga0068858_100448019 | 3300005842 | Bacteria | 1244 |
| 382 | Ga0068860_100009879 | 3300005843 | Bacteria | 9461 |
| 383 | Ga0068860_100011610 | 3300005843 | Bacteria | 8688 |
| 384 | Ga0068860_100012175 | 3300005843 | Bacteria | 8474 |
| 385 | Ga0068860_100052752 | 3300005843 | Bacteria | 3867 |
| 386 | Ga0068860_100471054 | 3300005843 | Bacteria | 1251 |
| 387 | Ga0068860_100499246 | 3300005843 | Bacteria | 1214 |
| 388 | Ga0068860_100653003 | 3300005843 | Bacteria | 1060 |
| 389 | Ga0068862_100003503 | 3300005844 | Bacteria | 13478 |
| 390 | Ga0068862_100023439 | 3300005844 | Bacteria | 5171 |
| 391 | Ga0068862_100046061 | 3300005844 | Bacteria | 3722 |
| 392 | Ga0068862_100048171 | 3300005844 | Bacteria | 3638 |
| 393 | Ga0068862_100248880 | 3300005844 | Bacteria | 1619 |
| 394 | Ga0081455_10029994 | 3300005937 | Bacteria | 4949 |
| 395 | Ga0081455_10048313 | 3300005937 | Bacteria | 3678 |
| 396 | Ga0081540_1000778 | 3300005983 | Bacteria | 29291 |
| 397 | Ga0081540_1002617 | 3300005983 | Bacteria | 14627 |
| 398 | Ga0081539_10004036 | 3300005985 | Bacteria | 16839 |
| 399 | Ga0070717_10356078 | 3300006028 | Bacteria | 1309 |
| 400 | Ga0075363_100042233 | 3300006048 | Bacteria | 2408 |
| 401 | Ga0075369_10005288 | 3300006186 | Bacteria | 4813 |
| 402 | Ga0075366_10203433 | 3300006195 | Bacteria | 1204 |
| 403 | Ga0097621_100061006 | 3300006237 | Bacteria | 3092 |
| 404 | Ga0097621_100065210 | 3300006237 | Bacteria | 2996 |
| 405 | Ga0097621_100087245 | 3300006237 | Bacteria | 2605 |
| 406 | Ga0097621_100121627 | 3300006237 | Bacteria | 2214 |
| 407 | Ga0097621_100166539 | 3300006237 | Bacteria | 1897 |
| 408 | Ga0097621_100180020 | 3300006237 | Bacteria | 1826 |
| 409 | Ga0068871_100029228 | 3300006358 | Bacteria | 4327 |
| 410 | Ga0068871_100043867 | 3300006358 | Bacteria | 3593 |
| 411 | Ga0068871_100099326 | 3300006358 | Bacteria | 2436 |
| 412 | Ga0075428_100259142 | 3300006844 | Bacteria | 1873 |
| 413 | Ga0075433_10005758 | 3300006852 | Bacteria | 9751 |
| 414 | Ga0075433_10072430 | 3300006852 | Bacteria | 3030 |
| 415 | Ga0075434_100080191 | 3300006871 | Bacteria | 3260 |
| 416 | Ga0075434_100102288 | 3300006871 | Bacteria | 2873 |
| 417 | Ga0068865_100115381 | 3300006881 | Bacteria | 1987 |
| 418 | Ga0068865_100171583 | 3300006881 | Bacteria | 1663 |
| 419 | Ga0068865_100237310 | 3300006881 | Bacteria | 1433 |
| 420 | Ga0075436_100170331 | 3300006914 | Bacteria | 1537 |
| 421 | Ga0097620_100001188 | 3300006931 | Bacteria | 26597 |
| 422 | Ga0097620_100003247 | 3300006931 | Bacteria | 16553 |
| 423 | Ga0097620_100038946 | 3300006931 | Bacteria | 4768 |
| 424 | Ga0097620_100183608 | 3300006931 | Bacteria | 2175 |
| 425 | Ga0097620_100583927 | 3300006931 | Bacteria | 1211 |
| 426 | Ga0099826_10000004 | 3300006948 | Bacteria | 802669 |
| 427 | Ga0099794_10018520 | 3300007265 | Bacteria | 3124 |
| 428 | Ga0099794_10023823 | 3300007265 | Bacteria | 2804 |
| 429 | Ga0105244_10085977 | 3300009036 | Bacteria | 1551 |
| 430 | Ga0105240_10000931 | 3300009093 | Bacteria | 52113 |
| 431 | Ga0105240_10014485 | 3300009093 | Bacteria | 10766 |
| 432 | Ga0105240_10018571 | 3300009093 | Bacteria | 9332 |
| 433 | Ga0105240_10038619 | 3300009093 | Bacteria | 6122 |
| 434 | Ga0105240_10077509 | 3300009093 | Bacteria | 4094 |
| 435 | Ga0105240_10130805 | 3300009093 | Bacteria | 3011 |
| 436 | Ga0105240_10171297 | 3300009093 | Bacteria | 2571 |
| 437 | Ga0105240_10301359 | 3300009093 | Bacteria | 1833 |
| 438 | Ga0105240_10384666 | 3300009093 | Bacteria | 1584 |
| 439 | Ga0105240_10525973 | 3300009093 | Bacteria | 1312 |
| 440 | Ga0105240_10611385 | 3300009093 | Bacteria | 1199 |
| 441 | Ga0105245_10058222 | 3300009098 | Bacteria | 3477 |
| 442 | Ga0105245_10176080 | 3300009098 | Bacteria | 2040 |
| 443 | Ga0105245_10368152 | 3300009098 | Bacteria | 1428 |
| 444 | Ga0105245_10579081 | 3300009098 | Bacteria | 1147 |
| 445 | Ga0105245_10754806 | 3300009098 | Bacteria | 1009 |
| 446 | Ga0114129_10079228 | 3300009147 | Bacteria | 4568 |
| 447 | Ga0114129_10118723 | 3300009147 | Bacteria | 3643 |
| 448 | Ga0114129_10176245 | 3300009147 | Bacteria | 2912 |
| 449 | Ga0105243_10247287 | 3300009148 | Bacteria | 1590 |
| 450 | Ga0105243_10871699 | 3300009148 | Bacteria | 893 |
| 451 | Ga0105241_10000966 | 3300009174 | Bacteria | 21742 |
| 452 | Ga0105241_10034302 | 3300009174 | Bacteria | 3812 |
| 453 | Ga0105241_10107632 | 3300009174 | Bacteria | 2227 |
| 454 | Ga0105241_10141839 | 3300009174 | Bacteria | 1957 |
| 455 | Ga0105241_10183109 | 3300009174 | Bacteria | 1739 |
| 456 | Ga0105242_10000940 | 3300009176 | Bacteria | 22701 |
| 457 | Ga0105248_10001462 | 3300009177 | Bacteria | 26311 |
| 458 | Ga0105248_10184190 | 3300009177 | Bacteria | 2353 |
| 459 | Ga0105248_10251892 | 3300009177 | Bacteria | 1988 |
| 460 | Ga0105248_10395924 | 3300009177 | Bacteria | 1555 |
| 461 | Ga0105248_10976783 | 3300009177 | Bacteria | 956 |
| 462 | Ga0105237_10000007 | 3300009545 | Bacteria | 367690 |
| 463 | Ga0105237_10000064 | 3300009545 | Bacteria | 139463 |
| 464 | Ga0105237_10004545 | 3300009545 | Bacteria | 16029 |
| 465 | Ga0105237_10008004 | 3300009545 | Bacteria | 11503 |
| 466 | Ga0105237_10049193 | 3300009545 | Bacteria | 4238 |
| 467 | Ga0105237_10096955 | 3300009545 | Bacteria | 2939 |
| 468 | Ga0105237_10173710 | 3300009545 | Bacteria | 2155 |
| 469 | Ga0105237_10640253 | 3300009545 | Bacteria | 1070 |
| 470 | Ga0105238_10000924 | 3300009551 | Bacteria | 30076 |
| 471 | Ga0105238_10001307 | 3300009551 | Bacteria | 25025 |
| 472 | Ga0105238_10010394 | 3300009551 | Bacteria | 9341 |
| 473 | Ga0105238_10021154 | 3300009551 | Bacteria | 6631 |
| 474 | Ga0105238_10027655 | 3300009551 | Bacteria | 5780 |
| 475 | Ga0105238_10035391 | 3300009551 | Bacteria | 5077 |
| 476 | Ga0105238_10042220 | 3300009551 | Bacteria | 4619 |
| 477 | Ga0105238_10107765 | 3300009551 | Bacteria | 2767 |
| 478 | Ga0105238_10122721 | 3300009551 | Bacteria | 2577 |
| 479 | Ga0105238_10128356 | 3300009551 | Bacteria | 2514 |
| 480 | Ga0105238_10439323 | 3300009551 | Bacteria | 1301 |
| 481 | Ga0105238_10587977 | 3300009551 | Bacteria | 1120 |
| 482 | Ga0105249_10000763 | 3300009553 | Bacteria | 28922 |
| 483 | Ga0105249_10271332 | 3300009553 | Bacteria | 1690 |
| 484 | Ga0105249_10462895 | 3300009553 | Bacteria | 1308 |
| 485 | Ga0105239_10008425 | 3300010375 | Bacteria | 11739 |
| 486 | Ga0105239_10010561 | 3300010375 | Bacteria | 10324 |
| 487 | Ga0105239_10015419 | 3300010375 | Bacteria | 8466 |
| 488 | Ga0105239_10018248 | 3300010375 | Bacteria | 7757 |
| 489 | Ga0105239_10090670 | 3300010375 | Bacteria | 3372 |
| 490 | Ga0105239_10094117 | 3300010375 | Bacteria | 3309 |
| 491 | Ga0105239_10101282 | 3300010375 | Bacteria | 3186 |
| 492 | Ga0105239_10110828 | 3300010375 | Bacteria | 3042 |
| 493 | Ga0105239_10127734 | 3300010375 | Bacteria | 2826 |
| 494 | Ga0105239_10159178 | 3300010375 | Bacteria | 2522 |
| 495 | Ga0105239_10174525 | 3300010375 | Bacteria | 2404 |
| 496 | Ga0105239_10184573 | 3300010375 | Bacteria | 2334 |
| 497 | Ga0105239_10197223 | 3300010375 | Bacteria | 2254 |
| 498 | Ga0105239_10239301 | 3300010375 | Bacteria | 2037 |
| 499 | Ga0105239_10241998 | 3300010375 | Bacteria | 2025 |
| 500 | Ga0105239_10450554 | 3300010375 | Bacteria | 1460 |
| 501 | Ga0157347_1000121 | 3300012502 | Bacteria | 3912 |
| 502 | Ga0157373_10000304 | 3300013100 | Bacteria | 39700 |
| 503 | Ga0157373_10071342 | 3300013100 | Bacteria | 2454 |
| 504 | Ga0157373_10081763 | 3300013100 | Bacteria | 2277 |
| 505 | Ga0157373_10238248 | 3300013100 | Bacteria | 1286 |
| 506 | Ga0157373_10256059 | 3300013100 | Bacteria | 1238 |
| 507 | Ga0157373_10361367 | 3300013100 | Bacteria | 1036 |
| 508 | Ga0157373_10398631 | 3300013100 | Bacteria | 986 |
| 509 | Ga0157371_10014172 | 3300013102 | Bacteria | 6027 |
| 510 | Ga0157371_10046460 | 3300013102 | Bacteria | 3088 |
| 511 | Ga0157371_10148481 | 3300013102 | Bacteria | 1671 |
| 512 | Ga0157371_10192929 | 3300013102 | Bacteria | 1459 |
| 513 | Ga0157371_10316741 | 3300013102 | Bacteria | 1131 |
| 514 | Ga0157370_10003005 | 3300013104 | Bacteria | 20023 |
| 515 | Ga0157370_10009864 | 3300013104 | Bacteria | 10122 |
| 516 | Ga0157370_10019411 | 3300013104 | Bacteria | 6818 |
| 517 | Ga0157370_10029943 | 3300013104 | Bacteria | 5336 |
| 518 | Ga0157370_10047259 | 3300013104 | Bacteria | 4126 |
| 519 | Ga0157370_10061424 | 3300013104 | Bacteria | 3567 |
| 520 | Ga0157370_10087421 | 3300013104 | Bacteria | 2928 |
| 521 | Ga0157370_10210385 | 3300013104 | Bacteria | 1802 |
| 522 | Ga0157370_10415832 | 3300013104 | Bacteria | 1237 |
| 523 | Ga0157369_10000195 | 3300013105 | Bacteria | 84688 |
| 524 | Ga0157369_10000509 | 3300013105 | Bacteria | 51146 |
| 525 | Ga0157369_10004837 | 3300013105 | Bacteria | 15811 |
| 526 | Ga0157369_10034421 | 3300013105 | Bacteria | 5559 |
| 527 | Ga0157369_10063749 | 3300013105 | Bacteria | 3970 |
| 528 | Ga0157369_10095444 | 3300013105 | Bacteria | 3173 |
| 529 | Ga0157369_10370628 | 3300013105 | Bacteria | 1486 |
| 530 | Ga0157369_10390047 | 3300013105 | Bacteria | 1445 |
| 531 | Ga0157369_10406107 | 3300013105 | Bacteria | 1413 |
| 532 | Ga0157369_10523965 | 3300013105 | Bacteria | 1226 |
| 533 | Ga0157369_10706311 | 3300013105 | Bacteria | 1038 |
| 534 | Ga0157369_10877909 | 3300013105 | Bacteria | 920 |
| 535 | Ga0157369_10975698 | 3300013105 | Bacteria | 868 |
| 536 | Ga0157369_10975699 | 3300013105 | Bacteria | 868 |
| 537 | Ga0157374_10022868 | 3300013296 | Bacteria | 5582 |
| 538 | Ga0157374_10061587 | 3300013296 | Bacteria | 3515 |
| 539 | Ga0157374_10125394 | 3300013296 | Bacteria | 2482 |
| 540 | Ga0157374_10328522 | 3300013296 | Bacteria | 1517 |
| 541 | Ga0157374_10356538 | 3300013296 | Bacteria | 1454 |
| 542 | Ga0157378_10000043 | 3300013297 | Bacteria | 107750 |
| 543 | Ga0157378_10039097 | 3300013297 | Bacteria | 4207 |
| 544 | Ga0157378_10180632 | 3300013297 | Bacteria | 1985 |
| 545 | Ga0157378_10367082 | 3300013297 | Bacteria | 1410 |
| 546 | Ga0157378_10384416 | 3300013297 | Bacteria | 1379 |
| 547 | Ga0163162_10000003 | 3300013306 | Bacteria | 698280 |
| 548 | Ga0163162_10000489 | 3300013306 | Bacteria | 36741 |
| 549 | Ga0163162_10009175 | 3300013306 | Bacteria | 9626 |
| 550 | Ga0163162_10078541 | 3300013306 | Bacteria | 3366 |
| 551 | Ga0163162_10306137 | 3300013306 | Bacteria | 1721 |
| 552 | Ga0163162_10490145 | 3300013306 | Bacteria | 1360 |
| 553 | Ga0157372_10001376 | 3300013307 | Bacteria | 26252 |
| 554 | Ga0157372_10005525 | 3300013307 | Bacteria | 13442 |
| 555 | Ga0157372_10005613 | 3300013307 | Bacteria | 13341 |
| 556 | Ga0157372_10005944 | 3300013307 | Bacteria | 12975 |
| 557 | Ga0157372_10019732 | 3300013307 | Bacteria | 7266 |
| 558 | Ga0157372_10038893 | 3300013307 | Bacteria | 5250 |
| 559 | Ga0157372_10065619 | 3300013307 | Bacteria | 4076 |
| 560 | Ga0157372_10072607 | 3300013307 | Bacteria | 3878 |
| 561 | Ga0157372_10110493 | 3300013307 | Bacteria | 3149 |
| 562 | Ga0157372_10397239 | 3300013307 | Bacteria | 1607 |
| 563 | Ga0157372_10498585 | 3300013307 | Bacteria | 1420 |
| 564 | Ga0157372_10499535 | 3300013307 | Bacteria | 1418 |
| 565 | Ga0157372_10879031 | 3300013307 | Bacteria | 1040 |
| 566 | Ga0157375_10000940 | 3300013308 | Bacteria | 25256 |
| 567 | Ga0157375_10001135 | 3300013308 | Bacteria | 23067 |
| 568 | Ga0157375_10120424 | 3300013308 | Bacteria | 2733 |
| 569 | Ga0157375_10127593 | 3300013308 | Bacteria | 2660 |
| 570 | Ga0157375_10188760 | 3300013308 | Bacteria | 2215 |
| 571 | Ga0157375_10406402 | 3300013308 | Bacteria | 1528 |
| 572 | Ga0157375_10492557 | 3300013308 | Bacteria | 1390 |
| 573 | Ga0157375_10871657 | 3300013308 | Bacteria | 1046 |
| 574 | Ga0163163_10002153 | 3300014325 | Bacteria | 16654 |
| 575 | Ga0163163_10103999 | 3300014325 | Bacteria | 2864 |
| 576 | Ga0182008_10002353 | 3300014497 | Bacteria | 11897 |
| 577 | Ga0182008_10009625 | 3300014497 | Bacteria | 5205 |
| 578 | Ga0182008_10033435 | 3300014497 | Bacteria | 2580 |
| 579 | Ga0182008_10051007 | 3300014497 | Bacteria | 2053 |
| 580 | Ga0157379_10001006 | 3300014968 | Bacteria | 22858 |
| 581 | Ga0157379_10207665 | 3300014968 | Bacteria | 1772 |
| 582 | Ga0157379_10672303 | 3300014968 | Bacteria | 971 |
| 583 | Ga0157376_10039337 | 3300014969 | Bacteria | 3856 |
| 584 | Ga0157376_10054895 | 3300014969 | Bacteria | 3323 |
| 585 | Ga0157376_10088038 | 3300014969 | Bacteria | 2681 |
| 586 | Ga0157376_10207223 | 3300014969 | Bacteria | 1808 |
| 587 | Ga0157376_10303334 | 3300014969 | Bacteria | 1512 |
| 588 | Ga0157376_10324512 | 3300014969 | Bacteria | 1465 |
| 589 | Ga0157376_10396833 | 3300014969 | Bacteria | 1333 |
| 590 | Ga0157376_10420760 | 3300014969 | Bacteria | 1296 |
| 591 | Ga0182006_1000085 | 3300015261 | Bacteria | 117595 |
| 592 | Ga0182006_1001966 | 3300015261 | Bacteria | 11638 |
| 593 | Ga0182006_1006387 | 3300015261 | Bacteria | 5487 |
| 594 | Ga0182006_1046769 | 3300015261 | Bacteria | 1680 |
| 595 | Ga0182007_10003021 | 3300015262 | Bacteria | 8128 |
| 596 | Ga0182007_10035389 | 3300015262 | Bacteria | 1683 |
| 597 | Ga0182005_1000028 | 3300015265 | Bacteria | 221889 |
| 598 | Ga0182005_1004956 | 3300015265 | Bacteria | 4218 |
| 599 | Ga0183369_1007 | 3300015685 | Bacteria | 414878 |
| 600 | Ga0183368_1003 | 3300015687 | Bacteria | 1276390 |
| 601 | Ga0163161_10001533 | 3300017792 | Bacteria | 17070 |
| 602 | Ga0163161_10103332 | 3300017792 | Bacteria | 2123 |
| 603 | Ga0163161_10406621 | 3300017792 | Bacteria | 1092 |
| 604 | Ga0197907_10112819 | 3300020069 | Bacteria | 1819 |
| 605 | Ga0206356_10073673 | 3300020070 | Bacteria | 4442 |
| 606 | Ga0206356_11092931 | 3300020070 | Bacteria | 2599 |
| 607 | Ga0206356_11137881 | 3300020070 | Bacteria | 5985 |
| 608 | Ga0206356_11619311 | 3300020070 | Bacteria | 1829 |
| 609 | Ga0206351_10351414 | 3300020077 | Bacteria | 2935 |
| 610 | Ga0206352_10906711 | 3300020078 | Bacteria | 1999 |
| 611 | Ga0206354_10103479 | 3300020081 | Bacteria | 3460 |
| 612 | Ga0206354_11015677 | 3300020081 | Bacteria | 1317 |
| 613 | Ga0206353_10470642 | 3300020082 | Bacteria | 3181 |
| 614 | Ga0206353_10873698 | 3300020082 | Bacteria | 2962 |
| 615 | Ga0206353_11102501 | 3300020082 | Bacteria | 1263 |
| 616 | Ga0206353_11830696 | 3300020082 | Bacteria | 2098 |
| 617 | Ga0213876_10044835 | 3300021384 | Bacteria | 2338 |
| 618 | Ga0209435_110491 | 3300025206 | Bacteria | 1002 |
| 619 | Ga0209760_100055 | 3300025207 | Bacteria | 100237 |
| 620 | Ga0209760_100585 | 3300025207 | Bacteria | 6376 |
| 621 | Ga0209784_100709 | 3300025224 | Bacteria | 8923 |
| 622 | Ga0209566_106060 | 3300025225 | Bacteria | 1456 |
| 623 | Ga0209674_100012 | 3300025226 | Bacteria | 950162 |
| 624 | Ga0209674_100119 | 3300025226 | Bacteria | 135468 |
| 625 | Ga0209674_100973 | 3300025226 | Bacteria | 8987 |
| 626 | Ga0209672_100005 | 3300025228 | Bacteria | 1069303 |
| 627 | Ga0209672_100016 | 3300025228 | Bacteria | 522604 |
| 628 | Ga0209672_100312 | 3300025228 | Bacteria | 32535 |
| 629 | Ga0209672_100887 | 3300025228 | Bacteria | 13631 |
| 630 | Ga0209672_104091 | 3300025228 | Bacteria | 2800 |
| 631 | Ga0209563_100023 | 3300025230 | Bacteria | 636844 |
| 632 | Ga0207427_100004 | 3300025231 | Bacteria | 939600 |
| 633 | Ga0207427_100055 | 3300025231 | Bacteria | 209093 |
| 634 | Ga0207427_100156 | 3300025231 | Bacteria | 77311 |
| 635 | Ga0207427_105404 | 3300025231 | Bacteria | 1810 |
| 636 | Ga0209437_100020 | 3300025233 | Bacteria | 656374 |
| 637 | Ga0209437_100028 | 3300025233 | Bacteria | 540136 |
| 638 | Ga0209437_100147 | 3300025233 | Bacteria | 161997 |
| 639 | Ga0209437_100161 | 3300025233 | Bacteria | 148264 |
| 640 | Ga0209437_100224 | 3300025233 | Bacteria | 101515 |
| 641 | Ga0209437_100476 | 3300025233 | Bacteria | 30448 |
| 642 | Ga0209258_100006 | 3300025242 | Bacteria | 1069303 |
| 643 | Ga0209258_100012 | 3300025242 | Bacteria | 825544 |
| 644 | Ga0209258_100049 | 3300025242 | Bacteria | 358328 |
| 645 | Ga0209258_100064 | 3300025242 | Bacteria | 293837 |
| 646 | Ga0209258_100186 | 3300025242 | Bacteria | 132381 |
| 647 | Ga0209258_101282 | 3300025242 | Bacteria | 9408 |
| 648 | Ga0207425_1017100 | 3300025245 | Bacteria | 1600 |
| 649 | Ga0209646_1002608 | 3300025246 | Bacteria | 3887 |
| 650 | Ga0209646_1004739 | 3300025246 | Bacteria | 2452 |
| 651 | Ga0209646_1010458 | 3300025246 | Bacteria | 1453 |
| 652 | Ga0209026_1000037 | 3300025250 | Bacteria | 282562 |
| 653 | Ga0209026_1000099 | 3300025250 | Bacteria | 161750 |
| 654 | Ga0209026_1000375 | 3300025250 | Bacteria | 41000 |
| 655 | Ga0209026_1000391 | 3300025250 | Bacteria | 39130 |
| 656 | Ga0209026_1000541 | 3300025250 | Bacteria | 26051 |
| 657 | Ga0209148_1000005 | 3300025254 | Bacteria | 1806504 |
| 658 | Ga0209148_1000010 | 3300025254 | Bacteria | 1265567 |
| 659 | Ga0209148_1000012 | 3300025254 | Bacteria | 1069303 |
| 660 | Ga0209148_1000014 | 3300025254 | Bacteria | 925277 |
| 661 | Ga0209148_1000073 | 3300025254 | Bacteria | 320851 |
| 662 | Ga0209148_1000142 | 3300025254 | Bacteria | 163404 |
| 663 | Ga0209148_1002604 | 3300025254 | Bacteria | 5903 |
| 664 | Ga0209759_1000103 | 3300025256 | Bacteria | 153195 |
| 665 | Ga0209759_1000792 | 3300025256 | Bacteria | 25985 |
| 666 | Ga0209759_1001568 | 3300025256 | Bacteria | 12465 |
| 667 | Ga0209759_1002641 | 3300025256 | Bacteria | 7707 |
| 668 | Ga0209759_1010031 | 3300025256 | Bacteria | 2811 |
| 669 | Ga0209759_1016594 | 3300025256 | Bacteria | 1851 |
| 670 | Ga0209129_1004913 | 3300025258 | Bacteria | 4986 |
| 671 | Ga0209129_1005589 | 3300025258 | Bacteria | 4381 |
| 672 | Ga0209233_1000008 | 3300025261 | Bacteria | 1356712 |
| 673 | Ga0209233_1000009 | 3300025261 | Bacteria | 1265567 |
| 674 | Ga0209233_1000020 | 3300025261 | Bacteria | 798224 |
| 675 | Ga0209233_1000063 | 3300025261 | Bacteria | 395810 |
| 676 | Ga0209233_1000147 | 3300025261 | Bacteria | 186517 |
| 677 | Ga0209233_1004515 | 3300025261 | Bacteria | 4719 |
| 678 | Ga0209565_1000018 | 3300025263 | Bacteria | 460940 |
| 679 | Ga0209565_1000136 | 3300025263 | Bacteria | 103019 |
| 680 | Ga0209565_1002813 | 3300025263 | Bacteria | 6014 |
| 681 | Ga0209455_1000008 | 3300025272 | Bacteria | 1069303 |
| 682 | Ga0209455_1000014 | 3300025272 | Bacteria | 806601 |
| 683 | Ga0209455_1000086 | 3300025272 | Bacteria | 244650 |
| 684 | Ga0209455_1000177 | 3300025272 | Bacteria | 106026 |
| 685 | Ga0209455_1000344 | 3300025272 | Bacteria | 43864 |
| 686 | Ga0209673_1000090 | 3300025273 | Bacteria | 202223 |
