F495756
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1807 | 1073 | 3612 | 247 |
Family's Representative Sequence
| Representative Sequence | 3300048922|Ga0496119_0020826|Ga0496119_0020826_224_1120 |
| Length | 298 |
| Sequence | VIALLLDECGSIPYNAAIQHGKRGGRPVCGQTHSYVTLSPCASYEQNRGAMAGHSQFKNIMHRKGRQDAVRSKMFSKLGREITVAAKQGLPDPLMNPRLRLAIQNAKAQSMPKDNIERAIKKAAGNDGENYDEVRYEGRGPGGVMVIVEALTDNRNRTASNVRAAFTKSGGALGETGSAAFMFDRVGEIVYKISVGDADKVMEAAIEAGADDVQSGEEEHVILCAFEDIGEVSKALETALGEAESIKTIWKPQTNTELDEEKARSVLKLLNVLEDDDDVQNVYSNFEVSDEVMEKLSA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 2 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 3 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 4 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 5 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 6 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 7 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 8 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 9 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 10 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 11 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 12 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 13 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 14 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 15 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 16 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 17 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 18 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 19 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 20 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 21 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 22 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 23 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 24 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 25 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 26 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 27 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 28 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 29 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 30 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 37 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 46 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 52 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 55 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 56 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 59 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 61 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 62 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 63 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 64 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 65 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 66 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 67 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 68 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 69 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 70 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 71 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 72 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 73 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 74 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 75 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 76 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 77 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 78 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 79 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 80 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 81 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 82 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 84 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 85 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 86 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 87 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 88 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 89 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 90 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 91 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 92 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 94 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 95 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 96 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009763 | Root nodule microbial communities of legume samples collected from Mexico - Siratro Mexico nodule mix | Metagenome | Nodule |
| 108 | 3300009765 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule | Metagenome | Nodule |
| 109 | 3300009766 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule | Metagenome | Nodule |
| 110 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300012500 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 | Metagenome | Rhizosphere |
| 113 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 121 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 123 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 124 | 3300015690 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 | Metagenome | Rhizosphere |
| 125 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 127 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 128 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 129 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 130 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 131 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 132 | 3300022739 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules | Metagenome | Nodule |
| 133 | 3300022740 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules | Metagenome | Nodule |
| 134 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 135 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 136 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 137 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 138 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 139 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 140 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 141 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 142 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 143 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 144 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 145 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 146 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 147 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 148 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 149 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 150 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 151 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 152 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 153 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 154 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 155 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 201 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 203 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 204 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 205 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 209 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 210 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 211 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 212 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 213 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 214 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 215 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 216 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 217 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 218 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 219 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 220 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 221 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 222 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 223 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 224 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 225 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 226 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 227 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 228 | 3300031967 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules | Metagenome | Nodule |
| 229 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 230 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 231 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 232 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 233 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 234 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 235 | 3300033430 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules | Metagenome | Nodule |
| 236 | 3300033464 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules | Metagenome | Nodule |
| 237 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 238 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 239 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 240 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 241 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 242 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 243 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 244 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 245 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 246 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 247 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 248 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 249 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 250 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 251 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 252 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 253 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 254 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 255 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 256 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 257 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 258 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 259 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 260 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 261 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 262 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 263 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 264 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 265 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 266 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 267 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 268 | 3300041907 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaT_extra_run | Metatranscriptome | Unclassified |
| 269 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 270 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 271 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 272 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 273 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 274 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 275 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 276 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 277 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 278 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 279 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 280 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 281 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 282 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 283 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 284 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 285 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 286 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 287 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 288 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 289 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 290 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 291 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 292 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 293 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 294 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 295 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 296 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 297 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 298 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 349 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 350 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 351 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 352 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 353 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 354 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 355 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 356 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 357 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 358 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 359 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 360 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 361 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 362 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 363 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 364 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 365 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 366 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 367 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 368 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 369 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 370 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 371 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 372 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 373 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 374 | 3300049129 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 375 | 3300049160 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 376 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 377 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 378 | 3300049530 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 379 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 380 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 381 | 3300049534 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 382 | 3300049536 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 383 | 3300049537 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 384 | 3300049539 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 385 | 3300049556 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 386 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 387 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 388 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 389 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 390 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 391 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 392 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 393 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 394 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 395 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 396 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 397 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 398 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 399 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 400 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 401 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 402 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 403 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 404 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 405 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 406 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 407 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 408 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 409 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 410 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 411 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 412 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 413 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 414 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 415 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 416 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 417 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 418 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 419 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 420 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 421 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 422 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 423 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 424 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 425 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 426 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 427 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 428 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 429 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 430 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 431 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 432 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 433 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 434 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 435 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 436 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 437 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 438 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 439 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 440 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 441 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 442 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 443 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 444 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 445 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 446 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 447 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 448 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 449 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 450 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 451 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 452 | 3300059490 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 453 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 454 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 455 | 3300059506 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 456 | 3300059507 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 457 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 458 | 3300059509 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 459 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 460 | 3300059513 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 461 | 3300059605 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 462 | 3300059607 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 463 | 3300059609 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 227R_SD_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 464 | 3300059623 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 465 | 3300059626 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 466 | 3300059630 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 467 | 3300059639 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 468 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 469 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 470 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 471 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 472 | 3300059660 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 161R_SW_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 473 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 474 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 475 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 476 | 2508501122 | Ensifer yinggardensis WSM1721 | Isolate | Nodule |
| 477 | 2509276019 | Ensifer aridi TW10 | Isolate | Nodule |
| 478 | 2509276033 | Rhizobium leguminosarum bv. trifolii WSM2012 | Isolate | Nodule |
| 479 | 2510065019 | Rhizobium leguminosarum bv. trifolii WSM1689 | Isolate | Nodule |