| 687 | Ga0209130_1012206 | 3300025284 | Bacteria | 2261 |
| 688 | Ga0209675_1000005 | 3300025291 | Bacteria | 849192 |
| 689 | Ga0209675_1000587 | 3300025291 | Bacteria | 26247 |
| 690 | Ga0209675_1006760 | 3300025291 | Bacteria | 4536 |
| 691 | Ga0209675_1009558 | 3300025291 | Bacteria | 3411 |
| 692 | Ga0209676_1000056 | 3300025292 | Bacteria | 361329 |
| 693 | Ga0209676_1000066 | 3300025292 | Bacteria | 317897 |
| 694 | Ga0209676_1000101 | 3300025292 | Bacteria | 227976 |
| 695 | Ga0209025_1000471 | 3300025294 | Bacteria | 78395 |
| 696 | Ga0209025_1000711 | 3300025294 | Bacteria | 56608 |
| 697 | Ga0209025_1001264 | 3300025294 | Bacteria | 34892 |
| 698 | Ga0209025_1001519 | 3300025294 | Bacteria | 29705 |
| 699 | Ga0209025_1068236 | 3300025294 | Bacteria | 1279 |
| 700 | Ga0209564_1000078 | 3300025295 | Bacteria | 275766 |
| 701 | Ga0209564_1003271 | 3300025295 | Bacteria | 11297 |
| 702 | Ga0209564_1003275 | 3300025295 | Bacteria | 11288 |
| 703 | Ga0209564_1003554 | 3300025295 | Bacteria | 10463 |
| 704 | Ga0209758_1001371 | 3300025297 | Bacteria | 29065 |
| 705 | Ga0209758_1004728 | 3300025297 | Bacteria | 11097 |
| 706 | Ga0209758_1018326 | 3300025297 | Bacteria | 3436 |
| 707 | Ga0209758_1079160 | 3300025297 | Bacteria | 1001 |
| 708 | Ga0209256_1000070 | 3300025299 | Bacteria | 245034 |
| 709 | Ga0209256_1001248 | 3300025299 | Bacteria | 28107 |
| 710 | Ga0209256_1003130 | 3300025299 | Bacteria | 12059 |
| 711 | Ga0209256_1012253 | 3300025299 | Bacteria | 3311 |
| 712 | Ga0209051_1003162 | 3300025303 | Bacteria | 11043 |
| 713 | Ga0209051_1039422 | 3300025303 | Bacteria | 1706 |
| 714 | Ga0209051_1064040 | 3300025303 | Bacteria | 1141 |
| 715 | Ga0209257_1025065 | 3300025304 | Bacteria | 2047 |
| 716 | Ga0207656_10004478 | 3300025321 | Bacteria | 4885 |
| 717 | Ga0207656_10044372 | 3300025321 | Bacteria | 1898 |
| 718 | Ga0207655_1000005 | 3300025728 | Bacteria | 917277 |
| 719 | Ga0207655_1000015 | 3300025728 | Bacteria | 600662 |
| 720 | Ga0207655_1000166 | 3300025728 | Bacteria | 119771 |
| 721 | Ga0207653_10001491 | 3300025885 | Bacteria | 7581 |
| 722 | Ga0207688_10028620 | 3300025901 | Bacteria | 3065 |
| 723 | Ga0207680_10000005 | 3300025903 | Bacteria | 660983 |
| 724 | Ga0207680_10000255 | 3300025903 | Bacteria | 25597 |
| 725 | Ga0207680_10147436 | 3300025903 | Bacteria | 1566 |
| 726 | Ga0207680_10157513 | 3300025903 | Bacteria | 1520 |
| 727 | Ga0207647_10000512 | 3300025904 | Bacteria | 30880 |
| 728 | Ga0207647_10000610 | 3300025904 | Bacteria | 27881 |
| 729 | Ga0207647_10001940 | 3300025904 | Bacteria | 15811 |
| 730 | Ga0207647_10007302 | 3300025904 | Bacteria | 7998 |
| 731 | Ga0207647_10013553 | 3300025904 | Bacteria | 5646 |
| 732 | Ga0207647_10018521 | 3300025904 | Bacteria | 4705 |
| 733 | Ga0207647_10042751 | 3300025904 | Bacteria | 2840 |
| 734 | Ga0207699_10199183 | 3300025906 | Bacteria | 1356 |
| 735 | Ga0207645_10000076 | 3300025907 | Bacteria | 70294 |
| 736 | Ga0207645_10016221 | 3300025907 | Bacteria | 4934 |
| 737 | Ga0207645_10107216 | 3300025907 | Bacteria | 1806 |
| 738 | Ga0207645_10122962 | 3300025907 | Bacteria | 1685 |
| 739 | Ga0207645_10299855 | 3300025907 | Bacteria | 1070 |
| 740 | Ga0207643_10000227 | 3300025908 | Bacteria | 39423 |
| 741 | Ga0207705_10003418 | 3300025909 | Bacteria | 12075 |
| 742 | Ga0207705_10005224 | 3300025909 | Bacteria | 9733 |
| 743 | Ga0207705_10013859 | 3300025909 | Bacteria | 5812 |
| 744 | Ga0207705_10014275 | 3300025909 | Bacteria | 5719 |
| 745 | Ga0207705_10067187 | 3300025909 | Bacteria | 2594 |
| 746 | Ga0207705_10175935 | 3300025909 | Bacteria | 1613 |
| 747 | Ga0207705_10179726 | 3300025909 | Bacteria | 1596 |
| 748 | Ga0207705_10265431 | 3300025909 | Bacteria | 1312 |
| 749 | Ga0207705_10305881 | 3300025909 | Bacteria | 1220 |
| 750 | Ga0207684_10000874 | 3300025910 | Bacteria | 34386 |
| 751 | Ga0207684_10015879 | 3300025910 | Bacteria | 6473 |
| 752 | Ga0207654_10001950 | 3300025911 | Bacteria | 10699 |
| 753 | Ga0207654_10006920 | 3300025911 | Bacteria | 5712 |
| 754 | Ga0207654_10007889 | 3300025911 | Bacteria | 5367 |
| 755 | Ga0207654_10089144 | 3300025911 | Bacteria | 1876 |
| 756 | Ga0207654_10091337 | 3300025911 | Bacteria | 1857 |
| 757 | Ga0207707_10000069 | 3300025912 | Bacteria | 103460 |
| 758 | Ga0207707_10000310 | 3300025912 | Bacteria | 51190 |
| 759 | Ga0207707_10000357 | 3300025912 | Bacteria | 48036 |
| 760 | Ga0207707_10001014 | 3300025912 | Bacteria | 26932 |
| 761 | Ga0207707_10004786 | 3300025912 | Bacteria | 11872 |
| 762 | Ga0207707_10009538 | 3300025912 | Bacteria | 8420 |
| 763 | Ga0207707_10013618 | 3300025912 | Bacteria | 7092 |
| 764 | Ga0207707_10042934 | 3300025912 | Bacteria | 3945 |
| 765 | Ga0207707_10174379 | 3300025912 | Bacteria | 1879 |
| 766 | Ga0207707_10185756 | 3300025912 | Bacteria | 1814 |
| 767 | Ga0207707_10188585 | 3300025912 | Bacteria | 1799 |
| 768 | Ga0207707_10214905 | 3300025912 | Bacteria | 1674 |
| 769 | Ga0207707_10414408 | 3300025912 | Bacteria | 1156 |
| 770 | Ga0207695_10000007 | 3300025913 | Bacteria | 1092551 |
| 771 | Ga0207695_10000780 | 3300025913 | Bacteria | 60243 |
| 772 | Ga0207695_10001750 | 3300025913 | Bacteria | 34466 |
| 773 | Ga0207695_10003105 | 3300025913 | Bacteria | 23782 |
| 774 | Ga0207695_10005621 | 3300025913 | Bacteria | 16567 |
| 775 | Ga0207695_10042664 | 3300025913 | Bacteria | 4841 |
| 776 | Ga0207695_10059150 | 3300025913 | Bacteria | 3976 |
| 777 | Ga0207695_10069722 | 3300025913 | Bacteria | 3597 |
| 778 | Ga0207695_10070350 | 3300025913 | Bacteria | 3578 |
| 779 | Ga0207695_10154475 | 3300025913 | Bacteria | 2230 |
| 780 | Ga0207695_10379157 | 3300025913 | Bacteria | 1300 |
| 781 | Ga0207695_10451902 | 3300025913 | Bacteria | 1168 |
| 782 | Ga0207671_10000061 | 3300025914 | Bacteria | 175061 |
| 783 | Ga0207671_10000074 | 3300025914 | Bacteria | 156482 |
| 784 | Ga0207671_10001147 | 3300025914 | Bacteria | 31646 |
| 785 | Ga0207671_10003503 | 3300025914 | Bacteria | 15596 |
| 786 | Ga0207671_10003678 | 3300025914 | Bacteria | 15116 |
| 787 | Ga0207671_10065748 | 3300025914 | Bacteria | 2698 |
| 788 | Ga0207671_10080968 | 3300025914 | Bacteria | 2435 |
| 789 | Ga0207671_10123741 | 3300025914 | Bacteria | 1979 |
| 790 | Ga0207693_10249914 | 3300025915 | Bacteria | 1392 |
| 791 | Ga0207663_10352093 | 3300025916 | Bacteria | 1115 |
| 792 | Ga0207660_10003495 | 3300025917 | Bacteria | 10237 |
| 793 | Ga0207660_10019459 | 3300025917 | Bacteria | 4539 |
| 794 | Ga0207660_10027109 | 3300025917 | Bacteria | 3906 |
| 795 | Ga0207660_10040839 | 3300025917 | Bacteria | 3249 |
| 796 | Ga0207660_10110909 | 3300025917 | Bacteria | 2064 |
| 797 | Ga0207660_10149308 | 3300025917 | Bacteria | 1794 |
| 798 | Ga0207660_10240301 | 3300025917 | Bacteria | 1427 |
| 799 | Ga0207657_10000417 | 3300025919 | Bacteria | 45146 |
| 800 | Ga0207657_10014538 | 3300025919 | Bacteria | 7675 |
| 801 | Ga0207657_10045337 | 3300025919 | Bacteria | 3860 |
| 802 | Ga0207657_10206205 | 3300025919 | Bacteria | 1579 |
| 803 | Ga0207657_10206256 | 3300025919 | Bacteria | 1579 |
| 804 | Ga0207649_10000847 | 3300025920 | Bacteria | 19667 |
| 805 | Ga0207649_10001653 | 3300025920 | Bacteria | 12915 |
| 806 | Ga0207649_10005305 | 3300025920 | Bacteria | 6976 |
| 807 | Ga0207649_10017567 | 3300025920 | Bacteria | 4054 |
| 808 | Ga0207649_10035699 | 3300025920 | Bacteria | 2989 |
| 809 | Ga0207649_10049981 | 3300025920 | Bacteria | 2585 |
| 810 | Ga0207649_10149653 | 3300025920 | Bacteria | 1606 |
| 811 | Ga0207649_10159121 | 3300025920 | Bacteria | 1563 |
| 812 | Ga0207649_10184626 | 3300025920 | Bacteria | 1462 |
| 813 | Ga0207649_10197151 | 3300025920 | Bacteria | 1420 |
| 814 | Ga0207652_10000394 | 3300025921 | Bacteria | 45530 |
| 815 | Ga0207652_10003410 | 3300025921 | Bacteria | 13119 |
| 816 | Ga0207652_10010725 | 3300025921 | Bacteria | 7378 |
| 817 | Ga0207652_10026547 | 3300025921 | Bacteria | 4825 |
| 818 | Ga0207652_10055480 | 3300025921 | Bacteria | 3408 |
| 819 | Ga0207652_10074563 | 3300025921 | Bacteria | 2955 |
| 820 | Ga0207652_10199817 | 3300025921 | Bacteria | 1799 |
| 821 | Ga0207652_10228318 | 3300025921 | Bacteria | 1678 |
| 822 | Ga0207646_10001150 | 3300025922 | Bacteria | 33745 |
| 823 | Ga0207646_10035755 | 3300025922 | Bacteria | 4485 |
| 824 | Ga0207646_10111999 | 3300025922 | Bacteria | 2449 |
| 825 | Ga0207681_10060077 | 3300025923 | Bacteria | 2608 |
| 826 | Ga0207681_10086448 | 3300025923 | Bacteria | 2228 |
| 827 | Ga0207681_10158962 | 3300025923 | Bacteria | 1701 |
| 828 | Ga0207694_10000162 | 3300025924 | Bacteria | 68375 |
| 829 | Ga0207694_10001362 | 3300025924 | Bacteria | 21050 |
| 830 | Ga0207694_10009064 | 3300025924 | Bacteria | 7509 |
| 831 | Ga0207694_10022629 | 3300025924 | Bacteria | 4769 |
| 832 | Ga0207694_10023759 | 3300025924 | Bacteria | 4655 |
| 833 | Ga0207694_10063972 | 3300025924 | Bacteria | 2866 |
| 834 | Ga0207694_10096636 | 3300025924 | Bacteria | 2336 |
| 835 | Ga0207694_10136232 | 3300025924 | Bacteria | 1972 |
| 836 | Ga0207694_10340457 | 3300025924 | Bacteria | 1240 |
| 837 | Ga0207694_10370239 | 3300025924 | Bacteria | 1188 |
| 838 | Ga0207650_10006670 | 3300025925 | Bacteria | 7878 |
| 839 | Ga0207650_10169670 | 3300025925 | Bacteria | 1734 |
| 840 | Ga0207659_10202713 | 3300025926 | Bacteria | 1585 |
| 841 | Ga0207687_10090627 | 3300025927 | Bacteria | 2229 |
| 842 | Ga0207687_10105282 | 3300025927 | Bacteria | 2084 |
| 843 | Ga0207700_10007782 | 3300025928 | Bacteria | 6585 |
| 844 | Ga0207700_10420206 | 3300025928 | Bacteria | 1174 |
| 845 | Ga0207664_10000026 | 3300025929 | Bacteria | 194571 |
| 846 | Ga0207664_10168743 | 3300025929 | Bacteria | 1871 |
| 847 | Ga0207644_10245162 | 3300025931 | Bacteria | 1428 |
| 848 | Ga0207644_10293900 | 3300025931 | Bacteria | 1307 |
| 849 | Ga0207690_10001242 | 3300025932 | Bacteria | 16111 |
| 850 | Ga0207690_10001494 | 3300025932 | Bacteria | 14609 |
| 851 | Ga0207690_10002715 | 3300025932 | Bacteria | 10679 |
| 852 | Ga0207690_10004311 | 3300025932 | Bacteria | 8397 |
| 853 | Ga0207690_10019003 | 3300025932 | Bacteria | 4220 |
| 854 | Ga0207690_10030674 | 3300025932 | Bacteria | 3432 |
| 855 | Ga0207690_10050680 | 3300025932 | Bacteria | 2772 |
| 856 | Ga0207690_10505429 | 3300025932 | Bacteria | 978 |
| 857 | Ga0207706_10010437 | 3300025933 | Bacteria | 8485 |
| 858 | Ga0207706_10026077 | 3300025933 | Bacteria | 5232 |
| 859 | Ga0207706_10045071 | 3300025933 | Bacteria | 3908 |
| 860 | Ga0207706_10095324 | 3300025933 | Bacteria | 2617 |
| 861 | Ga0207706_10127035 | 3300025933 | Bacteria | 2242 |
| 862 | Ga0207706_10252353 | 3300025933 | Bacteria | 1541 |
| 863 | Ga0207686_10073323 | 3300025934 | Bacteria | 2208 |
| 864 | Ga0207686_10271747 | 3300025934 | Bacteria | 1247 |
| 865 | Ga0207709_10000134 | 3300025935 | Bacteria | 108529 |
| 866 | Ga0207670_10340721 | 3300025936 | Bacteria | 1185 |
| 867 | Ga0207670_10355762 | 3300025936 | Bacteria | 1161 |
| 868 | Ga0207669_10515692 | 3300025937 | Bacteria | 959 |
| 869 | Ga0207704_10210700 | 3300025938 | Bacteria | 1430 |
| 870 | Ga0207704_10339637 | 3300025938 | Bacteria | 1165 |
| 871 | Ga0207665_10013326 | 3300025939 | Bacteria | 5404 |
| 872 | Ga0207691_10020705 | 3300025940 | Bacteria | 6220 |
| 873 | Ga0207691_10024916 | 3300025940 | Bacteria | 5622 |
| 874 | Ga0207691_10033298 | 3300025940 | Bacteria | 4797 |
| 875 | Ga0207691_10075826 | 3300025940 | Bacteria | 3031 |
| 876 | Ga0207711_10001229 | 3300025941 | Bacteria | 24284 |
| 877 | Ga0207711_10225466 | 3300025941 | Bacteria | 1715 |
| 878 | Ga0207689_10000281 | 3300025942 | Bacteria | 46204 |
| 879 | Ga0207689_10086754 | 3300025942 | Bacteria | 2572 |
| 880 | Ga0207689_10166996 | 3300025942 | Bacteria | 1813 |
| 881 | Ga0207689_10263540 | 3300025942 | Bacteria | 1426 |
| 882 | Ga0207689_10264633 | 3300025942 | Bacteria | 1423 |
| 883 | Ga0207661_10084908 | 3300025944 | Bacteria | 2623 |
| 884 | Ga0207661_10097137 | 3300025944 | Bacteria | 2466 |
| 885 | Ga0207661_10246511 | 3300025944 | Bacteria | 1586 |
| 886 | Ga0207679_10000280 | 3300025945 | Bacteria | 38589 |
| 887 | Ga0207679_10234820 | 3300025945 | Bacteria | 1550 |
| 888 | Ga0207679_10312468 | 3300025945 | Bacteria | 1358 |
| 889 | Ga0207679_10389602 | 3300025945 | Bacteria | 1223 |
| 890 | Ga0207667_10000381 | 3300025949 | Bacteria | 59990 |
| 891 | Ga0207667_10018815 | 3300025949 | Bacteria | 7733 |
| 892 | Ga0207667_10023112 | 3300025949 | Bacteria | 6849 |
| 893 | Ga0207667_10038148 | 3300025949 | Bacteria | 5132 |
| 894 | Ga0207667_10038559 | 3300025949 | Bacteria | 5101 |
| 895 | Ga0207667_10054076 | 3300025949 | Bacteria | 4223 |
| 896 | Ga0207667_10054635 | 3300025949 | Bacteria | 4200 |
| 897 | Ga0207667_10092652 | 3300025949 | Bacteria | 3120 |
| 898 | Ga0207667_10126234 | 3300025949 | Bacteria | 2635 |
| 899 | Ga0207667_10126270 | 3300025949 | Bacteria | 2635 |
| 900 | Ga0207667_10249823 | 3300025949 | Bacteria | 1814 |
| 901 | Ga0207667_10249844 | 3300025949 | Bacteria | 1814 |
| 902 | Ga0207651_10105004 | 3300025960 | Bacteria | 2106 |
| 903 | Ga0207651_10276350 | 3300025960 | Bacteria | 1386 |
| 904 | Ga0207651_10411670 | 3300025960 | Bacteria | 1152 |
| 905 | Ga0207712_10001183 | 3300025961 | Bacteria | 18055 |
| 906 | Ga0207712_10033417 | 3300025961 | Bacteria | 3478 |
| 907 | Ga0207668_10111329 | 3300025972 | Bacteria | 2055 |
| 908 | Ga0207668_10306195 | 3300025972 | Bacteria | 1313 |
| 909 | Ga0207640_10000797 | 3300025981 | Bacteria | 17930 |
| 910 | Ga0207640_10001740 | 3300025981 | Bacteria | 11681 |
| 911 | Ga0207640_10006198 | 3300025981 | Bacteria | 6548 |
| 912 | Ga0207640_10008720 | 3300025981 | Bacteria | 5642 |
| 913 | Ga0207640_10011204 | 3300025981 | Bacteria | 5070 |
| 914 | Ga0207640_10020709 | 3300025981 | Bacteria | 3908 |
| 915 | Ga0207640_10038505 | 3300025981 | Bacteria | 3018 |
| 916 | Ga0207640_10050569 | 3300025981 | Bacteria | 2698 |
| 917 | Ga0207640_10076264 | 3300025981 | Bacteria | 2275 |
| 918 | Ga0207640_10267166 | 3300025981 | Bacteria | 1336 |
| 919 | Ga0207658_10000006 | 3300025986 | Bacteria | 392309 |
| 920 | Ga0207658_10018272 | 3300025986 | Bacteria | 4839 |
| 921 | Ga0207658_10020586 | 3300025986 | Bacteria | 4567 |
| 922 | Ga0207658_10156818 | 3300025986 | Bacteria | 1861 |
| 923 | Ga0207658_10228535 | 3300025986 | Bacteria | 1569 |
| 924 | Ga0207677_10137076 | 3300026023 | Bacteria | 1868 |
| 925 | Ga0207677_10192173 | 3300026023 | Bacteria | 1615 |
| 926 | Ga0207677_10247984 | 3300026023 | Bacteria | 1444 |
| 927 | Ga0207703_10003470 | 3300026035 | Bacteria | 13203 |
| 928 | Ga0207703_10011783 | 3300026035 | Bacteria | 6805 |
| 929 | Ga0207703_10030081 | 3300026035 | Bacteria | 4290 |
| 930 | Ga0207703_10129839 | 3300026035 | Bacteria | 2175 |
| 931 | Ga0207639_10002695 | 3300026041 | Bacteria | 11917 |
| 932 | Ga0207639_10003901 | 3300026041 | Bacteria | 10058 |
| 933 | Ga0207639_10003979 | 3300026041 | Bacteria | 9972 |
| 934 | Ga0207639_10004097 | 3300026041 | Bacteria | 9830 |
| 935 | Ga0207639_10004960 | 3300026041 | Bacteria | 8966 |
| 936 | Ga0207639_10006175 | 3300026041 | Bacteria | 8135 |
| 937 | Ga0207639_10008407 | 3300026041 | Bacteria | 7072 |
| 938 | Ga0207639_10011963 | 3300026041 | Bacteria | 6038 |
| 939 | Ga0207639_10034646 | 3300026041 | Bacteria | 3732 |
| 940 | Ga0207639_10103696 | 3300026041 | Bacteria | 2305 |
| 941 | Ga0207639_10109558 | 3300026041 | Bacteria | 2247 |
| 942 | Ga0207639_10229565 | 3300026041 | Bacteria | 1608 |
| 943 | Ga0207639_10238882 | 3300026041 | Bacteria | 1579 |
| 944 | Ga0207639_10580621 | 3300026041 | Bacteria | 1032 |
| 945 | Ga0207678_10004583 | 3300026067 | Bacteria | 12431 |
| 946 | Ga0207678_10007556 | 3300026067 | Bacteria | 9605 |
| 947 | Ga0207678_10007809 | 3300026067 | Bacteria | 9445 |
| 948 | Ga0207678_10010017 | 3300026067 | Bacteria | 8317 |
| 949 | Ga0207678_10016606 | 3300026067 | Bacteria | 6467 |
| 950 | Ga0207678_10032508 | 3300026067 | Bacteria | 4547 |
| 951 | Ga0207678_10036895 | 3300026067 | Bacteria | 4255 |
| 952 | Ga0207678_10038897 | 3300026067 | Bacteria | 4130 |
| 953 | Ga0207678_10043296 | 3300026067 | Bacteria | 3895 |
| 954 | Ga0207678_10122985 | 3300026067 | Bacteria | 2214 |
| 955 | Ga0207678_10123140 | 3300026067 | Bacteria | 2213 |
| 956 | Ga0207678_10177580 | 3300026067 | Bacteria | 1818 |
| 957 | Ga0207678_10303673 | 3300026067 | Bacteria | 1372 |
| 958 | Ga0207678_10425557 | 3300026067 | Bacteria | 1152 |
| 959 | Ga0207702_10000185 | 3300026078 | Bacteria | 74602 |
| 960 | Ga0207702_10002243 | 3300026078 | Bacteria | 18541 |
| 961 | Ga0207702_10002724 | 3300026078 | Bacteria | 16557 |
| 962 | Ga0207702_10004362 | 3300026078 | Bacteria | 12611 |
| 963 | Ga0207702_10005659 | 3300026078 | Bacteria | 10899 |
| 964 | Ga0207702_10013254 | 3300026078 | Bacteria | 6856 |
| 965 | Ga0207702_10032427 | 3300026078 | Bacteria | 4359 |
| 966 | Ga0207702_10060932 | 3300026078 | Bacteria | 3217 |
| 967 | Ga0207702_10112765 | 3300026078 | Bacteria | 2420 |
| 968 | Ga0207702_10238212 | 3300026078 | Bacteria | 1704 |
| 969 | Ga0207641_10020593 | 3300026088 | Bacteria | 5419 |
| 970 | Ga0207641_10030714 | 3300026088 | Bacteria | 4451 |
| 971 | Ga0207641_10087126 | 3300026088 | Bacteria | 2724 |
| 972 | Ga0207641_10099047 | 3300026088 | Bacteria | 2564 |
| 973 | Ga0207641_10115438 | 3300026088 | Bacteria | 2387 |
| 974 | Ga0207641_10126684 | 3300026088 | Bacteria | 2287 |
| 975 | Ga0207641_10150579 | 3300026088 | Bacteria | 2107 |
| 976 | Ga0207641_10152166 | 3300026088 | Bacteria | 2096 |
| 977 | Ga0207641_10471639 | 3300026088 | Bacteria | 1215 |
| 978 | Ga0207648_10002334 | 3300026089 | Bacteria | 20483 |
| 979 | Ga0207648_10031857 | 3300026089 | Bacteria | 4659 |
| 980 | Ga0207648_10033541 | 3300026089 | Bacteria | 4528 |
| 981 | Ga0207648_10056639 | 3300026089 | Bacteria | 3420 |
| 982 | Ga0207648_10110473 | 3300026089 | Bacteria | 2413 |
| 983 | Ga0207648_10594987 | 3300026089 | Bacteria | 1019 |
| 984 | Ga0207676_10041958 | 3300026095 | Bacteria | 3516 |
| 985 | Ga0207674_10000226 | 3300026116 | Bacteria | 70605 |
| 986 | Ga0207674_10001350 | 3300026116 | Bacteria | 31756 |
| 987 | Ga0207674_10064922 | 3300026116 | Bacteria | 3681 |
| 988 | Ga0207674_10067399 | 3300026116 | Bacteria | 3603 |
| 989 | Ga0207674_10171398 | 3300026116 | Bacteria | 2123 |
| 990 | Ga0207674_10213726 | 3300026116 | Bacteria | 1877 |
| 991 | Ga0207674_10311061 | 3300026116 | Bacteria | 1524 |