| 480 | 2510065057 | Sinorhizobium meliloti WSM1022 | Isolate | Nodule |
| 481 | 2510461069 | Rhizobium sp. PDO1-076 | Isolate | Rhizosphere |
| 482 | 2510461076 | Rhizobium leguminosarum bv. trifolii TA1 | Isolate | Nodule |
| 483 | 2510917022 | Rhizobium sp. AP16 | Isolate | Rhizosphere |
| 484 | 2510917026 | Rhizobium sp. CF80 | Isolate | Rhizosphere |
| 485 | 2510917028 | Rhizobium sp. CF122 | Isolate | Rhizosphere |
| 486 | 2510917030 | Rhizobium sp. CF142 | Isolate | Rhizosphere |
| 487 | 2511231027 | Phyllobacterium sp. YR531 | Isolate | Rhizosphere |
| 488 | 2511231052 | Sinorhizobium meliloti AK58 | Isolate | Nodule |
| 489 | 2512047086 | Sinorhizobium arboris LMG 14919 | Isolate | Nodule |
| 490 | 2512875026 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 491 | 2513237084 | Rhizobium leguminosarum bv. viciae UPM1131 | Isolate | Nodule |
| 492 | 2513237085 | Rhizobium leguminosarum bv. viciae UPM1137 | Isolate | Nodule |
| 493 | 2513237086 | Sinorhizobium meliloti MVII-I | Isolate | Nodule |
| 494 | 2513237088 | Rhizobium mesoamericanum STM6155 | Isolate | Nodule |
| 495 | 2513237089 | Sinorhizobium medicae DI28 | Isolate | Nodule |
| 496 | 2513237091 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 497 | 2513237093 | Rhizobium leguminosarum bv. phaseoli FA23 | Isolate | Nodule |
| 498 | 2513237103 | Rhizobium leguminosarum bv. viciae VF39 | Isolate | Nodule |
| 499 | 2513237138 | Rhizobium favelukesii OR191 | Isolate | Nodule |
| 500 | 2513237140 | Sinorhizobium meliloti GVPV12 | Isolate | Nodule |
| 501 | 2513237143 | Sinorhizobium meliloti Mlalz-1 | Isolate | Nodule |
| 502 | 2513237156 | Sinorhizobium medicae WSM1369 | Isolate | Nodule |
| 503 | 2513237160 | Sinorhizobium medicae WSM244 | Isolate | Nodule |
| 504 | 2513237162 | Rhizobium ruizarguesonis GB30 | Isolate | Nodule |
| 505 | 2515075009 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 506 | 2515154107 | Sinorhizobium meliloti 4H41 | Isolate | Nodule |
| 507 | 2515154113 | Rhizobium ruizarguesonis Vc2 | Isolate | Nodule |
| 508 | 2515154114 | Rhizobium ruizarguesonis Vh3 | Isolate | Nodule |
| 509 | 2515154116 | Rhizobium ruizarguesonis Ps8 | Isolate | Nodule |
| 510 | 2515154134 | Rhizobium gallicum bv. gallicum R602sp | Isolate | Nodule |
| 511 | 2516143018 | Ensifer sp. BR816 | Isolate | Nodule |
| 512 | 2516653046 | Sinorhizobium meliloti BO21CC | Isolate | Nodule |
| 513 | 2516653077 | Rhizobium acaciae WSM1481 | Isolate | Nodule |
| 514 | 2516653085 | Rhizobium leguminosarum bv. phaseoli 4292 | Isolate | Nodule |
| 515 | 2517093000 | Rhizobium leguminosarum bv. trifolii SRDI943 | Isolate | Nodule |
| 516 | 2517287029 | Rhizobium leguminosarum bv. trifolii SRDI565 | Isolate | Nodule |
| 517 | 2517487022 | Sinorhizobium medicae WSM4191 | Isolate | Nodule |
| 518 | 2523231067 | Pleomorphomonas oryzae DSM 16300 | Isolate | Unclassified |
| 519 | 2524023207 | Ensifer sp. USDA 6670 | Isolate | Nodule |
| 520 | 2524023209 | Rhizobium leucaenae USDA 9039 | Isolate | Nodule |
| 521 | 2529292951 | Rhizobium sp. CCGE 510 | Isolate | Nodule |
| 522 | 2534681786 | Brucella suis 92/29 | Isolate | Unclassified |
| 523 | 2534681796 | Rhizobium grahamii CCGE 502 | Isolate | Nodule |
| 524 | 2537561587 | Agrobacterium tumefaciens Cherry 2E-2-2 | Isolate | Rhizosphere |
| 525 | 2551306084 | Sinorhizobium meliloti 5A14 | Isolate | Nodule |
| 526 | 2551306085 | Sinorhizobium meliloti AE608H | Isolate | Nodule |
| 527 | 2551306086 | Sinorhizobium meliloti AK11 | Isolate | Nodule |
| 528 | 2551306087 | Sinorhizobium meliloti A0643DD | Isolate | Nodule |
| 529 | 2551306089 | Sinorhizobium meliloti 1A42 | Isolate | Nodule |
| 530 | 2551306090 | Sinorhizobium meliloti A0641M | Isolate | Nodule |
| 531 | 2551306091 | Sinorhizobium meliloti C0431A | Isolate | Nodule |
| 532 | 2551306092 | Sinorhizobium meliloti AK75 | Isolate | Nodule |
| 533 | 2551306093 | Sinorhizobium meliloti C0438LL | Isolate | Nodule |
| 534 | 2554235003 | Agrobacterium tumefaciens WRT31 | Isolate | Rhizosphere |
| 535 | 2554235227 | Arthrobacter sp. PAO19 | Isolate | Rhizosphere |
| 536 | 2558860100 | Sinorhizobium sp. PC2 | Isolate | Nodule |
| 537 | 2558860242 | Agrobacterium fabacearum P4 | Isolate | Rhizosphere |
| 538 | 2558860983 | Allorhizobium undicola ATCC 700741 | Isolate | Rhizoplane |
| 539 | 2582581283 | Rhizobium sp. OK665 | Isolate | Rhizosphere |
| 540 | 2582581294 | Rhizobium sp. CF394 | Isolate | Rhizosphere |
| 541 | 2582581298 | Rhizobium alamii YR540 | Isolate | Rhizosphere |
| 542 | 2582581299 | Rhizobium leguminosarum OV483 | Isolate | Rhizosphere |
| 543 | 2582581304 | Rhizobium sp. YR519 | Isolate | Rhizosphere |
| 544 | 2582581306 | Rhizobium sp. YR295 | Isolate | Rhizosphere |
| 545 | 2582581307 | Rhizobium sp. YR060 | Isolate | Rhizosphere |
| 546 | 2582581308 | Rhizobium sp. OK494 | Isolate | Rhizosphere |
| 547 | 2582581315 | Agrobacterium rhizogenes YR147 | Isolate | Rhizosphere |
| 548 | 2582581316 | Agrobacterium rhizogenes OK036 | Isolate | Rhizosphere |
| 549 | 2582581865 | Rhizobium sp. CF258 | Isolate | Rhizosphere |
| 550 | 2582581867 | Rhizobium sp. OV201 | Isolate | Rhizosphere |
| 551 | 2585427526 | Rhizobium leguminosarum OV152 | Isolate | Rhizosphere |
| 552 | 2585427527 | Rhizobium lusitanum YR374 | Isolate | Rhizosphere |
| 553 | 2585427528 | Rhizobium leguminosarum CF307 | Isolate | Rhizosphere |
| 554 | 2585427529 | Rhizobium alamii YR584 | Isolate | Rhizosphere |
| 555 | 2585427530 | Rhizobium tropici YR635 | Isolate | Rhizosphere |
| 556 | 2585427531 | Agrobacterium rhizogenes YR530 | Isolate | Rhizosphere |
| 557 | 2585427590 | Rhizobium sp. CF048 | Isolate | Rhizosphere |
| 558 | 2585427593 | Rhizobium tropici CF286 | Isolate | Rhizosphere |
| 559 | 2585427594 | Rhizobium sp. YR528 | Isolate | Rhizosphere |
| 560 | 2585427608 | Agrobacterium rhizogenes OV677 | Isolate | Rhizosphere |
| 561 | 2585427609 | Agrobacterium rhizogenes CF263 | Isolate | Rhizosphere |
| 562 | 2585427633 | Neorhizobium galegae bv. officinalis HAMBI 1141 | Isolate | Nodule |
| 563 | 2585427634 | Neorhizobium galegae bv. orientalis HAMBI 540 | Isolate | Nodule |
| 564 | 2585428125 | Agrobacterium rhizogenes CF262 | Isolate | Rhizosphere |
| 565 | 2599185156 | Rhizobium sp. NFR03 | Isolate | Rhizoplane |
| 566 | 2599185170 | Rhizobium mongolense USDA 1844 (PacBio) | Isolate | Nodule |
| 567 | 2599185210 | Rhizobium sp. NFACC06-2 | Isolate | Rhizoplane |
| 568 | 2599185236 | Rhizobium sp. NFR07 | Isolate | Rhizoplane |
| 569 | 2600254933 | Rhizobium sp. NFR12 | Isolate | Rhizoplane |
| 570 | 2600255279 | Rhizobium sp. NFIX01 | Isolate | Rhizoplane |
| 571 | 2600255308 | Rhizobium sp. NFIX02 | Isolate | Rhizoplane |
| 572 | 2615840624 | Rhizobium aethiopicum HBR26 | Isolate | Nodule |
| 573 | 2615840626 | Rhizobium lusitanum P1-7 | Isolate | Nodule |
| 574 | 2615840698 | Rhizobium multihospitium HAMBI 2975 | Isolate | Nodule |
| 575 | 2643221546 | Microbacterium sp. Root53 | Isolate | Unclassified |
| 576 | 2643221550 | Mesorhizobium sp. Root552 | Isolate | Unclassified |
| 577 | 2643221558 | Rhizobium sp. Root149 | Isolate | Unclassified |
| 578 | 2643221564 | Mesorhizobium sp. Root157 | Isolate | Unclassified |
| 579 | 2643221568 | Rhizobium sp. Root564 | Isolate | Unclassified |
| 580 | 2643221582 | Rhizobium sp. Root651 | Isolate | Unclassified |
| 581 | 2643221599 | Rhizobium sp. Root708 | Isolate | Unclassified |
| 582 | 2643221607 | Rhizobium sp. Root73 | Isolate | Unclassified |
| 583 | 2643221618 | Ensifer sp. Root231 | Isolate | Unclassified |
| 584 | 2643221626 | Ensifer sp. Root31 | Isolate | Unclassified |
| 585 | 2643221634 | Rhizobium sp. Root1203 | Isolate | Unclassified |
| 586 | 2643221636 | Rhizobium sp. Root1204 | Isolate | Unclassified |
| 587 | 2643221637 | Rhizobium sp. Root1212 | Isolate | Unclassified |
| 588 | 2643221643 | Rhizobium sp. Root1220 | Isolate | Unclassified |
| 589 | 2643221653 | Rhizobium sp. Root1240 | Isolate | Unclassified |
| 590 | 2643221655 | Ensifer sp. Root1252 | Isolate | Unclassified |
| 591 | 2643221659 | Ensifer sp. Root127 | Isolate | Unclassified |
| 592 | 2643221686 | Rhizobium sp. Root1334 | Isolate | Unclassified |
| 593 | 2643221688 | Rhizobium sp. Root482 | Isolate | Unclassified |
| 594 | 2643221689 | Rhizobium sp. Root483D2 | Isolate | Unclassified |
| 595 | 2643221693 | Rhizobium sp. Root491 | Isolate | Unclassified |
| 596 | 2643221698 | Ensifer sp. Root142 | Isolate | Unclassified |
| 597 | 2643221712 | Ensifer sp. Root258 | Isolate | Unclassified |
| 598 | 2643221718 | Rhizobium sp. Root268 | Isolate | Unclassified |
| 599 | 2643221719 | Rhizobium sp. Root274 | Isolate | Unclassified |
| 600 | 2654587600 | Glutamicibacter halophytocola KLBMP5180 | Isolate | Unclassified |
| 601 | 2657244999 | Sinorhizobium sojae CCBAU 05684 | Isolate | Unclassified |
| 602 | 2667528174 | Rhizobium sp. NFR17 | Isolate | Rhizoplane |
| 603 | 2671180139 | Chelativorans sp. A52C2 | Isolate | Unclassified |
| 604 | 2690316117 | Sinorhizobium fredii CCBAU 45436 | Isolate | Unclassified |
| 605 | 2718217882 | Rhizobium sp. N741 | Isolate | Nodule |
| 606 | 2718217927 | Rhizobium sp. N324 | Isolate | Nodule |
| 607 | 2718218009 | Rhizobium sp. N561 | Isolate | Nodule |
| 608 | 2718218199 | Rhizobium phaseoli sv. phaseoli N261 | Isolate | Nodule |
| 609 | 2718218232 | Rhizobium phaseoli sv. phaseoli N161 | Isolate | Nodule |
| 610 | 2718218233 | Rhizobium phaseoli sv. phaseoli R744 | Isolate | Nodule |
| 611 | 2718218235 | Rhizobium phaseoli sv. phaseoli R620 | Isolate | Nodule |
| 612 | 2718218269 | Rhizobium phaseoli sv. phaseoli N671 | Isolate | Nodule |
| 613 | 2718218363 | Rhizobium sp. N113 | Isolate | Nodule |
| 614 | 2718218365 | Rhizobium sp. N731 | Isolate | Nodule |
| 615 | 2718218366 | Rhizobium sp. N621 | Isolate | Nodule |
| 616 | 2718218423 | Rhizobium sp. N941 | Isolate | Nodule |
| 617 | 2721755514 | Rhizobium sp. N6212 | Isolate | Nodule |
| 618 | 2721755556 | Rhizobium phaseoli sv. phaseoli N931 | Isolate | Nodule |
| 619 | 2721755684 | Rhizobium phaseoli sv. phaseoli N841 | Isolate | Nodule |
| 620 | 2721755685 | Rhizobium phaseoli sv. phaseoli R611 | Isolate | Nodule |
| 621 | 2721755809 | Rhizobium sp. N541 | Isolate | Nodule |
| 622 | 2721755810 | Rhizobium sp. N871 | Isolate | Nodule |
| 623 | 2721755819 | Rhizobium phaseoli sv. phaseoli N771 | Isolate | Nodule |
| 624 | 2721755822 | Rhizobium phaseoli sv. phaseoli R650 | Isolate | Nodule |
| 625 | 2721755823 | Rhizobium phaseoli sv. phaseoli R630 | Isolate | Nodule |
| 626 | 2724679232 | Rhizobium leguminosarum Vaf12 | Isolate | Unclassified |
| 627 | 2728369352 | Rhizobium phaseoli sv. phaseoli N831 | Isolate | Nodule |
| 628 | 2728369365 | Rhizobium sp. N1341 | Isolate | Nodule |
| 629 | 2728369397 | Rhizobium sp. N1314 | Isolate | Nodule |
| 630 | 2738541293 | Rhizobium sp. GV031 | Isolate | Unclassified |
| 631 | 2738541317 | Rhizobium halophytocola DSM 21600 | Isolate | Unclassified |
| 632 | 2738541333 | Rhizobium sophoriradicis CCBAU 03470 | Isolate | Unclassified |
| 633 | 2738543031 | Pleomorphomonas sp. CF100 | Isolate | Unclassified |
| 634 | 2751185800 | Brucella pituitosa AA2 | Isolate | Unclassified |
| 635 | 2751185821 | Ensifer shofinae CCBAU 251167 | Isolate | Unclassified |
| 636 | 2757320392 | Phyllobacterium leguminum ORS 1419 | Isolate | Nodule |
| 637 | 2758568016 | [Ochrobactrum] quorumnocens A44 | Isolate | Rhizosphere |
| 638 | 2765235802 | Phyllobacterium bourgognense 31-25a | Isolate | Rhizoplane |
| 639 | 2765235942 | Rhizobium sp. WYCCWR10014 | Isolate | Nodule |
| 640 | 2767802442 | Phyllobacterium brassicacearum 29-15 | Isolate | Rhizoplane |
| 641 | 2775506902 | Phyllobacterium zundukense Tri-48 | Isolate | Unclassified |
| 642 | 2775506904 | Phyllobacterium zundukense Tri-38 | Isolate | Unclassified |
| 643 | 2775507049 | Rhizobium sp. ACO-34A | Isolate | Unclassified |
| 644 | 2775507266 | Rhizobium tropici PRF 81 | Isolate | Nodule |
| 645 | 2791355082 | Ensifer alkalisoli YIC4027 | Isolate | Nodule |
| 646 | 2791355091 | Sinorhizobium sp. FG01 | Isolate | Nodule |
| 647 | 2791355092 | Sinorhizobium sp. NG07B | Isolate | Nodule |
| 648 | 2791355094 | Sinorhizobium sp. BJ1 | Isolate | Nodule |
| 649 | 2791355253 | Rhizobium rhizosphaerae RD15 | Isolate | Rhizosphere |
| 650 | 2791355256 | Rhizobium sp. M10 | Isolate | Nodule |
| 651 | 2791355259 | Rhizobium hidalgonense FH14 | Isolate | Nodule |
| 652 | 2791355260 | Rhizobium sp. L9 | Isolate | Nodule |
| 653 | 2791355261 | Rhizobium sp. J15 | Isolate | Nodule |
| 654 | 2791355262 | Rhizobium sp. M1 | Isolate | Nodule |
| 655 | 2791355263 | Rhizobium chutanense C5 | Isolate | Nodule |
| 656 | 2791355264 | Rhizobium sp. S9 | Isolate | Nodule |
| 657 | 2791355265 | Rhizobium sp. H4 | Isolate | Nodule |
| 658 | 2791355266 | Rhizobium sp. L43 | Isolate | Nodule |
| 659 | 2791355267 | Rhizobium sp. L18 | Isolate | Nodule |
| 660 | 2802428858 | Sinorhizobium medicae M14-1 | Isolate | Nodule |
| 661 | 2802428859 | Sinorhizobium medicae SF3.41 | Isolate | Nodule |
| 662 | 2802428860 | Sinorhizobium medicae M19-1 | Isolate | Nodule |
| 663 | 2802428861 | Sinorhizobium medicae USDA1037 | Isolate | Nodule |
| 664 | 2802428862 | Sinorhizobium medicae M7-4 | Isolate | Nodule |
| 665 | 2802428863 | Sinorhizobium medicae M26-2 | Isolate | Nodule |
| 666 | 2802429268 | Sinorhizobium sojae CCBAU 05684 | Isolate | Unclassified |
| 667 | 2802429605 | Rhizobium sophoriradicis L101 | Isolate | Nodule |
| 668 | 2802429606 | Rhizobium sophoriradicis JJW1 | Isolate | Nodule |
| 669 | 2802429633 | Rhizobium anhuiense J3 | Isolate | Nodule |
| 670 | 2802429634 | Rhizobium anhuiense S10 | Isolate | Nodule |
| 671 | 2802429635 | Rhizobium anhuiense Y27 | Isolate | Nodule |
| 672 | 2802429636 | Rhizobium anhuiense JX3 | Isolate | Nodule |
| 673 | 2802429637 | Rhizobium anhuiense C15 | Isolate | Nodule |
| 674 | 2808606370 | Arthrobacter sp. SLBN-100 | Isolate | Unclassified |
| 675 | 2808606387 | Rhizobium sp. SJZ105 | Isolate | Rhizosphere |
| 676 | 2818991272 | Rhizobium sp. SLBN-4 | Isolate | Unclassified |
| 677 | 2818991439 | Agrobacterium tumefaciens 1187 | Isolate | Unclassified |
| 678 | 2818991448 | Rhizobium miluonense 1234 | Isolate | Unclassified |
| 679 | 2818991453 | Rhizobium lusitanum 1158 | Isolate | Unclassified |
| 680 | 2818991461 | Neorhizobium alkalisoli 1225 | Isolate | Unclassified |
| 681 | 2821123053 | Rhizobium cellulosilyticum 1193 | Isolate | Unclassified |
| 682 | 2833709550 | Microbacterium sp. 3290 | Isolate | Rhizosphere |
| 683 | 2837678835 | Jiella endophytica CBS5Q-3 | Isolate | Unclassified |
| 684 | 2838016132 | Rhizobium phaseoli SEMIA 4071 | Isolate | Nodule |
| 685 | 2838022645 | Rhizobium aethiopicum SEMIA 4074 | Isolate | Nodule |
| 686 | 2838029111 | Rhizobium tropici SEMIA 4079 | Isolate | Nodule |
| 687 | 2838042994 | Rhizobium esperanzae SEMIA 4089 | Isolate | Nodule |
| 688 | 2838048938 | Rhizobium pisi 27/80 | Isolate | Nodule |
| 689 | 2838061910 | Rhizobium phaseoli L15 | Isolate | Nodule |
| 690 | 2838661181 | Rhizobium mongolense SEMIA 402 | Isolate | Nodule |
| 691 | 2838675328 | Agrobacterium radiobacter SEMIA 410 | Isolate | Nodule |
| 692 | 2838686498 | Rhizobium leguminosarum SEMIA 416 | Isolate | Nodule |
| 693 | 2838714209 | Agrobacterium radiobacter SEMIA 435 | Isolate | Nodule |
| 694 | 2838719591 | Agrobacterium radiobacter SEMIA 436 | Isolate | Nodule |
| 695 | 2838724970 | Agrobacterium radiobacter SEMIA 437 | Isolate | Nodule |
| 696 | 2838729681 | Rhizobium leguminosarum SEMIA 445 | Isolate | Nodule |
| 697 | 2838736955 | Rhizobium cellulosilyticum SEMIA 448 | Isolate | Nodule |
| 698 | 2838742623 | Rhizobium leguminosarum SEMIA 449 | Isolate | Nodule |
| 699 | 2839993093 | Phyllobacterium endophyticum PEPV15 | Isolate | Unclassified |
| 700 | 2840764183 | Phyllobacterium sophorae CCBAU 03422 | Isolate | Unclassified |
| 701 | 2841760612 | Bosea sp. Tri-49 | Isolate | Nodule |
| 702 | 2841840854 | Rhizobium cellulosilyticum SEMIA 444 | Isolate | Nodule |
| 703 | 2841846520 | Agrobacterium radiobacter SEMIA 440 | Isolate | Nodule |
| 704 | 2841851746 | Rhizobium leguminosarum SEMIA 498 | Isolate | Nodule |
| 705 | 2841859092 | Agrobacterium radiobacter SEMIA 4026 | Isolate | Nodule |
| 706 | 2841864319 | Rhizobium leguminosarum SEMIA 4052 | Isolate | Nodule |
| 707 | 2842124991 | Agrobacterium radiobacter SEMIA 434 | Isolate | Nodule |
| 708 | 2842130223 | Agrobacterium radiobacter SEMIA 441 | Isolate | Nodule |
| 709 | 2842140634 | Rhizobium cellulosilyticum SEMIA 452 | Isolate | Nodule |
| 710 | 2842152218 | Agrobacterium radiobacter SEMIA 457 | Isolate | Nodule |
| 711 | 2842156927 | Rhizobium leguminosarum SEMIA 459 | Isolate | Nodule |
| 712 | 2842163707 | Rhizobium leguminosarum SEMIA 460 | Isolate | Nodule |
| 713 | 2842170452 | Agrobacterium radiobacter SEMIA 461 | Isolate | Nodule |
| 714 | 2842175837 | Agrobacterium radiobacter SEMIA 462 | Isolate | Nodule |
| 715 | 2842180545 | Rhizobium leguminosarum SEMIA 463 | Isolate | Nodule |
| 716 | 2842187318 | Agrobacterium radiobacter SEMIA 464 | Isolate | Nodule |
| 717 | 2842198810 | Rhizobium aethiopicum SEMIA 470 | Isolate | Nodule |
| 718 | 2842211629 | Agrobacterium radiobacter SEMIA 472 | Isolate | Nodule |
| 719 | 2842224351 | Agrobacterium radiobacter SEMIA 480 | Isolate | Nodule |
| 720 | 2842229732 | Rhizobium leguminosarum SEMIA 481 | Isolate | Nodule |
| 721 | 2842243621 | Rhizobium leguminosarum SEMIA 483 | Isolate | Nodule |
| 722 | 2842250916 | Rhizobium etli SEMIA 484 | Isolate | Nodule |
| 723 | 2842257432 | Rhizobium leguminosarum SEMIA 485 | Isolate | Nodule |
| 724 | 2842264693 | Rhizobium phaseoli SEMIA 487 | Isolate | Nodule |
| 725 | 2842271015 | Rhizobium leguminosarum SEMIA 488 | Isolate | Nodule |
| 726 | 2842285085 | Rhizobium lentis SEMIA 490 | Isolate | Nodule |
| 727 | 2842298080 | Rhizobium leucaenae SEMIA 492 | Isolate | Nodule |
| 728 | 2842304105 | Rhizobium leguminosarum SEMIA 499 | Isolate | Nodule |
| 729 | 2842311132 | Rhizobium phaseoli SEMIA 4002 | Isolate | Nodule |
| 730 | 2842317721 | Rhizobium etli SEMIA 4004 | Isolate | Nodule |
| 731 | 2842341865 | Rhizobium leguminosarum SEMIA 4011 | Isolate | Nodule |
| 732 | 2842357229 | Rhizobium leucaenae SEMIA 4015 | Isolate | Nodule |
| 733 | 2842363717 | Rhizobium leguminosarum SEMIA 4016 | Isolate | Nodule |
| 734 | 2842395702 | Rhizobium ecuadorense SEMIA 4029 | Isolate | Nodule |
| 735 | 2842402390 | Rhizobium lentis SEMIA 4033 | Isolate | Nodule |
| 736 | 2842409023 | Rhizobium lentis SEMIA 4034 | Isolate | Nodule |
| 737 | 2842415677 | Rhizobium lentis SEMIA 4036 | Isolate | Nodule |
| 738 | 2842428310 | Rhizobium phaseoli SEMIA 4050 | Isolate | Nodule |
| 739 | 2842434925 | Rhizobium esperanzae SEMIA 4051 | Isolate | Nodule |
| 740 | 2842441272 | Rhizobium esperanzae SEMIA 4053 | Isolate | Nodule |
| 741 | 2842447887 | Rhizobium esperanzae SEMIA 4055 | Isolate | Nodule |
| 742 | 2842462802 | Rhizobium phaseoli SEMIA 4057 | Isolate | Nodule |
| 743 | 2842469257 | Rhizobium phaseoli SEMIA 4058 | Isolate | Nodule |
| 744 | 2842475841 | Rhizobium tropici SEMIA 4059 | Isolate | Nodule |
| 745 | 2842489311 | Rhizobium sophoriradicis SEMIA 4061 | Isolate | Nodule |
| 746 | 2842495871 | Rhizobium etli SEMIA 4062 | Isolate | Nodule |
| 747 | 2842502639 | Rhizobium tropici SEMIA 4063 | Isolate | Nodule |
| 748 | 2842509118 | Rhizobium paranaense SEMIA 4064 | Isolate | Nodule |
| 749 | 2842515876 | Agrobacterium radiobacter SEMIA 4072 | Isolate | Nodule |
| 750 | 2842694124 | Methylopila sp. R-72369 | Isolate | Unclassified |
| 751 | 2842871566 | Phyllobacterium sp. R-73111 | Isolate | Unclassified |
| 752 | 2842922631 | Pararhizobium sp. R-72066 | Isolate | Unclassified |
| 753 | 2844104063 | Bosea sp. Tri-39 | Isolate | Nodule |
| 754 | 2844163670 | Ensifer sp. 1H6 | Isolate | Unclassified |
| 755 | 2844454524 | Rhizobium leguminosarum bv. viciae BIHB 1217 | Isolate | Nodule |
| 756 | 2844849076 | Arthrobacter cupressi DSM 24664 | Isolate | Rhizosphere |
| 757 | 2847417321 | Sinorhizobium fredii CCBAU 45436 | Isolate | Unclassified |
| 758 | 2848992105 | Sinorhizobium fredii CCBAU 25509 | Isolate | Unclassified |
| 759 | 2850079185 | Ensifer aridi JNVU TP6 | Isolate | Unclassified |
| 760 | 2851246043 | Bosea sp. Tri-54 | Isolate | Nodule |
| 761 | 2852387548 | Rhizobium jaguaris CCGE525 | Isolate | Unclassified |
| 762 | 2852677369 | Pseudoclavibacter sp. JAI123 | Isolate | Rhizosphere |
| 763 | 2854896431 | Neorhizobium alkalisoli DSM 21826 | Isolate | Unclassified |
| 764 | 2854911287 | Brucella lupini LUP21 | Isolate | Unclassified |
| 765 | 2854916844 | Neorhizobium huautlense DSM 21817 | Isolate | Unclassified |
| 766 | 2855825444 | Sinorhizobium meliloti CXM1-105 | Isolate | Nodule |
| 767 | 2855839649 | Sinorhizobium meliloti AK555 | Isolate | Unclassified |
| 768 | 2855872281 | Sinorhizobium fredii PCH1 | Isolate | Nodule |
| 769 | 2857479173 | Micrococcus sp. R-74225 | Isolate | Unclassified |
| 770 | 2857531043 | Neorhizobium sp. R-72160 | Isolate | Unclassified |
| 771 | 2857632687 | Micrococcus sp. R-73081 | Isolate | Unclassified |
| 772 | 2857729791 | Plantibacter sp. R-72288 | Isolate | Unclassified |
| 773 | 2857740372 | Paenarthrobacter sp. R-74611 | Isolate | Unclassified |
| 774 | 2858800743 | Sinorhizobium meliloti AK170 | Isolate | Unclassified |
| 775 | 2870801768 | Micrococcus endophyticus DSM 17945 | Isolate | Unclassified |
| 776 | 2870804320 | Micrococcus yunnanensis DSM 21948 | Isolate | Unclassified |
| 777 | 2889790730 | Chelativorans xinjiangense lm93 | Isolate | Rhizosphere |
| 778 | 2889914905 | Chelativorans alearense UJN715 | Isolate | Rhizosphere |
| 779 | 2891048133 | Martelella lutilitoris GH2-6 | Isolate | Rhizosphere |
| 780 | 2891373044 | Shinella sp. AETb1-6 | Isolate | Rhizosphere |
| 781 | 2894652903 | Phyllobacterium sp. SYP-B3895 | Isolate | Rhizosphere |
| 782 | 2895880812 | Frankia sp. BMG5.11 | Isolate | Unclassified |
| 783 | 2897561785 | Pseudoclavibacter endophyticus EGI 60007 | Isolate | Unclassified |
| 784 | 2899275550 | Paracoccus hibiscisoli CCTCC AB2016182 | Isolate | Rhizosphere |
| 785 | 2899792073 | Agrobacterium deltaense CNPSo 3391 | Isolate | Nodule |
| 786 | 2899845264 | Agrobacterium fabacearum CNPSo 675 | Isolate | Unclassified |
| 787 | 2904497146 | Arthrobacter sp. 1276 | Isolate | Rhizosphere |
| 788 | 2904578770 | Phyllobacterium sp. 586 | Isolate | Unclassified |
| 789 | 2904776348 | Paenarthrobacter sp. 1092 | Isolate | Rhizosphere |
| 790 | 2910809715 | Paenarthrobacter sp. CM16 | Isolate | Unclassified |
| 791 | 2913295892 | Sinorhizobium kostiensis DSM 13372 | Isolate | Nodule |
| 792 | 2913308742 | Rhizobium halophytocola DSM 21600 | Isolate | Unclassified |
| 793 | 2915650412 | Ochrobactrum sp. CM-21-5 | Isolate | Rhizosphere |
| 794 | 2915980308 | Sinorhizobium medicae USDA1149 | Isolate | Nodule |
| 795 | 2915986958 | Sinorhizobium meliloti USDA1659 | Isolate | Nodule |
| 796 | 2915993759 | Sinorhizobium meliloti USDA1336 | Isolate | Nodule |
| 797 | 2916000859 | Sinorhizobium meliloti USDA1562 | Isolate | Nodule |
| 798 | 2916007675 | Sinorhizobium meliloti USDA1289 | Isolate | Nodule |
| 799 | 2916014648 | Sinorhizobium meliloti USDA1583 | Isolate | Nodule |
| 800 | 2916021584 | Sinorhizobium meliloti USDA1550 | Isolate | Nodule |
| 801 | 2916028427 | Sinorhizobium meliloti USDA1613 | Isolate | Nodule |
| 802 | 2916035215 | Sinorhizobium meliloti 3011 | Isolate | Nodule |
| 803 | 2916041962 | Sinorhizobium meliloti USDA1795 | Isolate | Nodule |
| 804 | 2916048683 | Sinorhizobium meliloti USDA1796 | Isolate | Nodule |
| 805 | 2916055098 | Sinorhizobium meliloti USDA1770 | Isolate | Nodule |
| 806 | 2916061851 | Sinorhizobium medicae USDA1638 | Isolate | Nodule |
| 807 | 2916068649 | Sinorhizobium meliloti USDA1220 | Isolate | Nodule |
| 808 | 2916076590 | Sinorhizobium meliloti USDA1661 | Isolate | Nodule |
| 809 | 2917554339 | Chthonobacter rhizosphaerae yh7-1 | Isolate | Rhizosphere |
| 810 | 2919034639 | Paenarthrobacter nitroguajacolicus 247 | Isolate | Rhizosphere |
| 811 | 2919059106 | Arthrobacter sp. 1088 | Isolate | Rhizosphere |
| 812 | 2919100787 | Rhizobium sp. 1399 | Isolate | Rhizosphere |
| 813 | 2919114240 | Agrobacterium tumefaciens 1457 | Isolate | Rhizosphere |
| 814 | 2919119836 | Phyllobacterium sp. 1468 | Isolate | Rhizosphere |
| 815 | 2919166419 | Agrobacterium cavarae 2074 | Isolate | Unclassified |
| 816 | 2919391150 | Arthrobacter ipis 2973 | Isolate | Unclassified |
| 817 | 2919408235 | Rhizobium miluonense 3199 | Isolate | Unclassified |
| 818 | 2919538618 | Paenarthrobacter nitroguajacolicus 3945 | Isolate | Unclassified |
| 819 | 2920822456 | Ensifer sesbaniae CCBAU 65729 | Isolate | Unclassified |
| 820 | 2921201388 | Sinorhizobium meliloti USDA1692 | Isolate | Nodule |
| 821 | 2921208531 | Sinorhizobium meliloti USDA1660 | Isolate | Nodule |
| 822 | 2921237296 | Sinorhizobium meliloti USDA1508 | Isolate | Nodule |
| 823 | 2921244191 | Sinorhizobium meliloti 2119 | Isolate | Nodule |
| 824 | 2921250672 | Sinorhizobium medicae USDA1169 | Isolate | Nodule |
| 825 | 2921257292 | Sinorhizobium meliloti USDA1320 | Isolate | Nodule |
| 826 | 2921263974 | Sinorhizobium meliloti USDA1107 | Isolate | Nodule |
| 827 | 2921282425 | Sinorhizobium meliloti USDA1203 | Isolate | Nodule |
| 828 | 2921289301 | Sinorhizobium meliloti USDA1730 | Isolate | Nodule |
| 829 | 2921296804 | Sinorhizobium meliloti USDA1200 | Isolate | Nodule |
| 830 | 2923556063 | Rhizobium tibeticum 3740 | Isolate | Unclassified |
| 831 | 2924144063 | Sinorhizobium meliloti USDA1022 | Isolate | Nodule |
| 832 | 2924150972 | Sinorhizobium meliloti USDA1700 | Isolate | Nodule |
| 833 | 2924158325 | Sinorhizobium meliloti USDA1146 | Isolate | Nodule |
| 834 | 2924165586 | Sinorhizobium meliloti USDA1264 | Isolate | Nodule |
| 835 | 2924172951 | Sinorhizobium meliloti USDA1626 | Isolate | Nodule |
| 836 | 2924179722 | Sinorhizobium meliloti USDA1280 | Isolate | Nodule |
| 837 | 2924186466 | Sinorhizobium meliloti USDA1389 | Isolate | Nodule |
| 838 | 2924193448 | Sinorhizobium meliloti USDA1158 | Isolate | Nodule |
| 839 | 2924200457 | Sinorhizobium meliloti USDA1007 | Isolate | Nodule |
| 840 | 2924207177 | Sinorhizobium meliloti USDA1589 | Isolate | Nodule |
| 841 | 2924214083 | Sinorhizobium meliloti USDA1702 | Isolate | Nodule |
| 842 | 2924221636 | Sinorhizobium meliloti USDA1416 | Isolate | Nodule |
| 843 | 2924228884 | Sinorhizobium meliloti USDA1581 | Isolate | Nodule |
| 844 | 2926754445 | Agrobacterium radiobacter SLBN-94 | Isolate | Rhizosphere |
| 845 | 2926760298 | Agrobacterium tumefaciens SLBN-170 | Isolate | Rhizosphere |
| 846 | 2928121344 | Plantibacter flavus 1756 | Isolate | Rhizosphere |
| 847 | 2928521798 | Phyllobacterium ifriqiyense 1451 | Isolate | Rhizosphere |
| 848 | 2929138655 | Agrobacterium sp. R-72433 Hybrid assembly | Isolate | Unclassified |
| 849 | 2932426870 | Paenarthrobacter sp. 4246 | Isolate | Rhizosphere |
| 850 | 2933006813 | Rhizobium sp. SEMIA 439 | Isolate | Unclassified |
| 851 | 2933011516 | Rhizobium sp. SEMIA 4032 | Isolate | Unclassified |
| 852 | 2933016740 | Rhizobium sp. SEMIA 4085 | Isolate | Nodule |
| 853 | 2933418574 | Jeotgalibacillus campisalis 4120 | Isolate | Rhizosphere |
| 854 | 2933570622 | Rhizobium leguminosarum SEMIA 409 | Isolate | Nodule |
| 855 | 2933586486 | Rhizobium leguminosarum SEMIA 4039 | Isolate | Nodule |
| 856 | 2933594066 | Agrobacterium fabrum 35/80 | Isolate | Nodule |
| 857 | 2933599457 | Rhizobium phaseoli M3 | Isolate | Nodule |
| 858 | 2935894831 | Rhizobium leguminosarum SEMIA 419 | Isolate | Nodule |
| 859 | 2935901341 | Rhizobium leguminosarum SEMIA 4082 | Isolate | Nodule |
| 860 | 2936367885 | Rhizobium changzhiense WYCCWR 11290 | Isolate | Nodule |
| 861 | 2936375103 | Rhizobium changzhiense WYCCWR 11317 | Isolate | Nodule |
| 862 | 2936381700 | Rhizobium chutanense C16 | Isolate | Unclassified |
| 863 | 2936996657 | Sinorhizobium meliloti USDA1025 | Isolate | Nodule |
| 864 | 2937002841 | Sinorhizobium meliloti USDA1006 | Isolate | Nodule |
| 865 | 2937009748 | Sinorhizobium meliloti USDA1162 | Isolate | Nodule |
| 866 | 2937016420 | Sinorhizobium meliloti USDA1027 | Isolate | Nodule |
| 867 | 2937023124 | Sinorhizobium meliloti USDA1335 | Isolate | Nodule |
| 868 | 2937029754 | Sinorhizobium medicae USDA1624 | Isolate | Nodule |
| 869 | 2937036028 | Sinorhizobium medicae USDA1608 | Isolate | Nodule |
| 870 | 2937042894 | Sinorhizobium meliloti USDA1687 | Isolate | Nodule |
| 871 | 2937049772 | Sinorhizobium meliloti USDA1691 | Isolate | Nodule |
| 872 | 2937056579 | Sinorhizobium meliloti USDA1357 | Isolate | Nodule |
| 873 | 2937063883 | Sinorhizobium meliloti USDA1808 | Isolate | Nodule |
| 874 | 2937071275 | Sinorhizobium meliloti USDA1623 | Isolate | Nodule |
| 875 | 2937078374 | Sinorhizobium medicae USDA1004 | Isolate | Nodule |
| 876 | 2937084907 | Sinorhizobium medicae USDA1664 | Isolate | Nodule |
| 877 | 2937091812 | Sinorhizobium meliloti USDA1221 | Isolate | Nodule |
| 878 | 2937098957 | Sinorhizobium meliloti USDA1519 | Isolate | Nodule |
| 879 | 2937106411 | Sinorhizobium meliloti USDA1214 | Isolate | Nodule |
| 880 | 2937113482 | Sinorhizobium meliloti USDA1180 | Isolate | Nodule |
| 881 | 2937119839 | Sinorhizobium meliloti USDA1790 | Isolate | Nodule |
| 882 | 2937126314 | Sinorhizobium meliloti USDA1612 | Isolate | Nodule |
| 883 | 2937843397 | Mesorhizobium xinjiangense lm94 | Isolate | Rhizosphere |
| 884 | 2939647034 | Arthrobacter sp. 2762 | Isolate | Rhizosphere |
| 885 | 2939669807 | Kaistia defluvii 3207 | Isolate | Rhizosphere |
| 886 | 2939674588 | Arthrobacter bambusae 3552 | Isolate | Rhizosphere |
| 887 | 2945941187 | Arthrobacter pascens W1I14 | Isolate | Rhizosphere |
| 888 | 2945956166 | Arthrobacter globiformus W2I3 | Isolate | Rhizosphere |
| 889 | 2946024296 | Arthrobacter woluwensis W4I2 | Isolate | Rhizosphere |
| 890 | 2953998280 | Pseudarthrobacter sp. W1I19 | Isolate | Rhizosphere |
| 891 | 2954011201 | Phyllobacterium ifrigiyense W4I11 | Isolate | Rhizosphere |
| 892 | 2957375807 | Sinorhizobium medicae USDA1632 | Isolate | Nodule |
| 893 | 2957382221 | Sinorhizobium meliloti USDA1919 | Isolate | Nodule |
| 894 | 2957388812 | Sinorhizobium meliloti USDA1195 | Isolate | Nodule |
| 895 | 2957395598 | Sinorhizobium meliloti USDA1237 | Isolate | Nodule |
| 896 | 2957402308 | Sinorhizobium meliloti USDA1794 | Isolate | Nodule |
| 897 | 2957408893 | Sinorhizobium meliloti USDA1163 | Isolate | Nodule |
| 898 | 2957415311 | Sinorhizobium meliloti USDA1724 | Isolate | Nodule |
| 899 | 2957422303 | Sinorhizobium meliloti USDA1497 | Isolate | Nodule |
| 900 | 2957430029 | Sinorhizobium meliloti USDA1590 | Isolate | Nodule |
| 901 | 2957437181 | Sinorhizobium medicae USDA1694 | Isolate | Nodule |
| 902 | 2957443900 | Sinorhizobium meliloti USDA1734 | Isolate | Nodule |
| 903 | 2957450854 | Sinorhizobium meliloti USDA1655 | Isolate | Nodule |
| 904 | 2957457609 | Sinorhizobium meliloti USDA1751 | Isolate | Nodule |
| 905 | 2957464669 | Sinorhizobium meliloti USDA1520 | Isolate | Nodule |
| 906 | 2957471148 | Sinorhizobium meliloti USDA1204 | Isolate | Nodule |
| 907 | 2957478035 | Sinorhizobium meliloti USDA1171 | Isolate | Nodule |
| 908 | 2957484790 | Sinorhizobium meliloti USDA1464 | Isolate | Nodule |
| 909 | 2957491536 | Sinorhizobium meliloti USDA1804 | Isolate | Nodule |
| 910 | 2957498199 | Sinorhizobium meliloti USDA1561 | Isolate | Nodule |
| 911 | 2957505466 | Sinorhizobium meliloti USDA1696 | Isolate | Nodule |
| 912 | 2960584000 | Sinorhizobium meliloti USDA1530 | Isolate | Nodule |
| 913 | 2960591022 | Sinorhizobium medicae USDA1066 | Isolate | Nodule |
| 914 | 2960597568 | Sinorhizobium meliloti 3085 | Isolate | Nodule |
| 915 | 2960603979 | Sinorhizobium meliloti USDA1580 | Isolate | Nodule |
| 916 | 2960610863 | Sinorhizobium meliloti USDA1792 | Isolate | Nodule |
| 917 | 2960617483 | Sinorhizobium meliloti USDA1719 | Isolate | Nodule |
| 918 | 2960624210 | Sinorhizobium meliloti USDA1415 | Isolate | Nodule |
| 919 | 2960631154 | Sinorhizobium medicae USDA1629 | Isolate | Nodule |
| 920 | 2960637947 | Sinorhizobium meliloti USDA1202 | Isolate | Nodule |
| 921 | 2960645483 | Sinorhizobium meliloti USDA1703 | Isolate | Nodule |
| 922 | 2960652885 | Sinorhizobium meliloti USDA1199 | Isolate | Nodule |
| 923 | 2960660292 | Sinorhizobium meliloti USDA1883 | Isolate | Nodule |
| 924 | 2960667422 | Sinorhizobium meliloti USDA1170 | Isolate | Nodule |
| 925 | 2960674078 | Sinorhizobium meliloti USDA1666 | Isolate | Nodule |
| 926 | 2960680706 | Sinorhizobium medicae USDA1150 | Isolate | Nodule |
| 927 | 2960687367 | Sinorhizobium meliloti USDA1462 | Isolate | Nodule |
| 928 | 2960693952 | Sinorhizobium medicae USDA1630 | Isolate | Nodule |
| 929 | 2964607997 | Sinorhizobium meliloti USDA1212 | Isolate | Nodule |
| 930 | 2964615318 | Sinorhizobium meliloti USDA1248 | Isolate | Nodule |
| 931 | 2964621998 | Sinorhizobium meliloti USDA1235 | Isolate | Nodule |
| 932 | 2964628898 | Sinorhizobium meliloti USDA1191 | Isolate | Nodule |
| 933 | 2964636051 | Sinorhizobium meliloti USDA1594 | Isolate | Nodule |
| 934 | 2964643177 | Sinorhizobium meliloti USDA1760 | Isolate | Nodule |
| 935 | 2964649959 | Sinorhizobium meliloti USDA1591 | Isolate | Nodule |
| 936 | 2964656573 | Sinorhizobium meliloti USDA1308 | Isolate | Nodule |
| 937 | 2964663802 | Sinorhizobium meliloti USDA1688 | Isolate | Nodule |
| 938 | 2964670856 | Sinorhizobium meliloti USDA1211 | Isolate | Nodule |
| 939 | 2964678106 | Sinorhizobium meliloti USDA1210 | Isolate | Nodule |
| 940 | 2964685014 | Sinorhizobium meliloti USDA1232 | Isolate | Nodule |
| 941 | 2964691889 | Sinorhizobium meliloti USDA1379 | Isolate | Nodule |
| 942 | 2964698721 | Sinorhizobium meliloti USDA1656 | Isolate | Nodule |
| 943 | 2964705432 | Sinorhizobium meliloti USDA1614 | Isolate | Nodule |
| 944 | 2964712639 | Sinorhizobium meliloti USDA1616 | Isolate | Nodule |
| 945 | 2964719344 | Sinorhizobium meliloti USDA1456 | Isolate | Nodule |
| 946 | 2967664464 | Sinorhizobium meliloti USDA1208 | Isolate | Nodule |
| 947 | 2967671571 | Sinorhizobium meliloti USDA1496 | Isolate | Nodule |
| 948 | 2967678726 | Sinorhizobium meliloti USDA1467 | Isolate | Nodule |
| 949 | 2967686174 | Sinorhizobium medicae USDA1641 | Isolate | Nodule |
| 950 | 2967693043 | Sinorhizobium meliloti USDA1183 | Isolate | Nodule |
| 951 | 2967699805 | Sinorhizobium meliloti USDA1695 | Isolate | Nodule |
| 952 | 2967706974 | Sinorhizobium meliloti USDA1206 | Isolate | Nodule |
| 953 | 2967714385 | Sinorhizobium meliloti USDA1023 | Isolate | Nodule |
| 954 | 2967721400 | Sinorhizobium meliloti USDA1742 | Isolate | Nodule |
| 955 | 2967728569 | Sinorhizobium medicae USDA1607 | Isolate | Nodule |
| 956 | 2967735183 | Sinorhizobium meliloti USDA1710 | Isolate | Nodule |
| 957 | 2967742019 | Sinorhizobium meliloti USDA1676 | Isolate | Nodule |
| 958 | 2967748971 | Sinorhizobium meliloti USDA1024A | Isolate | Nodule |
| 959 | 2967755722 | Sinorhizobium meliloti USDA1302 | Isolate | Nodule |
| 960 | 2967762386 | Sinorhizobium meliloti USDA1397 | Isolate | Nodule |
| 961 | 2967769361 | Sinorhizobium meliloti USDA1005 | Isolate | Nodule |
| 962 | 2967775926 | Sinorhizobium meliloti USDA1678 | Isolate | Nodule |
| 963 | 2970019648 | Sinorhizobium meliloti USDA1603 | Isolate | Nodule |
| 964 | 2970026789 | Sinorhizobium medicae USDA1611 | Isolate | Nodule |
| 965 | 2970033650 | Sinorhizobium meliloti USDA1565 | Isolate | Nodule |
| 966 | 2970040964 | Sinorhizobium meliloti USDA1501 | Isolate | Nodule |
| 967 | 2970047711 | Sinorhizobium meliloti USDA1793 | Isolate | Nodule |
| 968 | 2970054988 | Sinorhizobium meliloti USDA1031 | Isolate | Nodule |
| 969 | 2970061556 | Sinorhizobium meliloti USDA1810 | Isolate | Nodule |
| 970 | 2970068827 | Sinorhizobium meliloti USDA1227 | Isolate | Nodule |
| 971 | 2970076120 | Sinorhizobium meliloti USDA1706 | Isolate | Nodule |
| 972 | 2970082768 | Sinorhizobium meliloti USDA1803 | Isolate | Nodule |
| 973 | 2970088815 | Sinorhizobium meliloti USDA1819 | Isolate | Nodule |
| 974 | 2970095765 | Sinorhizobium meliloti USDA1225 | Isolate | Nodule |
| 975 | 2970102677 | Sinorhizobium meliloti USDA1325 | Isolate | Nodule |
| 976 | 2970109326 | Sinorhizobium meliloti USDA1186 | Isolate | Nodule |
| 977 | 2970116247 | Sinorhizobium meliloti USDA1566 | Isolate | Nodule |
| 978 | 2970122695 | Sinorhizobium medicae 3082 | Isolate | Nodule |
| 979 | 2970129317 | Sinorhizobium meliloti USDA1008 | Isolate | Nodule |
| 980 | 2970136068 | Sinorhizobium meliloti USDA1699 | Isolate | Nodule |
| 981 | 2970143518 | Sinorhizobium medicae USDA1652 | Isolate | Nodule |
| 982 | 2970149975 | Sinorhizobium meliloti USDA1215 | Isolate | Nodule |
| 983 | 2970156795 | Sinorhizobium meliloti USDA1491 | Isolate | Nodule |
| 984 | 2970164137 | Sinorhizobium meliloti USDA1018 | Isolate | Nodule |
| 985 | 2970170962 | Sinorhizobium meliloti USDA1571 | Isolate | Nodule |
| 986 | 2970177841 | Sinorhizobium meliloti USDA1533 | Isolate | Nodule |
| 987 | 2970184632 | Sinorhizobium meliloti USDA1593 | Isolate | Nodule |
| 988 | 2970191845 | Sinorhizobium meliloti USDA1187 | Isolate | Nodule |
| 989 | 2974302888 | Pseudarthrobacter sp. SORGH_AS 212 | Isolate | Unclassified |
| 990 | 2977516862 | Sinorhizobium meliloti USDA1791 | Isolate | Nodule |
| 991 | 2977523885 | Sinorhizobium meliloti USDA1777 | Isolate | Nodule |
| 992 | 2977530762 | Sinorhizobium medicae USDA1606 | Isolate | Nodule |
| 993 | 2977537788 | Sinorhizobium meliloti USDA1184 | Isolate | Nodule |
| 994 | 2977544691 | Sinorhizobium medicae USDA1631 | Isolate | Nodule |
| 995 | 2977551784 | Sinorhizobium meliloti USDA1035 | Isolate | Nodule |
| 996 | 2977558990 | Sinorhizobium meliloti USDA1222 | Isolate | Nodule |
| 997 | 2977565890 | Sinorhizobium meliloti USDA1617 | Isolate | Nodule |
| 998 | 2977572785 | Sinorhizobium meliloti USDA1767 | Isolate | Nodule |
| 999 | 2977579622 | Sinorhizobium meliloti USDA1161 | Isolate | Nodule |
| 1000 | 2978969890 | Agrobacterium sp. SORGH_AS 787 | Isolate | Unclassified |
| 1001 | 2979089926 | Agrobacterium sp. SORGH_AS 745 | Isolate | Unclassified |
| 1002 | 2979095461 | Agrobacterium tumefaciens SORGH_AS 749 | Isolate | Unclassified |
| 1003 | 2979100975 | Agrobacterium pusense SORGH_AS 755 | Isolate | Unclassified |
| 1004 | 2984509177 | Agrobacterium pusense SORGH_AS260 | Isolate | Aerial Root |
| 1005 | 2984518228 | Agrobacterium pusense SORGH_AS285 | Isolate | Aerial Root |
| 1006 | 2984537506 | Agrobacterium sp. SORGH_AS440 | Isolate | Aerial Root |
| 1007 | 2984587000 | Agrobacterium larrymoorei SORGH_AS974 | Isolate | Aerial Root |
| 1008 | 2984601300 | Rhizobium pusense SORGH_AS1083 | Isolate | Aerial Root |
| 1009 | 2989349275 | Shinella kummerowiae CCBAU 25048 | Isolate | Unclassified |
| 1010 | 2989771324 | Rhizobium rhizolycopersici DBTS2 | Isolate | Rhizosphere |
| 1011 | 2989776772 | Rhizobium glycinendophyticum CL12 | Isolate | Unclassified |
| 1012 | 2995392953 | Martelella limonii NBRC 109441 | Isolate | Unclassified |
| 1013 | 2996887358 | Rhizobium sp. R711 | Isolate | Nodule |
| 1014 | 2996893221 | Rhizobium sp. R635 | Isolate | Nodule |
| 1015 | 3002141150 | Phyllobacterium sp. 628 | Isolate | Unclassified |
| 1016 | 3003930520 | Sinorhizobium sp. BG8 | Isolate | Unclassified |
| 1017 | 3005409236 | Rhizobium sp. P32RR-XVIII | Isolate | Rhizosphere |
| 1018 | 3005416602 | Rhizobium sp. P40RR-XXII | Isolate | Rhizosphere |
| 1019 | 3005445848 | Rhizobium sp. WYJ-E13 | Isolate | Unclassified |
| 1020 | 3005452660 | Rhizobium grahamii BG7 | Isolate | Unclassified |
| 1021 | 639633055 | Rhizobium leguminosarum bv. viciae 3841 | Isolate | Unclassified |
| 1022 | 643692032 | Sinorhizobium fredii NGR234 | Isolate | Nodule |
| 1023 | 648276728 | Sinorhizobium meliloti BL225C | Isolate | Nodule |
| 1024 | 650716007 | Agrobacterium fabacearum H13-3 | Isolate | Rhizosphere |
| 1025 | 8003570095 | Agrobacterium rhizogenes GBBC3284 | Isolate | Unclassified |
| 1026 | 8003992118 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 1027 | 8003999396 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 1028 | 8005246636 | Rhizobium wuzhouense W44 | Isolate | Rhizosphere |
| 1029 | 8005258706 | Rhizobium sp. R693 | Isolate | Nodule |
| 1030 | 8005275841 | Rhizobium sp. N4311 | Isolate | Nodule |
| 1031 | 8005282627 | Rhizobium phaseoli NC1 | Isolate | Nodule |
| 1032 | 8005289223 | Rhizobium bangladeshense 1002 | Isolate | Nodule |
| 1033 | 8005301065 | Rhizobium bangladeshense 1017 | Isolate | Nodule |
| 1034 | 8005307578 | Rhizobium leguminosarum bv. phaseoli LCS0306 | Isolate | Unclassified |
| 1035 | 8005314921 | Rhizobium sp. P28RR-XV | Isolate | Rhizosphere |
| 1036 | 8005321885 | Rhizobium sp. R72 | Isolate | Nodule |
| 1037 | 8005376324 | Rhizobium changzhiense WYCCWR 11279 | Isolate | Nodule |
| 1038 | 8005382845 | Rhizobium sp. R634 | Isolate | Nodule |
| 1039 | 8005395548 | Rhizobium sp. R339 | Isolate | Nodule |
| 1040 | 8005430974 | Rhizobium phaseoli Y20 | Isolate | Nodule |
| 1041 | 8005460587 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 1042 | 8005484373 | Rhizobium tropici SARCC-755 | Isolate | Nodule |
| 1043 | 8005497431 | Rhizobium phaseoli CCGM8 | Isolate | Unclassified |
| 1044 | 8005542996 | Rhizobium grahamii CCGM3 | Isolate | Unclassified |
| 1045 | 8005556819 | Rhizobium sp. WYCCWR 11128 | Isolate | Nodule |
| 1046 | 8005563573 | Rhizobium sp. WYCCWR 11152 | Isolate | Nodule |
| 1047 | 8005570704 | Rhizobium anhuiense bv. trifolii WYCCWR10015 | Isolate | Nodule |