| 992 | Ga0207674_10378295 | 3300026116 | Bacteria | 1369 |
| 993 | Ga0207675_100012481 | 3300026118 | Bacteria | 7937 |
| 994 | Ga0207675_100020033 | 3300026118 | Bacteria | 6241 |
| 995 | Ga0207675_100275153 | 3300026118 | Bacteria | 1635 |
| 996 | Ga0207675_100808280 | 3300026118 | Bacteria | 951 |
| 997 | Ga0207683_10018309 | 3300026121 | Bacteria | 5975 |
| 998 | Ga0207698_10000529 | 3300026142 | Bacteria | 22200 |
| 999 | Ga0207698_10010039 | 3300026142 | Bacteria | 6063 |
| 1000 | Ga0207698_10065485 | 3300026142 | Bacteria | 2854 |
| 1001 | Ga0207698_10099827 | 3300026142 | Bacteria | 2402 |
| 1002 | Ga0207698_10112145 | 3300026142 | Bacteria | 2288 |
| 1003 | Ga0207698_10125951 | 3300026142 | Bacteria | 2178 |
| 1004 | Ga0207698_10170773 | 3300026142 | Bacteria | 1914 |
| 1005 | Ga0207698_10362427 | 3300026142 | Bacteria | 1373 |
| 1006 | Ga0207698_10438240 | 3300026142 | Bacteria | 1258 |
| 1007 | Ga0207698_11030904 | 3300026142 | Bacteria | 834 |
| 1008 | Ga0209281_1004884 | 3300027111 | Bacteria | 3878 |
| 1009 | Ga0209371_1000197 | 3300027312 | Bacteria | 88691 |
| 1010 | Ga0209969_1002912 | 3300027360 | Bacteria | 2369 |
| 1011 | Ga0209984_1000926 | 3300027424 | Bacteria | 3136 |
| 1012 | Ga0209995_1000280 | 3300027471 | Bacteria | 8040 |
| 1013 | Ga0209968_1004656 | 3300027526 | Bacteria | 2058 |
| 1014 | Ga0209968_1013426 | 3300027526 | Bacteria | 1285 |
| 1015 | Ga0209999_1000590 | 3300027543 | Bacteria | 5733 |
| 1016 | Ga0209982_1001566 | 3300027552 | Bacteria | 3144 |
| 1017 | Ga0209970_1001836 | 3300027614 | Bacteria | 3677 |
| 1018 | Ga0209970_1006001 | 3300027614 | Bacteria | 1992 |
| 1019 | Ga0210002_1011695 | 3300027617 | Bacteria | 1359 |
| 1020 | Ga0209983_1000494 | 3300027665 | Bacteria | 8492 |
| 1021 | Ga0209282_1000051 | 3300027666 | Bacteria | 107809 |
| 1022 | Ga0209971_1000054 | 3300027682 | Bacteria | 37135 |
| 1023 | Ga0209971_1000099 | 3300027682 | Bacteria | 25501 |
| 1024 | Ga0209966_1000059 | 3300027695 | Bacteria | 48677 |
| 1025 | Ga0209998_10000066 | 3300027717 | Bacteria | 41640 |
| 1026 | Ga0209974_10002860 | 3300027876 | Bacteria | 6259 |
| 1027 | Ga0209974_10050802 | 3300027876 | Bacteria | 1393 |
| 1028 | Ga0268266_10000001 | 3300028379 | Bacteria | 4040580 |
| 1029 | Ga0268266_10000004 | 3300028379 | Bacteria | 1495817 |
| 1030 | Ga0268266_10000006 | 3300028379 | Bacteria | 1410021 |
| 1031 | Ga0268266_10082833 | 3300028379 | Bacteria | 2799 |
| 1032 | Ga0268266_10343959 | 3300028379 | Bacteria | 1400 |
| 1033 | Ga0268265_10002756 | 3300028380 | Bacteria | 12975 |
| 1034 | Ga0268265_10004000 | 3300028380 | Bacteria | 10377 |
| 1035 | Ga0268265_10028139 | 3300028380 | Bacteria | 4021 |
| 1036 | Ga0268265_10420735 | 3300028380 | Bacteria | 1240 |
| 1037 | Ga0268265_10506695 | 3300028380 | Bacteria | 1138 |
| 1038 | Ga0268265_10612088 | 3300028380 | Bacteria | 1042 |
| 1039 | Ga0268264_10019805 | 3300028381 | Bacteria | 5497 |
| 1040 | Ga0268264_10020911 | 3300028381 | Bacteria | 5346 |
| 1041 | Ga0268264_10024072 | 3300028381 | Bacteria | 4969 |
| 1042 | Ga0268264_10051695 | 3300028381 | Bacteria | 3425 |
| 1043 | Ga0268264_10156716 | 3300028381 | Bacteria | 2047 |
| 1044 | Ga0268264_10816942 | 3300028381 | Bacteria | 932 |
| 1045 | Ga0265318_10092476 | 3300028577 | Bacteria | 1114 |
| 1046 | Ga0268256_1000147 | 3300030500 | Bacteria | 94888 |
| 1047 | Ga0316179_1058374 | 3300030734 | Bacteria | 3030 |
| 1048 | Ga0316178_1149128 | 3300030735 | Bacteria | 5805 |
| 1049 | Ga0265331_10059719 | 3300031250 | Bacteria | 1803 |
| 1050 | Ga0265327_10037033 | 3300031251 | Bacteria | 2675 |
| 1051 | Ga0265316_10197819 | 3300031344 | Bacteria | 1491 |
| 1052 | Ga0307408_100000045 | 3300031548 | Bacteria | 169484 |
| 1053 | Ga0307408_100002332 | 3300031548 | Bacteria | 13441 |
| 1054 | Ga0307408_100601933 | 3300031548 | Bacteria | 977 |
| 1055 | Ga0307508_10251269 | 3300031616 | Bacteria | 1364 |
| 1056 | Ga0316575_10001754 | 3300031665 | Bacteria | 7100 |
| 1057 | Ga0316575_10008938 | 3300031665 | Bacteria | 3659 |
| 1058 | Ga0316575_10035622 | 3300031665 | Bacteria | 1957 |
| 1059 | Ga0316579_10000043 | 3300031691 | Bacteria | 29246 |
| 1060 | Ga0316579_10000317 | 3300031691 | Bacteria | 14936 |
| 1061 | Ga0316579_10020194 | 3300031691 | Bacteria | 2951 |
| 1062 | Ga0316579_10021774 | 3300031691 | Bacteria | 2860 |
| 1063 | Ga0316576_10001368 | 3300031727 | Bacteria | 13015 |
| 1064 | Ga0316576_10069720 | 3300031727 | Bacteria | 2592 |
| 1065 | Ga0316576_10100835 | 3300031727 | Bacteria | 2158 |
| 1066 | Ga0316576_10114325 | 3300031727 | Bacteria | 2024 |
| 1067 | Ga0316576_10130349 | 3300031727 | Bacteria | 1892 |
| 1068 | Ga0316576_10154118 | 3300031727 | Bacteria | 1732 |
| 1069 | Ga0316576_10210742 | 3300031727 | Bacteria | 1462 |
| 1070 | Ga0316576_10342639 | 3300031727 | Bacteria | 1113 |
| 1071 | Ga0316578_10003074 | 3300031728 | Bacteria | 7533 |
| 1072 | Ga0316578_10008573 | 3300031728 | Bacteria | 5212 |
| 1073 | Ga0316578_10049852 | 3300031728 | Bacteria | 2448 |
| 1074 | Ga0316578_10065209 | 3300031728 | Bacteria | 2150 |
| 1075 | Ga0307516_10000386 | 3300031730 | Bacteria | 57562 |
| 1076 | Ga0307516_10027880 | 3300031730 | Bacteria | 5722 |
| 1077 | Ga0307516_10054707 | 3300031730 | Bacteria | 3899 |
| 1078 | Ga0307516_10088520 | 3300031730 | Bacteria | 2929 |
| 1079 | Ga0307405_10066722 | 3300031731 | Bacteria | 2295 |
| 1080 | Ga0316577_10001045 | 3300031733 | Bacteria | 12508 |
| 1081 | Ga0316577_10282142 | 3300031733 | Bacteria | 940 |
| 1082 | Ga0307413_10111219 | 3300031824 | Bacteria | 1834 |
| 1083 | Ga0307406_10061681 | 3300031901 | Bacteria | 2422 |
| 1084 | Ga0307412_10017964 | 3300031911 | Bacteria | 4243 |
| 1085 | Ga0307416_100045064 | 3300032002 | Bacteria | 3470 |
| 1086 | Ga0307414_10005715 | 3300032004 | Bacteria | 6872 |
| 1087 | Ga0307414_10031363 | 3300032004 | Bacteria | 3485 |
| 1088 | Ga0307414_10238244 | 3300032004 | Bacteria | 1504 |
| 1089 | Ga0307414_10351179 | 3300032004 | Bacteria | 1266 |
| 1090 | Ga0307411_10206503 | 3300032005 | Bacteria | 1513 |
| 1091 | Ga0307411_10373142 | 3300032005 | Bacteria | 1171 |
| 1092 | Ga0307411_10385626 | 3300032005 | Bacteria | 1154 |
| 1093 | Ga0316583_10003786 | 3300032133 | Bacteria | 5362 |
| 1094 | Ga0316585_10000368 | 3300032137 | Bacteria | 10376 |
| 1095 | Ga0316585_10032912 | 3300032137 | Bacteria | 1634 |
| 1096 | Ga0316580_10007606 | 3300032139 | Bacteria | 3230 |
| 1097 | Ga0316580_10009440 | 3300032139 | Bacteria | 2932 |
| 1098 | Ga0316580_10011538 | 3300032139 | Bacteria | 2683 |
| 1099 | Ga0316593_10000550 | 3300032168 | Bacteria | 7006 |
| 1100 | Ga0316593_10000980 | 3300032168 | Bacteria | 5914 |
| 1101 | Ga0316593_10001425 | 3300032168 | Bacteria | 5266 |
| 1102 | Ga0316593_10003419 | 3300032168 | Bacteria | 3937 |
| 1103 | Ga0316593_10004705 | 3300032168 | Bacteria | 3530 |
| 1104 | Ga0316593_10006108 | 3300032168 | Bacteria | 3232 |
| 1105 | Ga0316593_10009511 | 3300032168 | Bacteria | 2748 |
| 1106 | Ga0316593_10015674 | 3300032168 | Bacteria | 2285 |
| 1107 | Ga0316593_10018656 | 3300032168 | Bacteria | 2135 |
| 1108 | Ga0316593_10019079 | 3300032168 | Bacteria | 2116 |
| 1109 | Ga0316593_10021052 | 3300032168 | Bacteria | 2035 |
| 1110 | Ga0316593_10025794 | 3300032168 | Bacteria | 1874 |
| 1111 | Ga0316593_10026747 | 3300032168 | Bacteria | 1847 |
| 1112 | Ga0316593_10026969 | 3300032168 | Bacteria | 1840 |
| 1113 | Ga0316593_10027882 | 3300032168 | Bacteria | 1816 |
| 1114 | Ga0316593_10028085 | 3300032168 | Bacteria | 1811 |
| 1115 | Ga0316593_10040703 | 3300032168 | Bacteria | 1545 |
| 1116 | Ga0316593_10053218 | 3300032168 | Bacteria | 1371 |
| 1117 | Ga0307507_10161388 | 3300033179 | Bacteria | 1655 |
| 1118 | Ga0307510_10002044 | 3300033180 | Bacteria | 22812 |
| 1119 | Ga0316592_1000863 | 3300033524 | Bacteria | 4583 |
| 1120 | Ga0316592_1002557 | 3300033524 | Bacteria | 3160 |
| 1121 | Ga0316592_1004759 | 3300033524 | Bacteria | 2544 |
| 1122 | Ga0316592_1008886 | 3300033524 | Bacteria | 1999 |
| 1123 | Ga0316592_1013362 | 3300033524 | Bacteria | 1692 |
| 1124 | Ga0316592_1026549 | 3300033524 | Bacteria | 1250 |
| 1125 | Ga0316586_1001418 | 3300033527 | Bacteria | 2747 |
| 1126 | Ga0316586_1002226 | 3300033527 | Bacteria | 2390 |
| 1127 | Ga0316586_1002983 | 3300033527 | Bacteria | 2175 |
| 1128 | Ga0316586_1003553 | 3300033527 | Bacteria | 2057 |
| 1129 | Ga0316586_1007210 | 3300033527 | Bacteria | 1616 |
| 1130 | Ga0316588_1000832 | 3300033528 | Bacteria | 4655 |
| 1131 | Ga0316588_1003893 | 3300033528 | Bacteria | 2775 |
| 1132 | Ga0316588_1004524 | 3300033528 | Bacteria | 2642 |
| 1133 | Ga0316588_1006413 | 3300033528 | Bacteria | 2350 |
| 1134 | Ga0316588_1013330 | 3300033528 | Bacteria | 1782 |
| 1135 | Ga0316588_1030522 | 3300033528 | Bacteria | 1263 |
| 1136 | Ga0316587_1001625 | 3300033529 | Bacteria | 2827 |
| 1137 | Ga0316587_1001728 | 3300033529 | Bacteria | 2772 |
| 1138 | Ga0316587_1002587 | 3300033529 | Bacteria | 2434 |
| 1139 | Ga0316587_1002672 | 3300033529 | Bacteria | 2411 |
| 1140 | Ga0316587_1006257 | 3300033529 | Bacteria | 1814 |
| 1141 | Ga0316587_1006816 | 3300033529 | Bacteria | 1758 |
| 1142 | Ga0316596_1000224 | 3300033541 | Bacteria | 8525 |
| 1143 | Ga0316596_1001143 | 3300033541 | Bacteria | 5190 |
| 1144 | Ga0316596_1001775 | 3300033541 | Bacteria | 4479 |
| 1145 | Ga0316596_1003514 | 3300033541 | Bacteria | 3443 |
| 1146 | Ga0316596_1005947 | 3300033541 | Bacteria | 2813 |
| 1147 | Ga0316596_1009326 | 3300033541 | Bacteria | 2354 |
| 1148 | Ga0316596_1010266 | 3300033541 | Bacteria | 2263 |
| 1149 | Ga0316596_1015403 | 3300033541 | Bacteria | 1905 |
| 1150 | Ga0373958_0033968 | 3300034819 | Bacteria | 1014 |
| 1151 | Ga0373940_0003447 | 3300035088 | Bacteria | 3232 |
| 1152 | Ga0373940_0111018 | 3300035088 | Bacteria | 842 |
| 1153 | Ga0373951_0005229 | 3300035091 | Bacteria | 3027 |
| 1154 | Ga0373952_0005206 | 3300035092 | Bacteria | 2372 |
| 1155 | Ga0373941_0043016 | 3300035115 | Bacteria | 1404 |
| 1156 | Ga0373960_0003203 | 3300035121 | Bacteria | 3701 |
| 1157 | Ga0373943_0051525 | 3300035170 | Bacteria | 2027 |
| 1158 | Ga0373942_0045152 | 3300035207 | Bacteria | 1216 |
| 1159 | Ga0316574_0000519 | 3300035398 | Bacteria | 15743 |
| 1160 | Ga0316574_0000879 | 3300035398 | Bacteria | 13274 |
| 1161 | Ga0316574_0001141 | 3300035398 | Bacteria | 12209 |
| 1162 | Ga0316574_0001723 | 3300035398 | Bacteria | 10593 |
| 1163 | Ga0316574_0217935 | 3300035398 | Bacteria | 1223 |
| 1164 | Ga0316574_0237261 | 3300035398 | Bacteria | 1166 |
| 1165 | Ga0316574_0341579 | 3300035398 | Bacteria | 948 |
| 1166 | Ga0373931_0362461 | 3300035691 | Bacteria | 910 |
| 1167 | Ga0373935_0111045 | 3300035692 | Bacteria | 1820 |
| 1168 | Ga0316582_0001446 | 3300036647 | Bacteria | 10420 |
| 1169 | Ga0316582_0002348 | 3300036647 | Bacteria | 8857 |
| 1170 | Ga0316582_0002490 | 3300036647 | Bacteria | 8674 |
| 1171 | Ga0316582_0022499 | 3300036647 | Bacteria | 3743 |
| 1172 | Ga0316582_0032390 | 3300036647 | Bacteria | 3202 |
| 1173 | Ga0316582_0207547 | 3300036647 | Bacteria | 1338 |
| 1174 | Ga0316582_0236814 | 3300036647 | Bacteria | 1250 |
| 1175 | Ga0316584_0001564 | 3300036712 | Bacteria | 13866 |
| 1176 | Ga0316584_0007606 | 3300036712 | Bacteria | 7432 |
| 1177 | Ga0316584_0012345 | 3300036712 | Bacteria | 6023 |
| 1178 | Ga0316584_0058976 | 3300036712 | Bacteria | 2874 |
| 1179 | Ga0316584_0306418 | 3300036712 | Bacteria | 1149 |
| 1180 | Ga0373925_0188164 | 3300037068 | Bacteria | 1637 |
| 1181 | Ga0373925_0275217 | 3300037068 | Bacteria | 1355 |
| 1182 | Ga0395899_0000108 | 3300037312 | Bacteria | 142347 |
| 1183 | Ga0395899_0064157 | 3300037312 | Bacteria | 2701 |
| 1184 | Ga0395899_0293868 | 3300037312 | Bacteria | 1101 |
| 1185 | Ga0395899_0329021 | 3300037312 | Bacteria | 1027 |
| 1186 | Ga0395900_0000051 | 3300037418 | Bacteria | 224228 |
| 1187 | Ga0395900_0000144 | 3300037418 | Bacteria | 119971 |
| 1188 | Ga0395900_0002611 | 3300037418 | Bacteria | 19685 |
| 1189 | Ga0395900_0085695 | 3300037418 | Bacteria | 3237 |
| 1190 | Ga0395900_0138444 | 3300037418 | Bacteria | 2494 |
| 1191 | Ga0395900_0419903 | 3300037418 | Bacteria | 1298 |
| 1192 | Ga0395898_0000018 | 3300037466 | Bacteria | 418600 |
| 1193 | Ga0395898_0000049 | 3300037466 | Bacteria | 284792 |
| 1194 | Ga0395898_0050876 | 3300037466 | Bacteria | 4053 |
| 1195 | Ga0395898_0062023 | 3300037466 | Bacteria | 3631 |
| 1196 | Ga0395898_0159975 | 3300037466 | Bacteria | 2154 |
| 1197 | Ga0395898_0257020 | 3300037466 | Bacteria | 1666 |
| 1198 | Ga0395898_0614016 | 3300037466 | Bacteria | 1030 |
| 1199 | Ga0395905_0002802 | 3300037471 | Bacteria | 19102 |
| 1200 | Ga0395905_0014636 | 3300037471 | Bacteria | 7483 |
| 1201 | Ga0395905_0159906 | 3300037471 | Bacteria | 2117 |
| 1202 | Ga0395905_0240238 | 3300037471 | Bacteria | 1693 |
| 1203 | Ga0395905_0289328 | 3300037471 | Bacteria | 1525 |
| 1204 | Ga0395901_0000356 | 3300038443 | Bacteria | 55523 |
| 1205 | Ga0395901_0007439 | 3300038443 | Bacteria | 11052 |
| 1206 | Ga0395901_0065745 | 3300038443 | Bacteria | 3776 |
| 1207 | Ga0395901_0263752 | 3300038443 | Bacteria | 1792 |
| 1208 | Ga0395901_0399852 | 3300038443 | Bacteria | 1411 |
| 1209 | Ga0395901_0443936 | 3300038443 | Bacteria | 1328 |
| 1210 | Ga0395901_0449792 | 3300038443 | Bacteria | 1317 |
| 1211 | Ga0237819_01204 | 3300038705 | Bacteria | 7225 |
| 1212 | Ga0400488_28249 | 3300038741 | Bacteria | 3983 |
| 1213 | Ga0400483_043964 | 3300039062 | Bacteria | 4816 |
| 1214 | Ga0400483_173977 | 3300039062 | Bacteria | 8288 |
| 1215 | Ga0400487_66353 | 3300039110 | Bacteria | 11859 |
| 1216 | Ga0436365_0191135 | 3300039437 | Bacteria | 1980 |
| 1217 | Ga0439436_0000030 | 3300041404 | Bacteria | 48429 |
| 1218 | Ga0439465_0000405 | 3300041413 | Bacteria | 12512 |
| 1219 | Ga0439465_0002224 | 3300041413 | Bacteria | 6363 |
| 1220 | Ga0451793_0077380 | 3300041452 | Bacteria | 1568 |
| 1221 | Ga0451793_0740756 | 3300041452 | Bacteria | 3252 |
| 1222 | Ga0451793_1663964 | 3300041452 | Bacteria | 1384 |
| 1223 | Ga0451797_1461544 | 3300041453 | Bacteria | 1713 |
| 1224 | Ga0451795_0260148 | 3300041456 | Bacteria | 1367 |
| 1225 | Ga0451802_0477990 | 3300041460 | Bacteria | 7183 |
| 1226 | Ga0451808_17140 | 3300041464 | Bacteria | 1458 |
| 1227 | Ga0451807_0735864 | 3300041486 | Bacteria | 3233 |
| 1228 | Ga0451843_0137728 | 3300041509 | Bacteria | 1325 |
| 1229 | Ga0439441_014725 | 3300042001 | Bacteria | 1375 |
| 1230 | Ga0439445_0003009 | 3300042004 | Bacteria | 3774 |
| 1231 | Ga0439448_0001117 | 3300042005 | Bacteria | 6768 |
| 1232 | Ga0439448_0067247 | 3300042005 | Bacteria | 1190 |
| 1233 | Ga0439449_0000048 | 3300042007 | Bacteria | 36681 |
| 1234 | Ga0439450_009785 | 3300042008 | Bacteria | 1832 |
| 1235 | Ga0439455_0001844 | 3300042012 | Bacteria | 3697 |
| 1236 | Ga0439455_0004575 | 3300042012 | Bacteria | 2751 |
| 1237 | Ga0439455_0008969 | 3300042012 | Bacteria | 2159 |
| 1238 | Ga0450891_002252 | 3300042129 | Unclassified | 1951 |
| 1239 | Ga0450908_001816 | 3300042184 | Bacteria | 4176 |
| 1240 | Ga0439459_0000122 | 3300042438 | Bacteria | 7534 |
| 1241 | Ga0439459_0001238 | 3300042438 | Bacteria | 3730 |
| 1242 | Ga0439464_0002592 | 3300042439 | Bacteria | 4467 |
| 1243 | Ga0439464_0004445 | 3300042439 | Bacteria | 3589 |
| 1244 | Ga0439464_0021652 | 3300042439 | Bacteria | 1765 |
| 1245 | Ga0439460_0001989 | 3300042461 | Bacteria | 4888 |
| 1246 | Ga0451577_0000852 | 3300042876 | Bacteria | 45450 |
| 1247 | Ga0451577_0001148 | 3300042876 | Bacteria | 37395 |
| 1248 | Ga0451577_0005484 | 3300042876 | Bacteria | 12988 |
| 1249 | Ga0451577_0013868 | 3300042876 | Bacteria | 7525 |
| 1250 | Ga0466969_0007454 | 3300044656 | Bacteria | 5813 |
| 1251 | Ga0466972_0032221 | 3300044658 | Bacteria | 2574 |
| 1252 | Ga0466972_0073090 | 3300044658 | Bacteria | 1634 |
| 1253 | Ga0466989_0188469 | 3300044663 | Bacteria | 1222 |
| 1254 | Ga0466982_0000003 | 3300044672 | Bacteria | 417243 |
| 1255 | Ga0453683_0076427 | 3300044673 | Bacteria | 2097 |
| 1256 | Ga0466965_0006406 | 3300044683 | Bacteria | 5344 |
| 1257 | Ga0466965_0025791 | 3300044683 | Bacteria | 2847 |
| 1258 | Ga0466965_0187235 | 3300044683 | Bacteria | 1094 |
| 1259 | Ga0466966_0002423 | 3300044684 | Bacteria | 12184 |
| 1260 | Ga0466966_0015597 | 3300044684 | Bacteria | 5021 |
| 1261 | Ga0466966_0019653 | 3300044684 | Bacteria | 4443 |
| 1262 | Ga0466966_0034789 | 3300044684 | Bacteria | 3257 |
| 1263 | Ga0466966_0288483 | 3300044684 | Bacteria | 986 |
| 1264 | Ga0466961_0001662 | 3300044693 | Bacteria | 13835 |
| 1265 | Ga0466961_0028191 | 3300044693 | Bacteria | 3610 |
| 1266 | Ga0466961_0035526 | 3300044693 | Bacteria | 3200 |
| 1267 | Ga0466961_0091880 | 3300044693 | Bacteria | 1916 |
| 1268 | Ga0466961_0145599 | 3300044693 | Bacteria | 1481 |
| 1269 | Ga0466963_0133386 | 3300044694 | Bacteria | 1717 |
| 1270 | Ga0466963_0302871 | 3300044694 | Bacteria | 1124 |
| 1271 | Ga0466964_0001374 | 3300044706 | Bacteria | 8309 |
| 1272 | Ga0453684_0000298 | 3300044712 | Bacteria | 209777 |
| 1273 | Ga0453684_0000348 | 3300044712 | Bacteria | 192530 |
| 1274 | Ga0453684_0000419 | 3300044712 | Bacteria | 173463 |
| 1275 | Ga0453684_0002092 | 3300044712 | Bacteria | 50519 |
| 1276 | Ga0453684_0003824 | 3300044712 | Bacteria | 33195 |
| 1277 | Ga0453684_0042299 | 3300044712 | Bacteria | 6144 |
| 1278 | Ga0453684_0319178 | 3300044712 | Unclassified | 1760 |
| 1279 | Ga0466971_0001052 | 3300044719 | Bacteria | 11434 |
| 1280 | Ga0466971_0015307 | 3300044719 | Bacteria | 3375 |
| 1281 | Ga0466971_0052473 | 3300044719 | Bacteria | 1836 |
| 1282 | Ga0466968_0018034 | 3300044735 | Bacteria | 2828 |
| 1283 | Ga0466968_0057632 | 3300044735 | Bacteria | 1670 |
| 1284 | Ga0466968_0085106 | 3300044735 | Bacteria | 1395 |
| 1285 | Ga0466970_0000202 | 3300044765 | Bacteria | 28937 |
| 1286 | Ga0466970_0021855 | 3300044765 | Bacteria | 3337 |
| 1287 | Ga0466970_0040664 | 3300044765 | Bacteria | 2469 |
| 1288 | Ga0466970_0063568 | 3300044765 | Bacteria | 1979 |
| 1289 | Ga0466970_0232500 | 3300044765 | Bacteria | 1030 |
| 1290 | Ga0466970_0234734 | 3300044765 | Bacteria | 1025 |
| 1291 | Ga0466957_0006156 | 3300044842 | Bacteria | 6773 |
| 1292 | Ga0466957_0108334 | 3300044842 | Bacteria | 1759 |
| 1293 | Ga0466957_0308180 | 3300044842 | Bacteria | 1065 |
| 1294 | Ga0466959_0000194 | 3300045049 | Bacteria | 39999 |
| 1295 | Ga0466959_0003791 | 3300045049 | Bacteria | 10025 |