| 1048 | 8005619151 | Rhizobium phaseoli CCGM2 | Isolate | Unclassified |
| 1049 | 8005626139 | Rhizobium phaseoli Y18 | Isolate | Nodule |
| 1050 | 8005645114 | Rhizobium tropici IGFRI Rhizo-19 | Isolate | Rhizosphere |
| 1051 | 8005658619 | Rhizobium terrae CC-HIH110 | Isolate | Unclassified |
| 1052 | 8005668836 | Rhizobium phaseoli CCGM9 | Isolate | Unclassified |
| 1053 | 8005682033 | Rhizobium dioscoreae S-93 | Isolate | Unclassified |
| 1054 | 8005688590 | Rhizobium bangladeshense 1024 | Isolate | Nodule |
| 1055 | 8005695170 | Rhizobium sp. RMa-01 | Isolate | Unclassified |
| 1056 | 8018127388 | Rhizobium aegyptiacum 950 | Isolate | Nodule |
| 1057 | 8018150411 | Rhizobium straminoryzae SM12 | Isolate | Rhizosphere |
| 1058 | 8018163183 | Rhizobium sp. WYCCWR 11146 | Isolate | Nodule |
| 1059 | 8018176218 | Rhizobium sp. N122 | Isolate | Nodule |
| 1060 | 8023680758 | Rhizobium leguminosarum SARCC-132 | Isolate | Nodule |
| 1061 | 8024479707 | Rhizobium leguminosarum Tri-43 | Isolate | Nodule |
| 1062 | 8024486573 | Rhizobium tubonense CCBAU 85046 | Isolate | Nodule |
| 1063 | 8024501048 | Rhizobium sp. H4 | Isolate | Nodule |
| 1064 | 8045864390 | Aurantimonas endophytica KCTC 52296 | Isolate | Unclassified |
| 1065 | 8046767195 | Rhizobium calliandrae CCGE524 | Isolate | Unclassified |
| 1066 | 8049293176 | Ensifer alkalisoli YIC4027 | Isolate | Nodule |
| 1067 | 8054460903 | Agrobacterium vaccinii B7.6 | Isolate | Unclassified |
| 1068 | 8054563764 | Acuticoccus kalidii M5D2P5 | Isolate | Unclassified |
| 1069 | 8055431914 | Allorhizobium sonneratiae BGMRC 0089 | Isolate | Unclassified |
| 1070 | 8056375014 | Rhizobium redzepovicii 18T | Isolate | Nodule |
| 1071 | 8056382006 | Rhizobium croatiense 13T | Isolate | Nodule |
| 1072 | 8057575449 | Rhizobium mayense CCGE526 | Isolate | Nodule |
| 1073 | 8057874678 | Rhizobium acaciae 1AS12 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 64.36 |
| Metatranscriptomes | 2.55 |
| Isolates | 33.09 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.28 |
| Bulb | 0 |
| Endosphere | 10.85 |
| Nodule | 22.86 |
| Rhizoplane | 3.93 |
| Rhizosphere | 50.36 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0496119_0020826 | 3300048922 | Bacteria | 4763 |
| 2 | JGI24739J22299_10056206 | 3300001989 | Bacteria | 1256 |
| 3 | JGI24744J21845_10002172 | 3300002077 | Bacteria | 3986 |
| 4 | JGI25156J39149_1000066 | 3300002705 | Bacteria | 82816 |
| 5 | JGI25162J39368_1000488 | 3300002737 | Bacteria | 30289 |
| 6 | JGI25154J39366_1000035 | 3300002738 | Bacteria | 172224 |
| 7 | JGI25157J39369_1000036 | 3300002741 | Bacteria | 133671 |
| 8 | JGI25157J39369_1000197 | 3300002741 | Bacteria | 51019 |
| 9 | JGI25152J39213_1009568 | 3300002773 | Bacteria | 2292 |
| 10 | JGI25159J45721_1000463 | 3300002987 | Bacteria | 18770 |
| 11 | JGI25159J45721_1001920 | 3300002987 | Bacteria | 8309 |
| 12 | JGI25151J46595_10001277 | 3300003187 | Bacteria | 17761 |
| 13 | JGI25151J46595_10002842 | 3300003187 | Bacteria | 9972 |
| 14 | JGI25151J46595_10032258 | 3300003187 | Bacteria | 2033 |
| 15 | JGI25165J46597_1000676 | 3300003214 | Bacteria | 27457 |
| 16 | JGI25165J46597_1001184 | 3300003214 | Bacteria | 15921 |
| 17 | JGI25165J46597_1004445 | 3300003214 | Bacteria | 3010 |
| 18 | rootH1_10034840 | 3300003323 | Bacteria | 3538 |
| 19 | JGI25160J50197_1000100 | 3300003354 | Bacteria | 86646 |
| 20 | JGI25160J50197_1001130 | 3300003354 | Bacteria | 13639 |
| 21 | JGI25160J50197_1022014 | 3300003354 | Bacteria | 1878 |
| 22 | JGI25161J50226_1000072 | 3300003374 | Bacteria | 86646 |
| 23 | JGI25161J50226_1000104 | 3300003374 | Bacteria | 67942 |
| 24 | JGI25161J50226_1000396 | 3300003374 | Bacteria | 21728 |
| 25 | Ga0006562J51391_1020816 | 3300003578 | Bacteria | 3830 |
| 26 | Ga0055526_1001414 | 3300003771 | Bacteria | 17081 |
| 27 | Ga0055526_1017900 | 3300003771 | Bacteria | 2676 |
| 28 | Ga0055526_1024203 | 3300003771 | Bacteria | 1996 |
| 29 | Ga0055526_1028352 | 3300003771 | Bacteria | 1696 |
| 30 | Ga0055524_1002189 | 3300003775 | Bacteria | 10270 |
| 31 | Ga0055524_1005016 | 3300003775 | Bacteria | 5995 |
| 32 | Ga0055524_1008630 | 3300003775 | Bacteria | 4219 |
| 33 | Ga0055524_1010849 | 3300003775 | Bacteria | 3602 |
| 34 | Ga0055524_1015401 | 3300003775 | Bacteria | 2790 |
| 35 | Ga0055524_1025242 | 3300003775 | Bacteria | 1865 |
| 36 | Ga0055536_1019029 | 3300003781 | Bacteria | 2175 |
| 37 | Ga0055528_1000695 | 3300003790 | Bacteria | 23949 |
| 38 | Ga0055528_1005647 | 3300003790 | Bacteria | 5775 |
| 39 | Ga0055528_1008246 | 3300003790 | Bacteria | 4499 |
| 40 | Ga0055528_1011300 | 3300003790 | Bacteria | 3559 |
| 41 | Ga0055528_1021009 | 3300003790 | Bacteria | 2092 |
| 42 | Ga0055530_10018329 | 3300003791 | Bacteria | 2162 |
| 43 | Ga0055530_10056832 | 3300003791 | Bacteria | 887 |
| 44 | Ga0055540_1000752 | 3300003792 | Bacteria | 21989 |
| 45 | Ga0055540_1015474 | 3300003792 | Bacteria | 2218 |
| 46 | Ga0055540_1020091 | 3300003792 | Bacteria | 1778 |
| 47 | Ga0055531_10023282 | 3300003794 | Bacteria | 2329 |
| 48 | Ga0058692_1001306 | 3300003856 | Bacteria | 9405 |
| 49 | Ga0058692_1002399 | 3300003856 | Bacteria | 6287 |
| 50 | Ga0058692_1014818 | 3300003856 | Bacteria | 1776 |
| 51 | Ga0055543_1000078 | 3300004625 | Bacteria | 85340 |
| 52 | Ga0055543_1000280 | 3300004625 | Bacteria | 37509 |
| 53 | Ga0065165_1000623 | 3300005262 | Bacteria | 51455 |
| 54 | Ga0065165_1002557 | 3300005262 | Bacteria | 15059 |
| 55 | Ga0065165_1023432 | 3300005262 | Bacteria | 2093 |
| 56 | Ga0065714_10142918 | 3300005288 | Bacteria | 1146 |
| 57 | Ga0065704_10159503 | 3300005289 | Bacteria | 1357 |
| 58 | Ga0065712_10014529 | 3300005290 | Bacteria | 2633 |
| 59 | Ga0065712_10284402 | 3300005290 | Bacteria | 889 |
| 60 | Ga0065707_10089177 | 3300005295 | Bacteria | 4445 |
| 61 | Ga0070658_10000894 | 3300005327 | Bacteria | 25535 |
| 62 | Ga0070658_10020960 | 3300005327 | Bacteria | 5236 |
| 63 | Ga0070658_10065366 | 3300005327 | Bacteria | 2968 |
| 64 | Ga0070658_10159182 | 3300005327 | Bacteria | 1894 |
| 65 | Ga0070676_10037368 | 3300005328 | Bacteria | 2800 |
| 66 | Ga0070683_100092079 | 3300005329 | Bacteria | 2847 |
| 67 | Ga0070670_100000007 | 3300005331 | Bacteria | 318672 |
| 68 | Ga0070670_100065624 | 3300005331 | Bacteria | 3114 |
| 69 | Ga0070677_10152960 | 3300005333 | Bacteria | 1075 |
| 70 | Ga0070682_100202478 | 3300005337 | Bacteria | 1401 |
| 71 | Ga0068868_100056815 | 3300005338 | Bacteria | 3091 |
| 72 | Ga0068868_100103395 | 3300005338 | Bacteria | 2307 |
| 73 | Ga0070660_100003906 | 3300005339 | Bacteria | 10299 |
| 74 | Ga0070660_100016734 | 3300005339 | Bacteria | 5331 |
| 75 | Ga0070660_100026194 | 3300005339 | Bacteria | 4340 |
| 76 | Ga0070661_100000711 | 3300005344 | Bacteria | 24382 |
| 77 | Ga0070661_100010380 | 3300005344 | Bacteria | 6474 |
| 78 | Ga0070661_100175746 | 3300005344 | Bacteria | 1628 |
| 79 | Ga0070668_100000698 | 3300005347 | Bacteria | 22911 |
| 80 | Ga0070668_100003566 | 3300005347 | Bacteria | 11477 |
| 81 | Ga0070668_100015597 | 3300005347 | Bacteria | 5679 |
| 82 | Ga0070668_100016864 | 3300005347 | Bacteria | 5462 |
| 83 | Ga0070669_100017209 | 3300005353 | Bacteria | 5157 |
| 84 | Ga0070675_100025813 | 3300005354 | Bacteria | 4711 |
| 85 | Ga0070675_100138584 | 3300005354 | Bacteria | 2078 |
| 86 | Ga0070671_100000680 | 3300005355 | Bacteria | 24388 |
| 87 | Ga0070671_100018260 | 3300005355 | Bacteria | 5696 |
| 88 | Ga0070671_100107571 | 3300005355 | Bacteria | 2341 |
| 89 | Ga0070671_100256627 | 3300005355 | Bacteria | 1485 |
| 90 | Ga0070674_100022758 | 3300005356 | Bacteria | 4044 |
| 91 | Ga0070673_100135563 | 3300005364 | Bacteria | 2072 |
| 92 | Ga0070688_100005746 | 3300005365 | Bacteria | 6557 |
| 93 | Ga0070659_100088401 | 3300005366 | Bacteria | 2481 |
| 94 | Ga0070659_100367919 | 3300005366 | Bacteria | 1209 |
| 95 | Ga0070667_100000560 | 3300005367 | Bacteria | 36828 |
| 96 | Ga0070667_100002368 | 3300005367 | Bacteria | 16509 |
| 97 | Ga0070667_100033927 | 3300005367 | Bacteria | 4269 |
| 98 | Ga0070667_100035836 | 3300005367 | Bacteria | 4158 |
| 99 | Ga0070667_100039599 | 3300005367 | Bacteria | 3951 |
| 100 | Ga0070694_100030566 | 3300005444 | Bacteria | 3525 |
| 101 | Ga0070694_100139436 | 3300005444 | Bacteria | 1759 |
| 102 | Ga0070663_100089633 | 3300005455 | Bacteria | 2276 |
| 103 | Ga0070663_100109678 | 3300005455 | Bacteria | 2072 |
| 104 | Ga0070663_100119414 | 3300005455 | Bacteria | 1990 |
| 105 | Ga0070663_100308946 | 3300005455 | Bacteria | 1268 |
| 106 | Ga0070678_100014493 | 3300005456 | Bacteria | 4976 |
| 107 | Ga0070681_10034749 | 3300005458 | Bacteria | 5062 |
| 108 | Ga0070681_10114505 | 3300005458 | Bacteria | 2635 |
| 109 | Ga0070681_10131608 | 3300005458 | Bacteria | 2434 |
| 110 | Ga0070681_10202347 | 3300005458 | Bacteria | 1904 |
| 111 | Ga0070681_10701687 | 3300005458 | Bacteria | 928 |
| 112 | Ga0070707_100000419 | 3300005468 | Bacteria | 41972 |
| 113 | Ga0070699_100478633 | 3300005518 | Bacteria | 1130 |
| 114 | Ga0070699_100535106 | 3300005518 | Bacteria | 1066 |
| 115 | Ga0070679_100010746 | 3300005530 | Bacteria | 8694 |
| 116 | Ga0070679_100016613 | 3300005530 | Bacteria | 7107 |
| 117 | Ga0070679_100128027 | 3300005530 | Bacteria | 2521 |
| 118 | Ga0068853_100000320 | 3300005539 | Bacteria | 33466 |
| 119 | Ga0068853_100364565 | 3300005539 | Bacteria | 1347 |
| 120 | Ga0070665_100001645 | 3300005548 | Bacteria | 25760 |
| 121 | Ga0070665_100002076 | 3300005548 | Bacteria | 22480 |
| 122 | Ga0070665_100023709 | 3300005548 | Bacteria | 6181 |
| 123 | Ga0070665_100036777 | 3300005548 | Bacteria | 4923 |
| 124 | Ga0070665_100038919 | 3300005548 | Bacteria | 4781 |
| 125 | Ga0070665_100213000 | 3300005548 | Bacteria | 1933 |
| 126 | Ga0070665_100214059 | 3300005548 | Bacteria | 1928 |
| 127 | Ga0070665_100494499 | 3300005548 | Bacteria | 1234 |
| 128 | Ga0070704_100158381 | 3300005549 | Bacteria | 1788 |
| 129 | Ga0068855_100237447 | 3300005563 | Bacteria | 2038 |
| 130 | Ga0068855_100683284 | 3300005563 | Bacteria | 1100 |
| 131 | Ga0070664_100095467 | 3300005564 | Bacteria | 2579 |
| 132 | Ga0068857_100007929 | 3300005577 | Bacteria | 9164 |
| 133 | Ga0068854_100016799 | 3300005578 | Bacteria | 4884 |
| 134 | Ga0068854_100049485 | 3300005578 | Bacteria | 3002 |
| 135 | Ga0068854_100063977 | 3300005578 | Bacteria | 2671 |
| 136 | Ga0068854_100234496 | 3300005578 | Bacteria | 1458 |
| 137 | Ga0068856_100039088 | 3300005614 | Bacteria | 4659 |
| 138 | Ga0068856_100209447 | 3300005614 | Bacteria | 1964 |
| 139 | Ga0068852_100005347 | 3300005616 | Bacteria | 9172 |
| 140 | Ga0068852_100021220 | 3300005616 | Bacteria | 5180 |
| 141 | Ga0068852_100057334 | 3300005616 | Bacteria | 3370 |
| 142 | Ga0068852_100060942 | 3300005616 | Bacteria | 3277 |
| 143 | Ga0068852_100128153 | 3300005616 | Bacteria | 2333 |
| 144 | Ga0068852_100189602 | 3300005616 | Bacteria | 1939 |
| 145 | Ga0068852_100586486 | 3300005616 | Bacteria | 1118 |
| 146 | Ga0068859_100002330 | 3300005617 | Bacteria | 19304 |
| 147 | Ga0068859_100004673 | 3300005617 | Bacteria | 13948 |
| 148 | Ga0068859_100077898 | 3300005617 | Bacteria | 3356 |
| 149 | Ga0068859_100086490 | 3300005617 | Bacteria | 3182 |
| 150 | Ga0068864_100000095 | 3300005618 | Bacteria | 91554 |
| 151 | Ga0068861_100167728 | 3300005719 | Bacteria | 1817 |
| 152 | Ga0068851_10002754 | 3300005834 | Bacteria | 7742 |
| 153 | Ga0068851_10009811 | 3300005834 | Bacteria | 4459 |
| 154 | Ga0068851_10086230 | 3300005834 | Bacteria | 1647 |
| 155 | Ga0068863_100000566 | 3300005841 | Bacteria | 37590 |
| 156 | Ga0068863_100001255 | 3300005841 | Bacteria | 25283 |
| 157 | Ga0068863_100001274 | 3300005841 | Bacteria | 25120 |
| 158 | Ga0068863_100503216 | 3300005841 | Bacteria | 1193 |
| 159 | Ga0068858_100000408 | 3300005842 | Bacteria | 44660 |
| 160 | Ga0068858_100008334 | 3300005842 | Bacteria | 9973 |
| 161 | Ga0068860_100000204 | 3300005843 | Bacteria | 93995 |
| 162 | Ga0068860_100001329 | 3300005843 | Bacteria | 26865 |
| 163 | Ga0068860_100114548 | 3300005843 | Bacteria | 2578 |
| 164 | Ga0068860_100163268 | 3300005843 | Bacteria | 2149 |
| 165 | Ga0068860_100486502 | 3300005843 | Bacteria | 1230 |
| 166 | Ga0068862_100001099 | 3300005844 | Bacteria | 25679 |
| 167 | Ga0068862_100384906 | 3300005844 | Bacteria | 1309 |
| 168 | Ga0081455_10035277 | 3300005937 | Bacteria | 4473 |
| 169 | Ga0081455_10089432 | 3300005937 | Bacteria | 2499 |
| 170 | Ga0075365_10020781 | 3300006038 | Bacteria | 4078 |
| 171 | Ga0075365_10028497 | 3300006038 | Bacteria | 3563 |
| 172 | Ga0075365_10060257 | 3300006038 | Bacteria | 2532 |
| 173 | Ga0075365_10075414 | 3300006038 | Bacteria | 2276 |
| 174 | Ga0075365_10235632 | 3300006038 | Bacteria | 1285 |
| 175 | Ga0075368_10006205 | 3300006042 | Bacteria | 4165 |
| 176 | Ga0075363_100000517 | 3300006048 | Bacteria | 12410 |
| 177 | Ga0075363_100081721 | 3300006048 | Bacteria | 1768 |
| 178 | Ga0075364_10000330 | 3300006051 | Bacteria | 23530 |
| 179 | Ga0075364_10004100 | 3300006051 | Bacteria | 8361 |
| 180 | Ga0075364_10006116 | 3300006051 | Bacteria | 7047 |
| 181 | Ga0075364_10018863 | 3300006051 | Bacteria | 4326 |
| 182 | Ga0075364_10023387 | 3300006051 | Bacteria | 3913 |
| 183 | Ga0075364_10109383 | 3300006051 | Bacteria | 1843 |
| 184 | Ga0075432_10001362 | 3300006058 | Bacteria | 7938 |
| 185 | Ga0075432_10025711 | 3300006058 | Bacteria | 2020 |
| 186 | Ga0075362_10006339 | 3300006177 | Bacteria | 4406 |
| 187 | Ga0075362_10028612 | 3300006177 | Bacteria | 2394 |
| 188 | Ga0075367_10000817 | 3300006178 | Bacteria | 12303 |
| 189 | Ga0075367_10001867 | 3300006178 | Bacteria | 9309 |
| 190 | Ga0075367_10030850 | 3300006178 | Bacteria | 3076 |
| 191 | Ga0075367_10035201 | 3300006178 | Bacteria | 2897 |
| 192 | Ga0075367_10051829 | 3300006178 | Bacteria | 2427 |
| 193 | Ga0075369_10002835 | 3300006186 | Bacteria | 6244 |
| 194 | Ga0075369_10142406 | 3300006186 | Bacteria | 1094 |
| 195 | Ga0075366_10003864 | 3300006195 | Bacteria | 7981 |
| 196 | Ga0075366_10069473 | 3300006195 | Bacteria | 2096 |
| 197 | Ga0097621_100638531 | 3300006237 | Bacteria | 976 |
| 198 | Ga0075370_10007174 | 3300006353 | Bacteria | 5661 |
| 199 | Ga0075370_10137935 | 3300006353 | Bacteria | 1425 |
| 200 | Ga0075428_100000308 | 3300006844 | Bacteria | 48042 |
| 201 | Ga0075430_100175990 | 3300006846 | Bacteria | 1780 |
| 202 | Ga0075431_100035633 | 3300006847 | Bacteria | 5123 |
| 203 | Ga0075431_100117369 | 3300006847 | Bacteria | 2746 |
| 204 | Ga0075433_10003167 | 3300006852 | Bacteria | 12677 |
| 205 | Ga0075434_100040767 | 3300006871 | Bacteria | 4599 |
| 206 | Ga0075434_100231538 | 3300006871 | Bacteria | 1867 |
| 207 | Ga0075429_100326494 | 3300006880 | Bacteria | 1343 |
| 208 | Ga0068865_100004923 | 3300006881 | Bacteria | 8073 |
| 209 | Ga0075436_100107848 | 3300006914 | Bacteria | 1942 |
| 210 | Ga0097620_100002330 | 3300006931 | Bacteria | 19304 |
| 211 | Ga0097620_100004672 | 3300006931 | Bacteria | 13948 |
| 212 | Ga0097620_100077898 | 3300006931 | Bacteria | 3356 |
| 213 | Ga0097620_100086492 | 3300006931 | Bacteria | 3182 |
| 214 | Ga0079104_1007879 | 3300006946 | Bacteria | 3797 |
| 215 | Ga0099826_10001733 | 3300006948 | Bacteria | 13457 |
| 216 | Ga0099826_10011457 | 3300006948 | Bacteria | 6672 |
| 217 | Ga0099826_10085389 | 3300006948 | Bacteria | 1949 |
| 218 | Ga0075435_100001016 | 3300007076 | Bacteria | 17788 |
| 219 | Ga0075435_100126547 | 3300007076 | Bacteria | 2136 |
| 220 | Ga0075435_100360360 | 3300007076 | Bacteria | 1247 |
| 221 | Ga0105244_10005376 | 3300009036 | Bacteria | 8524 |
| 222 | Ga0105244_10024640 | 3300009036 | Bacteria | 3281 |
| 223 | Ga0105244_10054329 | 3300009036 | Bacteria | 2032 |
| 224 | Ga0105250_10048314 | 3300009092 | Bacteria | 1707 |
| 225 | Ga0105240_10000019 | 3300009093 | Bacteria | 406211 |
| 226 | Ga0105240_10008822 | 3300009093 | Bacteria | 14360 |
| 227 | Ga0105240_10034181 | 3300009093 | Bacteria | 6560 |
| 228 | Ga0105240_10133643 | 3300009093 | Bacteria | 2973 |
| 229 | Ga0105240_10162229 | 3300009093 | Bacteria | 2654 |
| 230 | Ga0105240_10784889 | 3300009093 | Bacteria | 1033 |
| 231 | Ga0111539_10009545 | 3300009094 | Bacteria | 12248 |
| 232 | Ga0114129_10002076 | 3300009147 | Bacteria | 27550 |
| 233 | Ga0105243_10009086 | 3300009148 | Bacteria | 7594 |
| 234 | Ga0105243_10102408 | 3300009148 | Bacteria | 2379 |
| 235 | Ga0105243_10251776 | 3300009148 | Bacteria | 1577 |
| 236 | Ga0105243_10498429 | 3300009148 | Bacteria | 1153 |
| 237 | Ga0105241_10134827 | 3300009174 | Bacteria | 2003 |
| 238 | Ga0105248_10000956 | 3300009177 | Bacteria | 32210 |
| 239 | Ga0105248_10002867 | 3300009177 | Bacteria | 19138 |
| 240 | Ga0105248_10022410 | 3300009177 | Bacteria | 7006 |
| 241 | Ga0105248_10333479 | 3300009177 | Bacteria | 1708 |
| 242 | Ga0105248_10433136 | 3300009177 | Bacteria | 1481 |
| 243 | Ga0105248_10956889 | 3300009177 | Bacteria | 967 |
| 244 | Ga0105248_11187341 | 3300009177 | Bacteria | 863 |
| 245 | Ga0105237_10000734 | 3300009545 | Bacteria | 45223 |
| 246 | Ga0105237_10013543 | 3300009545 | Bacteria | 8546 |
| 247 | Ga0105238_10130517 | 3300009551 | Bacteria | 2491 |
| 248 | Ga0105238_10131601 | 3300009551 | Bacteria | 2480 |
| 249 | Ga0105238_10141831 | 3300009551 | Bacteria | 2379 |
| 250 | Ga0105238_10257715 | 3300009551 | Bacteria | 1723 |
| 251 | Ga0105238_10308719 | 3300009551 | Bacteria | 1566 |
| 252 | Ga0105249_10002691 | 3300009553 | Bacteria | 15363 |
| 253 | Ga0105249_10085780 | 3300009553 | Bacteria | 2935 |
| 254 | Ga0123340_1060268 | 3300009763 | Bacteria | 1110 |
| 255 | Ga0123341_1000014 | 3300009765 | Bacteria | 91980 |
| 256 | Ga0123342_1013040 | 3300009766 | Bacteria | 8447 |
| 257 | Ga0123342_1035140 | 3300009766 | Bacteria | 2158 |
| 258 | Ga0105239_10000574 | 3300010375 | Bacteria | 52563 |
| 259 | Ga0105239_10038018 | 3300010375 | Bacteria | 5275 |
| 260 | Ga0105239_10152314 | 3300010375 | Bacteria | 2581 |
| 261 | Ga0105246_10003419 | 3300011119 | Bacteria | 9623 |
| 262 | Ga0105246_10006000 | 3300011119 | Bacteria | 7418 |
| 263 | Ga0105246_10033470 | 3300011119 | Bacteria | 3417 |
| 264 | Ga0157314_1002199 | 3300012500 | Bacteria | 1350 |
| 265 | Ga0157373_10041542 | 3300013100 | Bacteria | 3290 |
| 266 | Ga0157373_10109717 | 3300013100 | Bacteria | 1940 |
| 267 | Ga0157373_10235596 | 3300013100 | Bacteria | 1293 |
| 268 | Ga0157373_10528331 | 3300013100 | Bacteria | 854 |
| 269 | Ga0157371_10000002 | 3300013102 | Bacteria | 665040 |
| 270 | Ga0157371_10009588 | 3300013102 | Bacteria | 7615 |
| 271 | Ga0157370_10000131 | 3300013104 | Bacteria | 89805 |
| 272 | Ga0157370_10000246 | 3300013104 | Bacteria | 69424 |
| 273 | Ga0157370_10036865 | 3300013104 | Bacteria | 4743 |
| 274 | Ga0157370_10101533 | 3300013104 | Bacteria | 2694 |
| 275 | Ga0157369_10017091 | 3300013105 | Bacteria | 8152 |
| 276 | Ga0157369_10058336 | 3300013105 | Bacteria | 4164 |
| 277 | Ga0157369_10088543 | 3300013105 | Bacteria | 3304 |
| 278 | Ga0157369_10162395 | 3300013105 | Bacteria | 2357 |
| 279 | Ga0157369_10215221 | 3300013105 | Bacteria | 2013 |
| 280 | Ga0157369_10492205 | 3300013105 | Bacteria | 1269 |
| 281 | Ga0163162_10002377 | 3300013306 | Bacteria | 17690 |
| 282 | Ga0163162_10027041 | 3300013306 | Bacteria | 5673 |
| 283 | Ga0157375_10183886 | 3300013308 | Bacteria | 2243 |
| 284 | Ga0157375_10257464 | 3300013308 | Bacteria | 1906 |
| 285 | Ga0157375_10281673 | 3300013308 | Bacteria | 1825 |
| 286 | Ga0157375_10408714 | 3300013308 | Bacteria | 1524 |
| 287 | Ga0157375_10921504 | 3300013308 | Bacteria | 1017 |
| 288 | Ga0163163_10000523 | 3300014325 | Bacteria | 34253 |
| 289 | Ga0182008_10015150 | 3300014497 | Bacteria | 4029 |
| 290 | Ga0182008_10016782 | 3300014497 | Bacteria | 3798 |
| 291 | Ga0157379_10006347 | 3300014968 | Bacteria | 10183 |
| 292 | Ga0157379_10009511 | 3300014968 | Bacteria | 8464 |
| 293 | Ga0157379_10126411 | 3300014968 | Bacteria | 2300 |
| 294 | Ga0182006_1034649 | 3300015261 | Bacteria | 2018 |
| 295 | Ga0182007_10006425 | 3300015262 | Bacteria | 5043 |
| 296 | Ga0183363_1150 | 3300015690 | Bacteria | 17320 |
| 297 | Ga0163161_10306703 | 3300017792 | Bacteria | 1252 |
| 298 | Ga0206353_10568533 | 3300020082 | Bacteria | 842 |
| 299 | Ga0214544_1000893 | 3300021320 | Bacteria | 58796 |
| 300 | Ga0214542_1000115 | 3300021321 | Bacteria | 109873 |
| 301 | Ga0214542_1010937 | 3300021321 | Bacteria | 12829 |
| 302 | Ga0214543_1000008 | 3300021327 | Bacteria | 385680 |
| 303 | Ga0214543_1000098 | 3300021327 | Bacteria | 109894 |
| 304 | Ga0213872_10111147 | 3300021361 | Bacteria | 1217 |
| 305 | Ga0213875_10002358 | 3300021388 | Bacteria | 11392 |
| 306 | Ga0213875_10151488 | 3300021388 | Bacteria | 1087 |
| 307 | Ga0228711_1000003 | 3300022739 | Bacteria | 258118 |
| 308 | Ga0228710_1000003 | 3300022740 | Bacteria | 262981 |
| 309 | Ga0209435_100005 | 3300025206 | Bacteria | 573745 |
| 310 | Ga0209436_100023 | 3300025208 | Bacteria | 96401 |
| 311 | Ga0209436_100027 | 3300025208 | Bacteria | 87534 |
| 312 | Ga0209436_103154 | 3300025208 | Bacteria | 4518 |
| 313 | Ga0209437_100058 | 3300025233 | Bacteria | 357279 |
| 314 | Ga0209437_100313 | 3300025233 | Bacteria | 64057 |
| 315 | Ga0209437_114590 | 3300025233 | Bacteria | 1091 |
| 316 | Ga0207425_1000058 | 3300025245 | Bacteria | 149214 |
| 317 | Ga0207425_1006058 | 3300025245 | Bacteria | 3358 |
| 318 | Ga0207425_1008224 | 3300025245 | Bacteria | 2687 |
| 319 | Ga0207425_1014838 | 3300025245 | Bacteria | 1763 |
| 320 | Ga0209646_1000011 | 3300025246 | Bacteria | 573745 |
| 321 | Ga0209026_1000008 | 3300025250 | Bacteria | 573745 |
| 322 | Ga0209759_1000004 | 3300025256 | Bacteria | 573745 |
| 323 | Ga0209129_1000080 | 3300025258 | Bacteria | 186416 |
| 324 | Ga0209129_1000107 | 3300025258 | Bacteria | 154705 |
| 325 | Ga0209129_1000145 | 3300025258 | Bacteria | 115927 |
| 326 | Ga0209129_1000605 | 3300025258 | Bacteria | 24282 |
| 327 | Ga0209129_1000714 | 3300025258 | Bacteria | 21436 |
| 328 | Ga0209129_1001284 | 3300025258 | Bacteria | 14344 |
| 329 | Ga0209129_1001351 | 3300025258 | Bacteria | 13854 |
| 330 | Ga0209129_1024521 | 3300025258 | Bacteria | 1061 |
| 331 | Ga0209233_1000157 | 3300025261 | Bacteria | 164269 |
| 332 | Ga0209233_1000354 | 3300025261 | Bacteria | 42911 |
| 333 | Ga0209233_1000380 | 3300025261 | Bacteria | 38801 |
| 334 | Ga0209673_1000060 | 3300025273 | Bacteria | 263602 |
| 335 | Ga0209673_1000233 | 3300025273 | Bacteria | 108504 |
| 336 | Ga0209673_1000781 | 3300025273 | Bacteria | 42606 |
| 337 | Ga0209673_1001374 | 3300025273 | Bacteria | 23942 |
| 338 | Ga0209673_1005142 | 3300025273 | Bacteria | 6693 |
| 339 | Ga0209673_1010151 | 3300025273 | Bacteria | 3998 |
| 340 | Ga0209673_1014773 | 3300025273 | Bacteria | 3005 |
| 341 | Ga0209673_1016024 | 3300025273 | Bacteria | 2819 |
| 342 | Ga0209130_1000083 | 3300025284 | Bacteria | 162582 |
| 343 | Ga0209130_1000173 | 3300025284 | Bacteria | 92248 |
| 344 | Ga0209675_1019772 | 3300025291 | Bacteria | 1843 |
| 345 | Ga0209676_1009832 | 3300025292 | Bacteria | 4068 |
| 346 | Ga0209025_1000052 | 3300025294 | Bacteria | 324648 |
| 347 | Ga0209025_1000083 | 3300025294 | Bacteria | 265556 |
| 348 | Ga0209025_1000255 | 3300025294 | Bacteria | 125764 |
| 349 | Ga0209025_1000350 | 3300025294 | Bacteria | 99649 |
| 350 | Ga0209025_1002871 | 3300025294 | Bacteria | 17276 |
| 351 | Ga0209025_1004678 | 3300025294 | Bacteria | 11692 |
| 352 | Ga0209025_1015394 | 3300025294 | Bacteria | 4613 |
| 353 | Ga0209025_1026479 | 3300025294 | Bacteria | 2910 |
| 354 | Ga0209564_1000116 | 3300025295 | Bacteria | 207889 |
| 355 | Ga0209564_1000125 | 3300025295 | Bacteria | 201709 |
| 356 | Ga0209564_1001273 | 3300025295 | Bacteria | 27736 |
| 357 | Ga0209564_1003981 | 3300025295 | Bacteria | 9378 |
| 358 | Ga0209564_1006272 | 3300025295 | Bacteria | 6478 |
| 359 | Ga0209564_1010520 | 3300025295 | Bacteria | 4249 |
| 360 | Ga0209758_1000090 | 3300025297 | Bacteria | 246564 |
| 361 | Ga0209758_1000839 | 3300025297 | Bacteria | 42882 |
| 362 | Ga0209758_1000928 | 3300025297 | Bacteria | 39646 |
| 363 | Ga0209758_1001034 | 3300025297 | Bacteria | 36440 |
| 364 | Ga0209758_1001969 | 3300025297 | Bacteria | 22184 |
| 365 | Ga0209758_1003215 | 3300025297 | Bacteria | 15224 |
| 366 | Ga0209758_1009519 | 3300025297 | Bacteria | 6017 |
| 367 | Ga0209758_1015321 | 3300025297 | Bacteria | 3982 |
| 368 | Ga0209050_1003361 | 3300025298 | Bacteria | 11915 |
| 369 | Ga0209050_1005007 | 3300025298 | Bacteria | 8609 |
| 370 | Ga0209256_1000302 | 3300025299 | Bacteria | 86634 |
| 371 | Ga0209256_1001684 | 3300025299 | Bacteria | 21424 |
| 372 | Ga0209256_1001904 | 3300025299 | Bacteria | 19087 |
| 373 | Ga0209256_1006695 | 3300025299 | Bacteria | 5984 |
| 374 | Ga0209256_1007478 | 3300025299 | Bacteria | 5371 |
| 375 | Ga0209256_1009497 | 3300025299 | Bacteria | 4255 |
| 376 | Ga0207426_1000047 | 3300025302 | Bacteria | 417011 |
| 377 | Ga0207426_1000173 | 3300025302 | Bacteria | 162697 |
| 378 | Ga0207426_1000276 | 3300025302 | Bacteria | 106148 |
| 379 | Ga0207426_1001540 | 3300025302 | Bacteria | 18739 |
| 380 | Ga0209051_1000217 | 3300025303 | Bacteria | 97218 |
| 381 | Ga0209051_1003071 | 3300025303 | Bacteria | 11278 |
| 382 | Ga0209051_1013849 | 3300025303 | Bacteria | 3805 |
| 383 | Ga0209051_1017658 | 3300025303 | Bacteria | 3182 |
| 384 | Ga0209051_1023760 | 3300025303 | Bacteria | 2540 |
| 385 | Ga0209051_1044997 | 3300025303 | Bacteria | 1532 |
| 386 | Ga0209257_1002359 | 3300025304 | Bacteria | 18962 |
| 387 | Ga0209257_1003258 | 3300025304 | Bacteria | 14215 |
| 388 | Ga0209257_1026373 | 3300025304 | Bacteria | 1960 |
| 389 | Ga0207697_10000777 | 3300025315 | Bacteria | 18070 |
| 390 | Ga0207697_10016313 | 3300025315 | Bacteria | 3059 |
| 391 | Ga0207656_10007056 | 3300025321 | Bacteria | 4079 |
| 392 | Ga0207655_1002973 | 3300025728 | Bacteria | 13016 |
| 393 | Ga0207655_1003408 | 3300025728 | Bacteria | 11860 |
| 394 | Ga0207688_10143968 | 3300025901 | Bacteria | 1404 |
| 395 | Ga0207680_10151896 | 3300025903 | Bacteria | 1544 |
| 396 | Ga0207647_10023166 | 3300025904 | Bacteria | 4111 |
| 397 | Ga0207647_10032365 | 3300025904 | Bacteria | 3360 |
| 398 | Ga0207647_10190198 | 3300025904 | Bacteria | 1190 |
| 399 | Ga0207685_10104462 | 3300025905 | Bacteria | 1217 |
| 400 | Ga0207645_10003790 | 3300025907 | Bacteria | 11354 |
| 401 | Ga0207705_10285350 | 3300025909 | Bacteria | 1264 |
| 402 | Ga0207705_10428792 | 3300025909 | Bacteria | 1024 |
| 403 | Ga0207654_10131782 | 3300025911 | Bacteria | 1583 |
| 404 | Ga0207707_10070567 | 3300025912 | Bacteria | 3044 |
| 405 | Ga0207707_10236088 | 3300025912 | Bacteria | 1590 |
| 406 | Ga0207695_10000049 | 3300025913 | Bacteria | 406233 |
| 407 | Ga0207695_10002646 | 3300025913 | Bacteria | 26177 |
| 408 | Ga0207695_10169998 | 3300025913 | Bacteria | 2106 |
| 409 | Ga0207695_10326655 | 3300025913 | Bacteria | 1423 |
| 410 | Ga0207671_10000423 | 3300025914 | Bacteria | 58526 |
| 411 | Ga0207660_10046649 | 3300025917 | Bacteria | 3058 |
| 412 | Ga0207657_10013840 | 3300025919 | Bacteria | 7895 |
| 413 | Ga0207657_10033074 | 3300025919 | Bacteria | 4665 |
| 414 | Ga0207657_10060202 | 3300025919 | Bacteria | 3259 |
| 415 | Ga0207649_10007286 | 3300025920 | Bacteria | 6016 |
| 416 | Ga0207649_10028688 | 3300025920 | Bacteria | 3278 |
| 417 | Ga0207649_10132015 | 3300025920 | Bacteria | 1698 |
| 418 | Ga0207652_10046917 | 3300025921 | Bacteria | 3689 |
| 419 | Ga0207652_10245788 | 3300025921 | Bacteria | 1613 |
| 420 | Ga0207681_10010940 | 3300025923 | Bacteria | 5574 |
| 421 | Ga0207681_10017969 | 3300025923 | Bacteria | 4447 |
| 422 | Ga0207694_10017871 | 3300025924 | Bacteria | 5360 |
| 423 | Ga0207694_10025064 | 3300025924 | Bacteria | 4532 |
| 424 | Ga0207694_10058549 | 3300025924 | Bacteria | 2996 |
| 425 | Ga0207694_10208913 | 3300025924 | Bacteria | 1590 |
| 426 | Ga0207694_10254897 | 3300025924 | Bacteria | 1436 |
| 427 | Ga0207650_10000030 | 3300025925 | Bacteria | 235824 |
| 428 | Ga0207650_10007621 | 3300025925 | Bacteria | 7375 |
| 429 | Ga0207650_10023252 | 3300025925 | Bacteria | 4393 |
| 430 | Ga0207650_10551031 | 3300025925 | Bacteria | 967 |
| 431 | Ga0207644_10001318 | 3300025931 | Bacteria | 15943 |
| 432 | Ga0207644_10012003 | 3300025931 | Bacteria | 5745 |
| 433 | Ga0207644_10088856 | 3300025931 | Bacteria | 2299 |
| 434 | Ga0207690_10014391 | 3300025932 | Bacteria | 4779 |
| 435 | Ga0207690_10061781 | 3300025932 | Bacteria | 2548 |
| 436 | Ga0207709_10019698 | 3300025935 | Bacteria | 3798 |
| 437 | Ga0207709_10107250 | 3300025935 | Bacteria | 1860 |
| 438 | Ga0207709_10150025 | 3300025935 | Bacteria | 1613 |
| 439 | Ga0207669_10096773 | 3300025937 | Bacteria | 1939 |
| 440 | Ga0207704_10000732 | 3300025938 | Bacteria | 14438 |
| 441 | Ga0207691_10002449 | 3300025940 | Bacteria | 18143 |
| 442 | Ga0207711_10001411 | 3300025941 | Bacteria | 22498 |
| 443 | Ga0207711_10003037 | 3300025941 | Bacteria | 14667 |
| 444 | Ga0207711_10064476 | 3300025941 | Bacteria | 3164 |
| 445 | Ga0207711_10093560 | 3300025941 | Bacteria | 2648 |
| 446 | Ga0207711_10341662 | 3300025941 | Bacteria | 1385 |
| 447 | Ga0207661_10125732 | 3300025944 | Bacteria | 2190 |
| 448 | Ga0207679_10521673 | 3300025945 | Bacteria | 1063 |
| 449 | Ga0207667_10039773 | 3300025949 | Bacteria | 5008 |
| 450 | Ga0207667_10050469 | 3300025949 | Bacteria | 4389 |
| 451 | Ga0207667_10181735 | 3300025949 | Bacteria | 2160 |
| 452 | Ga0207667_10556790 | 3300025949 | Bacteria | 1159 |
| 453 | Ga0207667_10787625 | 3300025949 | Bacteria | 948 |
| 454 | Ga0207651_10134629 | 3300025960 | Bacteria | 1898 |
| 455 | Ga0207712_10001578 | 3300025961 | Bacteria | 15345 |
| 456 | Ga0207712_10575403 | 3300025961 | Bacteria | 971 |
| 457 | Ga0207668_10000010 | 3300025972 | Bacteria | 185249 |
| 458 | Ga0207668_10000502 | 3300025972 | Bacteria | 24518 |
| 459 | Ga0207668_10011325 | 3300025972 | Bacteria | 5414 |
| 460 | Ga0207668_10148790 | 3300025972 | Bacteria | 1810 |
| 461 | Ga0207668_10543076 | 3300025972 | Bacteria | 1006 |
| 462 | Ga0207640_10018321 | 3300025981 | Bacteria | 4113 |
| 463 | Ga0207640_10037509 | 3300025981 | Bacteria | 3050 |
| 464 | Ga0207640_10054952 | 3300025981 | Bacteria | 2606 |
| 465 | Ga0207640_10090944 | 3300025981 | Bacteria | 2113 |
| 466 | Ga0207640_10214772 | 3300025981 | Bacteria | 1468 |
| 467 | Ga0207658_10000810 | 3300025986 | Bacteria | 26172 |
| 468 | Ga0207658_10004019 | 3300025986 | Bacteria | 10294 |
| 469 | Ga0207658_10101217 | 3300025986 | Bacteria | 2257 |
| 470 | Ga0207658_10589461 | 3300025986 | Bacteria | 998 |
| 471 | Ga0207677_10656124 | 3300026023 | Bacteria | 927 |
| 472 | Ga0207703_10000171 | 3300026035 | Bacteria | 75791 |
| 473 | Ga0207703_10001817 | 3300026035 | Bacteria | 19028 |
| 474 | Ga0207639_10008114 | 3300026041 | Bacteria | 7179 |
| 475 | Ga0207639_10018028 | 3300026041 | Bacteria | 5009 |
| 476 | Ga0207639_10190099 | 3300026041 | Bacteria | 1753 |
| 477 | Ga0207639_10206687 | 3300026041 | Bacteria | 1687 |
| 478 | Ga0207639_10258988 | 3300026041 | Bacteria | 1520 |
| 479 | Ga0207678_10000075 | 3300026067 | Bacteria | 79006 |
| 480 | Ga0207678_10015962 | 3300026067 | Bacteria | 6596 |
| 481 | Ga0207678_10153082 | 3300026067 | Bacteria | 1969 |
| 482 | Ga0207702_10035243 | 3300026078 | Bacteria | 4184 |
| 483 | Ga0207702_10040011 | 3300026078 | Bacteria | 3930 |
| 484 | Ga0207702_10074658 | 3300026078 | Bacteria | 2927 |
| 485 | Ga0207641_10000007 | 3300026088 | Bacteria | 441443 |
| 486 | Ga0207641_10001223 | 3300026088 | Bacteria | 25730 |
| 487 | Ga0207641_10059544 | 3300026088 | Bacteria | 3252 |
| 488 | Ga0207641_10072576 | 3300026088 | Bacteria | 2964 |
| 489 | Ga0207641_10409698 | 3300026088 | Bacteria | 1303 |
| 490 | Ga0207676_10000095 | 3300026095 | Bacteria | 80405 |
| 491 | Ga0207676_10000268 | 3300026095 | Bacteria | 45354 |
| 492 | Ga0207674_10005582 | 3300026116 | Bacteria | 14914 |
| 493 | Ga0207674_10067558 | 3300026116 | Bacteria | 3599 |
| 494 | Ga0207674_10217523 | 3300026116 | Bacteria | 1859 |
| 495 | Ga0207674_10298985 | 3300026116 | Bacteria | 1558 |
| 496 | Ga0207683_10002422 | 3300026121 | Bacteria | 16293 |
| 497 | Ga0207698_10012352 | 3300026142 | Bacteria | 5585 |
| 498 | Ga0207698_10096926 | 3300026142 | Bacteria | 2432 |
| 499 | Ga0207698_10666257 | 3300026142 | Bacteria | 1032 |
| 500 | Ga0209281_1000068 | 3300027111 | Bacteria | 280238 |
| 501 | Ga0209281_1000081 | 3300027111 | Bacteria | 258084 |
| 502 | Ga0209281_1000269 | 3300027111 | Bacteria | 100505 |
| 503 | Ga0209371_1000003 | 3300027312 | Bacteria | 1122971 |
| 504 | Ga0209371_1001970 | 3300027312 | Bacteria | 12422 |
| 505 | Ga0209371_1004843 | 3300027312 | Bacteria | 5644 |
| 506 | Ga0209282_1000040 | 3300027666 | Bacteria | 127969 |
| 507 | Ga0209282_1005392 | 3300027666 | Bacteria | 7844 |
| 508 | Ga0209813_10002642 | 3300027866 | Bacteria | 4120 |
| 509 | Ga0207428_10028693 | 3300027907 | Bacteria | 4621 |
| 510 | Ga0207428_10331709 | 3300027907 | Bacteria | 1122 |
| 511 | Ga0268266_10001182 | 3300028379 | Bacteria | 32222 |
| 512 | Ga0268266_10003080 | 3300028379 | Bacteria | 17040 |
| 513 | Ga0268266_10018839 | 3300028379 | Bacteria | 5883 |
| 514 | Ga0268266_10048496 | 3300028379 | Bacteria | 3641 |
| 515 | Ga0268266_10070595 | 3300028379 | Bacteria | 3026 |
| 516 | Ga0268266_10079092 | 3300028379 | Bacteria | 2862 |
| 517 | Ga0268266_10109764 | 3300028379 | Bacteria | 2443 |
| 518 | Ga0268266_10165162 | 3300028379 | Bacteria | 2005 |
| 519 | Ga0268266_10198594 | 3300028379 | Bacteria | 1835 |
| 520 | Ga0268265_10009764 | 3300028380 | Bacteria | 6480 |
| 521 | Ga0268265_10020309 | 3300028380 | Bacteria | 4635 |
| 522 | Ga0268265_10591016 | 3300028380 | Bacteria | 1059 |
| 523 | Ga0268264_10000125 | 3300028381 | Bacteria | 186416 |
| 524 | Ga0268264_10006798 | 3300028381 | Bacteria | 9609 |
| 525 | Ga0268264_10040817 | 3300028381 | Bacteria | 3834 |
| 526 | Ga0268264_10095086 | 3300028381 | Bacteria | 2578 |
| 527 | Ga0265319_1026846 | 3300028563 | Bacteria | 2047 |
| 528 | Ga0265334_10015152 | 3300028573 | Bacteria | 3207 |
| 529 | Ga0265318_10000001 | 3300028577 | Bacteria | 500711 |
| 530 | Ga0265318_10045221 | 3300028577 | Bacteria | 1664 |
| 531 | Ga0307517_10001755 | 3300028786 | Bacteria | 35724 |
| 532 | Ga0307517_10051943 | 3300028786 | Bacteria | 4122 |
| 533 | Ga0307515_10000017 | 3300028794 | Bacteria | 550465 |
| 534 | Ga0307515_10108497 | 3300028794 | Bacteria | 3270 |
| 535 | Ga0265338_10001954 | 3300028800 | Bacteria | 32161 |
| 536 | Ga0265338_10020392 | 3300028800 | Bacteria | 6973 |
| 537 | Ga0265338_10107543 | 3300028800 | Bacteria | 2255 |
| 538 | Ga0265338_10135374 | 3300028800 | Bacteria | 1938 |
| 539 | Ga0265338_10196329 | 3300028800 | Bacteria | 1525 |
| 540 | Ga0268256_1000004 | 3300030500 | Bacteria | 1122967 |
| 541 | Ga0268256_1001045 | 3300030500 | Bacteria | 18558 |
| 542 | Ga0268256_1002352 | 3300030500 | Bacteria | 9744 |
| 543 | Ga0316181_1198668 | 3300030744 | Bacteria | 2128 |
| 544 | Ga0265325_10004909 | 3300031241 | Bacteria | 8349 |
| 545 | Ga0307513_10001025 | 3300031456 | Bacteria | 40478 |
| 546 | Ga0307513_10003675 | 3300031456 | Bacteria | 20751 |
| 547 | Ga0307513_10022270 | 3300031456 | Bacteria | 7454 |
| 548 | Ga0307513_10238617 | 3300031456 | Bacteria | 1625 |
| 549 | Ga0307408_100009834 | 3300031548 | Bacteria | 6303 |
| 550 | Ga0307408_100024062 | 3300031548 | Bacteria | 4154 |
| 551 | Ga0307408_100125185 | 3300031548 | Bacteria | 1997 |
| 552 | Ga0307408_100147439 | 3300031548 | Bacteria | 1854 |
| 553 | Ga0307408_100237683 | 3300031548 | Bacteria | 1495 |
| 554 | Ga0307408_100324237 | 3300031548 | Bacteria | 1298 |
| 555 | Ga0307408_100442502 | 3300031548 | Bacteria | 1125 |
| 556 | Ga0265313_10004959 | 3300031595 | Bacteria | 9959 |
| 557 | Ga0265313_10005514 | 3300031595 | Bacteria | 9274 |
| 558 | Ga0265342_10033039 | 3300031712 | Bacteria | 3185 |
| 559 | Ga0307405_10005651 | 3300031731 | Bacteria | 6059 |
| 560 | Ga0307405_10038653 | 3300031731 | Bacteria | 2879 |
| 561 | Ga0307405_10087614 | 3300031731 | Bacteria | 2052 |
| 562 | Ga0316577_10056427 | 3300031733 | Bacteria | 2192 |
| 563 | Ga0307413_10017665 | 3300031824 | Bacteria | 3721 |
| 564 | Ga0307413_10021565 | 3300031824 | Bacteria | 3453 |
| 565 | Ga0307413_10031744 | 3300031824 | Bacteria | 2985 |
| 566 | Ga0307413_10132346 | 3300031824 | Bacteria | 1709 |
| 567 | Ga0307413_10347617 | 3300031824 | Bacteria | 1143 |
| 568 | Ga0307413_10368866 | 3300031824 | Bacteria | 1114 |
| 569 | Ga0307413_10368993 | 3300031824 | Bacteria | 1114 |
| 570 | Ga0307410_10023042 | 3300031852 | Bacteria | 3862 |
| 571 | Ga0307410_10066580 | 3300031852 | Bacteria | 2482 |
| 572 | Ga0307410_10122282 | 3300031852 | Bacteria | 1900 |
| 573 | Ga0307410_10124450 | 3300031852 | Bacteria | 1885 |
| 574 | Ga0307410_10136708 | 3300031852 | Bacteria | 1807 |
| 575 | Ga0307410_10233966 | 3300031852 | Bacteria | 1420 |
| 576 | Ga0307410_10325903 | 3300031852 | Bacteria | 1220 |
| 577 | Ga0307406_10005179 | 3300031901 | Bacteria | 7118 |
| 578 | Ga0307406_10284958 | 3300031901 | Bacteria | 1262 |
| 579 | Ga0307407_10052043 | 3300031903 | Bacteria | 2350 |
| 580 | Ga0307407_10079070 | 3300031903 | Bacteria | 1983 |
| 581 | Ga0307412_10001366 | 3300031911 | Bacteria | 13566 |
| 582 | Ga0307412_10076509 | 3300031911 | Bacteria | 2299 |
| 583 | Ga0307412_10163356 | 3300031911 | Bacteria | 1657 |
| 584 | Ga0307412_10219959 | 3300031911 | Bacteria | 1455 |
| 585 | Ga0307412_10411022 | 3300031911 | Bacteria | 1104 |
| 586 | Ga0315914_1000002 | 3300031967 | Bacteria | 365357 |
| 587 | Ga0307409_100003695 | 3300031995 | Bacteria | 8390 |
| 588 | Ga0307409_100059958 | 3300031995 | Bacteria | 2965 |
| 589 | Ga0307409_100065009 | 3300031995 | Bacteria | 2868 |
| 590 | Ga0307409_100261492 | 3300031995 | Bacteria | 1588 |
| 591 | Ga0307409_100489087 | 3300031995 | Bacteria | 1196 |
| 592 | Ga0307416_100017153 | 3300032002 | Bacteria | 5056 |
| 593 | Ga0307416_100073294 | 3300032002 | Bacteria | 2854 |
| 594 | Ga0307416_100154821 | 3300032002 | Bacteria | 2108 |
| 595 | Ga0307416_101099398 | 3300032002 | Bacteria | 899 |
| 596 | Ga0307414_10297741 | 3300032004 | Bacteria | 1363 |
| 597 | Ga0307414_10435879 | 3300032004 | Bacteria | 1146 |
| 598 | Ga0307414_10578581 | 3300032004 | Bacteria | 1004 |
| 599 | Ga0307411_10634820 | 3300032005 | Bacteria | 923 |
| 600 | Ga0307415_100047280 | 3300032126 | Bacteria | 2896 |
| 601 | Ga0307415_100065634 | 3300032126 | Bacteria | 2530 |
| 602 | Ga0307415_100080857 | 3300032126 | Bacteria | 2320 |
| 603 | Ga0307415_100448254 | 3300032126 | Bacteria | 1115 |
| 604 | Ga0307510_10006103 | 3300033180 | Bacteria | 14357 |
| 605 | Ga0315913_1000016 | 3300033430 | Bacteria | 113410 |
| 606 | Ga0315915_1000005 | 3300033464 | Bacteria | 397591 |
| 607 | Ga0373950_0016026 | 3300034818 | Bacteria | 1278 |
| 608 | Ga0373932_0018430 | 3300035112 | Bacteria | 1805 |
| 609 | Ga0316574_0090561 | 3300035398 | Bacteria | 1950 |
| 610 | Ga0373931_0265539 | 3300035691 | Bacteria | 1049 |
| 611 | Ga0373935_0490795 | 3300035692 | Bacteria | 891 |
| 612 | Ga0373927_0044424 | 3300035695 | Bacteria | 2875 |
| 613 | Ga0316584_0034277 | 3300036712 | Bacteria | 3764 |
| 614 | Ga0373925_0009202 | 3300037068 | Bacteria | 7191 |
| 615 | Ga0373925_0504157 | 3300037068 | Bacteria | 994 |
| 616 | Ga0395899_0000003 | 3300037312 | Bacteria | 1232684 |
| 617 | Ga0395899_0000124 | 3300037312 | Bacteria | 122011 |
| 618 | Ga0395899_0005798 | 3300037312 | Bacteria | 9583 |
| 619 | Ga0395899_0015986 | 3300037312 | Bacteria | 5723 |
| 620 | Ga0395899_0020222 | 3300037312 | Bacteria | 5051 |
| 621 | Ga0395899_0072195 | 3300037312 | Bacteria | 2525 |
| 622 | Ga0395899_0079490 | 3300037312 | Bacteria | 2388 |
| 623 | Ga0395899_0119762 | 3300037312 | Bacteria | 1887 |
| 624 | Ga0395899_0277617 | 3300037312 | Bacteria | 1141 |
| 625 | Ga0395900_0000086 | 3300037418 | Bacteria | 171749 |
| 626 | Ga0395900_0009282 | 3300037418 | Bacteria | 10087 |
| 627 | Ga0395900_0028659 | 3300037418 | Bacteria | 5706 |
| 628 | Ga0395900_0078265 | 3300037418 | Bacteria | 3397 |
| 629 | Ga0395900_0091409 | 3300037418 | Bacteria | 3128 |
| 630 | Ga0395900_0094959 | 3300037418 | Bacteria | 3063 |
| 631 | Ga0395900_0231388 | 3300037418 | Bacteria | 1858 |
| 632 | Ga0395900_0375663 | 3300037418 | Bacteria | 1390 |
| 633 | Ga0395900_0586863 | 3300037418 | Bacteria | 1056 |
| 634 | Ga0395898_0000285 | 3300037466 | Bacteria | 122279 |
| 635 | Ga0395898_0005320 | 3300037466 | Bacteria | 13914 |
| 636 | Ga0395898_0015026 | 3300037466 | Bacteria | 7947 |
| 637 | Ga0395898_0020253 | 3300037466 | Bacteria | 6758 |
| 638 | Ga0395898_0054630 | 3300037466 | Bacteria | 3896 |
| 639 | Ga0395898_0057927 | 3300037466 | Bacteria | 3773 |
| 640 | Ga0395898_0138141 | 3300037466 | Bacteria | 2333 |
| 641 | Ga0395898_0675954 | 3300037466 | Bacteria | 974 |
| 642 | Ga0395898_0713937 | 3300037466 | Bacteria | 944 |
| 643 | Ga0395905_0000133 | 3300037471 | Bacteria | 123500 |
| 644 | Ga0395905_0001192 | 3300037471 | Bacteria | 32515 |
| 645 | Ga0395905_0009040 | 3300037471 | Bacteria | 9773 |
| 646 | Ga0395905_0022646 | 3300037471 | Bacteria | 5939 |
| 647 | Ga0395905_0032485 | 3300037471 | Bacteria | 4909 |
| 648 | Ga0395905_0047993 | 3300037471 | Bacteria | 4001 |
| 649 | Ga0395905_0049175 | 3300037471 | Bacteria | 3951 |
| 650 | Ga0395905_0057256 | 3300037471 | Bacteria | 3646 |
| 651 | Ga0395905_0075745 | 3300037471 | Bacteria | 3153 |
| 652 | Ga0436364_0477303 | 3300037853 | Bacteria | 13445 |
| 653 | Ga0436364_1483550 | 3300037853 | Bacteria | 1809 |
| 654 | Ga0395901_0000092 | 3300038443 | Bacteria | 121976 |
| 655 | Ga0395901_0059169 | 3300038443 | Bacteria | 3986 |
| 656 | Ga0395901_0135851 | 3300038443 | Bacteria | 2585 |