| 1296 | Ga0466959_0005674 | 3300045049 | Bacteria | 8585 |
| 1297 | Ga0466959_0031749 | 3300045049 | Bacteria | 3908 |
| 1298 | Ga0451576_0000033 | 3300045051 | Bacteria | 393131 |
| 1299 | Ga0451576_0005108 | 3300045051 | Bacteria | 16632 |
| 1300 | Ga0451576_0007972 | 3300045051 | Bacteria | 12526 |
| 1301 | Ga0451576_0132144 | 3300045051 | Bacteria | 2602 |
| 1302 | Ga0451576_0164052 | 3300045051 | Bacteria | 2318 |
| 1303 | Ga0451576_0279211 | 3300045051 | Bacteria | 1746 |
| 1304 | Ga0451576_0740926 | 3300045051 | Bacteria | 1032 |
| 1305 | Ga0466958_0010562 | 3300045836 | Bacteria | 5175 |
| 1306 | Ga0466958_0106742 | 3300045836 | Bacteria | 1746 |
| 1307 | Ga0466958_0283288 | 3300045836 | Bacteria | 1062 |
| 1308 | Ga0466967_0134565 | 3300045976 | Bacteria | 2298 |
| 1309 | Ga0495617_000586 | 3300046452 | Bacteria | 18560 |
| 1310 | Ga0495617_000939 | 3300046452 | Bacteria | 13544 |
| 1311 | Ga0495627_000074 | 3300046453 | Bacteria | 123139 |
| 1312 | Ga0495590_0002633 | 3300046457 | Bacteria | 7420 |
| 1313 | Ga0495590_0024655 | 3300046457 | Bacteria | 2119 |
| 1314 | Ga0495591_000142 | 3300046458 | Bacteria | 76727 |
| 1315 | Ga0495629_0120610 | 3300046459 | Bacteria | 1827 |
| 1316 | Ga0495638_0000038 | 3300046460 | Bacteria | 249534 |
| 1317 | Ga0495638_0000153 | 3300046460 | Bacteria | 109155 |
| 1318 | Ga0495641_0038501 | 3300046461 | Bacteria | 2234 |
| 1319 | Ga0495651_0307790 | 3300046462 | Bacteria | 1061 |
| 1320 | Ga0495650_0000337 | 3300046471 | Bacteria | 83530 |
| 1321 | Ga0495650_0001325 | 3300046471 | Bacteria | 24874 |
| 1322 | Ga0495650_0001596 | 3300046471 | Bacteria | 21215 |
| 1323 | Ga0495580_0189443 | 3300046472 | Bacteria | 1419 |
| 1324 | Ga0495580_0379156 | 3300046472 | Bacteria | 955 |
| 1325 | Ga0495582_0098622 | 3300046473 | Bacteria | 1635 |
| 1326 | Ga0495605_0003518 | 3300046474 | Bacteria | 9308 |
| 1327 | Ga0495584_0002465 | 3300046491 | Bacteria | 10482 |
| 1328 | Ga0495585_0000104 | 3300046492 | Bacteria | 90097 |
| 1329 | Ga0495585_0082489 | 3300046492 | Bacteria | 1740 |
| 1330 | Ga0495594_0358867 | 3300046499 | Bacteria | 830 |
| 1331 | Ga0495596_0002137 | 3300046500 | Bacteria | 10800 |
| 1332 | Ga0495607_0000211 | 3300046501 | Bacteria | 62291 |
| 1333 | Ga0495607_0002313 | 3300046501 | Bacteria | 15633 |
| 1334 | Ga0495607_0021677 | 3300046501 | Bacteria | 4040 |
| 1335 | Ga0495583_0018274 | 3300046506 | Bacteria | 3694 |
| 1336 | Ga0495606_0000338 | 3300046507 | Bacteria | 80898 |
| 1337 | Ga0495606_0000401 | 3300046507 | Bacteria | 73149 |
| 1338 | Ga0495606_0009207 | 3300046507 | Bacteria | 8393 |
| 1339 | Ga0495606_0024882 | 3300046507 | Bacteria | 4301 |
| 1340 | Ga0495606_0078131 | 3300046507 | Bacteria | 2065 |
| 1341 | Ga0495610_0000482 | 3300046512 | Bacteria | 41191 |
| 1342 | Ga0495610_0004004 | 3300046512 | Bacteria | 11120 |
| 1343 | Ga0495610_0015960 | 3300046512 | Bacteria | 4343 |
| 1344 | Ga0495616_0000086 | 3300046513 | Bacteria | 78187 |
| 1345 | Ga0495616_0008261 | 3300046513 | Bacteria | 6178 |
| 1346 | Ga0495620_0001045 | 3300046515 | Bacteria | 16982 |
| 1347 | Ga0495620_0001112 | 3300046515 | Bacteria | 16400 |
| 1348 | Ga0495631_0064213 | 3300046518 | Bacteria | 1589 |
| 1349 | Ga0495632_0000004 | 3300046519 | Bacteria | 381372 |
| 1350 | Ga0495632_0053890 | 3300046519 | Bacteria | 1973 |
| 1351 | Ga0495632_0098893 | 3300046519 | Bacteria | 1376 |
| 1352 | Ga0495632_0147550 | 3300046519 | Bacteria | 1088 |
| 1353 | Ga0495643_0058644 | 3300046522 | Bacteria | 2048 |
| 1354 | Ga0495648_0009285 | 3300046524 | Bacteria | 7644 |
| 1355 | Ga0495648_0030047 | 3300046524 | Bacteria | 3599 |
| 1356 | Ga0495642_0011374 | 3300046528 | Bacteria | 3418 |
| 1357 | Ga0495609_0002596 | 3300046538 | Bacteria | 10988 |
| 1358 | Ga0495609_0025461 | 3300046538 | Bacteria | 2712 |
| 1359 | Ga0495621_0023410 | 3300046539 | Bacteria | 2054 |
| 1360 | Ga0495597_0000040 | 3300046542 | Bacteria | 112292 |
| 1361 | Ga0495597_0151779 | 3300046542 | Bacteria | 950 |
| 1362 | Ga0495645_0072485 | 3300046543 | Bacteria | 2482 |
| 1363 | Ga0495622_0157027 | 3300046557 | Bacteria | 1027 |
| 1364 | Ga0495656_0049079 | 3300046615 | Bacteria | 1796 |
| 1365 | Ga0495668_0003978 | 3300046616 | Bacteria | 10764 |
| 1366 | Ga0495611_0000001 | 3300046648 | Bacteria | 2628469 |
| 1367 | Ga0495611_0000105 | 3300046648 | Bacteria | 58236 |
| 1368 | Ga0495625_0000022 | 3300046660 | Bacteria | 278823 |
| 1369 | Ga0495625_0080749 | 3300046660 | Bacteria | 2264 |
| 1370 | Ga0495625_0135776 | 3300046660 | Bacteria | 1663 |
| 1371 | Ga0495661_0000199 | 3300046665 | Bacteria | 69536 |
| 1372 | Ga0495661_0005804 | 3300046665 | Bacteria | 8726 |
| 1373 | Ga0495647_0056706 | 3300046681 | Bacteria | 1536 |
| 1374 | Ga0495658_0013679 | 3300046683 | Bacteria | 4134 |
| 1375 | Ga0495658_0019973 | 3300046683 | Bacteria | 3506 |
| 1376 | Ga0495671_0000372 | 3300046692 | Bacteria | 36874 |
| 1377 | Ga0495671_0002703 | 3300046692 | Bacteria | 11106 |
| 1378 | Ga0495649_0001571 | 3300046694 | Bacteria | 17089 |
| 1379 | Ga0495649_0013612 | 3300046694 | Bacteria | 4689 |
| 1380 | Ga0495649_0040058 | 3300046694 | Bacteria | 2567 |
| 1381 | Ga0495589_0000059 | 3300046794 | Bacteria | 107171 |
| 1382 | Ga0495660_0057098 | 3300046810 | Bacteria | 2106 |
| 1383 | Ga0495636_0090633 | 3300047318 | Bacteria | 1327 |
| 1384 | Ga0495674_0160703 | 3300047319 | Bacteria | 1880 |
| 1385 | Ga0495672_0059695 | 3300047320 | Bacteria | 2206 |
| 1386 | Ga0495687_005446 | 3300047443 | Bacteria | 8111 |
| 1387 | Ga0495679_000004 | 3300047446 | Bacteria | 748056 |
| 1388 | Ga0495685_007721 | 3300047447 | Bacteria | 3558 |
| 1389 | Ga0495673_0000004 | 3300047469 | Bacteria | 1354526 |
| 1390 | Ga0495673_0000048 | 3300047469 | Bacteria | 265950 |
| 1391 | Ga0495686_0000017 | 3300047472 | Bacteria | 435554 |
| 1392 | Ga0495686_0001206 | 3300047472 | Bacteria | 29747 |
| 1393 | Ga0495686_0013830 | 3300047472 | Bacteria | 5587 |
| 1394 | Ga0495686_0013909 | 3300047472 | Bacteria | 5567 |
| 1395 | Ga0495686_0030419 | 3300047472 | Bacteria | 3507 |
| 1396 | Ga0495686_0089278 | 3300047472 | Bacteria | 1873 |
| 1397 | Ga0496100_0009393 | 3300048903 | Bacteria | 5498 |
| 1398 | Ga0496101_0000776 | 3300048904 | Bacteria | 18897 |
| 1399 | Ga0496101_0283596 | 3300048904 | Bacteria | 1295 |
| 1400 | Ga0496102_0066165 | 3300048905 | Bacteria | 3313 |
| 1401 | Ga0496102_0216773 | 3300048905 | Bacteria | 1804 |
| 1402 | Ga0496103_0021319 | 3300048906 | Bacteria | 3898 |
| 1403 | Ga0496103_0418985 | 3300048906 | Bacteria | 859 |
| 1404 | Ga0496104_0000011 | 3300048907 | Bacteria | 459358 |
| 1405 | Ga0496104_0072803 | 3300048907 | Bacteria | 3268 |
| 1406 | Ga0496104_0197782 | 3300048907 | Bacteria | 1922 |
| 1407 | Ga0496105_0000071 | 3300048908 | Bacteria | 79908 |
| 1408 | Ga0496105_0001886 | 3300048908 | Bacteria | 15030 |
| 1409 | Ga0496106_0001299 | 3300048909 | Bacteria | 18754 |
| 1410 | Ga0496106_0076000 | 3300048909 | Bacteria | 2574 |
| 1411 | Ga0496113_0002731 | 3300048916 | Bacteria | 10367 |
| 1412 | Ga0496113_0312504 | 3300048916 | Bacteria | 1259 |
| 1413 | Ga0496115_0000062 | 3300048918 | Bacteria | 100189 |
| 1414 | Ga0496115_0000503 | 3300048918 | Bacteria | 30610 |
| 1415 | Ga0496115_0010955 | 3300048918 | Bacteria | 6789 |
| 1416 | Ga0496115_0143611 | 3300048918 | Bacteria | 1969 |
| 1417 | Ga0496116_0005928 | 3300048919 | Bacteria | 11207 |
| 1418 | Ga0496116_0032919 | 3300048919 | Bacteria | 3687 |
| 1419 | Ga0496116_0034533 | 3300048919 | Bacteria | 3567 |
| 1420 | Ga0496116_0040912 | 3300048919 | Bacteria | 3186 |
| 1421 | Ga0496116_0065855 | 3300048919 | Bacteria | 2322 |
| 1422 | Ga0496117_0002308 | 3300048920 | Bacteria | 24516 |
| 1423 | Ga0496117_0008888 | 3300048920 | Bacteria | 9471 |
| 1424 | Ga0496117_0011079 | 3300048920 | Bacteria | 8114 |
| 1425 | Ga0496117_0015531 | 3300048920 | Bacteria | 6484 |
| 1426 | Ga0496117_0187842 | 3300048920 | Bacteria | 1181 |
| 1427 | Ga0496118_0001694 | 3300048921 | Bacteria | 32220 |
| 1428 | Ga0496118_0002288 | 3300048921 | Bacteria | 26119 |
| 1429 | Ga0496118_0004070 | 3300048921 | Bacteria | 17730 |
| 1430 | Ga0496118_0005974 | 3300048921 | Bacteria | 13580 |
| 1431 | Ga0496118_0008410 | 3300048921 | Bacteria | 10671 |
| 1432 | Ga0496118_0016919 | 3300048921 | Bacteria | 6660 |
| 1433 | Ga0496118_0044429 | 3300048921 | Bacteria | 3479 |
| 1434 | Ga0496119_0000430 | 3300048922 | Bacteria | 57802 |
| 1435 | Ga0496120_0001482 | 3300048923 | Bacteria | 27908 |
| 1436 | Ga0496120_0026146 | 3300048923 | Bacteria | 3609 |
| 1437 | Ga0496121_0000743 | 3300048924 | Bacteria | 59998 |
| 1438 | Ga0496121_0000878 | 3300048924 | Bacteria | 54427 |
| 1439 | Ga0496121_0005536 | 3300048924 | Bacteria | 16138 |
| 1440 | Ga0496121_0011904 | 3300048924 | Bacteria | 9576 |
| 1441 | Ga0496121_0019136 | 3300048924 | Bacteria | 6864 |
| 1442 | Ga0496121_0025245 | 3300048924 | Bacteria | 5646 |
| 1443 | Ga0496121_0029686 | 3300048924 | Bacteria | 5045 |
| 1444 | Ga0496121_0068654 | 3300048924 | Bacteria | 2866 |
| 1445 | Ga0496121_0099925 | 3300048924 | Bacteria | 2241 |
| 1446 | Ga0496121_0166342 | 3300048924 | Bacteria | 1607 |
| 1447 | Ga0496122_0001419 | 3300048925 | Bacteria | 38784 |
| 1448 | Ga0496122_0006843 | 3300048925 | Bacteria | 12928 |
| 1449 | Ga0496122_0008492 | 3300048925 | Bacteria | 11061 |
| 1450 | Ga0496122_0034716 | 3300048925 | Bacteria | 4120 |
| 1451 | Ga0496122_0260417 | 3300048925 | Bacteria | 963 |
| 1452 | Ga0496123_0001598 | 3300048926 | Bacteria | 30746 |
| 1453 | Ga0496123_0006599 | 3300048926 | Bacteria | 11206 |
| 1454 | Ga0496123_0007233 | 3300048926 | Bacteria | 10537 |
| 1455 | Ga0496123_0044685 | 3300048926 | Bacteria | 3026 |
| 1456 | Ga0496123_0053734 | 3300048926 | Bacteria | 2659 |
| 1457 | Ga0496123_0108715 | 3300048926 | Bacteria | 1591 |
| 1458 | Ga0496123_0208601 | 3300048926 | Bacteria | 995 |
| 1459 | Ga0496124_0001044 | 3300048927 | Bacteria | 43754 |
| 1460 | Ga0496124_0022236 | 3300048927 | Bacteria | 5819 |
| 1461 | Ga0496124_0084629 | 3300048927 | Bacteria | 2600 |
| 1462 | Ga0496125_0000330 | 3300048928 | Bacteria | 91043 |
| 1463 | Ga0496125_0007864 | 3300048928 | Bacteria | 11266 |
| 1464 | Ga0496125_0141264 | 3300048928 | Bacteria | 1674 |
| 1465 | Ga0496125_0234616 | 3300048928 | Bacteria | 1170 |
| 1466 | Ga0496126_0000057 | 3300048929 | Bacteria | 276781 |
| 1467 | Ga0496126_0003181 | 3300048929 | Bacteria | 21118 |
| 1468 | Ga0496126_0011781 | 3300048929 | Bacteria | 9002 |
| 1469 | Ga0496126_0037880 | 3300048929 | Bacteria | 4492 |
| 1470 | Ga0496126_0085543 | 3300048929 | Bacteria | 2779 |
| 1471 | Ga0496126_0107731 | 3300048929 | Bacteria | 2430 |
| 1472 | Ga0496126_0122123 | 3300048929 | Bacteria | 2258 |
| 1473 | Ga0496126_0528490 | 3300048929 | Bacteria | 939 |
| 1474 | Ga0501308_005631 | 3300049128 | Bacteria | 1255 |
| 1475 | Ga0501305_002547 | 3300049161 | Bacteria | 1980 |
| 1476 | Ga0495678_000237 | 3300049459 | Bacteria | 62286 |
| 1477 | Ga0495678_046180 | 3300049459 | Bacteria | 1713 |
| 1478 | Ga0495682_0010154 | 3300049460 | Bacteria | 3656 |
| 1479 | Ga0501031_0005253 | 3300049568 | Bacteria | 8442 |
| 1480 | Ga0501031_0081639 | 3300049568 | Bacteria | 2107 |
| 1481 | Ga0501031_0149859 | 3300049568 | Bacteria | 1524 |
| 1482 | Ga0501031_0523149 | 3300049568 | Bacteria | 765 |
| 1483 | Ga0501032_0005060 | 3300049569 | Bacteria | 9851 |
| 1484 | Ga0501032_0005454 | 3300049569 | Bacteria | 9442 |
| 1485 | Ga0501032_0123687 | 3300049569 | Bacteria | 1709 |
| 1486 | Ga0501032_0153567 | 3300049569 | Bacteria | 1513 |
| 1487 | Ga0501033_0000329 | 3300049570 | Bacteria | 45324 |
| 1488 | Ga0501033_0003729 | 3300049570 | Bacteria | 12395 |
| 1489 | Ga0501033_0019213 | 3300049570 | Bacteria | 5166 |
| 1490 | Ga0501033_0186760 | 3300049570 | Bacteria | 1484 |
| 1491 | Ga0501034_0000411 | 3300049571 | Bacteria | 72008 |
| 1492 | Ga0501034_0001357 | 3300049571 | Bacteria | 33066 |
| 1493 | Ga0501034_0001661 | 3300049571 | Bacteria | 28667 |
| 1494 | Ga0501034_0003703 | 3300049571 | Bacteria | 17262 |
| 1495 | Ga0501034_0037041 | 3300049571 | Bacteria | 4939 |
| 1496 | Ga0501034_0062696 | 3300049571 | Bacteria | 3733 |
| 1497 | Ga0501034_0123873 | 3300049571 | Bacteria | 2570 |
| 1498 | Ga0501034_0149559 | 3300049571 | Bacteria | 2311 |
| 1499 | Ga0501034_0183306 | 3300049571 | Bacteria | 2058 |
| 1500 | Ga0501034_0295390 | 3300049571 | Bacteria | 1557 |
| 1501 | Ga0501034_0331371 | 3300049571 | Bacteria | 1454 |
| 1502 | Ga0501034_0397917 | 3300049571 | Bacteria | 1300 |
| 1503 | Ga0501034_0727426 | 3300049571 | Bacteria | 889 |
| 1504 | Ga0501036_0005648 | 3300049572 | Bacteria | 10147 |
| 1505 | Ga0501036_0027370 | 3300049572 | Bacteria | 4818 |
| 1506 | Ga0501036_0045145 | 3300049572 | Bacteria | 3734 |
| 1507 | Ga0501036_0064157 | 3300049572 | Bacteria | 3109 |
| 1508 | Ga0501036_0328518 | 3300049572 | Bacteria | 1278 |
| 1509 | Ga0501036_0482795 | 3300049572 | Bacteria | 1031 |
| 1510 | Ga0501037_0007118 | 3300049573 | Bacteria | 8175 |
| 1511 | Ga0501037_0009391 | 3300049573 | Bacteria | 7176 |
| 1512 | Ga0501037_0044301 | 3300049573 | Bacteria | 3267 |
| 1513 | Ga0501037_0186342 | 3300049573 | Bacteria | 1470 |
| 1514 | Ga0501038_0002332 | 3300049574 | Bacteria | 17683 |
| 1515 | Ga0501038_0007237 | 3300049574 | Bacteria | 10252 |
| 1516 | Ga0501038_0020463 | 3300049574 | Bacteria | 5947 |
| 1517 | Ga0501038_0224483 | 3300049574 | Bacteria | 1497 |
| 1518 | Ga0501038_0330702 | 3300049574 | Bacteria | 1190 |
| 1519 | Ga0501038_0610420 | 3300049574 | Bacteria | 824 |
| 1520 | Ga0501039_0003401 | 3300049575 | Bacteria | 11893 |
| 1521 | Ga0501039_0013074 | 3300049575 | Bacteria | 6347 |
| 1522 | Ga0501039_0137852 | 3300049575 | Bacteria | 1916 |
| 1523 | Ga0501040_0002748 | 3300049576 | Bacteria | 11335 |
| 1524 | Ga0501040_0009977 | 3300049576 | Bacteria | 6202 |
| 1525 | Ga0501040_0029928 | 3300049576 | Bacteria | 3675 |
| 1526 | Ga0501041_0005212 | 3300049577 | Bacteria | 7592 |
| 1527 | Ga0501041_0105148 | 3300049577 | Bacteria | 1749 |
| 1528 | Ga0501042_0019042 | 3300049578 | Bacteria | 4763 |
| 1529 | Ga0501042_0037272 | 3300049578 | Bacteria | 3451 |
| 1530 | Ga0501042_0104451 | 3300049578 | Bacteria | 2038 |
| 1531 | Ga0501042_0325065 | 3300049578 | Bacteria | 1111 |
| 1532 | Ga0501043_0004587 | 3300049579 | Bacteria | 11206 |
| 1533 | Ga0501043_0005521 | 3300049579 | Bacteria | 10209 |
| 1534 | Ga0501043_0038883 | 3300049579 | Bacteria | 3741 |
| 1535 | Ga0501043_0079013 | 3300049579 | Bacteria | 2585 |
| 1536 | Ga0501043_0081864 | 3300049579 | Bacteria | 2537 |
| 1537 | Ga0501043_0123909 | 3300049579 | Bacteria | 2026 |
| 1538 | Ga0501043_0233102 | 3300049579 | Bacteria | 1421 |
| 1539 | Ga0501043_0447378 | 3300049579 | Bacteria | 971 |
| 1540 | Ga0501046_0000202 | 3300049580 | Bacteria | 61588 |
| 1541 | Ga0501046_0002951 | 3300049580 | Bacteria | 15738 |
| 1542 | Ga0501046_0008359 | 3300049580 | Bacteria | 9027 |
| 1543 | Ga0501046_0012744 | 3300049580 | Bacteria | 7153 |
| 1544 | Ga0501046_0020233 | 3300049580 | Bacteria | 5508 |
| 1545 | Ga0501046_0024836 | 3300049580 | Bacteria | 4910 |
| 1546 | Ga0501046_0045092 | 3300049580 | Bacteria | 3505 |
| 1547 | Ga0501046_0086828 | 3300049580 | Bacteria | 2411 |
| 1548 | Ga0501047_0000748 | 3300049581 | Bacteria | 33896 |
| 1549 | Ga0501047_0007229 | 3300049581 | Bacteria | 10437 |
| 1550 | Ga0501047_0034066 | 3300049581 | Bacteria | 4917 |
| 1551 | Ga0501047_0057135 | 3300049581 | Bacteria | 3774 |
| 1552 | Ga0501047_0080934 | 3300049581 | Bacteria | 3122 |
| 1553 | Ga0501047_0085772 | 3300049581 | Bacteria | 3025 |
| 1554 | Ga0501047_0099975 | 3300049581 | Bacteria | 2779 |
| 1555 | Ga0501047_0119717 | 3300049581 | Bacteria | 2515 |
| 1556 | Ga0501047_0202088 | 3300049581 | Unclassified | 1848 |
| 1557 | Ga0501047_0238805 | 3300049581 | Bacteria | 1668 |
| 1558 | Ga0501047_0286709 | 3300049581 | Bacteria | 1490 |
| 1559 | Ga0501048_0024201 | 3300049582 | Bacteria | 4432 |
| 1560 | Ga0501048_0026524 | 3300049582 | Bacteria | 4219 |
| 1561 | Ga0501048_0049453 | 3300049582 | Bacteria | 2996 |
| 1562 | Ga0501048_0110752 | 3300049582 | Bacteria | 1938 |
| 1563 | Ga0501067_0000969 | 3300049583 | Bacteria | 15401 |
| 1564 | Ga0501067_0004300 | 3300049583 | Bacteria | 7847 |
| 1565 | Ga0501067_0211324 | 3300049583 | Bacteria | 1081 |
| 1566 | Ga0501068_0108801 | 3300049584 | Bacteria | 1722 |
| 1567 | Ga0501068_0134694 | 3300049584 | Bacteria | 1546 |
| 1568 | Ga0501068_0165665 | 3300049584 | Bacteria | 1394 |
| 1569 | Ga0501068_0310731 | 3300049584 | Bacteria | 1010 |
| 1570 | Ga0501069_0008226 | 3300049585 | Bacteria | 5477 |
| 1571 | Ga0501069_0008287 | 3300049585 | Bacteria | 5458 |
| 1572 | Ga0501069_0009860 | 3300049585 | Bacteria | 5051 |
| 1573 | Ga0501069_0026830 | 3300049585 | Bacteria | 3155 |
| 1574 | Ga0501069_0037712 | 3300049585 | Bacteria | 2667 |
| 1575 | Ga0501069_0137842 | 3300049585 | Bacteria | 1399 |
| 1576 | Ga0501069_0220764 | 3300049585 | Bacteria | 1101 |
| 1577 | Ga0501069_0359915 | 3300049585 | Bacteria | 858 |
| 1578 | Ga0501070_0000511 | 3300049586 | Bacteria | 35493 |
| 1579 | Ga0501070_0000588 | 3300049586 | Bacteria | 33139 |
| 1580 | Ga0501070_0003969 | 3300049586 | Bacteria | 12730 |
| 1581 | Ga0501070_0007466 | 3300049586 | Bacteria | 9287 |
| 1582 | Ga0501070_0020658 | 3300049586 | Bacteria | 5523 |
| 1583 | Ga0501070_0038354 | 3300049586 | Bacteria | 3997 |
| 1584 | Ga0501070_0052819 | 3300049586 | Bacteria | 3372 |
| 1585 | Ga0501070_0063480 | 3300049586 | Bacteria | 3059 |
| 1586 | Ga0501070_0111768 | 3300049586 | Bacteria | 2258 |
| 1587 | Ga0501070_0156042 | 3300049586 | Bacteria | 1882 |
| 1588 | Ga0501070_0169190 | 3300049586 | Bacteria | 1800 |
| 1589 | Ga0501070_0261498 | 3300049586 | Bacteria | 1414 |
| 1590 | Ga0501070_0332190 | 3300049586 | Bacteria | 1235 |
| 1591 | Ga0501070_0341362 | 3300049586 | Bacteria | 1216 |
| 1592 | Ga0501071_0016581 | 3300049587 | Bacteria | 5068 |
| 1593 | Ga0501071_0068531 | 3300049587 | Bacteria | 2582 |
| 1594 | Ga0501071_0205135 | 3300049587 | Bacteria | 1481 |
| 1595 | Ga0501071_0268087 | 3300049587 | Bacteria | 1290 |
| 1596 | Ga0501072_0009507 | 3300049588 | Bacteria | 7394 |
| 1597 | Ga0501072_0031970 | 3300049588 | Bacteria | 4120 |
| 1598 | Ga0501072_0075815 | 3300049588 | Bacteria | 2660 |
| 1599 | Ga0501072_0094580 | 3300049588 | Bacteria | 2374 |
| 1600 | Ga0501073_0013953 | 3300049589 | Bacteria | 5840 |