| 657 | Ga0395901_0272901 | 3300038443 | Bacteria | 1758 |
| 658 | Ga0395901_0278815 | 3300038443 | Bacteria | 1737 |
| 659 | Ga0395901_0320703 | 3300038443 | Bacteria | 1603 |
| 660 | Ga0395901_0357710 | 3300038443 | Bacteria | 1506 |
| 661 | Ga0395901_0433940 | 3300038443 | Bacteria | 1345 |
| 662 | Ga0395901_0718362 | 3300038443 | Bacteria | 995 |
| 663 | Ga0436365_0172426 | 3300039437 | Bacteria | 2802 |
| 664 | Ga0436360_0128350 | 3300039438 | Bacteria | 9271 |
| 665 | Ga0436361_1068301 | 3300039447 | Bacteria | 3639 |
| 666 | Ga0439436_0018565 | 3300041404 | Bacteria | 2079 |
| 667 | Ga0439438_002499 | 3300041405 | Bacteria | 7818 |
| 668 | Ga0439439_0000167 | 3300041406 | Bacteria | 9811 |
| 669 | Ga0439447_017353 | 3300041407 | Bacteria | 1960 |
| 670 | Ga0439466_0005649 | 3300041411 | Bacteria | 4768 |
| 671 | Ga0439465_0043450 | 3300041413 | Bacteria | 1458 |
| 672 | Ga0451787_375456 | 3300041441 | Bacteria | 1432 |
| 673 | Ga0451791_0372016 | 3300041451 | Bacteria | 1210 |
| 674 | Ga0451797_0412961 | 3300041453 | Bacteria | 1554 |
| 675 | Ga0451797_1592940 | 3300041453 | Bacteria | 1033 |
| 676 | Ga0451845_0403339 | 3300041501 | Bacteria | 1628 |
| 677 | Ga0451847_0456571 | 3300041503 | Bacteria | 1192 |
| 678 | Ga0451849_0249873 | 3300041505 | Bacteria | 2624 |
| 679 | Ga0451855_0519245 | 3300041511 | Bacteria | 1193 |
| 680 | Ga0451853_3280964 | 3300041512 | Bacteria | 1704 |
| 681 | Ga0451853_3662635 | 3300041512 | Bacteria | 1872 |
| 682 | Ga0452268_08108 | 3300041907 | Bacteria | 1192 |
| 683 | Ga0439431_0024355 | 3300041997 | Bacteria | 1472 |
| 684 | Ga0439433_0000009 | 3300041999 | Bacteria | 32735 |
| 685 | Ga0439433_0000060 | 3300041999 | Bacteria | 13464 |
| 686 | Ga0439433_0031738 | 3300041999 | Bacteria | 1210 |
| 687 | Ga0439442_003183 | 3300042002 | Bacteria | 3249 |
| 688 | Ga0439432_003007 | 3300042006 | Bacteria | 6276 |
| 689 | Ga0439432_021736 | 3300042006 | Bacteria | 2124 |
| 690 | Ga0439449_0000822 | 3300042007 | Bacteria | 11997 |
| 691 | Ga0439449_0010414 | 3300042007 | Bacteria | 3511 |
| 692 | Ga0439449_0017291 | 3300042007 | Bacteria | 2707 |
| 693 | Ga0439449_0022734 | 3300042007 | Bacteria | 2347 |
| 694 | Ga0439449_0022817 | 3300042007 | Bacteria | 2342 |
| 695 | Ga0439449_0038752 | 3300042007 | Bacteria | 1772 |
| 696 | Ga0439449_0072326 | 3300042007 | Bacteria | 1270 |
| 697 | Ga0439452_023439 | 3300042010 | Bacteria | 1589 |
| 698 | Ga0439454_024146 | 3300042011 | Bacteria | 917 |
| 699 | Ga0439457_000415 | 3300042014 | Bacteria | 12228 |
| 700 | Ga0439457_002076 | 3300042014 | Bacteria | 5858 |
| 701 | Ga0439462_0000333 | 3300042015 | Bacteria | 8843 |
| 702 | Ga0439462_0004265 | 3300042015 | Bacteria | 3478 |
| 703 | Ga0439462_0063684 | 3300042015 | Bacteria | 998 |
| 704 | Ga0450919_000036 | 3300042121 | Bacteria | 11386 |
| 705 | Ga0450923_033312 | 3300042125 | Bacteria | 1059 |
| 706 | Ga0439446_0007611 | 3300042156 | Bacteria | 2853 |
| 707 | Ga0450908_000417 | 3300042184 | Bacteria | 8196 |
| 708 | Ga0450909_000690 | 3300042185 | Bacteria | 4515 |
| 709 | Ga0439434_0005303 | 3300042435 | Bacteria | 3770 |
| 710 | Ga0439435_0017110 | 3300042436 | Bacteria | 1828 |
| 711 | Ga0450918_004267 | 3300042531 | Bacteria | 2615 |
| 712 | Ga0466972_0070585 | 3300044658 | Bacteria | 1667 |
| 713 | Ga0453683_0000002 | 3300044673 | Bacteria | 1244396 |
| 714 | Ga0453683_0000848 | 3300044673 | Bacteria | 29516 |
| 715 | Ga0453683_0007480 | 3300044673 | Bacteria | 7406 |
| 716 | Ga0466961_0171647 | 3300044693 | Bacteria | 1349 |
| 717 | Ga0466963_0000551 | 3300044694 | Bacteria | 17610 |
| 718 | Ga0466963_0013745 | 3300044694 | Bacteria | 4979 |
| 719 | Ga0453684_0000006 | 3300044712 | Bacteria | 1364191 |
| 720 | Ga0453684_0000048 | 3300044712 | Bacteria | 559743 |
| 721 | Ga0453684_0544482 | 3300044712 | Bacteria | 1279 |
| 722 | Ga0466968_0101030 | 3300044735 | Bacteria | 1288 |
| 723 | Ga0466970_0046089 | 3300044765 | Bacteria | 2322 |
| 724 | Ga0466957_0241358 | 3300044842 | Bacteria | 1199 |
| 725 | Ga0466960_0155106 | 3300044901 | Bacteria | 1226 |
| 726 | Ga0451576_0186193 | 3300045051 | Bacteria | 2168 |
| 727 | Ga0451576_0213557 | 3300045051 | Bacteria | 2015 |
| 728 | Ga0466958_0012379 | 3300045836 | Bacteria | 4832 |
| 729 | Ga0466958_0063741 | 3300045836 | Bacteria | 2248 |
| 730 | Ga0466958_0147632 | 3300045836 | Bacteria | 1482 |
| 731 | Ga0466967_0005549 | 3300045976 | Bacteria | 8760 |
| 732 | Ga0466967_0015125 | 3300045976 | Bacteria | 6041 |
| 733 | Ga0466967_0032079 | 3300045976 | Bacteria | 4432 |
| 734 | Ga0466967_0064140 | 3300045976 | Bacteria | 3266 |
| 735 | Ga0466967_0217932 | 3300045976 | Bacteria | 1812 |
| 736 | Ga0495638_0006458 | 3300046460 | Bacteria | 8530 |
| 737 | Ga0495653_0008062 | 3300046463 | Bacteria | 8627 |
| 738 | Ga0495653_0038307 | 3300046463 | Bacteria | 3763 |
| 739 | Ga0495650_0045538 | 3300046471 | Bacteria | 1847 |
| 740 | Ga0495580_0048533 | 3300046472 | Bacteria | 3005 |
| 741 | Ga0495582_0026943 | 3300046473 | Bacteria | 3149 |
| 742 | Ga0495605_0056839 | 3300046474 | Bacteria | 1886 |
| 743 | Ga0495639_0002717 | 3300046475 | Bacteria | 7689 |
| 744 | Ga0495639_0125428 | 3300046475 | Bacteria | 1227 |
| 745 | Ga0495662_0032753 | 3300046476 | Bacteria | 2511 |
| 746 | Ga0495662_0125037 | 3300046476 | Bacteria | 1263 |
| 747 | Ga0495607_0184233 | 3300046501 | Bacteria | 1045 |
| 748 | Ga0495606_0003931 | 3300046507 | Bacteria | 15287 |
| 749 | Ga0495606_0040817 | 3300046507 | Bacteria | 3116 |
| 750 | Ga0495608_0094790 | 3300046511 | Bacteria | 1929 |
| 751 | Ga0495610_0011758 | 3300046512 | Bacteria | 5317 |
| 752 | Ga0495616_0036341 | 3300046513 | Bacteria | 2542 |
| 753 | Ga0495618_0293807 | 3300046514 | Bacteria | 1011 |
| 754 | Ga0495618_0335582 | 3300046514 | Bacteria | 934 |
| 755 | Ga0495618_0374818 | 3300046514 | Bacteria | 874 |
| 756 | Ga0495620_0137895 | 3300046515 | Bacteria | 955 |
| 757 | Ga0495620_0141682 | 3300046515 | Bacteria | 940 |
| 758 | Ga0495630_0135225 | 3300046517 | Bacteria | 1873 |
| 759 | Ga0495632_0028927 | 3300046519 | Bacteria | 2890 |
| 760 | Ga0495643_0025280 | 3300046522 | Bacteria | 3361 |
| 761 | Ga0495648_0044152 | 3300046524 | Bacteria | 2785 |
| 762 | Ga0495654_0000635 | 3300046530 | Bacteria | 27690 |
| 763 | Ga0495654_0065960 | 3300046530 | Bacteria | 1727 |
| 764 | Ga0495665_0004205 | 3300046531 | Bacteria | 7768 |
| 765 | Ga0495665_0006628 | 3300046531 | Bacteria | 6249 |
| 766 | Ga0495586_0000879 | 3300046535 | Bacteria | 17184 |
| 767 | Ga0495586_0017309 | 3300046535 | Bacteria | 3831 |
| 768 | Ga0495587_0003433 | 3300046536 | Bacteria | 10569 |
| 769 | Ga0495587_0275380 | 3300046536 | Bacteria | 944 |
| 770 | Ga0495609_0005705 | 3300046538 | Bacteria | 6481 |
| 771 | Ga0495645_0001581 | 3300046543 | Bacteria | 15422 |
| 772 | Ga0495667_0004009 | 3300046559 | Bacteria | 9890 |
| 773 | Ga0495667_0097009 | 3300046559 | Bacteria | 1908 |
| 774 | Ga0495667_0289715 | 3300046559 | Bacteria | 1038 |
| 775 | Ga0495668_0004368 | 3300046616 | Bacteria | 10085 |
| 776 | Ga0495668_0018076 | 3300046616 | Bacteria | 4080 |
| 777 | Ga0495668_0270723 | 3300046616 | Bacteria | 930 |
| 778 | Ga0495625_0105363 | 3300046660 | Bacteria | 1932 |
| 779 | Ga0495625_0134729 | 3300046660 | Bacteria | 1670 |
| 780 | Ga0495625_0153701 | 3300046660 | Bacteria | 1545 |
| 781 | Ga0495625_0207939 | 3300046660 | Bacteria | 1288 |
| 782 | Ga0495635_0025255 | 3300046663 | Bacteria | 4138 |
| 783 | Ga0495659_0010930 | 3300046664 | Bacteria | 2923 |
| 784 | Ga0495661_0122459 | 3300046665 | Bacteria | 1435 |
| 785 | Ga0495588_0001385 | 3300046674 | Bacteria | 10360 |
| 786 | Ga0495588_0003429 | 3300046674 | Bacteria | 6891 |
| 787 | Ga0495588_0007477 | 3300046674 | Bacteria | 4974 |
| 788 | Ga0495588_0059848 | 3300046674 | Bacteria | 1971 |
| 789 | Ga0495657_0040369 | 3300046675 | Bacteria | 3201 |
| 790 | Ga0495657_0073272 | 3300046675 | Bacteria | 2231 |
| 791 | Ga0495599_0224696 | 3300046678 | Bacteria | 1148 |
| 792 | Ga0495623_0034629 | 3300046679 | Bacteria | 3238 |
| 793 | Ga0495669_0000009 | 3300046684 | Bacteria | 165516 |
| 794 | Ga0495669_0000153 | 3300046684 | Bacteria | 44276 |
| 795 | Ga0495669_0091910 | 3300046684 | Bacteria | 1402 |
| 796 | Ga0495613_0300963 | 3300046689 | Bacteria | 1110 |
| 797 | Ga0495670_0058999 | 3300046691 | Bacteria | 1926 |
| 798 | Ga0495670_0105887 | 3300046691 | Bacteria | 1452 |
| 799 | Ga0495600_0020885 | 3300046809 | Bacteria | 4190 |
| 800 | Ga0495581_0043902 | 3300047315 | Bacteria | 2585 |
| 801 | Ga0495604_0031099 | 3300047317 | Bacteria | 4236 |
| 802 | Ga0495636_0050778 | 3300047318 | Bacteria | 1737 |
| 803 | Ga0495674_0505928 | 3300047319 | Bacteria | 966 |
| 804 | Ga0495680_0016626 | 3300047322 | Bacteria | 6313 |
| 805 | Ga0495687_051636 | 3300047443 | Bacteria | 1743 |
| 806 | Ga0495675_0026688 | 3300047444 | Bacteria | 3682 |
| 807 | Ga0495681_0060428 | 3300047470 | Bacteria | 1749 |
| 808 | Ga0495684_0077973 | 3300047471 | Bacteria | 2514 |
| 809 | Ga0495686_0000852 | 3300047472 | Bacteria | 39191 |
| 810 | Ga0495686_0008302 | 3300047472 | Bacteria | 7637 |
| 811 | Ga0495686_0094384 | 3300047472 | Bacteria | 1813 |
| 812 | Ga0495593_0019117 | 3300047673 | Bacteria | 3845 |
| 813 | Ga0496100_0013260 | 3300048903 | Bacteria | 4747 |
| 814 | Ga0496100_0081076 | 3300048903 | Bacteria | 2191 |
| 815 | Ga0496101_0017290 | 3300048904 | Bacteria | 4890 |
| 816 | Ga0496101_0044320 | 3300048904 | Bacteria | 3182 |
| 817 | Ga0496101_0059675 | 3300048904 | Bacteria | 2766 |
| 818 | Ga0496101_0060189 | 3300048904 | Bacteria | 2755 |
| 819 | Ga0496101_0271258 | 3300048904 | Bacteria | 1324 |
| 820 | Ga0496102_0005681 | 3300048905 | Bacteria | 10589 |
| 821 | Ga0496102_0005930 | 3300048905 | Bacteria | 10404 |
| 822 | Ga0496102_0016011 | 3300048905 | Bacteria | 6545 |
| 823 | Ga0496102_0069810 | 3300048905 | Bacteria | 3225 |
| 824 | Ga0496103_0002113 | 3300048906 | Bacteria | 12648 |
| 825 | Ga0496103_0007511 | 3300048906 | Bacteria | 6496 |
| 826 | Ga0496103_0064827 | 3300048906 | Bacteria | 2278 |
| 827 | Ga0496103_0108511 | 3300048906 | Bacteria | 1761 |
| 828 | Ga0496104_0045979 | 3300048907 | Bacteria | 4107 |
| 829 | Ga0496104_0157489 | 3300048907 | Bacteria | 2179 |
| 830 | Ga0496105_0017399 | 3300048908 | Bacteria | 5762 |
| 831 | Ga0496105_0028335 | 3300048908 | Bacteria | 4580 |
| 832 | Ga0496105_0031283 | 3300048908 | Bacteria | 4363 |
| 833 | Ga0496106_0009583 | 3300048909 | Bacteria | 7150 |
| 834 | Ga0496106_0052469 | 3300048909 | Bacteria | 3076 |
| 835 | Ga0496106_0115013 | 3300048909 | Bacteria | 2098 |
| 836 | Ga0496107_0009215 | 3300048910 | Bacteria | 6840 |
| 837 | Ga0496107_0011077 | 3300048910 | Bacteria | 6274 |
| 838 | Ga0496107_0022043 | 3300048910 | Bacteria | 4499 |
| 839 | Ga0496107_0096943 | 3300048910 | Bacteria | 2158 |
| 840 | Ga0496108_0328271 | 3300048911 | Bacteria | 1334 |
| 841 | Ga0496109_0013737 | 3300048912 | Bacteria | 7035 |
| 842 | Ga0496109_0160319 | 3300048912 | Bacteria | 2107 |
| 843 | Ga0496109_0167366 | 3300048912 | Bacteria | 2061 |
| 844 | Ga0496109_0425294 | 3300048912 | Bacteria | 1255 |
| 845 | Ga0496110_0019081 | 3300048913 | Bacteria | 5764 |
| 846 | Ga0496110_0066728 | 3300048913 | Bacteria | 3182 |
| 847 | Ga0496110_0070903 | 3300048913 | Bacteria | 3089 |
| 848 | Ga0496110_0311837 | 3300048913 | Bacteria | 1433 |
| 849 | Ga0496110_0371985 | 3300048913 | Bacteria | 1302 |
| 850 | Ga0496111_0002534 | 3300048914 | Bacteria | 11025 |
| 851 | Ga0496111_0028422 | 3300048914 | Bacteria | 3962 |
| 852 | Ga0496111_0114775 | 3300048914 | Bacteria | 1985 |
| 853 | Ga0496111_0157767 | 3300048914 | Bacteria | 1684 |
| 854 | Ga0496111_0236973 | 3300048914 | Bacteria | 1355 |
| 855 | Ga0496111_0266716 | 3300048914 | Bacteria | 1270 |
| 856 | Ga0496112_0000720 | 3300048915 | Bacteria | 22965 |
| 857 | Ga0496112_0057323 | 3300048915 | Bacteria | 3835 |
| 858 | Ga0496112_0126747 | 3300048915 | Bacteria | 2523 |
| 859 | Ga0496112_0251571 | 3300048915 | Bacteria | 1718 |
| 860 | Ga0496113_0044249 | 3300048916 | Bacteria | 3297 |
| 861 | Ga0496113_0044795 | 3300048916 | Bacteria | 3279 |
| 862 | Ga0496114_0034913 | 3300048917 | Bacteria | 4152 |
| 863 | Ga0496114_0066033 | 3300048917 | Bacteria | 3032 |
| 864 | Ga0496114_0093662 | 3300048917 | Bacteria | 2554 |
| 865 | Ga0496115_0024704 | 3300048918 | Bacteria | 4673 |
| 866 | Ga0496115_0110781 | 3300048918 | Bacteria | 2255 |
| 867 | Ga0496115_0136398 | 3300048918 | Bacteria | 2023 |
| 868 | Ga0496115_0198520 | 3300048918 | Bacteria | 1657 |
| 869 | Ga0496115_0544471 | 3300048918 | Bacteria | 928 |
| 870 | Ga0496116_0000471 | 3300048919 | Bacteria | 55687 |
| 871 | Ga0496116_0006412 | 3300048919 | Bacteria | 10676 |
| 872 | Ga0496116_0021816 | 3300048919 | Bacteria | 4817 |
| 873 | Ga0496116_0032549 | 3300048919 | Bacteria | 3714 |
| 874 | Ga0496116_0045918 | 3300048919 | Bacteria | 2952 |
| 875 | Ga0496117_0000052 | 3300048920 | Bacteria | 280463 |
| 876 | Ga0496117_0000926 | 3300048920 | Bacteria | 44886 |
| 877 | Ga0496117_0002079 | 3300048920 | Bacteria | 26445 |
| 878 | Ga0496117_0022166 | 3300048920 | Bacteria | 5101 |
| 879 | Ga0496117_0028573 | 3300048920 | Bacteria | 4316 |
| 880 | Ga0496118_0000792 | 3300048921 | Bacteria | 50632 |
| 881 | Ga0496118_0001977 | 3300048921 | Bacteria | 29110 |
| 882 | Ga0496118_0015866 | 3300048921 | Bacteria | 6945 |
| 883 | Ga0496118_0023162 | 3300048921 | Bacteria | 5404 |
| 884 | Ga0496119_0005539 | 3300048922 | Bacteria | 12029 |
| 885 | Ga0496119_0007934 | 3300048922 | Bacteria | 9446 |
| 886 | Ga0496119_0012383 | 3300048922 | Bacteria | 6935 |
| 887 | Ga0496119_0023594 | 3300048922 | Bacteria | 4355 |
| 888 | Ga0496119_0028943 | 3300048922 | Bacteria | 3769 |
| 889 | Ga0496119_0064456 | 3300048922 | Bacteria | 2175 |
| 890 | Ga0496119_0089163 | 3300048922 | Bacteria | 1757 |
| 891 | Ga0496120_0000019 | 3300048923 | Bacteria | 260115 |
| 892 | Ga0496120_0005030 | 3300048923 | Bacteria | 10720 |
| 893 | Ga0496120_0099216 | 3300048923 | Bacteria | 1542 |
| 894 | Ga0496120_0099510 | 3300048923 | Bacteria | 1539 |
| 895 | Ga0496121_0000003 | 3300048924 | Bacteria | 1191431 |
| 896 | Ga0496121_0000442 | 3300048924 | Bacteria | 81890 |
| 897 | Ga0496121_0007187 | 3300048924 | Bacteria | 13486 |
| 898 | Ga0496121_0009686 | 3300048924 | Bacteria | 11033 |
| 899 | Ga0496121_0032256 | 3300048924 | Bacteria | 4766 |
| 900 | Ga0496121_0149771 | 3300048924 | Bacteria | 1718 |
| 901 | Ga0496122_0000042 | 3300048925 | Bacteria | 280482 |
| 902 | Ga0496122_0000053 | 3300048925 | Bacteria | 260120 |
| 903 | Ga0496122_0008527 | 3300048925 | Bacteria | 11027 |
| 904 | Ga0496122_0018036 | 3300048925 | Bacteria | 6546 |
| 905 | Ga0496122_0030136 | 3300048925 | Bacteria | 4555 |
| 906 | Ga0496123_0000030 | 3300048926 | Bacteria | 291764 |
| 907 | Ga0496123_0000038 | 3300048926 | Bacteria | 260120 |
| 908 | Ga0496123_0006991 | 3300048926 | Bacteria | 10763 |
| 909 | Ga0496123_0014925 | 3300048926 | Bacteria | 6404 |
| 910 | Ga0496123_0032380 | 3300048926 | Bacteria | 3787 |
| 911 | Ga0496123_0034916 | 3300048926 | Bacteria | 3593 |
| 912 | Ga0496123_0205788 | 3300048926 | Bacteria | 1004 |
| 913 | Ga0496124_0001932 | 3300048927 | Bacteria | 28393 |
| 914 | Ga0496124_0009594 | 3300048927 | Bacteria | 9924 |
| 915 | Ga0496124_0010356 | 3300048927 | Bacteria | 9451 |
| 916 | Ga0496124_0021455 | 3300048927 | Bacteria | 5950 |
| 917 | Ga0496124_0022392 | 3300048927 | Bacteria | 5793 |
| 918 | Ga0496124_0035547 | 3300048927 | Bacteria | 4357 |
| 919 | Ga0496124_0046484 | 3300048927 | Bacteria | 3716 |
| 920 | Ga0496124_0054364 | 3300048927 | Bacteria | 3389 |
| 921 | Ga0496124_0076409 | 3300048927 | Bacteria | 2764 |
| 922 | Ga0496124_0099570 | 3300048927 | Bacteria | 2357 |
| 923 | Ga0496124_0120441 | 3300048927 | Bacteria | 2098 |
| 924 | Ga0496124_0152582 | 3300048927 | Bacteria | 1810 |
| 925 | Ga0496124_0253426 | 3300048927 | Bacteria | 1300 |
| 926 | Ga0496125_0000170 | 3300048928 | Bacteria | 145369 |
| 927 | Ga0496125_0000611 | 3300048928 | Bacteria | 60631 |
| 928 | Ga0496125_0044183 | 3300048928 | Bacteria | 3771 |
| 929 | Ga0496125_0229273 | 3300048928 | Bacteria | 1189 |
| 930 | Ga0496125_0250537 | 3300048928 | Bacteria | 1117 |
| 931 | Ga0496126_0000640 | 3300048929 | Bacteria | 65206 |
| 932 | Ga0496126_0002372 | 3300048929 | Bacteria | 25676 |
| 933 | Ga0496126_0067226 | 3300048929 | Bacteria | 3202 |
| 934 | Ga0496126_0290682 | 3300048929 | Bacteria | 1351 |
| 935 | Ga0501309_019150 | 3300049129 | Bacteria | 950 |
| 936 | Ga0501304_001866 | 3300049160 | Bacteria | 1408 |
| 937 | Ga0501305_030646 | 3300049161 | Bacteria | 837 |
| 938 | Ga0501312_013804 | 3300049528 | Bacteria | 1128 |
| 939 | Ga0501314_002497 | 3300049530 | Bacteria | 1426 |
| 940 | Ga0501315_002817 | 3300049531 | Bacteria | 1681 |
| 941 | Ga0501317_005340 | 3300049533 | Bacteria | 1372 |
| 942 | Ga0501318_000524 | 3300049534 | Bacteria | 2500 |
| 943 | Ga0501318_005739 | 3300049534 | Bacteria | 1243 |
| 944 | Ga0501320_003313 | 3300049536 | Bacteria | 1358 |
| 945 | Ga0501321_001114 | 3300049537 | Bacteria | 2042 |
| 946 | Ga0501321_016663 | 3300049537 | Bacteria | 876 |
| 947 | Ga0501323_005732 | 3300049539 | Bacteria | 1370 |
| 948 | Ga0501340_003880 | 3300049556 | Bacteria | 923 |
| 949 | Ga0501031_0014277 | 3300049568 | Bacteria | 5166 |
| 950 | Ga0501031_0097270 | 3300049568 | Bacteria | 1921 |
| 951 | Ga0501031_0119662 | 3300049568 | Bacteria | 1720 |
| 952 | Ga0501032_0005338 | 3300049569 | Bacteria | 9563 |
| 953 | Ga0501032_0006157 | 3300049569 | Bacteria | 8829 |
| 954 | Ga0501032_0035359 | 3300049569 | Bacteria | 3416 |
| 955 | Ga0501032_0094584 | 3300049569 | Bacteria | 1981 |
| 956 | Ga0501032_0102286 | 3300049569 | Bacteria | 1898 |
| 957 | Ga0501032_0252081 | 3300049569 | Bacteria | 1146 |
| 958 | Ga0501033_0000318 | 3300049570 | Bacteria | 45707 |
| 959 | Ga0501033_0012344 | 3300049570 | Bacteria | 6520 |
| 960 | Ga0501033_0015989 | 3300049570 | Bacteria | 5684 |
| 961 | Ga0501033_0055013 | 3300049570 | Bacteria | 2942 |
| 962 | Ga0501033_0056189 | 3300049570 | Bacteria | 2910 |
| 963 | Ga0501033_0078764 | 3300049570 | Bacteria | 2418 |
| 964 | Ga0501033_0105754 | 3300049570 | Bacteria | 2051 |
| 965 | Ga0501033_0265589 | 3300049570 | Bacteria | 1214 |
| 966 | Ga0501033_0323046 | 3300049570 | Bacteria | 1084 |
| 967 | Ga0501034_0000016 | 3300049571 | Bacteria | 289751 |
| 968 | Ga0501034_0000076 | 3300049571 | Bacteria | 174683 |
| 969 | Ga0501034_0025717 | 3300049571 | Bacteria | 5995 |
| 970 | Ga0501034_0026667 | 3300049571 | Bacteria | 5880 |
| 971 | Ga0501034_0040959 | 3300049571 | Bacteria | 4687 |
| 972 | Ga0501034_0059256 | 3300049571 | Bacteria | 3846 |
| 973 | Ga0501034_0207206 | 3300049571 | Bacteria | 1917 |
| 974 | Ga0501034_0215982 | 3300049571 | Bacteria | 1871 |
| 975 | Ga0501034_0216044 | 3300049571 | Bacteria | 1871 |
| 976 | Ga0501034_0258522 | 3300049571 | Bacteria | 1684 |
| 977 | Ga0501034_0427048 | 3300049571 | Bacteria | 1245 |
| 978 | Ga0501034_0450970 | 3300049571 | Bacteria | 1204 |
| 979 | Ga0501034_0615653 | 3300049571 | Bacteria | 990 |
| 980 | Ga0501034_0734672 | 3300049571 | Bacteria | 883 |
| 981 | Ga0501034_0795656 | 3300049571 | Bacteria | 838 |
| 982 | Ga0501036_0140654 | 3300049572 | Bacteria | 2037 |
| 983 | Ga0501036_0654182 | 3300049572 | Bacteria | 870 |
| 984 | Ga0501037_0000136 | 3300049573 | Bacteria | 68536 |
| 985 | Ga0501037_0001333 | 3300049573 | Bacteria | 18111 |
| 986 | Ga0501037_0091212 | 3300049573 | Bacteria | 2203 |
| 987 | Ga0501037_0107536 | 3300049573 | Bacteria | 2010 |
| 988 | Ga0501037_0180281 | 3300049573 | Bacteria | 1499 |
| 989 | Ga0501037_0223331 | 3300049573 | Bacteria | 1324 |
| 990 | Ga0501037_0384396 | 3300049573 | Bacteria | 964 |
| 991 | Ga0501038_0073537 | 3300049574 | Bacteria | 2894 |
| 992 | Ga0501038_0093115 | 3300049574 | Bacteria | 2522 |
| 993 | Ga0501038_0150328 | 3300049574 | Bacteria | 1899 |
| 994 | Ga0501038_0195184 | 3300049574 | Bacteria | 1627 |
| 995 | Ga0501038_0210752 | 3300049574 | Bacteria | 1554 |
| 996 | Ga0501038_0212880 | 3300049574 | Bacteria | 1545 |
| 997 | Ga0501038_0331652 | 3300049574 | Bacteria | 1188 |
| 998 | Ga0501039_0001974 | 3300049575 | Bacteria | 15213 |
| 999 | Ga0501039_0050313 | 3300049575 | Bacteria | 3223 |
| 1000 | Ga0501039_0337716 | 3300049575 | Bacteria | 1184 |
| 1001 | Ga0501043_0000006 | 3300049579 | Bacteria | 234413 |
| 1002 | Ga0501043_0009632 | 3300049579 | Bacteria | 7572 |
| 1003 | Ga0501043_0027393 | 3300049579 | Bacteria | 4474 |
| 1004 | Ga0501043_0045511 | 3300049579 | Bacteria | 3452 |
| 1005 | Ga0501043_0083456 | 3300049579 | Bacteria | 2512 |
| 1006 | Ga0501043_0107807 | 3300049579 | Bacteria | 2188 |
| 1007 | Ga0501043_0132071 | 3300049579 | Bacteria | 1956 |
| 1008 | Ga0501043_0337247 | 3300049579 | Bacteria | 1147 |
| 1009 | Ga0501043_0346549 | 3300049579 | Bacteria | 1129 |