| 1601 | Ga0501073_0016433 | 3300049589 | Bacteria | 5362 |
| 1602 | Ga0501073_0020861 | 3300049589 | Bacteria | 4725 |
| 1603 | Ga0501073_0037122 | 3300049589 | Bacteria | 3461 |
| 1604 | Ga0501073_0046668 | 3300049589 | Bacteria | 3045 |
| 1605 | Ga0501073_0051652 | 3300049589 | Bacteria | 2879 |
| 1606 | Ga0501073_0073633 | 3300049589 | Bacteria | 2378 |
| 1607 | Ga0501073_0085565 | 3300049589 | Bacteria | 2193 |
| 1608 | Ga0501073_0204491 | 3300049589 | Bacteria | 1365 |
| 1609 | Ga0501073_0279371 | 3300049589 | Bacteria | 1152 |
| 1610 | Ga0501074_0004544 | 3300049590 | Bacteria | 9933 |
| 1611 | Ga0501074_0006004 | 3300049590 | Bacteria | 8762 |
| 1612 | Ga0501074_0007085 | 3300049590 | Bacteria | 8101 |
| 1613 | Ga0501074_0009292 | 3300049590 | Bacteria | 7140 |
| 1614 | Ga0501074_0013181 | 3300049590 | Bacteria | 6011 |
| 1615 | Ga0501074_0053421 | 3300049590 | Bacteria | 2914 |
| 1616 | Ga0501074_0086594 | 3300049590 | Bacteria | 2244 |
| 1617 | Ga0501074_0175423 | 3300049590 | Bacteria | 1529 |
| 1618 | Ga0501075_0022125 | 3300049591 | Bacteria | 4642 |
| 1619 | Ga0501075_0143193 | 3300049591 | Bacteria | 1822 |
| 1620 | Ga0501076_0018272 | 3300049592 | Bacteria | 5343 |
| 1621 | Ga0501076_0251135 | 3300049592 | Bacteria | 1447 |
| 1622 | Ga0501079_0000982 | 3300049741 | Bacteria | 19647 |
| 1623 | Ga0501079_0079959 | 3300049741 | Bacteria | 2527 |
| 1624 | Ga0501079_0086907 | 3300049741 | Bacteria | 2420 |
| 1625 | Ga0501079_0224337 | 3300049741 | Bacteria | 1468 |
| 1626 | Ga0501079_0310252 | 3300049741 | Bacteria | 1234 |
| 1627 | Ga0501080_0001987 | 3300049742 | Bacteria | 17631 |
| 1628 | Ga0501080_0005078 | 3300049742 | Bacteria | 11725 |
| 1629 | Ga0501080_0009813 | 3300049742 | Bacteria | 8750 |
| 1630 | Ga0501080_0024565 | 3300049742 | Bacteria | 5587 |
| 1631 | Ga0501080_0026489 | 3300049742 | Bacteria | 5387 |
| 1632 | Ga0501080_0029269 | 3300049742 | Bacteria | 5127 |
| 1633 | Ga0501080_0037132 | 3300049742 | Bacteria | 4548 |
| 1634 | Ga0501080_0058835 | 3300049742 | Bacteria | 3576 |
| 1635 | Ga0501080_0119095 | 3300049742 | Bacteria | 2447 |
| 1636 | Ga0501080_0183587 | 3300049742 | Unclassified | 1924 |
| 1637 | Ga0501081_0002701 | 3300049743 | Bacteria | 11222 |
| 1638 | Ga0501083_0003824 | 3300049744 | Bacteria | 10573 |
| 1639 | Ga0501083_0012064 | 3300049744 | Bacteria | 6051 |
| 1640 | Ga0501083_0093189 | 3300049744 | Bacteria | 1988 |
| 1641 | Ga0501035_0003159 | 3300049822 | Bacteria | 15825 |
| 1642 | Ga0501035_0004686 | 3300049822 | Bacteria | 12978 |
| 1643 | Ga0501035_0011530 | 3300049822 | Bacteria | 8189 |
| 1644 | Ga0501035_0059213 | 3300049822 | Bacteria | 3411 |
| 1645 | Ga0501035_0065799 | 3300049822 | Bacteria | 3217 |
| 1646 | Ga0501035_0225887 | 3300049822 | Bacteria | 1597 |
| 1647 | Ga0501035_0288812 | 3300049822 | Bacteria | 1384 |
| 1648 | Ga0501035_0310314 | 3300049822 | Bacteria | 1327 |
| 1649 | Ga0501035_0466818 | 3300049822 | Bacteria | 1042 |
| 1650 | Ga0501044_0006675 | 3300049823 | Bacteria | 12721 |
| 1651 | Ga0501044_0009007 | 3300049823 | Bacteria | 10916 |
| 1652 | Ga0501044_0010264 | 3300049823 | Bacteria | 10172 |
| 1653 | Ga0501044_0030778 | 3300049823 | Bacteria | 5654 |
| 1654 | Ga0501044_0035211 | 3300049823 | Bacteria | 5244 |
| 1655 | Ga0501044_0051231 | 3300049823 | Bacteria | 4256 |
| 1656 | Ga0501044_0071532 | 3300049823 | Bacteria | 3526 |
| 1657 | Ga0501044_0088501 | 3300049823 | Bacteria | 3126 |
| 1658 | Ga0501044_0122205 | 3300049823 | Bacteria | 2603 |
| 1659 | Ga0501044_0128713 | 3300049823 | Bacteria | 2527 |
| 1660 | Ga0501044_0189331 | 3300049823 | Bacteria | 2021 |
| 1661 | Ga0501044_0476047 | 3300049823 | Bacteria | 1152 |
| 1662 | Ga0501044_0545866 | 3300049823 | Bacteria | 1056 |
| 1663 | Ga0501045_0001661 | 3300049824 | Bacteria | 14965 |
| 1664 | Ga0501045_0165938 | 3300049824 | Bacteria | 1644 |
| 1665 | Ga0501045_0196647 | 3300049824 | Bacteria | 1503 |
| 1666 | nmdc:mga05p37_253260_c1 | 3300050507 | Bacteria | 2111 |
| 1667 | nmdc:mga05p37_43420_c1 | 3300050507 | Bacteria | 5531 |
| 1668 | nmdc:mga08y16_288964_c1 | 3300050511 | Bacteria | 1690 |
| 1669 | nmdc:mga0n895_121117_c1 | 3300050512 | Bacteria | 2638 |
| 1670 | nmdc:mga0rr50_798_c1 | 3300050513 | Bacteria | 17004 |
| 1671 | nmdc:mga08x19_107361_c1 | 3300050514 | Bacteria | 1859 |
| 1672 | nmdc:mga08x19_193477_c1 | 3300050514 | Bacteria | 1392 |
| 1673 | nmdc:mga08x19_40745_c1 | 3300050514 | Bacteria | 2957 |
| 1674 | nmdc:mga0a205_67618_c1 | 3300050515 | Bacteria | 3452 |
| 1675 | nmdc:mga0sz30_9663_c1 | 3300050516 | Bacteria | 3676 |
| 1676 | Ga0500610_0013261 | 3300053079 | Bacteria | 3829 |
| 1677 | Ga0500643_000020 | 3300053087 | Bacteria | 290328 |
| 1678 | Ga0500643_036015 | 3300053087 | Bacteria | 1479 |
| 1679 | Ga0500651_0000592 | 3300053093 | Bacteria | 18193 |
| 1680 | Ga0500555_000336 | 3300053103 | Bacteria | 20134 |
| 1681 | Ga0500597_027420 | 3300053120 | Bacteria | 2314 |
| 1682 | Ga0500652_085216 | 3300053131 | Bacteria | 1317 |
| 1683 | Ga0500559_0144884 | 3300053136 | Bacteria | 1113 |
| 1684 | Ga0500561_0014856 | 3300053137 | Bacteria | 1717 |
| 1685 | Ga0500568_0000145 | 3300053139 | Bacteria | 62300 |
| 1686 | Ga0500627_0119526 | 3300053158 | Bacteria | 1188 |
| 1687 | Ga0500633_0000702 | 3300053160 | Bacteria | 5658 |
| 1688 | Ga0500636_0214431 | 3300053177 | Bacteria | 1008 |
| 1689 | Ga0500645_001746 | 3300053730 | Bacteria | 10543 |
| 1690 | Ga0501084_0002444 | 3300054114 | Bacteria | 14939 |
| 1691 | Ga0501084_0077485 | 3300054114 | Bacteria | 2787 |
| 1692 | Ga0501084_0315743 | 3300054114 | Bacteria | 1320 |
| 1693 | Ga0500661_007161 | 3300055283 | Bacteria | 2070 |
| 1694 | Ga0587073_0002117 | 3300059492 | Bacteria | 2486 |
| 1695 | Ga0587082_000953 | 3300059504 | Bacteria | 2763 |
| 1696 | Ga0587083_0017763 | 3300059505 | Bacteria | 1277 |
| 1697 | Ga0587088_021761 | 3300059508 | Bacteria | 1075 |
| 1698 | Ga0587106_011083 | 3300059605 | Bacteria | 1181 |
| 1699 | Ga0587076_002674 | 3300059645 | Bacteria | 2030 |
| 1700 | Ga0501082_0000082 | 3300060353 | Bacteria | 71065 |
| 1701 | Ga0501082_0001816 | 3300060353 | Bacteria | 18794 |
| 1702 | Ga0501082_0160299 | 3300060353 | Bacteria | 1955 |
| 1703 | Ga0501082_0197205 | 3300060353 | Bacteria | 1751 |
| 1704 | Ga0501082_0330353 | 3300060353 | Bacteria | 1328 |
| 1705 | Ga0466962_0002443 | 3300061719 | Bacteria | 8811 |
| 1706 | Ga0466962_0061287 | 3300061719 | Bacteria | 1796 |
| 1707 | Ga0530510_0013467 | 3300061734 | Bacteria | 5750 |
| 1708 | Ga0530510_0101826 | 3300061734 | Bacteria | 2100 |
| 1709 | 2511266537 | 2511231006 | Bacteria | 6794709 |
| 1710 | 2511320490 | 2511231015 | Bacteria | 6598026 |
| 1711 | 2511369125 | 2511231023 | Bacteria | 6808468 |
| 1712 | 2511411098 | 2511231031 | Bacteria | 6558529 |
| 1713 | 2512328328 | 2512047018 | Bacteria | 6663241 |
| 1714 | 2513953180 | 2513237150 | Bacteria | 6553639 |
| 1715 | 2514042145 | 2513237165 | Bacteria | 6771773 |
| 1716 | 2525555961 | 2524614729 | Bacteria | 3091755 |
| 1717 | 2538832269 | 2537561836 | Bacteria | 3910579 |
| 1718 | 2555668058 | 2554235341 | Bacteria | 6867980 |
| 1719 | 2583790500 | 2582580891 | Bacteria | 6800976 |
| 1720 | 2595446802 | 2593339238 | Bacteria | 4182970 |
| 1721 | 2595449564 | 2593339239 | Bacteria | 4124669 |
| 1722 | 2597856273 | 2597489887 | Bacteria | 6666321 |
| 1723 | 2599483471 | 2599185185 | Bacteria | 6652270 |
| 1724 | 2599805377 | 2599185257 | Bacteria | 6492581 |
| 1725 | 2600364083 | 2600254931 | Bacteria | 6734225 |
| 1726 | 2600442452 | 2600254954 | Bacteria | 5100516 |
| 1727 | 2602012386 | 2600255389 | Bacteria | 5275336 |
| 1728 | 2630650975 | 2627854209 | Bacteria | 3093011 |
| 1729 | 2643830279 | 2643221562 | Bacteria | 4048635 |
| 1730 | 2643896784 | 2643221577 | Bacteria | 3710843 |
| 1731 | 2644030482 | 2643221603 | Bacteria | 6147767 |
| 1732 | 2644478989 | 2643221685 | Bacteria | 3673288 |
| 1733 | 2671767887 | 2671180172 | Bacteria | 6495783 |
| 1734 | 2687580517 | 2687453129 | Bacteria | 4387428 |
| 1735 | 2687583772 | 2687453130 | Bacteria | 4227172 |
| 1736 | 2715750794 | 2713897148 | Bacteria | 5883533 |
| 1737 | 2718632724 | 2718217725 | Bacteria | 5758958 |
| 1738 | 2721026525 | 2718218334 | Bacteria | 4765486 |
| 1739 | 2735833480 | 2734482264 | Unclassified | 5014763 |
| 1740 | 2739229481 | 2738543009 | Bacteria | 4944499 |
| 1741 | 2739316443 | 2738543025 | Bacteria | 6600348 |
| 1742 | 2739730256 | 2739367700 | Bacteria | 4747630 |
| 1743 | 2743735682 | 2740892503 | Bacteria | 6855563 |
| 1744 | 2808943050 | 2808606379 | Bacteria | 5022697 |
| 1745 | 2819563958 | 2818991440 | Bacteria | 4774720 |
| 1746 | 2823422551 | 2823421272 | Bacteria | 5372474 |
| 1747 | 2842835691 | 2842832357 | Bacteria | 5959113 |
| 1748 | 2842847438 | 2842843487 | Bacteria | 6004777 |
| 1749 | 2842918502 | 2842914999 | Bacteria | 4419378 |
| 1750 | 2842919876 | 2842918807 | Bacteria | 4289178 |
| 1751 | 2846037042 | 2846033681 | Bacteria | 4377894 |
| 1752 | 2858697910 | 2858688981 | Bacteria | 8184122 |
| 1753 | 2884341474 | 2884338543 | Bacteria | 4610696 |
| 1754 | 2884412148 | 2884411467 | Bacteria | 5246714 |
| 1755 | 2894414648 | 2894414249 | Bacteria | 4405451 |
| 1756 | 2894510786 | 2894510363 | Bacteria | 5121143 |
| 1757 | 2895397666 | 2895395659 | Bacteria | 3983269 |
| 1758 | 2901308509 | 2901300506 | Bacteria | 8463898 |
| 1759 | 2904464594 | 2904463128 | Bacteria | 4775606 |
| 1760 | 2919088324 | 2919085039 | Bacteria | 4532964 |
| 1761 | 2919385856 | 2919385768 | Bacteria | 5897293 |
| 1762 | 2919406093 | 2919404418 | Bacteria | 4232372 |
| 1763 | 2919490641 | 2919487758 | Bacteria | 5929766 |
| 1764 | 2919505010 | 2919501602 | Bacteria | 5286340 |
| 1765 | 2923154691 | 2923153595 | Bacteria | 6870622 |
| 1766 | 2926066687 | 2926063275 | Bacteria | 5285848 |
| 1767 | 2928967692 | 2928963466 | Bacteria | 5165703 |
| 1768 | 2939612519 | 2939611941 | Bacteria | 3892017 |
| 1769 | 2941472924 | 2941471342 | Bacteria | 5018624 |
| 1770 | 2953995173 | 2953994433 | Bacteria | 4303959 |
| 1771 | 2969305626 | 2969304461 | Bacteria | 6601805 |
| 1772 | 2974292741 | 2974289157 | Bacteria | 6080362 |
| 1773 | 2984291338 | 2984286254 | Bacteria | 6702062 |
| 1774 | 2998141069 | 2998139840 | Bacteria | 6073514 |
| 1775 | 2998348353 | 2998344455 | Bacteria | 4222996 |
| 1776 | 3007256036 | 3007252601 | Bacteria | 4559114 |
| 1777 | 3007319893 | 3007315729 | Bacteria | 5076637 |
| 1778 | 3007400221 | 3007395558 | Bacteria | 6755444 |
| 1779 | 3007420705 | 3007419365 | Bacteria | 7026924 |
| 1780 | 3007619695 | 3007614139 | Bacteria | 6053559 |
| 1781 | 3007860950 | 3007855910 | Bacteria | 5637581 |
| 1782 | 3007863710 | 3007861166 | Bacteria | 6045338 |
| 1783 | 644747125 | 644736347 | Bacteria | 6476522 |
| 1784 | 8002747903 | 8002745576 | Bacteria | 4840272 |
| 1785 | 8015688927 | 8015687852 | Bacteria | 6613826 |
| 1786 | 8029999693 | 8029995093 | Bacteria | 5990776 |
| 1787 | 8034964162 | 8034962539 | Bacteria | 4884839 |
| 1788 | 8055772044 | 8055770955 | Bacteria | 6827675 |
| 1789 | 8056169982 | 8056166840 | Bacteria | 5820959 |
| 1790 | Ga0163162_10250967 | |||
| 1791 | JGI24736J21556_1006935 | |||
| 1792 | JGI24736J21556_1010588 | |||
| 1793 | JGI24741J21665_1001528 | |||
| 1794 | JGI24741J21665_1004362 | |||
| 1795 | JGI24741J21665_1009278 | |||
| 1796 | JGI24740J21852_10001136 | |||
| 1797 | JGI24740J21852_10003252 | |||
| 1798 | JGI24740J21852_10003557 | |||
| 1799 | JGI24739J22299_10002603 | |||
| 1800 | JGI24739J22299_10007598 | |||
| 1801 | JGI24737J22298_10000899 | |||
| 1802 | JGI24735J21928_10011929 | |||
| 1803 | JGI24744J21845_10016356 | |||
| 1804 | JGI25156J39149_1004589 | |||
| 1805 | JGI25156J39149_1010939 | |||
| 1806 | JGI25162J39368_1000029 | |||
| 1807 | JGI25162J39368_1000257 | |||
| 1808 | JGI25162J39368_1000686 | |||
| 1809 | JGI25162J39368_1005350 | |||
| 1810 | JGI25162J39368_1006243 | |||
| 1811 | JGI25154J39366_1002591 | |||
| 1812 | JGI25157J39369_1000996 | |||
| 1813 | JGI25157J39369_1001342 | |||
| 1814 | JGI25157J39369_1001369 | |||
| 1815 | JGI25157J39369_1002698 | |||
| 1816 | JGI25163J39215_1000989 | |||
| 1817 | JGI25164J39214_1000045 | |||
| 1818 | JGI25164J39214_1000202 | |||
| 1819 | JGI25164J39214_1001231 | |||
| 1820 | JGI25151J46595_10002568 | |||
| 1821 | JGI25151J46595_10011802 | |||
| 1822 | JGI25151J46595_10024630 | |||
| 1823 | JGI25165J46597_1000072 | |||
| 1824 | JGI25165J46597_1000361 | |||
| 1825 | JGI25165J46597_1002202 | |||
| 1826 | JGI25153J46596_10043492 | |||
| 1827 | rootH1_10003782 | |||
| 1828 | rootH1_10052609 | |||
| 1829 | rootH2_10001711 | |||
| 1830 | rootL2_10105381 | |||
| 1831 | Ga0006560J51390_1028717 | |||
| 1832 | Ga0006562J51391_1014503 | |||
| 1833 | Ga0006562J51391_1014504 | |||
| 1834 | Ga0055538_1001576 | |||
| 1835 | Ga0055533_1000617 | |||
| 1836 | Ga0055533_1001801 | |||
| 1837 | Ga0055525_1000027 | |||
| 1838 | Ga0055527_1000293 | |||
| 1839 | Ga0055527_1000294 | |||
| 1840 | Ga0055527_1000694 | |||
| 1841 | Ga0055535_1000623 | |||
| 1842 | Ga0055535_1001746 | |||
| 1843 | Ga0055535_1002327 | |||
| 1844 | Ga0055535_1009433 | |||
| 1845 | Ga0055535_1009450 | |||
| 1846 | Ga0055542_1000329 | |||
| 1847 | Ga0055542_1000649 | |||
| 1848 | Ga0055542_1006140 | |||
| 1849 | Ga0055542_1006760 | |||
| 1850 | Ga0055542_1010547 | |||
| 1851 | Ga0055542_1010580 | |||
| 1852 | Ga0055529_1001508 | |||
| 1853 | Ga0055529_1002348 | |||
| 1854 | Ga0055529_1005126 | |||
| 1855 | Ga0055529_1006206 | |||
| 1856 | Ga0055529_1006222 | |||
| 1857 | Ga0055526_1000580 | |||
| 1858 | Ga0055526_1018820 | |||
| 1859 | Ga0055526_1026663 | |||
| 1860 | Ga0055537_1000822 | |||
| 1861 | Ga0055524_1001415 | |||
| 1862 | Ga0055524_1003597 | |||
| 1863 | Ga0055524_1013467 | |||
| 1864 | Ga0055536_1000020 | |||
| 1865 | Ga0055534_1000601 | |||
| 1866 | Ga0055534_1001148 | |||
| 1867 | Ga0055534_1003594 | |||
| 1868 | Ga0055528_1000050 | |||
| 1869 | Ga0055540_1025844 | |||
| 1870 | Ga0065165_1000587 | |||
| 1871 | Ga0065165_1003615 | |||
| 1872 | Ga0070658_10004423 | |||
| 1873 | Ga0070658_10079714 | |||
| 1874 | Ga0070658_10131004 | |||
| 1875 | Ga0070658_10297438 | |||
| 1876 | Ga0070658_10325742 | |||
| 1877 | Ga0070658_10400607 | |||
| 1878 | Ga0070658_10518964 | |||
| 1879 | Ga0070658_10694702 | |||
| 1880 | Ga0070676_10000078 | |||
| 1881 | Ga0070676_10059283 | |||
| 1882 | Ga0070683_100119371 | |||
| 1883 | Ga0070683_100128406 | |||
| 1884 | Ga0070683_100184171 | |||
| 1885 | Ga0070683_100187357 | |||
| 1886 | Ga0070683_100318777 | |||
| 1887 | Ga0070683_100343947 | |||
| 1888 | Ga0070690_100204832 | |||
| 1889 | Ga0070690_100205152 | |||
| 1890 | Ga0070670_100009753 | |||
| 1891 | Ga0070670_100150273 | |||
| 1892 | Ga0070670_100366514 | |||
| 1893 | Ga0068869_100000679 | |||
| 1894 | Ga0068869_100046919 | |||
| 1895 | Ga0068869_100223687 | |||
| 1896 | Ga0070666_10000005 | |||
| 1897 | Ga0070666_10000109 | |||
| 1898 | Ga0070666_10003252 | |||
| 1899 | Ga0070666_10216277 | |||
| 1900 | Ga0070680_100002566 | |||
| 1901 | Ga0070680_100035951 | |||
| 1902 | Ga0070680_100085679 | |||
| 1903 | Ga0070680_100100598 | |||
| 1904 | Ga0070680_100150299 | |||
| 1905 | Ga0070680_100227890 | |||
| 1906 | Ga0070680_100600616 | |||
| 1907 | Ga0070682_100001048 | |||
| 1908 | Ga0070682_100005998 | |||
| 1909 | Ga0070682_100011654 | |||
| 1910 | Ga0070682_100014093 | |||
| 1911 | Ga0070682_100026910 | |||
| 1912 | Ga0070682_100103446 | |||
| 1913 | Ga0070682_100265407 | |||
| 1914 | Ga0068868_100005961 | |||
| 1915 | Ga0068868_100045091 | |||
| 1916 | Ga0068868_100145667 | |||
| 1917 | Ga0068868_100183755 | |||
| 1918 | Ga0070660_100000369 | |||
| 1919 | Ga0070660_100035972 | |||
| 1920 | Ga0070660_100166347 | |||
| 1921 | Ga0070660_100206953 | |||
| 1922 | Ga0070689_100000503 | |||
| 1923 | Ga0070689_100463040 | |||
| 1924 | Ga0070691_10003685 | |||
| 1925 | Ga0070691_10004460 | |||
| 1926 | Ga0070691_10103569 | |||
| 1927 | Ga0070691_10119729 | |||
| 1928 | Ga0070691_10122129 | |||
| 1929 | Ga0070661_100000449 | |||
| 1930 | Ga0070661_100011087 | |||
| 1931 | Ga0070661_100027110 | |||
| 1932 | Ga0070661_100031058 | |||
| 1933 | Ga0070661_100037672 | |||
| 1934 | Ga0070661_100043927 | |||
| 1935 | Ga0070661_100132250 | |||
| 1936 | Ga0070661_100165830 | |||
| 1937 | Ga0070661_100673044 | |||
| 1938 | Ga0070692_10001584 | |||
| 1939 | Ga0070692_10015943 | |||
| 1940 | Ga0070692_10018107 | |||
| 1941 | Ga0070692_10088543 | |||
| 1942 | Ga0070668_100013598 | |||
| 1943 | Ga0070668_100030062 | |||
| 1944 | Ga0070668_100068441 | |||
| 1945 | Ga0070668_100112657 | |||
| 1946 | Ga0070668_100193652 | |||
| 1947 | Ga0070668_100421454 | |||
| 1948 | Ga0070669_100068181 | |||
| 1949 | Ga0070669_100071564 | |||
| 1950 | Ga0070669_100197913 | |||
| 1951 | Ga0070675_100067894 | |||
| 1952 | Ga0070675_100106792 | |||
| 1953 | Ga0070675_100293549 | |||
| 1954 | Ga0070671_100070009 | |||
| 1955 | Ga0070671_100141142 | |||
| 1956 | Ga0070671_100183076 | |||
| 1957 | Ga0070674_100231432 | |||
| 1958 | Ga0070674_100520571 | |||
| 1959 | Ga0070673_100033543 | |||
| 1960 | Ga0070673_100073836 | |||
| 1961 | Ga0070673_100266670 | |||
| 1962 | Ga0070688_100109365 | |||
| 1963 | Ga0070688_100376323 | |||
| 1964 | Ga0070659_100003864 | |||
| 1965 | Ga0070659_100035435 | |||
| 1966 | Ga0070659_100109214 | |||
| 1967 | Ga0070659_100179434 | |||
| 1968 | Ga0070659_100196476 | |||
| 1969 | Ga0070659_100277474 | |||
| 1970 | Ga0070659_100283525 | |||
| 1971 | Ga0070667_100000005 | |||
| 1972 | Ga0070667_100011088 | |||
| 1973 | Ga0070667_100018821 | |||
| 1974 | Ga0070667_100036335 | |||
| 1975 | Ga0070667_100258782 | |||
| 1976 | Ga0070667_100307674 | |||
| 1977 | Ga0070667_100321454 | |||
| 1978 | Ga0070667_100334108 | |||
| 1979 | Ga0070703_10012638 | |||
| 1980 | Ga0070714_100035856 | |||
| 1981 | Ga0070714_100115600 | |||
| 1982 | Ga0070713_100002641 | |||
| 1983 | Ga0070711_100190947 | |||
| 1984 | Ga0070705_100000292 | |||
| 1985 | Ga0070694_100088104 | |||
| 1986 | Ga0070694_100115209 | |||
| 1987 | Ga0070708_100018903 | |||
| 1988 | Ga0070708_100323608 | |||
| 1989 | Ga0070708_100414067 | |||
| 1990 | Ga0070708_100644124 | |||
| 1991 | Ga0070663_100001614 | |||
| 1992 | Ga0070663_100002590 | |||
| 1993 | Ga0070663_100003691 | |||
| 1994 | Ga0070663_100003836 | |||
| 1995 | Ga0070663_100023092 | |||
| 1996 | Ga0070663_100027969 | |||
| 1997 | Ga0070663_100094637 | |||