| 1010 | Ga0501046_0000060 | 3300049580 | Bacteria | 125548 |
| 1011 | Ga0501046_0011131 | 3300049580 | Bacteria | 7705 |
| 1012 | Ga0501046_0045243 | 3300049580 | Bacteria | 3498 |
| 1013 | Ga0501046_0110512 | 3300049580 | Bacteria | 2100 |
| 1014 | Ga0501046_0115621 | 3300049580 | Bacteria | 2045 |
| 1015 | Ga0501047_0000130 | 3300049581 | Bacteria | 91144 |
| 1016 | Ga0501047_0005754 | 3300049581 | Bacteria | 11671 |
| 1017 | Ga0501047_0023767 | 3300049581 | Bacteria | 5884 |
| 1018 | Ga0501047_0047434 | 3300049581 | Bacteria | 4150 |
| 1019 | Ga0501047_0066121 | 3300049581 | Bacteria | 3485 |
| 1020 | Ga0501047_0078348 | 3300049581 | Bacteria | 3178 |
| 1021 | Ga0501047_0139393 | 3300049581 | Bacteria | 2304 |
| 1022 | Ga0501047_0159167 | 3300049581 | Bacteria | 2130 |
| 1023 | Ga0501047_0176911 | 3300049581 | Bacteria | 2001 |
| 1024 | Ga0501047_0314545 | 3300049581 | Bacteria | 1406 |
| 1025 | Ga0501047_0577825 | 3300049581 | Bacteria | 947 |
| 1026 | Ga0501047_0768892 | 3300049581 | Bacteria | 779 |
| 1027 | Ga0501048_0088984 | 3300049582 | Bacteria | 2178 |
| 1028 | Ga0501048_0314151 | 3300049582 | Bacteria | 1116 |
| 1029 | Ga0501067_0001850 | 3300049583 | Bacteria | 11641 |
| 1030 | Ga0501067_0001904 | 3300049583 | Bacteria | 11473 |
| 1031 | Ga0501067_0011547 | 3300049583 | Bacteria | 4895 |
| 1032 | Ga0501067_0089570 | 3300049583 | Bacteria | 1707 |
| 1033 | Ga0501068_0183464 | 3300049584 | Bacteria | 1324 |
| 1034 | Ga0501068_0194072 | 3300049584 | Bacteria | 1287 |
| 1035 | Ga0501069_0000024 | 3300049585 | Bacteria | 117140 |
| 1036 | Ga0501069_0058776 | 3300049585 | Bacteria | 2145 |
| 1037 | Ga0501069_0065714 | 3300049585 | Bacteria | 2028 |
| 1038 | Ga0501069_0265020 | 3300049585 | Bacteria | 1003 |
| 1039 | Ga0501070_0000093 | 3300049586 | Bacteria | 76623 |
| 1040 | Ga0501070_0001628 | 3300049586 | Bacteria | 19920 |
| 1041 | Ga0501070_0028127 | 3300049586 | Bacteria | 4714 |
| 1042 | Ga0501070_0048150 | 3300049586 | Bacteria | 3541 |
| 1043 | Ga0501070_0063370 | 3300049586 | Bacteria | 3062 |
| 1044 | Ga0501070_0104466 | 3300049586 | Bacteria | 2342 |
| 1045 | Ga0501070_0137356 | 3300049586 | Bacteria | 2018 |
| 1046 | Ga0501071_0019991 | 3300049587 | Bacteria | 4651 |
| 1047 | Ga0501071_0134088 | 3300049587 | Bacteria | 1842 |
| 1048 | Ga0501072_0344501 | 3300049588 | Bacteria | 1183 |
| 1049 | Ga0501073_0001043 | 3300049589 | Bacteria | 20024 |
| 1050 | Ga0501073_0006499 | 3300049589 | Bacteria | 8696 |
| 1051 | Ga0501073_0031644 | 3300049589 | Bacteria | 3775 |
| 1052 | Ga0501073_0048885 | 3300049589 | Bacteria | 2967 |
| 1053 | Ga0501073_0132018 | 3300049589 | Bacteria | 1731 |
| 1054 | Ga0501073_0215651 | 3300049589 | Bacteria | 1326 |
| 1055 | Ga0501073_0286184 | 3300049589 | Bacteria | 1137 |
| 1056 | Ga0501074_0000011 | 3300049590 | Bacteria | 93181 |
| 1057 | Ga0501074_0067201 | 3300049590 | Bacteria | 2578 |
| 1058 | Ga0501074_0218449 | 3300049590 | Bacteria | 1357 |
| 1059 | Ga0501075_0585000 | 3300049591 | Bacteria | 852 |
| 1060 | Ga0501076_0095588 | 3300049592 | Bacteria | 2393 |
| 1061 | Ga0501076_0327444 | 3300049592 | Bacteria | 1257 |
| 1062 | Ga0501233_022834 | 3300049668 | Bacteria | 1355 |
| 1063 | Ga0501249_014808 | 3300049679 | Bacteria | 1664 |
| 1064 | Ga0501079_0203850 | 3300049741 | Bacteria | 1545 |
| 1065 | Ga0501080_0000004 | 3300049742 | Bacteria | 180905 |
| 1066 | Ga0501080_0001346 | 3300049742 | Bacteria | 20520 |
| 1067 | Ga0501080_0014444 | 3300049742 | Bacteria | 7274 |
| 1068 | Ga0501080_0015694 | 3300049742 | Bacteria | 6983 |
| 1069 | Ga0501080_0165199 | 3300049742 | Bacteria | 2043 |
| 1070 | Ga0501080_0270799 | 3300049742 | Bacteria | 1546 |
| 1071 | Ga0501080_0609410 | 3300049742 | Bacteria | 969 |
| 1072 | Ga0501083_0000097 | 3300049744 | Bacteria | 59474 |
| 1073 | Ga0501083_0006732 | 3300049744 | Bacteria | 8154 |
| 1074 | Ga0501083_0036629 | 3300049744 | Bacteria | 3345 |
| 1075 | Ga0501083_0068497 | 3300049744 | Bacteria | 2361 |
| 1076 | Ga0501083_0075083 | 3300049744 | Bacteria | 2245 |
| 1077 | Ga0501083_0114881 | 3300049744 | Bacteria | 1768 |
| 1078 | Ga0501083_0377277 | 3300049744 | Bacteria | 922 |
| 1079 | Ga0501280_004583 | 3300049776 | Bacteria | 2020 |
| 1080 | Ga0501035_0000068 | 3300049822 | Bacteria | 128392 |
| 1081 | Ga0501035_0000191 | 3300049822 | Bacteria | 75056 |
| 1082 | Ga0501035_0005628 | 3300049822 | Bacteria | 11834 |
| 1083 | Ga0501035_0015558 | 3300049822 | Bacteria | 7018 |
| 1084 | Ga0501035_0024244 | 3300049822 | Bacteria | 5564 |
| 1085 | Ga0501035_0037531 | 3300049822 | Bacteria | 4387 |
| 1086 | Ga0501035_0050175 | 3300049822 | Bacteria | 3740 |
| 1087 | Ga0501035_0150104 | 3300049822 | Bacteria | 2023 |
| 1088 | Ga0501035_0167838 | 3300049822 | Bacteria | 1897 |
| 1089 | Ga0501035_0215972 | 3300049822 | Bacteria | 1639 |
| 1090 | Ga0501035_0238499 | 3300049822 | Bacteria | 1547 |
| 1091 | Ga0501035_0251803 | 3300049822 | Bacteria | 1499 |
| 1092 | Ga0501035_0272035 | 3300049822 | Bacteria | 1433 |
| 1093 | Ga0501035_0433632 | 3300049822 | Bacteria | 1089 |
| 1094 | Ga0501044_0000096 | 3300049823 | Bacteria | 109532 |
| 1095 | Ga0501044_0000227 | 3300049823 | Bacteria | 70875 |
| 1096 | Ga0501044_0015336 | 3300049823 | Bacteria | 8254 |
| 1097 | Ga0501044_0034145 | 3300049823 | Bacteria | 5338 |
| 1098 | Ga0501044_0091334 | 3300049823 | Bacteria | 3071 |
| 1099 | Ga0501044_0095974 | 3300049823 | Bacteria | 2987 |
| 1100 | Ga0501044_0216393 | 3300049823 | Bacteria | 1868 |
| 1101 | Ga0501044_0223969 | 3300049823 | Bacteria | 1830 |
| 1102 | Ga0501044_0278545 | 3300049823 | Bacteria | 1607 |
| 1103 | Ga0501044_0492252 | 3300049823 | Bacteria | 1128 |
| 1104 | Ga0501045_0111485 | 3300049824 | Bacteria | 2028 |
| 1105 | nmdc:mga03683_23695_c1 | 3300050489 | Bacteria | 2394 |
| 1106 | nmdc:mga03683_4150_c1 | 3300050489 | Bacteria | 4766 |
| 1107 | nmdc:mga03n38_985_c1 | 3300050490 | Bacteria | 7777 |
| 1108 | nmdc:mga00v17_13099_c1 | 3300050491 | Bacteria | 4595 |
| 1109 | nmdc:mga00v17_1452_c1 | 3300050491 | Bacteria | 12404 |
| 1110 | nmdc:mga00v17_30044_c1 | 3300050491 | Bacteria | 3194 |
| 1111 | nmdc:mga00v17_3294_c1 | 3300050491 | Bacteria | 8327 |
| 1112 | nmdc:mga00v17_346_c2 | 3300050491 | Bacteria | 15851 |
| 1113 | nmdc:mga00v17_34837_c1 | 3300050491 | Bacteria | 2993 |
| 1114 | nmdc:mga00v17_5491_c1 | 3300050491 | Bacteria | 6680 |
| 1115 | nmdc:mga00v17_55_c1 | 3300050491 | Bacteria | 72029 |
| 1116 | nmdc:mga0yw44_10019_c1 | 3300050492 | Bacteria | 2331 |
| 1117 | nmdc:mga0yw44_113102_c1 | 3300050492 | Bacteria | 1741 |
| 1118 | nmdc:mga0yw44_13785_c1 | 3300050492 | Bacteria | 4270 |
| 1119 | nmdc:mga0yw44_18133_c1 | 3300050492 | Bacteria | 3849 |
| 1120 | nmdc:mga0yw44_18651_c1 | 3300050492 | Bacteria | 3806 |
| 1121 | nmdc:mga0yw44_221381_c1 | 3300050492 | Bacteria | 1254 |
| 1122 | nmdc:mga0yw44_42753_c1 | 3300050492 | Bacteria | 2703 |
| 1123 | nmdc:mga0yw44_55885_c1 | 3300050492 | Bacteria | 2403 |
| 1124 | nmdc:mga0yw44_57531_c1 | 3300050492 | Bacteria | 2372 |
| 1125 | nmdc:mga0k408_2026_c1 | 3300050493 | Bacteria | 10850 |
| 1126 | nmdc:mga0k408_22262_c1 | 3300050493 | Bacteria | 3568 |
| 1127 | nmdc:mga06z11_168428_c1 | 3300050494 | Bacteria | 1256 |
| 1128 | nmdc:mga06z11_42828_c1 | 3300050494 | Bacteria | 2273 |
| 1129 | nmdc:mga06z11_6363_c1 | 3300050494 | Bacteria | 4798 |
| 1130 | nmdc:mga04h51_19483_c1 | 3300050495 | Bacteria | 2013 |
| 1131 | nmdc:mga04h51_24571_c1 | 3300050495 | Bacteria | 1847 |
| 1132 | nmdc:mga07m45_19471_c1 | 3300050496 | Bacteria | 3678 |
| 1133 | nmdc:mga07m45_48666_c1 | 3300050496 | Bacteria | 2385 |
| 1134 | nmdc:mga05p37_13210_c1 | 3300050507 | Bacteria | 9885 |
| 1135 | nmdc:mga09592_299655_c1 | 3300050508 | Bacteria | 1394 |
| 1136 | nmdc:mga0qj67_140319_c1 | 3300050509 | Bacteria | 1959 |
| 1137 | nmdc:mga06r32_141587_c1 | 3300050510 | Bacteria | 2381 |
| 1138 | nmdc:mga06r32_145692_c1 | 3300050510 | Bacteria | 2346 |
| 1139 | nmdc:mga06r32_254070_c1 | 3300050510 | Bacteria | 1745 |
| 1140 | nmdc:mga08y16_19492_c1 | 3300050511 | Bacteria | 7151 |
| 1141 | nmdc:mga0n895_235902_c1 | 3300050512 | Bacteria | 1856 |
| 1142 | nmdc:mga0n895_235970_c1 | 3300050512 | Bacteria | 1856 |
| 1143 | nmdc:mga0rr50_201022_c1 | 3300050513 | Bacteria | 1637 |
| 1144 | nmdc:mga08x19_24076_c1 | 3300050514 | Bacteria | 3781 |
| 1145 | nmdc:mga0a205_670708_c1 | 3300050515 | Bacteria | 887 |
| 1146 | nmdc:mga0a205_69791_c1 | 3300050515 | Bacteria | 3393 |
| 1147 | nmdc:mga0sz30_32_c1 | 3300050516 | Bacteria | 54057 |
| 1148 | Ga0495612_0077729 | 3300053078 | Bacteria | 1391 |
| 1149 | Ga0495595_0114375 | 3300053084 | Bacteria | 1311 |
| 1150 | Ga0495619_0006691 | 3300053085 | Bacteria | 7292 |
| 1151 | Ga0495619_0124989 | 3300053085 | Bacteria | 1765 |
| 1152 | Ga0495619_0218437 | 3300053085 | Bacteria | 1320 |
| 1153 | Ga0500578_0031483 | 3300053086 | Bacteria | 3408 |
| 1154 | Ga0500641_0000724 | 3300053096 | Bacteria | 11934 |
| 1155 | Ga0500555_043140 | 3300053103 | Bacteria | 1251 |
| 1156 | Ga0500556_0000245 | 3300053104 | Bacteria | 44002 |
| 1157 | Ga0500569_015440 | 3300053109 | Bacteria | 1912 |
| 1158 | Ga0500593_000184 | 3300053117 | Bacteria | 25269 |
| 1159 | Ga0500595_050259 | 3300053119 | Bacteria | 1295 |
| 1160 | Ga0500618_000337 | 3300053125 | Bacteria | 33703 |
| 1161 | Ga0500658_0000832 | 3300053134 | Bacteria | 12692 |
| 1162 | Ga0500561_0001332 | 3300053137 | Bacteria | 4016 |
| 1163 | Ga0500568_0000004 | 3300053139 | Bacteria | 621666 |
| 1164 | Ga0500568_0000066 | 3300053139 | Bacteria | 104826 |
| 1165 | Ga0500568_0002568 | 3300053139 | Bacteria | 10581 |
| 1166 | Ga0500590_000975 | 3300053148 | Bacteria | 11070 |
| 1167 | Ga0500616_0000677 | 3300053153 | Bacteria | 39945 |
| 1168 | Ga0500616_0002705 | 3300053153 | Bacteria | 14398 |
| 1169 | Ga0500616_0010398 | 3300053153 | Bacteria | 5571 |
| 1170 | Ga0500616_0056498 | 3300053153 | Bacteria | 2049 |
| 1171 | Ga0501084_0047108 | 3300054114 | Bacteria | 3611 |
| 1172 | Ga0587066_009767 | 3300059490 | Bacteria | 1367 |
| 1173 | Ga0587077_007087 | 3300059493 | Bacteria | 1618 |
| 1174 | Ga0587077_011570 | 3300059493 | Bacteria | 1391 |
| 1175 | Ga0587077_039791 | 3300059493 | Bacteria | 938 |
| 1176 | Ga0587080_011972 | 3300059503 | Bacteria | 1305 |
| 1177 | Ga0587085_025967 | 3300059506 | Bacteria | 930 |
| 1178 | Ga0587086_003962 | 3300059507 | Bacteria | 1523 |
| 1179 | Ga0587088_009540 | 3300059508 | Bacteria | 1399 |
| 1180 | Ga0587088_055478 | 3300059508 | Bacteria | 788 |
| 1181 | Ga0587089_004516 | 3300059509 | Bacteria | 1537 |
| 1182 | Ga0587090_003549 | 3300059510 | Bacteria | 1822 |
| 1183 | Ga0587090_017559 | 3300059510 | Bacteria | 1083 |
| 1184 | Ga0587094_025508 | 3300059513 | Bacteria | 886 |
| 1185 | Ga0587106_005895 | 3300059605 | Bacteria | 1422 |
| 1186 | Ga0587125_002729 | 3300059607 | Bacteria | 1444 |
| 1187 | Ga0587131_000391 | 3300059609 | Bacteria | 1722 |
| 1188 | Ga0587101_006661 | 3300059623 | Bacteria | 1335 |
| 1189 | Ga0587101_026602 | 3300059623 | Bacteria | 874 |
| 1190 | Ga0587115_006083 | 3300059626 | Bacteria | 1380 |
| 1191 | Ga0587128_003881 | 3300059630 | Bacteria | 1698 |
| 1192 | Ga0587062_002913 | 3300059639 | Bacteria | 1680 |
| 1193 | Ga0587062_021918 | 3300059639 | Bacteria | 913 |
| 1194 | Ga0587067_034787 | 3300059640 | Bacteria | 950 |
| 1195 | Ga0587068_005894 | 3300059641 | Bacteria | 1693 |
| 1196 | Ga0587072_002513 | 3300059643 | Bacteria | 2461 |
| 1197 | Ga0587072_004020 | 3300059643 | Bacteria | 2106 |
| 1198 | Ga0587072_011351 | 3300059643 | Bacteria | 1456 |
| 1199 | Ga0587079_039765 | 3300059647 | Bacteria | 945 |
| 1200 | Ga0587124_001124 | 3300059660 | Bacteria | 1670 |
| 1201 | Ga0501082_0058170 | 3300060353 | Bacteria | 3330 |
| 1202 | Ga0501082_0090625 | 3300060353 | Bacteria | 2640 |
| 1203 | Ga0501082_0121513 | 3300060353 | Bacteria | 2264 |
| 1204 | Ga0501082_0272645 | 3300060353 | Bacteria | 1473 |
| 1205 | Ga0466962_0010536 | 3300061719 | Bacteria | 4448 |
| 1206 | Ga0466962_0071935 | 3300061719 | Bacteria | 1652 |
| 1207 | Ga0466962_0104240 | 3300061719 | Bacteria | 1363 |
| 1208 | Ga0530510_0083423 | 3300061734 | Bacteria | 2327 |
| 1209 | 2509109744 | 2508501122 | Bacteria | 6292184 |
| 1210 | 2509379278 | 2509276019 | Bacteria | 6802256 |
| 1211 | 2509447786 | 2509276033 | Bacteria | 7180565 |
| 1212 | 2510134698 | 2510065019 | Bacteria | 6903379 |
| 1213 | 2510307322 | 2510065057 | Bacteria | 6649661 |
| 1214 | 2510842495 | 2510461069 | Bacteria | 5505000 |
| 1215 | 2510896049 | 2510461076 | Bacteria | 8618824 |
| 1216 | 2511136686 | 2510917022 | Bacteria | 6504556 |
| 1217 | 2511171482 | 2510917026 | Bacteria | 7046020 |
| 1218 | 2511187187 | 2510917028 | Bacteria | 6185411 |
| 1219 | 2511200458 | 2510917030 | Bacteria | 7460662 |
| 1220 | 2511392381 | 2511231027 | Bacteria | 5013807 |
| 1221 | 2511502896 | 2511231052 | Bacteria | 6974333 |
| 1222 | 2512534138 | 2512047086 | Bacteria | 6850303 |
| 1223 | 2512974027 | 2512875026 | Bacteria | 6861065 |
| 1224 | 2513573250 | 2513237084 | Bacteria | 7231967 |
| 1225 | 2513578499 | 2513237085 | Bacteria | 7695351 |
| 1226 | 2513584116 | 2513237086 | Bacteria | 7265287 |
| 1227 | 2513599087 | 2513237088 | Bacteria | 6927906 |
| 1228 | 2513602256 | 2513237089 | Bacteria | 6553624 |
| 1229 | 2513616988 | 2513237091 | Bacteria | 6900273 |
| 1230 | 2513631463 | 2513237093 | Bacteria | 7545552 |
| 1231 | 2513710604 | 2513237103 | Bacteria | 7647401 |
| 1232 | 2513867574 | 2513237138 | Bacteria | 7368160 |
| 1233 | 2513882001 | 2513237140 | Bacteria | 7076289 |
| 1234 | 2513905533 | 2513237143 | Bacteria | 6664116 |
| 1235 | 2513985486 | 2513237156 | Bacteria | 6402557 |
| 1236 | 2514003899 | 2513237160 | Bacteria | 6650282 |
| 1237 | 2514023413 | 2513237162 | Bacteria | 7468464 |
| 1238 | 2515113789 | 2515075009 | Bacteria | 7288508 |
| 1239 | 2515610446 | 2515154107 | Bacteria | 6795637 |
| 1240 | 2515634653 | 2515154113 | Bacteria | 7807172 |
| 1241 | 2515645303 | 2515154114 | Bacteria | 7848616 |
| 1242 | 2515660891 | 2515154116 | Bacteria | 7552979 |
| 1243 | 2515743511 | 2515154134 | Bacteria | 7220242 |
| 1244 | 2516205136 | 2516143018 | Bacteria | 6951533 |
| 1245 | 2516894302 | 2516653046 | Bacteria | 6989037 |
| 1246 | 2517037400 | 2516653077 | Bacteria | 7555578 |
| 1247 | 2517077700 | 2516653085 | Bacteria | 7346596 |
| 1248 | 2517096499 | 2517093000 | Bacteria | 7412387 |
| 1249 | 2517410596 | 2517287029 | Bacteria | 6905599 |
| 1250 | 2517570909 | 2517487022 | Bacteria | 7227575 |
| 1251 | 2523469464 | 2523231067 | Bacteria | 5230452 |
| 1252 | 2524451769 | 2524023207 | Bacteria | 6813453 |
| 1253 | 2524462068 | 2524023209 | Bacteria | 6679728 |
| 1254 | 2530646816 | 2529292951 | Bacteria | 6916614 |
| 1255 | 2535485788 | 2534681786 | Bacteria | 3308809 |
| 1256 | 2535519577 | 2534681796 | Bacteria | 7146037 |
| 1257 | 2537876439 | 2537561587 | Bacteria | 5425293 |
| 1258 | 2551674721 | 2551306084 | Bacteria | 8942552 |
| 1259 | 2551685469 | 2551306085 | Bacteria | 7347181 |
| 1260 | 2551693876 | 2551306086 | Bacteria | 6843938 |
| 1261 | 2551698535 | 2551306087 | Bacteria | 7351905 |
| 1262 | 2551713413 | 2551306089 | Bacteria | 7162724 |
| 1263 | 2551717355 | 2551306090 | Bacteria | 7953713 |
| 1264 | 2551730383 | 2551306091 | Bacteria | 7086830 |
| 1265 | 2551736235 | 2551306092 | Bacteria | 6992595 |
| 1266 | 2551741347 | 2551306093 | Bacteria | 7064773 |
| 1267 | 2554245230 | 2554235003 | Bacteria | 5877155 |
| 1268 | 2555229954 | 2554235227 | Bacteria | 3637389 |
| 1269 | 2558860318 | 2558860100 | Bacteria | 8458965 |
| 1270 | 2559296940 | 2558860242 | Bacteria | 5568029 |
| 1271 | 2561468095 | 2558860983 | Bacteria | 4133860 |
| 1272 | 2585167913 | 2582581283 | Bacteria | 6030556 |
| 1273 | 2585204877 | 2582581294 | Bacteria | 6626667 |
| 1274 | 2585224936 | 2582581298 | Bacteria | 7315509 |
| 1275 | 2585227649 | 2582581299 | Bacteria | 6518058 |
| 1276 | 2585257664 | 2582581304 | Bacteria | 5831370 |
| 1277 | 2585265473 | 2582581306 | Bacteria | 6450535 |
| 1278 | 2585274157 | 2582581307 | Bacteria | 6597605 |
| 1279 | 2585280430 | 2582581308 | Bacteria | 7413247 |
| 1280 | 2585322703 | 2582581315 | Bacteria | 7318924 |
| 1281 | 2585330820 | 2582581316 | Bacteria | 7774528 |
| 1282 | 2585388426 | 2582581865 | Bacteria | 6644329 |
| 1283 | 2585403379 | 2582581867 | Bacteria | 7184437 |
| 1284 | 2585529610 | 2585427526 | Bacteria | 7258840 |
| 1285 | 2585532658 | 2585427527 | Bacteria | 7273426 |
| 1286 | 2585541156 | 2585427528 | Bacteria | 6842387 |
| 1287 | 2585547492 | 2585427529 | Bacteria | 7395659 |
| 1288 | 2585554326 | 2585427530 | Bacteria | 7383882 |
| 1289 | 2585560606 | 2585427531 | Bacteria | 6992870 |
| 1290 | 2585823675 | 2585427590 | Bacteria | 6824633 |
| 1291 | 2585839919 | 2585427593 | Bacteria | 7141551 |
| 1292 | 2585845182 | 2585427594 | Bacteria | 6180594 |
| 1293 | 2585898817 | 2585427608 | Bacteria | 6544331 |
| 1294 | 2585903596 | 2585427609 | Bacteria | 6667127 |
| 1295 | 2585997029 | 2585427633 | Bacteria | 6413184 |
| 1296 | 2586001630 | 2585427634 | Bacteria | 6455027 |
| 1297 | 2587981284 | 2585428125 | Bacteria | 6662905 |
| 1298 | 2599334827 | 2599185156 | Bacteria | 5403036 |
| 1299 | 2599420683 | 2599185170 | Bacteria | 7295545 |
| 1300 | 2599604630 | 2599185210 | Bacteria | 5624189 |
| 1301 | 2599722496 | 2599185236 | Bacteria | 6875203 |
| 1302 | 2600373762 | 2600254933 | Bacteria | 4750527 |
| 1303 | 2601611213 | 2600255279 | Bacteria | 5605316 |
| 1304 | 2601747986 | 2600255308 | Bacteria | 5611129 |
| 1305 | 2616295420 | 2615840624 | Bacteria | 6557588 |
| 1306 | 2616307271 | 2615840626 | Bacteria | 7921970 |
| 1307 | 2616554814 | 2615840698 | Bacteria | 7319877 |
| 1308 | 2643752063 | 2643221546 | Bacteria | 2910897 |
| 1309 | 2643771423 | 2643221550 | Bacteria | 4619371 |
| 1310 | 2643813151 | 2643221558 | Bacteria | 5460675 |
| 1311 | 2643836882 | 2643221564 | Bacteria | 4193379 |
| 1312 | 2643858255 | 2643221568 | Bacteria | 5187270 |
| 1313 | 2643916954 | 2643221582 | Bacteria | 5804683 |
| 1314 | 2644006264 | 2643221599 | Bacteria | 6292121 |
| 1315 | 2644050975 | 2643221607 | Bacteria | 6314006 |
| 1316 | 2644108590 | 2643221618 | Bacteria | 7717186 |
| 1317 | 2644145636 | 2643221626 | Bacteria | 8069654 |
| 1318 | 2644191533 | 2643221634 | Bacteria | 6705461 |
| 1319 | 2644205478 | 2643221636 | Bacteria | 6583769 |
| 1320 | 2644209959 | 2643221637 | Bacteria | 5345260 |
| 1321 | 2644241715 | 2643221643 | Bacteria | 5749658 |
| 1322 | 2644299143 | 2643221653 | Bacteria | 4569637 |
| 1323 | 2644312287 | 2643221655 | Bacteria | 7722067 |
| 1324 | 2644335916 | 2643221659 | Bacteria | 7890716 |
| 1325 | 2644483879 | 2643221686 | Bacteria | 6310811 |
| 1326 | 2644496275 | 2643221688 | Bacteria | 5260751 |
| 1327 | 2644500312 | 2643221689 | Bacteria | 6042950 |
| 1328 | 2644521182 | 2643221693 | Bacteria | 5513853 |
| 1329 | 2644546773 | 2643221698 | Bacteria | 7756764 |
| 1330 | 2644617970 | 2643221712 | Bacteria | 7729434 |
| 1331 | 2644653510 | 2643221718 | Bacteria | 5345506 |
| 1332 | 2644657371 | 2643221719 | Bacteria | 4568197 |
| 1333 | 2655032658 | 2654587600 | Bacteria | 3911798 |
| 1334 | 2657684076 | 2657244999 | Bacteria | 5946535 |
| 1335 | 2671112068 | 2667528174 | Bacteria | 6435400 |
| 1336 | 2671691851 | 2671180139 | Bacteria | 4196045 |
| 1337 | 2692314613 | 2690316117 | Bacteria | 6800650 |
| 1338 | 2719182468 | 2718217882 | Bacteria | 6556348 |
| 1339 | 2719387127 | 2718217927 | Bacteria | 6972593 |
| 1340 | 2719733187 | 2718218009 | Bacteria | 6478651 |
| 1341 | 2720493191 | 2718218199 | Bacteria | 6740745 |
| 1342 | 2720614668 | 2718218232 | Bacteria | 6720332 |
| 1343 | 2720621441 | 2718218233 | Bacteria | 6662049 |
| 1344 | 2720632769 | 2718218235 | Bacteria | 6630699 |
| 1345 | 2720776493 | 2718218269 | Bacteria | 6906114 |
| 1346 | 2721148581 | 2718218363 | Bacteria | 6524337 |
| 1347 | 2721159967 | 2718218365 | Bacteria | 6274507 |
| 1348 | 2721165395 | 2718218366 | Bacteria | 6425255 |
| 1349 | 2721400762 | 2718218423 | Bacteria | 6438183 |
| 1350 | 2722841565 | 2721755514 | Bacteria | 6424414 |
| 1351 | 2723028081 | 2721755556 | Bacteria | 6745503 |
| 1352 | 2723561712 | 2721755684 | Bacteria | 6859907 |
| 1353 | 2723568341 | 2721755685 | Bacteria | 6704835 |
| 1354 | 2724039575 | 2721755809 | Bacteria | 6438790 |
| 1355 | 2724045943 | 2721755810 | Bacteria | 6479005 |
| 1356 | 2724091100 | 2721755819 | Bacteria | 6906405 |
| 1357 | 2724105606 | 2721755822 | Bacteria | 6726041 |
| 1358 | 2724111433 | 2721755823 | Bacteria | 6752556 |
| 1359 | 2725947685 | 2724679232 | Bacteria | 7646494 |
| 1360 | 2730109017 | 2728369352 | Bacteria | 6745171 |
| 1361 | 2730165703 | 2728369365 | Bacteria | 6555560 |
| 1362 | 2730299599 | 2728369397 | Bacteria | 6274511 |
| 1363 | 2738800600 | 2738541293 | Bacteria | 7065685 |