| 1998 | Ga0070663_100226957 | |||
| 1999 | Ga0070663_100287362 | |||
| 2000 | Ga0070663_100411181 | |||
| 2001 | Ga0070663_100795687 | |||
| 2002 | Ga0070678_100032720 | |||
| 2003 | Ga0070678_100068406 | |||
| 2004 | Ga0070662_100001136 | |||
| 2005 | Ga0070662_100043134 | |||
| 2006 | Ga0070662_100050898 | |||
| 2007 | Ga0070662_100066979 | |||
| 2008 | Ga0070662_100143413 | |||
| 2009 | Ga0070662_100171880 | |||
| 2010 | Ga0070681_10000122 | |||
| 2011 | Ga0070681_10003994 | |||
| 2012 | Ga0070681_10004905 | |||
| 2013 | Ga0070681_10044503 | |||
| 2014 | Ga0070681_10114722 | |||
| 2015 | Ga0070681_10121667 | |||
| 2016 | Ga0070681_10187020 | |||
| 2017 | Ga0070681_10348376 | |||
| 2018 | Ga0070681_10415251 | |||
| 2019 | Ga0070681_10453641 | |||
| 2020 | Ga0068867_100002791 | |||
| 2021 | Ga0068867_100014624 | |||
| 2022 | Ga0068867_100117777 | |||
| 2023 | Ga0068867_100273716 | |||
| 2024 | Ga0068867_100285344 | |||
| 2025 | Ga0070685_10007066 | |||
| 2026 | Ga0070685_10052180 | |||
| 2027 | Ga0070706_100015314 | |||
| 2028 | Ga0070706_100054339 | |||
| 2029 | Ga0070706_100067931 | |||
| 2030 | Ga0070707_100080966 | |||
| 2031 | Ga0070698_100012924 | |||
| 2032 | Ga0070698_100041165 | |||
| 2033 | Ga0070699_100024294 | |||
| 2034 | Ga0070699_100032858 | |||
| 2035 | Ga0070699_100102912 | |||
| 2036 | Ga0070679_100001153 | |||
| 2037 | Ga0070679_100001205 | |||
| 2038 | Ga0070679_100006031 | |||
| 2039 | Ga0070679_100029564 | |||
| 2040 | Ga0070679_100082714 | |||
| 2041 | Ga0070679_100157157 | |||
| 2042 | Ga0070679_100434738 | |||
| 2043 | Ga0070684_100004922 | |||
| 2044 | Ga0070684_100131879 | |||
| 2045 | Ga0070684_100256986 | |||
| 2046 | Ga0070697_100000561 | |||
| 2047 | Ga0070697_100017353 | |||
| 2048 | Ga0070697_100031854 | |||
| 2049 | Ga0070697_100228890 | |||
| 2050 | Ga0068853_100003605 | |||
| 2051 | Ga0068853_100015685 | |||
| 2052 | Ga0068853_100030340 | |||
| 2053 | Ga0068853_100030487 | |||
| 2054 | Ga0068853_100060929 | |||
| 2055 | Ga0068853_100062449 | |||
| 2056 | Ga0068853_100097425 | |||
| 2057 | Ga0068853_100098452 | |||
| 2058 | Ga0068853_100136503 | |||
| 2059 | Ga0068853_100139695 | |||
| 2060 | Ga0068853_100307837 | |||
| 2061 | Ga0068853_100487258 | |||
| 2062 | Ga0070672_100015511 | |||
| 2063 | Ga0070672_100022870 | |||
| 2064 | Ga0070672_100071348 | |||
| 2065 | Ga0070672_100107701 | |||
| 2066 | Ga0070672_100161959 | |||
| 2067 | Ga0070672_100288116 | |||
| 2068 | Ga0070695_100018060 | |||
| 2069 | Ga0070695_100092135 | |||
| 2070 | Ga0070695_100120739 | |||
| 2071 | Ga0070696_100000277 | |||
| 2072 | Ga0070696_100002542 | |||
| 2073 | Ga0070696_100014375 | |||
| 2074 | Ga0070696_100031811 | |||
| 2075 | Ga0070696_100043559 | |||
| 2076 | Ga0070696_100044652 | |||
| 2077 | Ga0070696_100069181 | |||
| 2078 | Ga0070696_100210264 | |||
| 2079 | Ga0070693_100000692 | |||
| 2080 | Ga0070693_100012046 | |||
| 2081 | Ga0070693_100020805 | |||
| 2082 | Ga0070693_100029136 | |||
| 2083 | Ga0070693_100081272 | |||
| 2084 | Ga0070693_100204112 | |||
| 2085 | Ga0070665_100000057 | |||
| 2086 | Ga0070665_100000838 | |||
| 2087 | Ga0070665_100041503 | |||
| 2088 | Ga0070665_100146563 | |||
| 2089 | Ga0070665_100217554 | |||
| 2090 | Ga0070665_100250182 | |||
| 2091 | Ga0070665_100317672 | |||
| 2092 | Ga0070665_100499306 | |||
| 2093 | Ga0070704_100000361 | |||
| 2094 | Ga0068855_100000559 | |||
| 2095 | Ga0068855_100002399 | |||
| 2096 | Ga0068855_100024413 | |||
| 2097 | Ga0068855_100034536 | |||
| 2098 | Ga0068855_100100139 | |||
| 2099 | Ga0068855_100155534 | |||
| 2100 | Ga0068855_100159346 | |||
| 2101 | Ga0068855_100293923 | |||
| 2102 | Ga0068855_100360132 | |||
| 2103 | Ga0070664_100002942 | |||
| 2104 | Ga0070664_100060997 | |||
| 2105 | Ga0070664_100074821 | |||
| 2106 | Ga0068857_100000591 | |||
| 2107 | Ga0068857_100005102 | |||
| 2108 | Ga0068857_100026022 | |||
| 2109 | Ga0068857_100040303 | |||
| 2110 | Ga0068857_100244529 | |||
| 2111 | Ga0068857_100284186 | |||
| 2112 | Ga0068857_100454352 | |||
| 2113 | Ga0068854_100000497 | |||
| 2114 | Ga0068854_100010672 | |||
| 2115 | Ga0068854_100047075 | |||
| 2116 | Ga0068854_100204707 | |||
| 2117 | Ga0068854_100226578 | |||
| 2118 | Ga0068856_100000940 | |||
| 2119 | Ga0068856_100001887 | |||
| 2120 | Ga0068856_100008425 | |||
| 2121 | Ga0068856_100049386 | |||
| 2122 | Ga0068856_100055647 | |||
| 2123 | Ga0068856_100126308 | |||
| 2124 | Ga0068856_100144506 | |||
| 2125 | Ga0068856_100219979 | |||
| 2126 | Ga0068856_100221061 | |||
| 2127 | Ga0068856_100310128 | |||
| 2128 | Ga0068856_100323501 | |||
| 2129 | Ga0068856_100547304 | |||
| 2130 | Ga0070702_100279397 | |||
| 2131 | Ga0068852_100020193 | |||
| 2132 | Ga0068852_100038168 | |||
| 2133 | Ga0068852_100056139 | |||
| 2134 | Ga0068852_100167375 | |||
| 2135 | Ga0068852_100189399 | |||
| 2136 | Ga0068852_100298511 | |||
| 2137 | Ga0068852_100345723 | |||
| 2138 | Ga0068852_100354288 | |||
| 2139 | Ga0068852_100424242 | |||
| 2140 | Ga0068852_100435473 | |||
| 2141 | Ga0068859_100001188 | |||
| 2142 | Ga0068859_100003247 | |||
| 2143 | Ga0068859_100038947 | |||
| 2144 | Ga0068859_100183596 | |||
| 2145 | Ga0068859_100583789 | |||
| 2146 | Ga0068864_100015261 | |||
| 2147 | Ga0068864_100137235 | |||
| 2148 | Ga0068864_100171677 | |||
| 2149 | Ga0068864_100208859 | |||
| 2150 | Ga0068861_100006592 | |||
| 2151 | Ga0068861_100054679 | |||
| 2152 | Ga0068861_100271260 | |||
| 2153 | Ga0068851_10001445 | |||
| 2154 | Ga0068851_10016464 | |||
| 2155 | Ga0068851_10139662 | |||
| 2156 | Ga0068851_10248850 | |||
| 2157 | Ga0068870_10000438 | |||
| 2158 | Ga0068863_100010303 | |||
| 2159 | Ga0068863_100090958 | |||
| 2160 | Ga0068863_100235473 | |||
| 2161 | Ga0068863_100518929 | |||
| 2162 | Ga0068863_100660228 | |||
| 2163 | Ga0068858_100001163 | |||
| 2164 | Ga0068858_100023895 | |||
| 2165 | Ga0068858_100024853 | |||
| 2166 | Ga0068858_100038899 | |||
| 2167 | Ga0068858_100220414 | |||
| 2168 | Ga0068858_100361783 | |||
| 2169 | Ga0068858_100448019 | |||
| 2170 | Ga0068860_100009879 | |||
| 2171 | Ga0068860_100011610 | |||
| 2172 | Ga0068860_100012175 | |||
| 2173 | Ga0068860_100052752 | |||
| 2174 | Ga0068860_100471054 | |||
| 2175 | Ga0068860_100499246 | |||
| 2176 | Ga0068860_100653003 | |||
| 2177 | Ga0068862_100003503 | |||
| 2178 | Ga0068862_100023439 | |||
| 2179 | Ga0068862_100046061 | |||
| 2180 | Ga0068862_100048171 | |||
| 2181 | Ga0068862_100248880 | |||
| 2182 | Ga0081455_10029994 | |||
| 2183 | Ga0081455_10048313 | |||
| 2184 | Ga0081540_1000778 | |||
| 2185 | Ga0081540_1002617 | |||
| 2186 | Ga0081539_10004036 | |||
| 2187 | Ga0070717_10356078 | |||
| 2188 | Ga0075363_100042233 | |||
| 2189 | Ga0075369_10005288 | |||
| 2190 | Ga0075366_10203433 | |||
| 2191 | Ga0097621_100061006 | |||
| 2192 | Ga0097621_100065210 | |||
| 2193 | Ga0097621_100087245 | |||
| 2194 | Ga0097621_100121627 | |||
| 2195 | Ga0097621_100166539 | |||
| 2196 | Ga0097621_100180020 | |||
| 2197 | Ga0068871_100029228 | |||
| 2198 | Ga0068871_100043867 | |||
| 2199 | Ga0068871_100099326 | |||
| 2200 | Ga0075428_100259142 | |||
| 2201 | Ga0075433_10005758 | |||
| 2202 | Ga0075433_10072430 | |||
| 2203 | Ga0075434_100080191 | |||
| 2204 | Ga0075434_100102288 | |||
| 2205 | Ga0068865_100115381 | |||
| 2206 | Ga0068865_100171583 | |||
| 2207 | Ga0068865_100237310 | |||
| 2208 | Ga0075436_100170331 | |||
| 2209 | Ga0097620_100001188 | |||
| 2210 | Ga0097620_100003247 | |||
| 2211 | Ga0097620_100038946 | |||
| 2212 | Ga0097620_100183608 | |||
| 2213 | Ga0097620_100583927 | |||
| 2214 | Ga0099826_10000004 | |||
| 2215 | Ga0099794_10018520 | |||
| 2216 | Ga0099794_10023823 | |||
| 2217 | Ga0105244_10085977 | |||
| 2218 | Ga0105240_10000931 | |||
| 2219 | Ga0105240_10014485 | |||
| 2220 | Ga0105240_10018571 | |||
| 2221 | Ga0105240_10038619 | |||
| 2222 | Ga0105240_10077509 | |||
| 2223 | Ga0105240_10130805 | |||
| 2224 | Ga0105240_10171297 | |||
| 2225 | Ga0105240_10301359 | |||
| 2226 | Ga0105240_10384666 | |||
| 2227 | Ga0105240_10525973 | |||
| 2228 | Ga0105240_10611385 | |||
| 2229 | Ga0105245_10058222 | |||
| 2230 | Ga0105245_10176080 | |||
| 2231 | Ga0105245_10368152 | |||
| 2232 | Ga0105245_10579081 | |||
| 2233 | Ga0105245_10754806 | |||
| 2234 | Ga0114129_10079228 | |||
| 2235 | Ga0114129_10118723 | |||
| 2236 | Ga0114129_10176245 | |||
| 2237 | Ga0105243_10247287 | |||
| 2238 | Ga0105243_10871699 | |||
| 2239 | Ga0105241_10000966 | |||
| 2240 | Ga0105241_10034302 | |||
| 2241 | Ga0105241_10107632 | |||
| 2242 | Ga0105241_10141839 | |||
| 2243 | Ga0105241_10183109 | |||
| 2244 | Ga0105242_10000940 | |||
| 2245 | Ga0105248_10001462 | |||
| 2246 | Ga0105248_10184190 | |||
| 2247 | Ga0105248_10251892 | |||
| 2248 | Ga0105248_10395924 | |||
| 2249 | Ga0105248_10976783 | |||
| 2250 | Ga0105237_10000007 | |||
| 2251 | Ga0105237_10000064 | |||
| 2252 | Ga0105237_10004545 | |||
| 2253 | Ga0105237_10008004 | |||
| 2254 | Ga0105237_10049193 | |||
| 2255 | Ga0105237_10096955 | |||
| 2256 | Ga0105237_10173710 | |||
| 2257 | Ga0105237_10640253 | |||
| 2258 | Ga0105238_10000924 | |||
| 2259 | Ga0105238_10001307 | |||
| 2260 | Ga0105238_10010394 | |||
| 2261 | Ga0105238_10021154 | |||
| 2262 | Ga0105238_10027655 | |||
| 2263 | Ga0105238_10035391 | |||
| 2264 | Ga0105238_10042220 | |||
| 2265 | Ga0105238_10107765 | |||
| 2266 | Ga0105238_10122721 | |||
| 2267 | Ga0105238_10128356 | |||
| 2268 | Ga0105238_10439323 | |||
| 2269 | Ga0105238_10587977 | |||
| 2270 | Ga0105249_10000763 | |||
| 2271 | Ga0105249_10271332 | |||
| 2272 | Ga0105249_10462895 | |||
| 2273 | Ga0105239_10008425 | |||
| 2274 | Ga0105239_10010561 | |||
| 2275 | Ga0105239_10015419 | |||
| 2276 | Ga0105239_10018248 | |||
| 2277 | Ga0105239_10090670 | |||
| 2278 | Ga0105239_10094117 | |||
| 2279 | Ga0105239_10101282 | |||
| 2280 | Ga0105239_10110828 | |||
| 2281 | Ga0105239_10127734 | |||
| 2282 | Ga0105239_10159178 | |||
| 2283 | Ga0105239_10174525 | |||
| 2284 | Ga0105239_10184573 | |||
| 2285 | Ga0105239_10197223 | |||
| 2286 | Ga0105239_10239301 | |||
| 2287 | Ga0105239_10241998 | |||
| 2288 | Ga0105239_10450554 | |||
| 2289 | Ga0157347_1000121 | |||
| 2290 | Ga0157373_10000304 | |||
| 2291 | Ga0157373_10071342 | |||
| 2292 | Ga0157373_10081763 | |||
| 2293 | Ga0157373_10238248 | |||
| 2294 | Ga0157373_10256059 | |||
| 2295 | Ga0157373_10361367 | |||
| 2296 | Ga0157373_10398631 | |||
| 2297 | Ga0157371_10014172 | |||
| 2298 | Ga0157371_10046460 | |||
| 2299 | Ga0157371_10148481 | |||
| 2300 | Ga0157371_10192929 | |||
| 2301 | Ga0157371_10316741 | |||
| 2302 | Ga0157370_10003005 | |||
| 2303 | Ga0157370_10009864 | |||
| 2304 | Ga0157370_10019411 | |||
| 2305 | Ga0157370_10029943 | |||
| 2306 | Ga0157370_10047259 | |||
| 2307 | Ga0157370_10061424 | |||
| 2308 | Ga0157370_10087421 | |||
| 2309 | Ga0157370_10210385 | |||
| 2310 | Ga0157370_10415832 | |||
| 2311 | Ga0157369_10000195 | |||
| 2312 | Ga0157369_10000509 | |||
| 2313 | Ga0157369_10004837 | |||
| 2314 | Ga0157369_10034421 | |||
| 2315 | Ga0157369_10063749 | |||
| 2316 | Ga0157369_10095444 | |||
| 2317 | Ga0157369_10370628 | |||
| 2318 | Ga0157369_10390047 | |||
| 2319 | Ga0157369_10406107 | |||
| 2320 | Ga0157369_10523965 | |||
| 2321 | Ga0157369_10706311 | |||
| 2322 | Ga0157369_10877909 | |||
| 2323 | Ga0157369_10975698 | |||
| 2324 | Ga0157369_10975699 | |||
| 2325 | Ga0157374_10022868 | |||
| 2326 | Ga0157374_10061587 | |||
| 2327 | Ga0157374_10125394 | |||
| 2328 | Ga0157374_10328522 | |||
| 2329 | Ga0157374_10356538 | |||
| 2330 | Ga0157378_10000043 | |||
| 2331 | Ga0157378_10039097 | |||
| 2332 | Ga0157378_10180632 | |||
| 2333 | Ga0157378_10367082 | |||
| 2334 | Ga0157378_10384416 | |||
| 2335 | Ga0163162_10000003 | |||
| 2336 | Ga0163162_10000489 | |||
| 2337 | Ga0163162_10009175 | |||
| 2338 | Ga0163162_10078541 | |||
| 2339 | Ga0163162_10306137 | |||
| 2340 | Ga0163162_10490145 | |||
| 2341 | Ga0157372_10001376 | |||
| 2342 | Ga0157372_10005525 | |||
| 2343 | Ga0157372_10005613 | |||
| 2344 | Ga0157372_10005944 | |||
| 2345 | Ga0157372_10019732 | |||
| 2346 | Ga0157372_10038893 | |||
| 2347 | Ga0157372_10065619 | |||
| 2348 | Ga0157372_10072607 | |||
| 2349 | Ga0157372_10110493 | |||
| 2350 | Ga0157372_10397239 | |||
| 2351 | Ga0157372_10498585 | |||
| 2352 | Ga0157372_10499535 | |||
| 2353 | Ga0157372_10879031 | |||
| 2354 | Ga0157375_10000940 | |||
| 2355 | Ga0157375_10001135 | |||
| 2356 | Ga0157375_10120424 | |||
| 2357 | Ga0157375_10127593 | |||
| 2358 | Ga0157375_10188760 | |||
| 2359 | Ga0157375_10406402 | |||
| 2360 | Ga0157375_10492557 | |||
| 2361 | Ga0157375_10871657 | |||
| 2362 | Ga0163163_10002153 | |||
| 2363 | Ga0163163_10103999 | |||
| 2364 | Ga0182008_10002353 | |||
| 2365 | Ga0182008_10009625 | |||
| 2366 | Ga0182008_10033435 | |||
| 2367 | Ga0182008_10051007 | |||
| 2368 | Ga0157379_10001006 | |||
| 2369 | Ga0157379_10207665 | |||
| 2370 | Ga0157379_10672303 | |||
| 2371 | Ga0157376_10039337 | |||
| 2372 | Ga0157376_10054895 | |||
| 2373 | Ga0157376_10088038 | |||
| 2374 | Ga0157376_10207223 | |||
| 2375 | Ga0157376_10303334 | |||
| 2376 | Ga0157376_10324512 | |||
| 2377 | Ga0157376_10396833 | |||
| 2378 | Ga0157376_10420760 | |||
| 2379 | Ga0182006_1000085 | |||
| 2380 | Ga0182006_1001966 | |||
| 2381 | Ga0182006_1006387 | |||
| 2382 | Ga0182006_1046769 | |||
| 2383 | Ga0182007_10003021 | |||
| 2384 | Ga0182007_10035389 | |||
| 2385 | Ga0182005_1000028 | |||
| 2386 | Ga0182005_1004956 | |||
| 2387 | Ga0183369_1007 | |||
| 2388 | Ga0183368_1003 | |||
| 2389 | Ga0163161_10001533 | |||
| 2390 | Ga0163161_10103332 | |||
| 2391 | Ga0163161_10406621 | |||
| 2392 | Ga0197907_10112819 | |||
| 2393 | Ga0206356_10073673 | |||
| 2394 | Ga0206356_11092931 | |||
| 2395 | Ga0206356_11137881 | |||
| 2396 | Ga0206356_11619311 | |||
| 2397 | Ga0206351_10351414 | |||
| 2398 | Ga0206352_10906711 | |||
| 2399 | Ga0206354_10103479 | |||
| 2400 | Ga0206354_11015677 | |||
| 2401 | Ga0206353_10470642 | |||
| 2402 | Ga0206353_10873698 | |||
| 2403 | Ga0206353_11102501 | |||
| 2404 | Ga0206353_11830696 | |||
| 2405 | Ga0213876_10044835 | |||
| 2406 | Ga0209435_110491 | |||
| 2407 | Ga0209760_100055 | |||
| 2408 | Ga0209760_100585 | |||
| 2409 | Ga0209784_100709 | |||
| 2410 | Ga0209566_106060 | |||
| 2411 | Ga0209674_100012 | |||
| 2412 | Ga0209674_100119 | |||
| 2413 | Ga0209674_100973 | |||
| 2414 | Ga0209672_100005 | |||
| 2415 | Ga0209672_100016 | |||
| 2416 | Ga0209672_100312 | |||
| 2417 | Ga0209672_100887 | |||
| 2418 | Ga0209672_104091 | |||
| 2419 | Ga0209563_100023 | |||
| 2420 | Ga0207427_100004 | |||
| 2421 | Ga0207427_100055 | |||
| 2422 | Ga0207427_100156 | |||
| 2423 | Ga0207427_105404 | |||
| 2424 | Ga0209437_100020 | |||
| 2425 | Ga0209437_100028 | |||
| 2426 | Ga0209437_100147 | |||
| 2427 | Ga0209437_100161 | |||
| 2428 | Ga0209437_100224 | |||
| 2429 | Ga0209437_100476 | |||
| 2430 | Ga0209258_100006 | |||
| 2431 | Ga0209258_100012 | |||
| 2432 | Ga0209258_100049 | |||
| 2433 | Ga0209258_100064 | |||
| 2434 | Ga0209258_100186 | |||
| 2435 | Ga0209258_101282 | |||
| 2436 | Ga0207425_1017100 | |||
| 2437 | Ga0209646_1002608 | |||
| 2438 | Ga0209646_1004739 | |||
| 2439 | Ga0209646_1010458 | |||
| 2440 | Ga0209026_1000037 | |||
| 2441 | Ga0209026_1000099 | |||
| 2442 | Ga0209026_1000375 | |||
| 2443 | Ga0209026_1000391 | |||
| 2444 | Ga0209026_1000541 | |||
| 2445 | Ga0209148_1000005 | |||
| 2446 | Ga0209148_1000010 | |||
| 2447 | Ga0209148_1000012 | |||
| 2448 | Ga0209148_1000014 | |||
| 2449 | Ga0209148_1000073 | |||
| 2450 | Ga0209148_1000142 | |||
| 2451 | Ga0209148_1002604 | |||
| 2452 | Ga0209759_1000103 | |||
| 2453 | Ga0209759_1000792 | |||
| 2454 | Ga0209759_1001568 | |||
| 2455 | Ga0209759_1002641 | |||
| 2456 | Ga0209759_1010031 | |||
| 2457 | Ga0209759_1016594 | |||
| 2458 | Ga0209129_1004913 | |||
| 2459 | Ga0209129_1005589 | |||
| 2460 | Ga0209233_1000008 | |||
| 2461 | Ga0209233_1000009 | |||
| 2462 | Ga0209233_1000020 | |||
| 2463 | Ga0209233_1000063 | |||
| 2464 | Ga0209233_1000147 | |||
| 2465 | Ga0209233_1004515 | |||
| 2466 | Ga0209565_1000018 | |||
| 2467 | Ga0209565_1000136 | |||
| 2468 | Ga0209565_1002813 | |||
| 2469 | Ga0209455_1000008 | |||
| 2470 | Ga0209455_1000014 | |||
| 2471 | Ga0209455_1000086 | |||
| 2472 | Ga0209455_1000177 | |||
| 2473 | Ga0209455_1000344 | |||
| 2474 | Ga0209673_1000090 | |||
| 2475 | Ga0209130_1012206 | |||
| 2476 | Ga0209675_1000005 | |||
| 2477 | Ga0209675_1000587 | |||
| 2478 | Ga0209675_1006760 | |||
| 2479 | Ga0209675_1009558 | |||
| 2480 | Ga0209676_1000056 | |||
| 2481 | Ga0209676_1000066 | |||
| 2482 | Ga0209676_1000101 | |||
| 2483 | Ga0209025_1000471 | |||
| 2484 | Ga0209025_1000711 | |||
| 2485 | Ga0209025_1001264 | |||
| 2486 | Ga0209025_1001519 | |||
| 2487 | Ga0209025_1068236 | |||
| 2488 | Ga0209564_1000078 | |||
| 2489 | Ga0209564_1003271 | |||
| 2490 | Ga0209564_1003275 | |||
| 2491 | Ga0209564_1003554 | |||
| 2492 | Ga0209758_1001371 | |||
| 2493 | Ga0209758_1004728 | |||
| 2494 | Ga0209758_1018326 | |||
| 2495 | Ga0209758_1079160 | |||
| 2496 | Ga0209256_1000070 | |||
| 2497 | Ga0209256_1001248 | |||
| 2498 | Ga0209256_1003130 | |||
| 2499 | Ga0209256_1012253 | |||
| 2500 | Ga0209051_1003162 | |||
| 2501 | Ga0209051_1039422 | |||
| 2502 | Ga0209051_1064040 | |||
| 2503 | Ga0209257_1025065 | |||
| 2504 | Ga0207656_10004478 | |||
| 2505 | Ga0207656_10044372 | |||
| 2506 | Ga0207655_1000005 | |||
| 2507 | Ga0207655_1000015 | |||
| 2508 | Ga0207655_1000166 | |||
| 2509 | Ga0207653_10001491 | |||
| 2510 | Ga0207688_10028620 | |||
| 2511 | Ga0207680_10000005 | |||
| 2512 | Ga0207680_10000255 | |||
| 2513 | Ga0207680_10147436 | |||
| 2514 | Ga0207680_10157513 | |||
| 2515 | Ga0207647_10000512 | |||
| 2516 | Ga0207647_10000610 | |||
| 2517 | Ga0207647_10001940 | |||
| 2518 | Ga0207647_10007302 | |||
| 2519 | Ga0207647_10013553 | |||
| 2520 | Ga0207647_10018521 | |||
| 2521 | Ga0207647_10042751 | |||
| 2522 | Ga0207699_10199183 | |||
| 2523 | Ga0207645_10000076 | |||
| 2524 | Ga0207645_10016221 | |||
| 2525 | Ga0207645_10107216 | |||
| 2526 | Ga0207645_10122962 | |||
| 2527 | Ga0207645_10299855 | |||
| 2528 | Ga0207643_10000227 | |||
| 2529 | Ga0207705_10003418 | |||
| 2530 | Ga0207705_10005224 | |||
| 2531 | Ga0207705_10013859 | |||
| 2532 | Ga0207705_10014275 | |||
| 2533 | Ga0207705_10067187 | |||
| 2534 | Ga0207705_10175935 | |||
| 2535 | Ga0207705_10179726 | |||
| 2536 | Ga0207705_10265431 | |||
| 2537 | Ga0207705_10305881 | |||
| 2538 | Ga0207684_10000874 | |||
| 2539 | Ga0207684_10015879 | |||
| 2540 | Ga0207654_10001950 | |||
| 2541 | Ga0207654_10006920 | |||
| 2542 | Ga0207654_10007889 | |||
| 2543 | Ga0207654_10089144 | |||
| 2544 | Ga0207654_10091337 | |||
| 2545 | Ga0207707_10000069 | |||
| 2546 | Ga0207707_10000310 | |||
| 2547 | Ga0207707_10000357 | |||
| 2548 | Ga0207707_10001014 | |||
| 2549 | Ga0207707_10004786 | |||
| 2550 | Ga0207707_10009538 | |||
| 2551 | Ga0207707_10013618 | |||
| 2552 | Ga0207707_10042934 | |||
| 2553 | Ga0207707_10174379 | |||
| 2554 | Ga0207707_10185756 | |||
| 2555 | Ga0207707_10188585 | |||
| 2556 | Ga0207707_10214905 | |||
| 2557 | Ga0207707_10414408 | |||
| 2558 | Ga0207695_10000007 | |||
| 2559 | Ga0207695_10000780 | |||
| 2560 | Ga0207695_10001750 | |||
| 2561 | Ga0207695_10003105 | |||
| 2562 | Ga0207695_10005621 | |||
| 2563 | Ga0207695_10042664 | |||
| 2564 | Ga0207695_10059150 | |||
| 2565 | Ga0207695_10069722 | |||
| 2566 | Ga0207695_10070350 | |||
| 2567 | Ga0207695_10154475 | |||
| 2568 | Ga0207695_10379157 | |||
| 2569 | Ga0207695_10451902 | |||
| 2570 | Ga0207671_10000061 | |||
| 2571 | Ga0207671_10000074 | |||
| 2572 | Ga0207671_10001147 | |||
| 2573 | Ga0207671_10003503 | |||
| 2574 | Ga0207671_10003678 | |||
| 2575 | Ga0207671_10065748 | |||
| 2576 | Ga0207671_10080968 | |||
| 2577 | Ga0207671_10123741 | |||
| 2578 | Ga0207693_10249914 | |||
| 2579 | Ga0207663_10352093 | |||
| 2580 | Ga0207660_10003495 | |||
| 2581 | Ga0207660_10019459 | |||
| 2582 | Ga0207660_10027109 | |||
| 2583 | Ga0207660_10040839 | |||
| 2584 | Ga0207660_10110909 | |||
| 2585 | Ga0207660_10149308 | |||
| 2586 | Ga0207660_10240301 | |||
| 2587 | Ga0207657_10000417 | |||
| 2588 | Ga0207657_10014538 | |||
| 2589 | Ga0207657_10045337 | |||
| 2590 | Ga0207657_10206205 | |||
| 2591 | Ga0207657_10206256 | |||
| 2592 | Ga0207649_10000847 | |||
| 2593 | Ga0207649_10001653 | |||
| 2594 | Ga0207649_10005305 | |||
| 2595 | Ga0207649_10017567 | |||
| 2596 | Ga0207649_10035699 | |||
| 2597 | Ga0207649_10049981 | |||
| 2598 | Ga0207649_10149653 | |||
| 2599 | Ga0207649_10159121 | |||
| 2600 | Ga0207649_10184626 | |||
| 2601 | Ga0207649_10197151 | |||
| 2602 | Ga0207652_10000394 | |||
| 2603 | Ga0207652_10003410 | |||
| 2604 | Ga0207652_10010725 | |||
| 2605 | Ga0207652_10026547 | |||
| 2606 | Ga0207652_10055480 | |||
| 2607 | Ga0207652_10074563 | |||
| 2608 | Ga0207652_10199817 | |||
| 2609 | Ga0207652_10228318 | |||
| 2610 | Ga0207646_10001150 | |||
| 2611 | Ga0207646_10035755 | |||
| 2612 | Ga0207646_10111999 | |||
| 2613 | Ga0207681_10060077 | |||
| 2614 | Ga0207681_10086448 | |||
| 2615 | Ga0207681_10158962 | |||
| 2616 | Ga0207694_10000162 | |||
| 2617 | Ga0207694_10001362 | |||
| 2618 | Ga0207694_10009064 | |||
| 2619 | Ga0207694_10022629 | |||
| 2620 | Ga0207694_10023759 | |||
| 2621 | Ga0207694_10063972 | |||
| 2622 | Ga0207694_10096636 | |||
| 2623 | Ga0207694_10136232 | |||
| 2624 | Ga0207694_10340457 | |||
| 2625 | Ga0207694_10370239 | |||
| 2626 | Ga0207650_10006670 | |||
| 2627 | Ga0207650_10169670 | |||
| 2628 | Ga0207659_10202713 | |||
| 2629 | Ga0207687_10090627 | |||
| 2630 | Ga0207687_10105282 | |||
| 2631 | Ga0207700_10007782 | |||
| 2632 | Ga0207700_10420206 | |||
| 2633 | Ga0207664_10000026 | |||
| 2634 | Ga0207664_10168743 | |||
| 2635 | Ga0207644_10245162 | |||
| 2636 | Ga0207644_10293900 | |||
| 2637 | Ga0207690_10001242 | |||
| 2638 | Ga0207690_10001494 | |||
| 2639 | Ga0207690_10002715 | |||
| 2640 | Ga0207690_10004311 | |||
| 2641 | Ga0207690_10019003 | |||
| 2642 | Ga0207690_10030674 | |||
| 2643 | Ga0207690_10050680 | |||
| 2644 | Ga0207690_10505429 | |||
| 2645 | Ga0207706_10010437 | |||
| 2646 | Ga0207706_10026077 | |||
| 2647 | Ga0207706_10045071 | |||
| 2648 | Ga0207706_10095324 | |||
| 2649 | Ga0207706_10127035 | |||
| 2650 | Ga0207706_10252353 | |||
| 2651 | Ga0207686_10073323 | |||
| 2652 | Ga0207686_10271747 | |||
| 2653 | Ga0207709_10000134 | |||
| 2654 | Ga0207670_10340721 | |||
| 2655 | Ga0207670_10355762 | |||
| 2656 | Ga0207669_10515692 | |||
| 2657 | Ga0207704_10210700 | |||
| 2658 | Ga0207704_10339637 | |||
| 2659 | Ga0207665_10013326 | |||
| 2660 | Ga0207691_10020705 | |||
| 2661 | Ga0207691_10024916 | |||
| 2662 | Ga0207691_10033298 | |||
| 2663 | Ga0207691_10075826 | |||
| 2664 | Ga0207711_10001229 | |||
| 2665 | Ga0207711_10225466 | |||
| 2666 | Ga0207689_10000281 | |||
| 2667 | Ga0207689_10086754 | |||
| 2668 | Ga0207689_10166996 | |||
| 2669 | Ga0207689_10263540 | |||
| 2670 | Ga0207689_10264633 | |||
| 2671 | Ga0207661_10084908 | |||
| 2672 | Ga0207661_10097137 | |||
| 2673 | Ga0207661_10246511 | |||
| 2674 | Ga0207679_10000280 | |||
| 2675 | Ga0207679_10234820 | |||
| 2676 | Ga0207679_10312468 | |||
| 2677 | Ga0207679_10389602 | |||
| 2678 | Ga0207667_10000381 | |||
| 2679 | Ga0207667_10018815 | |||
| 2680 | Ga0207667_10023112 | |||
| 2681 | Ga0207667_10038148 | |||
| 2682 | Ga0207667_10038559 | |||
| 2683 | Ga0207667_10054076 | |||
| 2684 | Ga0207667_10054635 | |||
| 2685 | Ga0207667_10092652 | |||
| 2686 | Ga0207667_10126234 | |||
| 2687 | Ga0207667_10126270 | |||
| 2688 | Ga0207667_10249823 | |||
| 2689 | Ga0207667_10249844 | |||
| 2690 | Ga0207651_10105004 | |||
| 2691 | Ga0207651_10276350 | |||
| 2692 | Ga0207651_10411670 | |||
| 2693 | Ga0207712_10001183 | |||
| 2694 | Ga0207712_10033417 | |||
| 2695 | Ga0207668_10111329 | |||
| 2696 | Ga0207668_10306195 | |||
| 2697 | Ga0207640_10000797 | |||
| 2698 | Ga0207640_10001740 | |||
| 2699 | Ga0207640_10006198 | |||
| 2700 | Ga0207640_10008720 | |||
| 2701 | Ga0207640_10011204 | |||
| 2702 | Ga0207640_10020709 | |||
| 2703 | Ga0207640_10038505 | |||
| 2704 | Ga0207640_10050569 | |||
| 2705 | Ga0207640_10076264 | |||
| 2706 | Ga0207640_10267166 | |||
| 2707 | Ga0207658_10000006 | |||
| 2708 | Ga0207658_10018272 | |||
| 2709 | Ga0207658_10020586 | |||
| 2710 | Ga0207658_10156818 | |||
| 2711 | Ga0207658_10228535 | |||
| 2712 | Ga0207677_10137076 | |||
| 2713 | Ga0207677_10192173 | |||
| 2714 | Ga0207677_10247984 | |||
| 2715 | Ga0207703_10003470 | |||
| 2716 | Ga0207703_10011783 | |||
| 2717 | Ga0207703_10030081 | |||
| 2718 | Ga0207703_10129839 | |||
| 2719 | Ga0207639_10002695 | |||
| 2720 | Ga0207639_10003901 | |||
| 2721 | Ga0207639_10003979 | |||
| 2722 | Ga0207639_10004097 | |||
| 2723 | Ga0207639_10004960 | |||
| 2724 | Ga0207639_10006175 | |||
| 2725 | Ga0207639_10008407 | |||
| 2726 | Ga0207639_10011963 | |||
| 2727 | Ga0207639_10034646 | |||
| 2728 | Ga0207639_10103696 | |||
| 2729 | Ga0207639_10109558 | |||
| 2730 | Ga0207639_10229565 | |||
| 2731 | Ga0207639_10238882 | |||
| 2732 | Ga0207639_10580621 | |||
| 2733 | Ga0207678_10004583 | |||
| 2734 | Ga0207678_10007556 | |||
| 2735 | Ga0207678_10007809 | |||
| 2736 | Ga0207678_10010017 | |||
| 2737 | Ga0207678_10016606 | |||
| 2738 | Ga0207678_10032508 | |||
| 2739 | Ga0207678_10036895 | |||
| 2740 | Ga0207678_10038897 | |||
| 2741 | Ga0207678_10043296 | |||
| 2742 | Ga0207678_10122985 | |||
| 2743 | Ga0207678_10123140 | |||
| 2744 | Ga0207678_10177580 | |||
| 2745 | Ga0207678_10303673 | |||
| 2746 | Ga0207678_10425557 | |||
| 2747 | Ga0207702_10000185 | |||
| 2748 | Ga0207702_10002243 | |||
| 2749 | Ga0207702_10002724 | |||
| 2750 | Ga0207702_10004362 | |||
| 2751 | Ga0207702_10005659 | |||
| 2752 | Ga0207702_10013254 | |||
| 2753 | Ga0207702_10032427 | |||
| 2754 | Ga0207702_10060932 | |||
| 2755 | Ga0207702_10112765 | |||
| 2756 | Ga0207702_10238212 | |||
| 2757 | Ga0207641_10020593 | |||
| 2758 | Ga0207641_10030714 | |||
| 2759 | Ga0207641_10087126 | |||
| 2760 | Ga0207641_10099047 | |||
| 2761 | Ga0207641_10115438 | |||
| 2762 | Ga0207641_10126684 | |||
| 2763 | Ga0207641_10150579 | |||
| 2764 | Ga0207641_10152166 | |||
| 2765 | Ga0207641_10471639 | |||
| 2766 | Ga0207648_10002334 | |||
| 2767 | Ga0207648_10031857 | |||
| 2768 | Ga0207648_10033541 | |||
| 2769 | Ga0207648_10056639 | |||
| 2770 | Ga0207648_10110473 | |||
| 2771 | Ga0207648_10594987 | |||
| 2772 | Ga0207676_10041958 | |||
| 2773 | Ga0207674_10000226 | |||
| 2774 | Ga0207674_10001350 | |||
| 2775 | Ga0207674_10064922 | |||
| 2776 | Ga0207674_10067399 | |||
| 2777 | Ga0207674_10171398 | |||
| 2778 | Ga0207674_10213726 | |||
| 2779 | Ga0207674_10311061 | |||
| 2780 | Ga0207674_10378295 | |||
| 2781 | Ga0207675_100012481 | |||
| 2782 | Ga0207675_100020033 | |||
| 2783 | Ga0207675_100275153 | |||
| 2784 | Ga0207675_100808280 | |||
| 2785 | Ga0207683_10018309 | |||
| 2786 | Ga0207698_10000529 | |||
| 2787 | Ga0207698_10010039 | |||
| 2788 | Ga0207698_10065485 | |||
| 2789 | Ga0207698_10099827 | |||
| 2790 | Ga0207698_10112145 | |||
| 2791 | Ga0207698_10125951 | |||
| 2792 | Ga0207698_10170773 | |||
| 2793 | Ga0207698_10362427 | |||
| 2794 | Ga0207698_10438240 | |||
| 2795 | Ga0207698_11030904 | |||
| 2796 | Ga0209281_1004884 | |||
| 2797 | Ga0209371_1000197 | |||
| 2798 | Ga0209969_1002912 | |||
| 2799 | Ga0209984_1000926 | |||
| 2800 | Ga0209995_1000280 | |||
| 2801 | Ga0209968_1004656 | |||
| 2802 | Ga0209968_1013426 | |||
| 2803 | Ga0209999_1000590 | |||
| 2804 | Ga0209982_1001566 | |||
| 2805 | Ga0209970_1001836 | |||
| 2806 | Ga0209970_1006001 | |||
| 2807 | Ga0210002_1011695 | |||
| 2808 | Ga0209983_1000494 | |||
| 2809 | Ga0209282_1000051 | |||
| 2810 | Ga0209971_1000054 | |||
| 2811 | Ga0209971_1000099 | |||
| 2812 | Ga0209966_1000059 | |||
| 2813 | Ga0209998_10000066 | |||
| 2814 | Ga0209974_10002860 | |||
| 2815 | Ga0209974_10050802 | |||
| 2816 | Ga0268266_10000001 | |||
| 2817 | Ga0268266_10000004 | |||
| 2818 | Ga0268266_10000006 | |||
| 2819 | Ga0268266_10082833 | |||
| 2820 | Ga0268266_10343959 | |||
| 2821 | Ga0268265_10002756 | |||
| 2822 | Ga0268265_10004000 | |||
| 2823 | Ga0268265_10028139 | |||
| 2824 | Ga0268265_10420735 | |||
| 2825 | Ga0268265_10506695 | |||
| 2826 | Ga0268265_10612088 | |||
| 2827 | Ga0268264_10019805 | |||
| 2828 | Ga0268264_10020911 | |||
| 2829 | Ga0268264_10024072 | |||
| 2830 | Ga0268264_10051695 | |||
| 2831 | Ga0268264_10156716 | |||
| 2832 | Ga0268264_10816942 | |||
| 2833 | Ga0265318_10092476 | |||
| 2834 | Ga0268256_1000147 | |||
| 2835 | Ga0316179_1058374 | |||
| 2836 | Ga0316178_1149128 | |||
| 2837 | Ga0265331_10059719 | |||
| 2838 | Ga0265327_10037033 | |||
| 2839 | Ga0265316_10197819 | |||
| 2840 | Ga0307408_100000045 | |||
| 2841 | Ga0307408_100002332 | |||
| 2842 | Ga0307408_100601933 | |||
| 2843 | Ga0307508_10251269 | |||
| 2844 | Ga0316575_10001754 | |||
| 2845 | Ga0316575_10008938 | |||
| 2846 | Ga0316575_10035622 | |||
| 2847 | Ga0316579_10000043 | |||
| 2848 | Ga0316579_10000317 | |||
| 2849 | Ga0316579_10020194 | |||
| 2850 | Ga0316579_10021774 | |||
| 2851 | Ga0316576_10001368 | |||
| 2852 | Ga0316576_10069720 | |||
| 2853 | Ga0316576_10100835 | |||
| 2854 | Ga0316576_10114325 | |||
| 2855 | Ga0316576_10130349 | |||
| 2856 | Ga0316576_10154118 | |||
| 2857 | Ga0316576_10210742 | |||
| 2858 | Ga0316576_10342639 | |||
| 2859 | Ga0316578_10003074 | |||
| 2860 | Ga0316578_10008573 | |||
| 2861 | Ga0316578_10049852 | |||
| 2862 | Ga0316578_10065209 | |||
| 2863 | Ga0307516_10000386 | |||
| 2864 | Ga0307516_10027880 | |||
| 2865 | Ga0307516_10054707 | |||
| 2866 | Ga0307516_10088520 | |||
| 2867 | Ga0307405_10066722 | |||
| 2868 | Ga0316577_10001045 | |||
| 2869 | Ga0316577_10282142 | |||
| 2870 | Ga0307413_10111219 | |||
| 2871 | Ga0307406_10061681 | |||
| 2872 | Ga0307412_10017964 | |||
| 2873 | Ga0307416_100045064 | |||
| 2874 | Ga0307414_10005715 | |||
| 2875 | Ga0307414_10031363 | |||
| 2876 | Ga0307414_10238244 | |||
| 2877 | Ga0307414_10351179 | |||
| 2878 | Ga0307411_10206503 | |||
| 2879 | Ga0307411_10373142 | |||
| 2880 | Ga0307411_10385626 | |||
| 2881 | Ga0316583_10003786 | |||
| 2882 | Ga0316585_10000368 | |||
| 2883 | Ga0316585_10032912 | |||
| 2884 | Ga0316580_10007606 | |||
| 2885 | Ga0316580_10009440 | |||
| 2886 | Ga0316580_10011538 | |||
| 2887 | Ga0316593_10000550 | |||
| 2888 | Ga0316593_10000980 | |||
| 2889 | Ga0316593_10001425 | |||
| 2890 | Ga0316593_10003419 | |||
| 2891 | Ga0316593_10004705 | |||
| 2892 | Ga0316593_10006108 | |||
| 2893 | Ga0316593_10009511 | |||
| 2894 | Ga0316593_10015674 | |||
| 2895 | Ga0316593_10018656 | |||
| 2896 | Ga0316593_10019079 | |||
| 2897 | Ga0316593_10021052 | |||
| 2898 | Ga0316593_10025794 | |||
| 2899 | Ga0316593_10026747 | |||
| 2900 | Ga0316593_10026969 | |||
| 2901 | Ga0316593_10027882 | |||
| 2902 | Ga0316593_10028085 | |||
| 2903 | Ga0316593_10040703 | |||
| 2904 | Ga0316593_10053218 | |||
| 2905 | Ga0307507_10161388 | |||
| 2906 | Ga0307510_10002044 | |||
| 2907 | Ga0316592_1000863 | |||
| 2908 | Ga0316592_1002557 | |||
| 2909 | Ga0316592_1004759 | |||
| 2910 | Ga0316592_1008886 | |||
| 2911 | Ga0316592_1013362 | |||
| 2912 | Ga0316592_1026549 | |||
| 2913 | Ga0316586_1001418 | |||
| 2914 | Ga0316586_1002226 | |||
| 2915 | Ga0316586_1002983 | |||
| 2916 | Ga0316586_1003553 | |||
| 2917 | Ga0316586_1007210 | |||
| 2918 | Ga0316588_1000832 | |||
| 2919 | Ga0316588_1003893 | |||
| 2920 | Ga0316588_1004524 | |||
| 2921 | Ga0316588_1006413 | |||
| 2922 | Ga0316588_1013330 | |||
| 2923 | Ga0316588_1030522 | |||
| 2924 | Ga0316587_1001625 | |||
| 2925 | Ga0316587_1001728 | |||
| 2926 | Ga0316587_1002587 | |||
| 2927 | Ga0316587_1002672 | |||
| 2928 | Ga0316587_1006257 | |||
| 2929 | Ga0316587_1006816 | |||
| 2930 | Ga0316596_1000224 | |||
| 2931 | Ga0316596_1001143 | |||
| 2932 | Ga0316596_1001775 | |||
| 2933 | Ga0316596_1003514 | |||
| 2934 | Ga0316596_1005947 | |||
| 2935 | Ga0316596_1009326 | |||
| 2936 | Ga0316596_1010266 | |||
| 2937 | Ga0316596_1015403 | |||
| 2938 | Ga0373958_0033968 | |||
| 2939 | Ga0373940_0003447 | |||
| 2940 | Ga0373940_0111018 | |||
| 2941 | Ga0373951_0005229 | |||
| 2942 | Ga0373952_0005206 | |||
| 2943 | Ga0373941_0043016 | |||
| 2944 | Ga0373960_0003203 | |||
| 2945 | Ga0373943_0051525 | |||
| 2946 | Ga0373942_0045152 | |||
| 2947 | Ga0316574_0000519 | |||
| 2948 | Ga0316574_0000879 | |||
| 2949 | Ga0316574_0001141 | |||
| 2950 | Ga0316574_0001723 | |||
| 2951 | Ga0316574_0217935 | |||
| 2952 | Ga0316574_0237261 | |||
| 2953 | Ga0316574_0341579 | |||
| 2954 | Ga0373931_0362461 | |||
| 2955 | Ga0373935_0111045 | |||
| 2956 | Ga0316582_0001446 | |||
| 2957 | Ga0316582_0002348 | |||
| 2958 | Ga0316582_0002490 | |||
| 2959 | Ga0316582_0022499 | |||
| 2960 | Ga0316582_0032390 | |||
| 2961 | Ga0316582_0207547 | |||
| 2962 | Ga0316582_0236814 | |||
| 2963 | Ga0316584_0001564 | |||
| 2964 | Ga0316584_0007606 | |||
| 2965 | Ga0316584_0012345 | |||
| 2966 | Ga0316584_0058976 | |||
| 2967 | Ga0316584_0306418 | |||
| 2968 | Ga0373925_0188164 | |||
| 2969 | Ga0373925_0275217 | |||
| 2970 | Ga0395899_0000108 | |||
| 2971 | Ga0395899_0064157 | |||
| 2972 | Ga0395899_0293868 | |||
| 2973 | Ga0395899_0329021 | |||
| 2974 | Ga0395900_0000051 | |||
| 2975 | Ga0395900_0000144 | |||
| 2976 | Ga0395900_0002611 | |||
| 2977 | Ga0395900_0085695 | |||
| 2978 | Ga0395900_0138444 | |||
| 2979 | Ga0395900_0419903 | |||
| 2980 | Ga0395898_0000018 | |||
| 2981 | Ga0395898_0000049 | |||
| 2982 | Ga0395898_0050876 | |||
| 2983 | Ga0395898_0062023 | |||
| 2984 | Ga0395898_0159975 | |||
| 2985 | Ga0395898_0257020 | |||
| 2986 | Ga0395898_0614016 | |||
| 2987 | Ga0395905_0002802 | |||
| 2988 | Ga0395905_0014636 | |||
| 2989 | Ga0395905_0159906 | |||
| 2990 | Ga0395905_0240238 | |||
| 2991 | Ga0395905_0289328 | |||
| 2992 | Ga0395901_0000356 | |||
| 2993 | Ga0395901_0007439 | |||
| 2994 | Ga0395901_0065745 | |||
| 2995 | Ga0395901_0263752 | |||
| 2996 | Ga0395901_0399852 | |||
| 2997 | Ga0395901_0443936 | |||
| 2998 | Ga0395901_0449792 | |||
| 2999 | Ga0237819_01204 | |||
| 3000 | Ga0400488_28249 | |||
| 3001 | Ga0400483_043964 | |||
| 3002 | Ga0400483_173977 | |||
| 3003 | Ga0400487_66353 | |||
| 3004 | Ga0436365_0191135 | |||
| 3005 | Ga0439436_0000030 | |||
| 3006 | Ga0439465_0000405 | |||
| 3007 | Ga0439465_0002224 | |||
| 3008 | Ga0451793_0077380 | |||
| 3009 | Ga0451793_0740756 | |||
| 3010 | Ga0451793_1663964 | |||
| 3011 | Ga0451797_1461544 | |||
| 3012 | Ga0451795_0260148 | |||
| 3013 | Ga0451802_0477990 | |||
| 3014 | Ga0451808_17140 | |||
| 3015 | Ga0451807_0735864 | |||
| 3016 | Ga0451843_0137728 | |||
| 3017 | Ga0439441_014725 | |||
| 3018 | Ga0439445_0003009 | |||
| 3019 | Ga0439448_0001117 | |||
| 3020 | Ga0439448_0067247 | |||
| 3021 | Ga0439449_0000048 | |||
| 3022 | Ga0439450_009785 | |||
| 3023 | Ga0439455_0001844 | |||
| 3024 | Ga0439455_0004575 | |||
| 3025 | Ga0439455_0008969 | |||
| 3026 | Ga0450891_002252 | |||
| 3027 | Ga0450908_001816 | |||
| 3028 | Ga0439459_0000122 | |||
| 3029 | Ga0439459_0001238 | |||
| 3030 | Ga0439464_0002592 | |||
| 3031 | Ga0439464_0004445 | |||
| 3032 | Ga0439464_0021652 | |||
| 3033 | Ga0439460_0001989 | |||
| 3034 | Ga0451577_0000852 | |||
| 3035 | Ga0451577_0001148 | |||
| 3036 | Ga0451577_0005484 | |||
| 3037 | Ga0451577_0013868 | |||
| 3038 | Ga0466969_0007454 | |||
| 3039 | Ga0466972_0032221 | |||
| 3040 | Ga0466972_0073090 | |||
| 3041 | Ga0466989_0188469 | |||
| 3042 | Ga0466982_0000003 | |||
| 3043 | Ga0453683_0076427 | |||
| 3044 | Ga0466965_0006406 | |||
| 3045 | Ga0466965_0025791 | |||
| 3046 | Ga0466965_0187235 | |||
| 3047 | Ga0466966_0002423 | |||
| 3048 | Ga0466966_0015597 | |||
| 3049 | Ga0466966_0019653 | |||
| 3050 | Ga0466966_0034789 | |||
| 3051 | Ga0466966_0288483 | |||
| 3052 | Ga0466961_0001662 | |||
| 3053 | Ga0466961_0028191 | |||
| 3054 | Ga0466961_0035526 | |||
| 3055 | Ga0466961_0091880 | |||
| 3056 | Ga0466961_0145599 | |||
| 3057 | Ga0466963_0133386 | |||
| 3058 | Ga0466963_0302871 | |||
| 3059 | Ga0466964_0001374 | |||
| 3060 | Ga0453684_0000298 | |||
| 3061 | Ga0453684_0000348 | |||
| 3062 | Ga0453684_0000419 | |||
| 3063 | Ga0453684_0002092 | |||
| 3064 | Ga0453684_0003824 | |||
| 3065 | Ga0453684_0042299 | |||
| 3066 | Ga0453684_0319178 | |||
| 3067 | Ga0466971_0001052 | |||
| 3068 | Ga0466971_0015307 | |||
| 3069 | Ga0466971_0052473 | |||
| 3070 | Ga0466968_0018034 | |||
| 3071 | Ga0466968_0057632 | |||
| 3072 | Ga0466968_0085106 | |||
| 3073 | Ga0466970_0000202 | |||
| 3074 | Ga0466970_0021855 | |||
| 3075 | Ga0466970_0040664 | |||
| 3076 | Ga0466970_0063568 | |||
| 3077 | Ga0466970_0232500 | |||
| 3078 | Ga0466970_0234734 | |||
| 3079 | Ga0466957_0006156 | |||
| 3080 | Ga0466957_0108334 | |||
| 3081 | Ga0466957_0308180 | |||
| 3082 | Ga0466959_0000194 | |||
| 3083 | Ga0466959_0003791 | |||
| 3084 | Ga0466959_0005674 | |||
| 3085 | Ga0466959_0031749 | |||
| 3086 | Ga0451576_0000033 | |||
| 3087 | Ga0451576_0005108 | |||
| 3088 | Ga0451576_0007972 | |||
| 3089 | Ga0451576_0132144 | |||
| 3090 | Ga0451576_0164052 | |||
| 3091 | Ga0451576_0279211 | |||
| 3092 | Ga0451576_0740926 | |||
| 3093 | Ga0466958_0010562 | |||
| 3094 | Ga0466958_0106742 | |||
| 3095 | Ga0466958_0283288 | |||
| 3096 | Ga0466967_0134565 | |||
| 3097 | Ga0495617_000586 | |||
| 3098 | Ga0495617_000939 | |||
| 3099 | Ga0495627_000074 | |||
| 3100 | Ga0495590_0002633 | |||
| 3101 | Ga0495590_0024655 | |||
| 3102 | Ga0495591_000142 | |||
| 3103 | Ga0495629_0120610 | |||
| 3104 | Ga0495638_0000038 | |||
| 3105 | Ga0495638_0000153 | |||
| 3106 | Ga0495641_0038501 | |||
| 3107 | Ga0495651_0307790 | |||
| 3108 | Ga0495650_0000337 | |||
| 3109 | Ga0495650_0001325 | |||
| 3110 | Ga0495650_0001596 | |||
| 3111 | Ga0495580_0189443 | |||
| 3112 | Ga0495580_0379156 | |||
| 3113 | Ga0495582_0098622 | |||
| 3114 | Ga0495605_0003518 | |||
| 3115 | Ga0495584_0002465 | |||
| 3116 | Ga0495585_0000104 | |||
| 3117 | Ga0495585_0082489 | |||
| 3118 | Ga0495594_0358867 | |||
| 3119 | Ga0495596_0002137 | |||
| 3120 | Ga0495607_0000211 | |||
| 3121 | Ga0495607_0002313 | |||
| 3122 | Ga0495607_0021677 | |||
| 3123 | Ga0495583_0018274 | |||
| 3124 | Ga0495606_0000338 | |||
| 3125 | Ga0495606_0000401 | |||
| 3126 | Ga0495606_0009207 | |||
| 3127 | Ga0495606_0024882 | |||
| 3128 | Ga0495606_0078131 | |||
| 3129 | Ga0495610_0000482 | |||
| 3130 | Ga0495610_0004004 | |||
| 3131 | Ga0495610_0015960 | |||
| 3132 | Ga0495616_0000086 | |||
| 3133 | Ga0495616_0008261 | |||
| 3134 | Ga0495620_0001045 | |||
| 3135 | Ga0495620_0001112 | |||
| 3136 | Ga0495631_0064213 | |||
| 3137 | Ga0495632_0000004 | |||
| 3138 | Ga0495632_0053890 | |||
| 3139 | Ga0495632_0098893 | |||
| 3140 | Ga0495632_0147550 | |||
| 3141 | Ga0495643_0058644 | |||
| 3142 | Ga0495648_0009285 | |||
| 3143 | Ga0495648_0030047 | |||
| 3144 | Ga0495642_0011374 | |||
| 3145 | Ga0495609_0002596 | |||
| 3146 | Ga0495609_0025461 | |||
| 3147 | Ga0495621_0023410 | |||
| 3148 | Ga0495597_0000040 | |||
| 3149 | Ga0495597_0151779 | |||
| 3150 | Ga0495645_0072485 | |||
| 3151 | Ga0495622_0157027 | |||
| 3152 | Ga0495656_0049079 | |||
| 3153 | Ga0495668_0003978 | |||
| 3154 | Ga0495611_0000001 | |||
| 3155 | Ga0495611_0000105 | |||
| 3156 | Ga0495625_0000022 | |||
| 3157 | Ga0495625_0080749 | |||
| 3158 | Ga0495625_0135776 | |||
| 3159 | Ga0495661_0000199 | |||
| 3160 | Ga0495661_0005804 | |||
| 3161 | Ga0495647_0056706 | |||
| 3162 | Ga0495658_0013679 | |||
| 3163 | Ga0495658_0019973 | |||
| 3164 | Ga0495671_0000372 | |||
| 3165 | Ga0495671_0002703 | |||
| 3166 | Ga0495649_0001571 | |||
| 3167 | Ga0495649_0013612 | |||
| 3168 | Ga0495649_0040058 | |||
| 3169 | Ga0495589_0000059 | |||
| 3170 | Ga0495660_0057098 | |||
| 3171 | Ga0495636_0090633 | |||
| 3172 | Ga0495674_0160703 | |||
| 3173 | Ga0495672_0059695 | |||
| 3174 | Ga0495687_005446 | |||
| 3175 | Ga0495679_000004 | |||
| 3176 | Ga0495685_007721 | |||
| 3177 | Ga0495673_0000004 | |||
| 3178 | Ga0495673_0000048 | |||
| 3179 | Ga0495686_0000017 | |||
| 3180 | Ga0495686_0001206 | |||
| 3181 | Ga0495686_0013830 | |||
| 3182 | Ga0495686_0013909 | |||
| 3183 | Ga0495686_0030419 | |||
| 3184 | Ga0495686_0089278 | |||
| 3185 | Ga0496100_0009393 | |||
| 3186 | Ga0496101_0000776 | |||
| 3187 | Ga0496101_0283596 | |||
| 3188 | Ga0496102_0066165 | |||
| 3189 | Ga0496102_0216773 | |||
| 3190 | Ga0496103_0021319 | |||
| 3191 | Ga0496103_0418985 | |||
| 3192 | Ga0496104_0000011 | |||
| 3193 | Ga0496104_0072803 | |||
| 3194 | Ga0496104_0197782 | |||
| 3195 | Ga0496105_0000071 | |||
| 3196 | Ga0496105_0001886 | |||
| 3197 | Ga0496106_0001299 | |||
| 3198 | Ga0496106_0076000 | |||
| 3199 | Ga0496113_0002731 | |||
| 3200 | Ga0496113_0312504 | |||
| 3201 | Ga0496115_0000062 | |||
| 3202 | Ga0496115_0000503 | |||
| 3203 | Ga0496115_0010955 | |||
| 3204 | Ga0496115_0143611 | |||
| 3205 | Ga0496116_0005928 | |||
| 3206 | Ga0496116_0032919 | |||
| 3207 | Ga0496116_0034533 | |||
| 3208 | Ga0496116_0040912 | |||
| 3209 | Ga0496116_0065855 | |||
| 3210 | Ga0496117_0002308 | |||
| 3211 | Ga0496117_0008888 | |||
| 3212 | Ga0496117_0011079 | |||
| 3213 | Ga0496117_0015531 | |||
| 3214 | Ga0496117_0187842 | |||
| 3215 | Ga0496118_0001694 | |||
| 3216 | Ga0496118_0002288 | |||
| 3217 | Ga0496118_0004070 | |||
| 3218 | Ga0496118_0005974 | |||
| 3219 | Ga0496118_0008410 | |||
| 3220 | Ga0496118_0016919 | |||
| 3221 | Ga0496118_0044429 | |||
| 3222 | Ga0496119_0000430 | |||
| 3223 | Ga0496120_0001482 | |||
| 3224 | Ga0496120_0026146 | |||
| 3225 | Ga0496121_0000743 | |||
| 3226 | Ga0496121_0000878 | |||
| 3227 | Ga0496121_0005536 | |||
| 3228 | Ga0496121_0011904 | |||
| 3229 | Ga0496121_0019136 | |||
| 3230 | Ga0496121_0025245 | |||
| 3231 | Ga0496121_0029686 | |||
| 3232 | Ga0496121_0068654 | |||
| 3233 | Ga0496121_0099925 | |||
| 3234 | Ga0496121_0166342 | |||
| 3235 | Ga0496122_0001419 | |||
| 3236 | Ga0496122_0006843 | |||
| 3237 | Ga0496122_0008492 | |||
| 3238 | Ga0496122_0034716 | |||
| 3239 | Ga0496122_0260417 | |||
| 3240 | Ga0496123_0001598 | |||
| 3241 | Ga0496123_0006599 | |||
| 3242 | Ga0496123_0007233 | |||
| 3243 | Ga0496123_0044685 | |||
| 3244 | Ga0496123_0053734 | |||
| 3245 | Ga0496123_0108715 | |||
| 3246 | Ga0496123_0208601 | |||
| 3247 | Ga0496124_0001044 | |||
| 3248 | Ga0496124_0022236 | |||
| 3249 | Ga0496124_0084629 | |||
| 3250 | Ga0496125_0000330 | |||
| 3251 | Ga0496125_0007864 | |||
| 3252 | Ga0496125_0141264 | |||
| 3253 | Ga0496125_0234616 | |||
| 3254 | Ga0496126_0000057 | |||
| 3255 | Ga0496126_0003181 | |||
| 3256 | Ga0496126_0011781 | |||
| 3257 | Ga0496126_0037880 | |||
| 3258 | Ga0496126_0085543 | |||
| 3259 | Ga0496126_0107731 | |||
| 3260 | Ga0496126_0122123 | |||
| 3261 | Ga0496126_0528490 | |||
| 3262 | Ga0501308_005631 | |||
| 3263 | Ga0501305_002547 | |||
| 3264 | Ga0495678_000237 | |||
| 3265 | Ga0495678_046180 | |||
| 3266 | Ga0495682_0010154 | |||
| 3267 | Ga0501031_0005253 | |||
| 3268 | Ga0501031_0081639 | |||
| 3269 | Ga0501031_0149859 | |||
| 3270 | Ga0501031_0523149 | |||
| 3271 | Ga0501032_0005060 | |||
| 3272 | Ga0501032_0005454 | |||
| 3273 | Ga0501032_0123687 | |||
| 3274 | Ga0501032_0153567 | |||
| 3275 | Ga0501033_0000329 | |||
| 3276 | Ga0501033_0003729 | |||
| 3277 | Ga0501033_0019213 | |||
| 3278 | Ga0501033_0186760 | |||
| 3279 | Ga0501034_0000411 | |||
| 3280 | Ga0501034_0001357 | |||
| 3281 | Ga0501034_0001661 | |||
| 3282 | Ga0501034_0003703 | |||
| 3283 | Ga0501034_0037041 | |||
| 3284 | Ga0501034_0062696 | |||
| 3285 | Ga0501034_0123873 | |||
| 3286 | Ga0501034_0149559 | |||
| 3287 | Ga0501034_0183306 | |||
| 3288 | Ga0501034_0295390 | |||
| 3289 | Ga0501034_0331371 | |||
| 3290 | Ga0501034_0397917 | |||
| 3291 | Ga0501034_0727426 | |||
| 3292 | Ga0501036_0005648 | |||
| 3293 | Ga0501036_0027370 | |||
| 3294 | Ga0501036_0045145 | |||
| 3295 | Ga0501036_0064157 | |||
| 3296 | Ga0501036_0328518 | |||
| 3297 | Ga0501036_0482795 | |||
| 3298 | Ga0501037_0007118 | |||
| 3299 | Ga0501037_0009391 | |||
| 3300 | Ga0501037_0044301 | |||
| 3301 | Ga0501037_0186342 | |||
| 3302 | Ga0501038_0002332 | |||
| 3303 | Ga0501038_0007237 | |||
| 3304 | Ga0501038_0020463 | |||
| 3305 | Ga0501038_0224483 | |||
| 3306 | Ga0501038_0330702 | |||
| 3307 | Ga0501038_0610420 | |||
| 3308 | Ga0501039_0003401 | |||
| 3309 | Ga0501039_0013074 | |||
| 3310 | Ga0501039_0137852 | |||
| 3311 | Ga0501040_0002748 | |||
| 3312 | Ga0501040_0009977 | |||
| 3313 | Ga0501040_0029928 | |||
| 3314 | Ga0501041_0005212 | |||
| 3315 | Ga0501041_0105148 | |||
| 3316 | Ga0501042_0019042 | |||
| 3317 | Ga0501042_0037272 | |||
| 3318 | Ga0501042_0104451 | |||
| 3319 | Ga0501042_0325065 | |||
| 3320 | Ga0501043_0004587 | |||
| 3321 | Ga0501043_0005521 | |||
| 3322 | Ga0501043_0038883 | |||
| 3323 | Ga0501043_0079013 | |||
| 3324 | Ga0501043_0081864 | |||
| 3325 | Ga0501043_0123909 | |||
| 3326 | Ga0501043_0233102 | |||
| 3327 | Ga0501043_0447378 | |||
| 3328 | Ga0501046_0000202 | |||
| 3329 | Ga0501046_0002951 | |||
| 3330 | Ga0501046_0008359 | |||
| 3331 | Ga0501046_0012744 | |||
| 3332 | Ga0501046_0020233 | |||
| 3333 | Ga0501046_0024836 | |||
| 3334 | Ga0501046_0045092 | |||
| 3335 | Ga0501046_0086828 | |||
| 3336 | Ga0501047_0000748 | |||
| 3337 | Ga0501047_0007229 | |||
| 3338 | Ga0501047_0034066 | |||
| 3339 | Ga0501047_0057135 | |||
| 3340 | Ga0501047_0080934 | |||
| 3341 | Ga0501047_0085772 | |||
| 3342 | Ga0501047_0099975 | |||
| 3343 | Ga0501047_0119717 | |||
| 3344 | Ga0501047_0202088 | |||
| 3345 | Ga0501047_0238805 | |||
| 3346 | Ga0501047_0286709 | |||
| 3347 | Ga0501048_0024201 | |||
| 3348 | Ga0501048_0026524 | |||
| 3349 | Ga0501048_0049453 | |||
| 3350 | Ga0501048_0110752 | |||
| 3351 | Ga0501067_0000969 | |||
| 3352 | Ga0501067_0004300 | |||
| 3353 | Ga0501067_0211324 | |||
| 3354 | Ga0501068_0108801 | |||
| 3355 | Ga0501068_0134694 | |||
| 3356 | Ga0501068_0165665 | |||
| 3357 | Ga0501068_0310731 | |||
| 3358 | Ga0501069_0008226 | |||
| 3359 | Ga0501069_0008287 | |||
| 3360 | Ga0501069_0009860 | |||
| 3361 | Ga0501069_0026830 | |||
| 3362 | Ga0501069_0037712 | |||
| 3363 | Ga0501069_0137842 | |||
| 3364 | Ga0501069_0220764 | |||
| 3365 | Ga0501069_0359915 | |||
| 3366 | Ga0501070_0000511 | |||
| 3367 | Ga0501070_0000588 | |||
| 3368 | Ga0501070_0003969 | |||
| 3369 | Ga0501070_0007466 | |||
| 3370 | Ga0501070_0020658 | |||
| 3371 | Ga0501070_0038354 | |||
| 3372 | Ga0501070_0052819 | |||
| 3373 | Ga0501070_0063480 | |||
| 3374 | Ga0501070_0111768 | |||
| 3375 | Ga0501070_0156042 | |||
| 3376 | Ga0501070_0169190 | |||
| 3377 | Ga0501070_0261498 | |||
| 3378 | Ga0501070_0332190 | |||
| 3379 | Ga0501070_0341362 | |||
| 3380 | Ga0501071_0016581 | |||
| 3381 | Ga0501071_0068531 | |||
| 3382 | Ga0501071_0205135 | |||
| 3383 | Ga0501071_0268087 | |||
| 3384 | Ga0501072_0009507 | |||
| 3385 | Ga0501072_0031970 | |||
| 3386 | Ga0501072_0075815 | |||
| 3387 | Ga0501072_0094580 | |||
| 3388 | Ga0501073_0013953 | |||
| 3389 | Ga0501073_0016433 | |||
| 3390 | Ga0501073_0020861 | |||
| 3391 | Ga0501073_0037122 | |||
| 3392 | Ga0501073_0046668 | |||
| 3393 | Ga0501073_0051652 | |||
| 3394 | Ga0501073_0073633 | |||
| 3395 | Ga0501073_0085565 | |||
| 3396 | Ga0501073_0204491 | |||
| 3397 | Ga0501073_0279371 | |||
| 3398 | Ga0501074_0004544 | |||
| 3399 | Ga0501074_0006004 | |||
| 3400 | Ga0501074_0007085 | |||
| 3401 | Ga0501074_0009292 | |||
| 3402 | Ga0501074_0013181 | |||
| 3403 | Ga0501074_0053421 | |||
| 3404 | Ga0501074_0086594 | |||
| 3405 | Ga0501074_0175423 | |||
| 3406 | Ga0501075_0022125 | |||
| 3407 | Ga0501075_0143193 | |||
| 3408 | Ga0501076_0018272 | |||
| 3409 | Ga0501076_0251135 | |||
| 3410 | Ga0501079_0000982 | |||
| 3411 | Ga0501079_0079959 | |||
| 3412 | Ga0501079_0086907 | |||
| 3413 | Ga0501079_0224337 | |||
| 3414 | Ga0501079_0310252 | |||
| 3415 | Ga0501080_0001987 | |||
| 3416 | Ga0501080_0005078 | |||
| 3417 | Ga0501080_0009813 | |||
| 3418 | Ga0501080_0024565 | |||
| 3419 | Ga0501080_0026489 | |||
| 3420 | Ga0501080_0029269 | |||
| 3421 | Ga0501080_0037132 | |||
| 3422 | Ga0501080_0058835 | |||
| 3423 | Ga0501080_0119095 | |||
| 3424 | Ga0501080_0183587 | |||
| 3425 | Ga0501081_0002701 | |||
| 3426 | Ga0501083_0003824 | |||
| 3427 | Ga0501083_0012064 | |||
| 3428 | Ga0501083_0093189 | |||
| 3429 | Ga0501035_0003159 | |||
| 3430 | Ga0501035_0004686 | |||
| 3431 | Ga0501035_0011530 | |||
| 3432 | Ga0501035_0059213 | |||
| 3433 | Ga0501035_0065799 | |||
| 3434 | Ga0501035_0225887 | |||
| 3435 | Ga0501035_0288812 | |||
| 3436 | Ga0501035_0310314 | |||
| 3437 | Ga0501035_0466818 | |||
| 3438 | Ga0501044_0006675 | |||
| 3439 | Ga0501044_0009007 | |||
| 3440 | Ga0501044_0010264 | |||
| 3441 | Ga0501044_0030778 | |||
| 3442 | Ga0501044_0035211 | |||
| 3443 | Ga0501044_0051231 | |||
| 3444 | Ga0501044_0071532 | |||
| 3445 | Ga0501044_0088501 | |||
| 3446 | Ga0501044_0122205 | |||
| 3447 | Ga0501044_0128713 | |||
| 3448 | Ga0501044_0189331 | |||
| 3449 | Ga0501044_0476047 | |||
| 3450 | Ga0501044_0545866 | |||
| 3451 | Ga0501045_0001661 | |||
| 3452 | Ga0501045_0165938 | |||
| 3453 | Ga0501045_0196647 | |||
| 3454 | nmdc:mga05p37_253260_c1 | |||
| 3455 | nmdc:mga05p37_43420_c1 | |||
| 3456 | nmdc:mga08y16_288964_c1 | |||
| 3457 | nmdc:mga0n895_121117_c1 | |||
| 3458 | nmdc:mga0rr50_798_c1 | |||
| 3459 | nmdc:mga08x19_107361_c1 | |||
| 3460 | nmdc:mga08x19_193477_c1 | |||
| 3461 | nmdc:mga08x19_40745_c1 | |||
| 3462 | nmdc:mga0a205_67618_c1 | |||
| 3463 | nmdc:mga0sz30_9663_c1 | |||
| 3464 | Ga0500610_0013261 | |||
| 3465 | Ga0500643_000020 | |||
| 3466 | Ga0500643_036015 | |||
| 3467 | Ga0500651_0000592 | |||
| 3468 | Ga0500555_000336 | |||
| 3469 | Ga0500597_027420 | |||
| 3470 | Ga0500652_085216 | |||
| 3471 | Ga0500559_0144884 | |||
| 3472 | Ga0500561_0014856 | |||
| 3473 | Ga0500568_0000145 | |||
| 3474 | Ga0500627_0119526 | |||
| 3475 | Ga0500633_0000702 | |||
| 3476 | Ga0500636_0214431 | |||
| 3477 | Ga0500645_001746 | |||
| 3478 | Ga0501084_0002444 | |||
| 3479 | Ga0501084_0077485 | |||
| 3480 | Ga0501084_0315743 | |||
| 3481 | Ga0500661_007161 | |||
| 3482 | Ga0587073_0002117 | |||
| 3483 | Ga0587082_000953 | |||
| 3484 | Ga0587083_0017763 | |||
| 3485 | Ga0587088_021761 | |||
| 3486 | Ga0587106_011083 | |||
| 3487 | Ga0587076_002674 | |||
| 3488 | Ga0501082_0000082 | |||
| 3489 | Ga0501082_0001816 | |||
| 3490 | Ga0501082_0160299 | |||
| 3491 | Ga0501082_0197205 | |||
| 3492 | Ga0501082_0330353 | |||
| 3493 | Ga0466962_0002443 | |||
| 3494 | Ga0466962_0061287 | |||
| 3495 | Ga0530510_0013467 | |||
| 3496 | Ga0530510_0101826 | |||
| 3497 | 2511266537 | |||
| 3498 | 2511320490 | |||
| 3499 | 2511369125 | |||
| 3500 | 2511411098 | |||
| 3501 | 2512328328 | |||
| 3502 | 2513953180 | |||
| 3503 | 2514042145 | |||
| 3504 | 2525555961 | |||
| 3505 | 2538832269 | |||
| 3506 | 2555668058 | |||
| 3507 | 2583790500 | |||
| 3508 | 2595446802 | |||
| 3509 | 2595449564 | |||
| 3510 | 2597856273 | |||
| 3511 | 2599483471 | |||
| 3512 | 2599805377 | |||
| 3513 | 2600364083 | |||
| 3514 | 2600442452 | |||
| 3515 | 2602012386 | |||
| 3516 | 2630650975 | |||
| 3517 | 2643830279 | |||
| 3518 | 2643896784 | |||
| 3519 | 2644030482 | |||
| 3520 | 2644478989 | |||
| 3521 | 2671767887 | |||
| 3522 | 2687580517 | |||
| 3523 | 2687583772 | |||
| 3524 | 2715750794 | |||
| 3525 | 2718632724 | |||
| 3526 | 2721026525 | |||
| 3527 | 2735833480 | |||
| 3528 | 2739229481 | |||
| 3529 | 2739316443 | |||
| 3530 | 2739730256 | |||
| 3531 | 2743735682 | |||
| 3532 | 2808943050 | |||
| 3533 | 2819563958 | |||
| 3534 | 2823422551 | |||
| 3535 | 2842835691 | |||
| 3536 | 2842847438 | |||
| 3537 | 2842918502 | |||
| 3538 | 2842919876 | |||
| 3539 | 2846037042 | |||
| 3540 | 2858697910 | |||
| 3541 | 2884341474 | |||
| 3542 | 2884412148 | |||
| 3543 | 2894414648 | |||
| 3544 | 2894510786 | |||
| 3545 | 2895397666 | |||
| 3546 | 2901308509 | |||
| 3547 | 2904464594 | |||
| 3548 | 2919088324 | |||
| 3549 | 2919385856 | |||
| 3550 | 2919406093 | |||
| 3551 | 2919490641 | |||
| 3552 | 2919505010 | |||
| 3553 | 2923154691 | |||
| 3554 | 2926066687 | |||
| 3555 | 2928967692 | |||
| 3556 | 2939612519 | |||
| 3557 | 2941472924 | |||
| 3558 | 2953995173 | |||
| 3559 | 2969305626 | |||
| 3560 | 2974292741 | |||
| 3561 | 2984291338 | |||
| 3562 | 2998141069 | |||
| 3563 | 2998348353 | |||
| 3564 | 3007256036 | |||
| 3565 | 3007319893 | |||
| 3566 | 3007400221 | |||
| 3567 | 3007420705 | |||
| 3568 | 3007619695 | |||
| 3569 | 3007860950 | |||
| 3570 | 3007863710 | |||
| 3571 | 644747125 | |||
| 3572 | 8002747903 | |||
| 3573 | 8015688927 | |||
| 3574 | 8029999693 | |||
| 3575 | 8034964162 | |||
| 3576 | 8055772044 | |||
| 3577 | 8056169982 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4yvg-assembly1.cif.gz_A | crystal structure of h. influenzae trmd in complex with adomet | 0.9767 | 1 | 245 |
| 4yvk-assembly1.cif.gz_A | crystal structure of h. influenzae trmd in complex with sinefungin and trna variant (g36c) | 0.9753 | 1 | 244 |
| 1uak-assembly1.cif.gz_A | crystal structure of trna(m1g37)methyltransferase: insight into trna recognition | 0.9751 | 1 | 246 |
| 4ypx-assembly1.cif.gz_A-2 | crystal structure of trmd, a m1g37 trna methyltransferase with sam-competitive compounds | 0.9739 | 1 | 244 |
| 5wyq-assembly1.cif.gz_B | crystal structure and catalytic mechanism of the essential m1g37 trna methyltransferase trmd from pseudomonas aeruginosa | 0.973 | 2 | 244 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P0A873_166_255_1.10.1270.20 | Mainly Alpha;Orthogonal Bundle;Trp Operon Repressor; Chain A;tRNA(m1g37)methyltransferase, domain 2 | 0.9934 | 167 | 252 | 1.10.1270.20 |
| 5wyqB02 | Mainly Alpha;Orthogonal Bundle;Trp Operon Repressor; Chain A;tRNA(m1g37)methyltransferase, domain 2 | 0.9789 | 170 | 244 | 1.10.1270.20 |
| 5wyrA01 | Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain | 0.9764 | 1 | 162 | 3.40.1280.10 |
| 5wyrA02 | Mainly Alpha;Orthogonal Bundle;Trp Operon Repressor; Chain A;tRNA(m1g37)methyltransferase, domain 2 | 0.9762 | 169 | 242 | 1.10.1270.20 |
| 5zhlA02 | Mainly Alpha;Orthogonal Bundle;Trp Operon Repressor; Chain A;tRNA(m1g37)methyltransferase, domain 2 | 0.9735 | 175 | 223 | 1.10.1270.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2Z7C629-F1-model_v4 | tRNA (guanine-N(1)-)-methyltransferase (EC 2.1.1.228) (M1G-methyltransferase) (tRNA [GM37] methyltransferase) | 0.9913 | 19 | 234 |
GO:0002939
GO:0003735 GO:0005829 GO:0005840 GO:0006364 GO:0006412 GO:0043022 GO:0052906 GO:1990904 |
| AF-A0A6I7WYU9-F1-model_v4 | tRNA (guanine-N(1)-)-methyltransferase (EC 2.1.1.228) (M1G-methyltransferase) (tRNA [GM37] methyltransferase) | 0.9907 | 1 | 246 |
GO:0002939
GO:0005829 GO:0052906 |
| AF-A0A0J7YLT4-F1-model_v4 | tRNA (guanine-N(1)-)-methyltransferase (EC 2.1.1.228) (M1G-methyltransferase) (tRNA [GM37] methyltransferase) | 0.9905 | 43 | 250 |
GO:0002939
GO:0003735 GO:0005829 GO:0005840 GO:0006412 GO:0052906 GO:1990904 |
| AF-A0A259FH75-F1-model_v4 | tRNA (guanine-N(1)-)-methyltransferase (EC 2.1.1.228) (M1G-methyltransferase) (tRNA [GM37] methyltransferase) | 0.989 | 1 | 226 |
GO:0002939
GO:0005829 GO:0052906 |
| AF-A0A2P5T1L2-F1-model_v4 | tRNA (guanine-N(1)-)-methyltransferase (EC 2.1.1.228) (M1G-methyltransferase) (tRNA [GM37] methyltransferase) | 0.9888 | 1 | 245 |
GO:0002939
GO:0005829 GO:0052906 |