| 1364 | 2738944407 | 2738541317 | Bacteria | 5340176 |
| 1365 | 2739035708 | 2738541333 | Bacteria | 7106503 |
| 1366 | 2739351717 | 2738543031 | Bacteria | 5769731 |
| 1367 | 2753360177 | 2751185800 | Bacteria | 5467370 |
| 1368 | 2753458711 | 2751185821 | Bacteria | 6189929 |
| 1369 | 2757570491 | 2757320392 | Bacteria | 3737298 |
| 1370 | 2758642500 | 2758568016 | Bacteria | 5645291 |
| 1371 | 2765467283 | 2765235802 | Bacteria | 5618596 |
| 1372 | 2766065469 | 2765235942 | Bacteria | 7445910 |
| 1373 | 2770198098 | 2767802442 | Bacteria | 5747986 |
| 1374 | 2776269947 | 2775506902 | Bacteria | 6208009 |
| 1375 | 2776281064 | 2775506904 | Bacteria | 5954060 |
| 1376 | 2776914462 | 2775507049 | Bacteria | 6284736 |
| 1377 | 2778175888 | 2775507266 | Bacteria | 7392367 |
| 1378 | 2792582639 | 2791355082 | Bacteria | 5973319 |
| 1379 | 2792622899 | 2791355091 | Bacteria | 6135441 |
| 1380 | 2792629153 | 2791355092 | Bacteria | 6248105 |
| 1381 | 2792640494 | 2791355094 | Bacteria | 7011481 |
| 1382 | 2793281714 | 2791355253 | Bacteria | 5171699 |
| 1383 | 2793293780 | 2791355256 | Bacteria | 6798008 |
| 1384 | 2793313196 | 2791355259 | Bacteria | 7254731 |
| 1385 | 2793319857 | 2791355260 | Bacteria | 6598818 |
| 1386 | 2793328139 | 2791355261 | Bacteria | 6661293 |
| 1387 | 2793333235 | 2791355262 | Bacteria | 6774204 |
| 1388 | 2793343818 | 2791355263 | Bacteria | 6872478 |
| 1389 | 2793347238 | 2791355264 | Bacteria | 6429314 |
| 1390 | 2793356625 | 2791355265 | Bacteria | 6539969 |
| 1391 | 2793362916 | 2791355266 | Bacteria | 7116587 |
| 1392 | 2793370058 | 2791355267 | Bacteria | 7222458 |
| 1393 | 2802718001 | 2802428858 | Bacteria | 6636079 |
| 1394 | 2802725148 | 2802428859 | Bacteria | 6667919 |
| 1395 | 2802730728 | 2802428860 | Bacteria | 6525526 |
| 1396 | 2802738075 | 2802428861 | Bacteria | 6534206 |
| 1397 | 2802744055 | 2802428862 | Bacteria | 6633353 |
| 1398 | 2802750934 | 2802428863 | Bacteria | 6410669 |
| 1399 | 2804753235 | 2802429268 | Bacteria | 6094027 |
| 1400 | 2805930706 | 2802429605 | Bacteria | 6875453 |
| 1401 | 2805934179 | 2802429606 | Bacteria | 6346811 |
| 1402 | 2806044695 | 2802429633 | Bacteria | 7341974 |
| 1403 | 2806052895 | 2802429634 | Bacteria | 7083200 |
| 1404 | 2806059195 | 2802429635 | Bacteria | 7650140 |
| 1405 | 2806068142 | 2802429636 | Bacteria | 7597525 |
| 1406 | 2806074262 | 2802429637 | Bacteria | 7067217 |
| 1407 | 2808891465 | 2808606370 | Bacteria | 4942454 |
| 1408 | 2808987456 | 2808606387 | Bacteria | 5697198 |
| 1409 | 2819243714 | 2818991272 | Bacteria | 4622173 |
| 1410 | 2819557226 | 2818991439 | Bacteria | 6907412 |
| 1411 | 2819609728 | 2818991448 | Bacteria | 6772224 |
| 1412 | 2819639827 | 2818991453 | Bacteria | 7181617 |
| 1413 | 2819685550 | 2818991461 | Bacteria | 7026071 |
| 1414 | 2821126037 | 2821123053 | Bacteria | 7836056 |
| 1415 | 2833710890 | 2833709550 | Bacteria | 4008291 |
| 1416 | 2837679087 | 2837678835 | Bacteria | 5252418 |
| 1417 | 2838018968 | 2838016132 | Bacteria | 6577831 |
| 1418 | 2838024432 | 2838022645 | Bacteria | 6494267 |
| 1419 | 2838033007 | 2838029111 | Bacteria | 6603031 |
| 1420 | 2838046389 | 2838042994 | Bacteria | 6046894 |
| 1421 | 2838051316 | 2838048938 | Bacteria | 6044578 |
| 1422 | 2838063706 | 2838061910 | Bacteria | 6794874 |
| 1423 | 2838664969 | 2838661181 | Bacteria | 7385261 |
| 1424 | 2838678233 | 2838675328 | Bacteria | 4909118 |
| 1425 | 2838691466 | 2838686498 | Bacteria | 7807632 |
| 1426 | 2838716861 | 2838714209 | Bacteria | 5525906 |
| 1427 | 2838722529 | 2838719591 | Bacteria | 5523910 |
| 1428 | 2838727610 | 2838724970 | Bacteria | 4908691 |
| 1429 | 2838733425 | 2838729681 | Bacteria | 7400765 |
| 1430 | 2838737486 | 2838736955 | Bacteria | 5760694 |
| 1431 | 2838746003 | 2838742623 | Bacteria | 7396178 |
| 1432 | 2839998041 | 2839993093 | Bacteria | 5512535 |
| 1433 | 2840765654 | 2840764183 | Bacteria | 6358399 |
| 1434 | 2841766481 | 2841760612 | Bacteria | 6454112 |
| 1435 | 2841842145 | 2841840854 | Bacteria | 5761912 |
| 1436 | 2841849216 | 2841846520 | Bacteria | 5345850 |
| 1437 | 2841853715 | 2841851746 | Bacteria | 7532261 |
| 1438 | 2841861713 | 2841859092 | Bacteria | 5436171 |
| 1439 | 2841868320 | 2841864319 | Bacteria | 6742987 |
| 1440 | 2842128035 | 2842124991 | Bacteria | 5346824 |
| 1441 | 2842133126 | 2842130223 | Bacteria | 4909145 |
| 1442 | 2842141924 | 2842140634 | Bacteria | 5759631 |
| 1443 | 2842155120 | 2842152218 | Bacteria | 4908957 |
| 1444 | 2842162278 | 2842156927 | Bacteria | 6894975 |
| 1445 | 2842169834 | 2842163707 | Bacteria | 6916235 |
| 1446 | 2842173619 | 2842170452 | Bacteria | 5525737 |
| 1447 | 2842178741 | 2842175837 | Bacteria | 4908771 |
| 1448 | 2842185204 | 2842180545 | Bacteria | 6888678 |
| 1449 | 2842189968 | 2842187318 | Bacteria | 5524014 |
| 1450 | 2842199975 | 2842198810 | Bacteria | 6608673 |
| 1451 | 2842214282 | 2842211629 | Bacteria | 5523832 |
| 1452 | 2842227001 | 2842224351 | Bacteria | 5524473 |
| 1453 | 2842233691 | 2842229732 | Bacteria | 7475766 |
| 1454 | 2842247735 | 2842243621 | Bacteria | 7421798 |
| 1455 | 2842253893 | 2842250916 | Bacteria | 6579627 |
| 1456 | 2842261997 | 2842257432 | Bacteria | 7401195 |
| 1457 | 2842266474 | 2842264693 | Bacteria | 6472963 |
| 1458 | 2842275940 | 2842271015 | Bacteria | 7807131 |
| 1459 | 2842288929 | 2842285085 | Bacteria | 6011953 |
| 1460 | 2842298567 | 2842298080 | Bacteria | 6123127 |
| 1461 | 2842308076 | 2842304105 | Bacteria | 7023636 |
| 1462 | 2842316167 | 2842311132 | Bacteria | 6616990 |
| 1463 | 2842321542 | 2842317721 | Bacteria | 6793725 |
| 1464 | 2842344858 | 2842341865 | Bacteria | 7003929 |
| 1465 | 2842362419 | 2842357229 | Bacteria | 6485165 |
| 1466 | 2842369363 | 2842363717 | Bacteria | 6844742 |
| 1467 | 2842398667 | 2842395702 | Bacteria | 6780583 |
| 1468 | 2842406404 | 2842402390 | Bacteria | 6681310 |
| 1469 | 2842413169 | 2842409023 | Bacteria | 6687331 |
| 1470 | 2842419812 | 2842415677 | Bacteria | 6596907 |
| 1471 | 2842429793 | 2842428310 | Bacteria | 6767288 |
| 1472 | 2842436547 | 2842434925 | Bacteria | 6502746 |
| 1473 | 2842444250 | 2842441272 | Bacteria | 6769273 |
| 1474 | 2842450889 | 2842447887 | Bacteria | 6754142 |
| 1475 | 2842464214 | 2842462802 | Bacteria | 6588055 |
| 1476 | 2842470876 | 2842469257 | Bacteria | 6752936 |
| 1477 | 2842479740 | 2842475841 | Bacteria | 6603183 |
| 1478 | 2842493122 | 2842489311 | Bacteria | 6620893 |
| 1479 | 2842499308 | 2842495871 | Bacteria | 6820686 |
| 1480 | 2842506916 | 2842502639 | Bacteria | 6604161 |
| 1481 | 2842510595 | 2842509118 | Bacteria | 6850950 |
| 1482 | 2842518021 | 2842515876 | Bacteria | 5436280 |
| 1483 | 2842695232 | 2842694124 | Bacteria | 4063419 |
| 1484 | 2842874745 | 2842871566 | Bacteria | 4827117 |
| 1485 | 2842925953 | 2842922631 | Bacteria | 5824079 |
| 1486 | 2844106248 | 2844104063 | Bacteria | 6440972 |
| 1487 | 2844169135 | 2844163670 | Bacteria | 7266046 |
| 1488 | 2844457640 | 2844454524 | Bacteria | 7952546 |
| 1489 | 2844849107 | 2844849076 | Bacteria | 4091819 |
| 1490 | 2847420337 | 2847417321 | Bacteria | 6913799 |
| 1491 | 2848995149 | 2848992105 | Bacteria | 6810864 |
| 1492 | 2850082216 | 2850079185 | Bacteria | 6848280 |
| 1493 | 2851246604 | 2851246043 | Bacteria | 6439203 |
| 1494 | 2852391046 | 2852387548 | Bacteria | 8025568 |
| 1495 | 2852679308 | 2852677369 | Bacteria | 3768884 |
| 1496 | 2854900356 | 2854896431 | Bacteria | 5869725 |
| 1497 | 2854912979 | 2854911287 | Bacteria | 5582813 |
| 1498 | 2854920188 | 2854916844 | Bacteria | 5725939 |
| 1499 | 2855826937 | 2855825444 | Bacteria | 6785811 |
| 1500 | 2855842333 | 2855839649 | Bacteria | 7135830 |
| 1501 | 2855878530 | 2855872281 | Bacteria | 6964271 |
| 1502 | 2857481066 | 2857479173 | Bacteria | 2469263 |
| 1503 | 2857532599 | 2857531043 | Bacteria | 6754041 |
| 1504 | 2857634796 | 2857632687 | Bacteria | 2448521 |
| 1505 | 2857732661 | 2857729791 | Bacteria | 4040535 |
| 1506 | 2857741918 | 2857740372 | Bacteria | 4782044 |
| 1507 | 2858803148 | 2858800743 | Bacteria | 6603254 |
| 1508 | 2870802353 | 2870801768 | Bacteria | 2710986 |
| 1509 | 2870804435 | 2870804320 | Bacteria | 2552467 |
| 1510 | 2889793273 | 2889790730 | Bacteria | 5689708 |
| 1511 | 2889917474 | 2889914905 | Bacteria | 5702301 |
| 1512 | 2891049307 | 2891048133 | Bacteria | 4447501 |
| 1513 | 2891377603 | 2891373044 | Bacteria | 5202277 |
| 1514 | 2894654054 | 2894652903 | Bacteria | 4587256 |
| 1515 | 2895882162 | 2895880812 | Bacteria | 11255272 |
| 1516 | 2897563324 | 2897561785 | Bacteria | 3256946 |
| 1517 | 2899275900 | 2899275550 | Bacteria | 3958688 |
| 1518 | 2899792801 | 2899792073 | Bacteria | 4926588 |
| 1519 | 2899845462 | 2899845264 | Bacteria | 5672268 |
| 1520 | 2904498055 | 2904497146 | Bacteria | 4731781 |
| 1521 | 2904580339 | 2904578770 | Bacteria | 5302906 |
| 1522 | 2904777413 | 2904776348 | Bacteria | 4658726 |
| 1523 | 2910810629 | 2910809715 | Bacteria | 4982797 |
| 1524 | 2913299750 | 2913295892 | Bacteria | 6333755 |
| 1525 | 2913309026 | 2913308742 | Bacteria | 5350706 |
| 1526 | 2915654220 | 2915650412 | Bacteria | 4288180 |
| 1527 | 2915980456 | 2915980308 | Bacteria | 6624279 |
| 1528 | 2915987745 | 2915986958 | Bacteria | 6739310 |
| 1529 | 2915999004 | 2915993759 | Bacteria | 7016183 |
| 1530 | 2916006173 | 2916000859 | Bacteria | 6865702 |
| 1531 | 2916013013 | 2916007675 | Bacteria | 6898660 |
| 1532 | 2916015605 | 2916014648 | Bacteria | 6946486 |
| 1533 | 2916022472 | 2916021584 | Bacteria | 6854472 |
| 1534 | 2916029080 | 2916028427 | Bacteria | 6748433 |
| 1535 | 2916038408 | 2916035215 | Bacteria | 6755766 |
| 1536 | 2916044834 | 2916041962 | Bacteria | 6820487 |
| 1537 | 2916054076 | 2916048683 | Bacteria | 6543552 |
| 1538 | 2916058153 | 2916055098 | Bacteria | 6758838 |
| 1539 | 2916067034 | 2916061851 | Bacteria | 6737736 |
| 1540 | 2916068878 | 2916068649 | Bacteria | 6943657 |
| 1541 | 2916077371 | 2916076590 | Bacteria | 6596108 |
| 1542 | 2917556592 | 2917554339 | Bacteria | 4987857 |
| 1543 | 2919034785 | 2919034639 | Bacteria | 4763403 |
| 1544 | 2919062256 | 2919059106 | Bacteria | 4991624 |
| 1545 | 2919104412 | 2919100787 | Bacteria | 7710546 |
| 1546 | 2919117052 | 2919114240 | Bacteria | 5700270 |
| 1547 | 2919119985 | 2919119836 | Bacteria | 5208557 |
| 1548 | 2919169778 | 2919166419 | Bacteria | 4952238 |
| 1549 | 2919393814 | 2919391150 | Bacteria | 4884741 |
| 1550 | 2919410553 | 2919408235 | Bacteria | 6149349 |
| 1551 | 2919540250 | 2919538618 | Bacteria | 4677069 |
| 1552 | 2920828594 | 2920822456 | Bacteria | 6897201 |
| 1553 | 2921202914 | 2921201388 | Bacteria | 6926299 |
| 1554 | 2921214573 | 2921208531 | Bacteria | 6745326 |
| 1555 | 2921242582 | 2921237296 | Bacteria | 6876710 |
| 1556 | 2921250181 | 2921244191 | Bacteria | 6568419 |
| 1557 | 2921252274 | 2921250672 | Bacteria | 6677771 |
| 1558 | 2921257553 | 2921257292 | Bacteria | 6808382 |
| 1559 | 2921270835 | 2921263974 | Bacteria | 6864552 |
| 1560 | 2921282897 | 2921282425 | Bacteria | 6826397 |
| 1561 | 2921292583 | 2921289301 | Bacteria | 7316391 |
| 1562 | 2921300944 | 2921296804 | Bacteria | 7176999 |
| 1563 | 2923558920 | 2923556063 | Bacteria | 6793593 |
| 1564 | 2924149317 | 2924144063 | Bacteria | 6883928 |
| 1565 | 2924155467 | 2924150972 | Bacteria | 7169444 |
| 1566 | 2924163257 | 2924158325 | Bacteria | 7188855 |
| 1567 | 2924171844 | 2924165586 | Bacteria | 7260590 |
| 1568 | 2924176975 | 2924172951 | Bacteria | 6749356 |
| 1569 | 2924186278 | 2924179722 | Bacteria | 6843264 |
| 1570 | 2924191599 | 2924186466 | Bacteria | 6876637 |
| 1571 | 2924195010 | 2924193448 | Bacteria | 6955718 |
| 1572 | 2924201627 | 2924200457 | Bacteria | 6757188 |
| 1573 | 2924213498 | 2924207177 | Bacteria | 6917007 |
| 1574 | 2924220819 | 2924214083 | Bacteria | 7080103 |
| 1575 | 2924221861 | 2924221636 | Bacteria | 7113495 |
| 1576 | 2924233362 | 2924228884 | Bacteria | 6633132 |
| 1577 | 2926758565 | 2926754445 | Bacteria | 5964435 |
| 1578 | 2926763903 | 2926760298 | Bacteria | 5505990 |
| 1579 | 2928123002 | 2928121344 | Bacteria | 3972376 |
| 1580 | 2928523093 | 2928521798 | Bacteria | 4960112 |
| 1581 | 2929141293 | 2929138655 | Bacteria | 5810547 |
| 1582 | 2932428080 | 2932426870 | Bacteria | 4547726 |
| 1583 | 2933009501 | 2933006813 | Bacteria | 4912075 |
| 1584 | 2933013650 | 2933011516 | Bacteria | 5439334 |
| 1585 | 2933023329 | 2933016740 | Bacteria | 6355406 |
| 1586 | 2933421403 | 2933418574 | Bacteria | 4476724 |
| 1587 | 2933574525 | 2933570622 | Bacteria | 7023390 |
| 1588 | 2933589126 | 2933586486 | Bacteria | 7667493 |
| 1589 | 2933598108 | 2933594066 | Bacteria | 5594265 |
| 1590 | 2933604733 | 2933599457 | Bacteria | 5858799 |
| 1591 | 2935899873 | 2935894831 | Bacteria | 6620579 |
| 1592 | 2935907043 | 2935901341 | Bacteria | 7341747 |
| 1593 | 2936375012 | 2936367885 | Bacteria | 7324495 |
| 1594 | 2936380703 | 2936375103 | Bacteria | 6652732 |
| 1595 | 2936382127 | 2936381700 | Bacteria | 7006523 |
| 1596 | 2936999940 | 2936996657 | Bacteria | 6298727 |
| 1597 | 2937007084 | 2937002841 | Bacteria | 6934057 |
| 1598 | 2937010940 | 2937009748 | Bacteria | 6746052 |
| 1599 | 2937018274 | 2937016420 | Bacteria | 6782579 |
| 1600 | 2937025757 | 2937023124 | Bacteria | 6815156 |
| 1601 | 2937033103 | 2937029754 | Bacteria | 6424026 |
| 1602 | 2937036605 | 2937036028 | Bacteria | 6846469 |
| 1603 | 2937044044 | 2937042894 | Bacteria | 6741576 |
| 1604 | 2937055686 | 2937049772 | Bacteria | 6757901 |
| 1605 | 2937058405 | 2937056579 | Bacteria | 7107896 |
| 1606 | 2937067448 | 2937063883 | Bacteria | 7199456 |
| 1607 | 2937074772 | 2937071275 | Bacteria | 6984483 |
| 1608 | 2937078522 | 2937078374 | Bacteria | 6610289 |
| 1609 | 2937091353 | 2937084907 | Bacteria | 6618516 |
| 1610 | 2937092748 | 2937091812 | Bacteria | 6979387 |
| 1611 | 2937104948 | 2937098957 | Bacteria | 7249374 |
| 1612 | 2937111743 | 2937106411 | Bacteria | 6947143 |
| 1613 | 2937114938 | 2937113482 | Bacteria | 6505872 |
| 1614 | 2937121445 | 2937119839 | Bacteria | 6597547 |
| 1615 | 2937129421 | 2937126314 | Bacteria | 6771275 |
| 1616 | 2937848507 | 2937843397 | Bacteria | 5256375 |
| 1617 | 2939648500 | 2939647034 | Bacteria | 4681660 |
| 1618 | 2939672282 | 2939669807 | Bacteria | 5028511 |
| 1619 | 2939675455 | 2939674588 | Bacteria | 4844420 |
| 1620 | 2945942901 | 2945941187 | Bacteria | 4682474 |
| 1621 | 2945959353 | 2945956166 | Bacteria | 5110334 |
| 1622 | 2946025612 | 2946024296 | Bacteria | 3508095 |
| 1623 | 2954000048 | 2953998280 | Bacteria | 4812144 |
| 1624 | 2954013542 | 2954011201 | Bacteria | 4762601 |
| 1625 | 2957377547 | 2957375807 | Bacteria | 6425588 |
| 1626 | 2957387668 | 2957382221 | Bacteria | 6737050 |
| 1627 | 2957389887 | 2957388812 | Bacteria | 6778072 |
| 1628 | 2957397419 | 2957395598 | Bacteria | 6822399 |
| 1629 | 2957404648 | 2957402308 | Bacteria | 6741770 |
| 1630 | 2957409116 | 2957408893 | Bacteria | 6558585 |
| 1631 | 2957420698 | 2957415311 | Bacteria | 6991633 |
| 1632 | 2957426439 | 2957422303 | Bacteria | 7172205 |
| 1633 | 2957435751 | 2957430029 | Bacteria | 7022557 |
| 1634 | 2957437280 | 2957437181 | Bacteria | 6568994 |
| 1635 | 2957449450 | 2957443900 | Bacteria | 6869977 |
| 1636 | 2957452316 | 2957450854 | Bacteria | 6765715 |
| 1637 | 2957458678 | 2957457609 | Bacteria | 6967680 |
| 1638 | 2957469699 | 2957464669 | Bacteria | 6568877 |
| 1639 | 2957472117 | 2957471148 | Bacteria | 6797643 |
| 1640 | 2957484463 | 2957478035 | Bacteria | 6756658 |
| 1641 | 2957490933 | 2957484790 | Bacteria | 6703082 |
| 1642 | 2957496286 | 2957491536 | Bacteria | 6695180 |
| 1643 | 2957499363 | 2957498199 | Bacteria | 7126688 |
| 1644 | 2957509074 | 2957505466 | Bacteria | 7253085 |
| 1645 | 2960585453 | 2960584000 | Bacteria | 6864594 |
| 1646 | 2960591170 | 2960591022 | Bacteria | 6622873 |
| 1647 | 2960602272 | 2960597568 | Bacteria | 6550735 |
| 1648 | 2960609602 | 2960603979 | Bacteria | 6898737 |
| 1649 | 2960614320 | 2960610863 | Bacteria | 6691244 |
| 1650 | 2960623449 | 2960617483 | Bacteria | 6727748 |
| 1651 | 2960627996 | 2960624210 | Bacteria | 6875384 |
| 1652 | 2960636548 | 2960631154 | Bacteria | 6732508 |
| 1653 | 2960640534 | 2960637947 | Bacteria | 7296468 |
| 1654 | 2960651546 | 2960645483 | Bacteria | 7211087 |
| 1655 | 2960653175 | 2960652885 | Bacteria | 7083688 |
| 1656 | 2960665373 | 2960660292 | Bacteria | 7041660 |
| 1657 | 2960672542 | 2960667422 | Bacteria | 6763020 |
| 1658 | 2960676329 | 2960674078 | Bacteria | 6609048 |
| 1659 | 2960682538 | 2960680706 | Bacteria | 6624464 |
| 1660 | 2960692454 | 2960687367 | Bacteria | 6535474 |
| 1661 | 2960696899 | 2960693952 | Bacteria | 6749742 |
| 1662 | 2964612910 | 2964607997 | Bacteria | 7101408 |
| 1663 | 2964619734 | 2964615318 | Bacteria | 6809089 |
| 1664 | 2964628294 | 2964621998 | Bacteria | 6834995 |
| 1665 | 2964630953 | 2964628898 | Bacteria | 7083044 |
| 1666 | 2964637105 | 2964636051 | Bacteria | 7091832 |
| 1667 | 2964644732 | 2964643177 | Bacteria | 6820887 |
| 1668 | 2964651413 | 2964649959 | Bacteria | 6675118 |
| 1669 | 2964657701 | 2964656573 | Bacteria | 7100150 |
| 1670 | 2964666565 | 2964663802 | Bacteria | 7019362 |
| 1671 | 2964674593 | 2964670856 | Bacteria | 6851364 |
| 1672 | 2964679552 | 2964678106 | Bacteria | 6792020 |
| 1673 | 2964687360 | 2964685014 | Bacteria | 6839111 |
| 1674 | 2964692327 | 2964691889 | Bacteria | 6802758 |
| 1675 | 2964702620 | 2964698721 | Bacteria | 6765331 |
| 1676 | 2964711110 | 2964705432 | Bacteria | 7114648 |
| 1677 | 2964713287 | 2964712639 | Bacteria | 6695970 |
| 1678 | 2964722456 | 2964719344 | Bacteria | 7286602 |
| 1679 | 2967670785 | 2967664464 | Bacteria | 6948836 |
| 1680 | 2967672818 | 2967671571 | Bacteria | 7021409 |
| 1681 | 2967685301 | 2967678726 | Bacteria | 7264382 |
| 1682 | 2967689311 | 2967686174 | Bacteria | 6678622 |
| 1683 | 2967696258 | 2967693043 | Bacteria | 6804451 |
| 1684 | 2967701413 | 2967699805 | Bacteria | 6854538 |
| 1685 | 2967713838 | 2967706974 | Bacteria | 7186053 |
| 1686 | 2967719980 | 2967714385 | Bacteria | 7000047 |
| 1687 | 2967727768 | 2967721400 | Bacteria | 7073753 |
| 1688 | 2967732595 | 2967728569 | Bacteria | 6641507 |
| 1689 | 2967735288 | 2967735183 | Bacteria | 6827012 |
| 1690 | 2967745522 | 2967742019 | Bacteria | 6794534 |
| 1691 | 2967752343 | 2967748971 | Bacteria | 6733771 |
| 1692 | 2967759268 | 2967755722 | Bacteria | 6814706 |
| 1693 | 2967766867 | 2967762386 | Bacteria | 6923502 |
| 1694 | 2967770536 | 2967769361 | Bacteria | 6587838 |
| 1695 | 2967777554 | 2967775926 | Bacteria | 6738189 |
| 1696 | 2970025890 | 2970019648 | Bacteria | 7072033 |
| 1697 | 2970028196 | 2970026789 | Bacteria | 6785236 |
| 1698 | 2970035020 | 2970033650 | Bacteria | 7118744 |
| 1699 | 2970042493 | 2970040964 | Bacteria | 6731123 |
| 1700 | 2970053489 | 2970047711 | Bacteria | 7088379 |
| 1701 | 2970056063 | 2970054988 | Bacteria | 6611507 |
| 1702 | 2970063048 | 2970061556 | Bacteria | 7099761 |
| 1703 | 2970074494 | 2970068827 | Bacteria | 7123112 |
| 1704 | 2970079216 | 2970076120 | Bacteria | 6697332 |
| 1705 | 2970087812 | 2970082768 | Bacteria | 6183754 |
| 1706 | 2970089159 | 2970088815 | Bacteria | 6933825 |
| 1707 | 2970100291 | 2970095765 | Bacteria | 6936963 |
| 1708 | 2970103788 | 2970102677 | Bacteria | 6812532 |
| 1709 | 2970116134 | 2970109326 | Bacteria | 6863976 |
| 1710 | 2970121249 | 2970116247 | Bacteria | 6501857 |
| 1711 | 2970126038 | 2970122695 | Bacteria | 6625855 |
| 1712 | 2970130170 | 2970129317 | Bacteria | 6806560 |
| 1713 | 2970141212 | 2970136068 | Bacteria | 7207982 |
| 1714 | 2970146524 | 2970143518 | Bacteria | 6446480 |
| 1715 | 2970150523 | 2970149975 | Bacteria | 6779706 |
| 1716 | 2970159310 | 2970156795 | Bacteria | 7168044 |
| 1717 | 2970166822 | 2970164137 | Bacteria | 6861252 |
| 1718 | 2970173481 | 2970170962 | Bacteria | 6876229 |
| 1719 | 2970180679 | 2970177841 | Bacteria | 6768001 |
| 1720 | 2970191545 | 2970184632 | Bacteria | 7054431 |
| 1721 | 2970196263 | 2970191845 | Bacteria | 7032787 |
| 1722 | 2974306751 | 2974302888 | Bacteria | 4369871 |
| 1723 | 2977519839 | 2977516862 | Bacteria | 6940108 |
| 1724 | 2977528019 | 2977523885 | Bacteria | 6960446 |
| 1725 | 2977534247 | 2977530762 | Bacteria | 6951399 |
| 1726 | 2977541103 | 2977537788 | Bacteria | 6929320 |
| 1727 | 2977548089 | 2977544691 | Bacteria | 6875412 |
| 1728 | 2977552173 | 2977551784 | Bacteria | 7125765 |
| 1729 | 2977560069 | 2977558990 | Bacteria | 6863948 |
| 1730 | 2977567261 | 2977565890 | Bacteria | 6901543 |
| 1731 | 2977574862 | 2977572785 | Bacteria | 6763888 |
| 1732 | 2977579846 | 2977579622 | Bacteria | 6772100 |
| 1733 | 2978972197 | 2978969890 | Bacteria | 5400756 |
| 1734 | 2979090999 | 2979089926 | Bacteria | 5670289 |
| 1735 | 2979096525 | 2979095461 | Bacteria | 5669583 |
| 1736 | 2979102258 | 2979100975 | Bacteria | 5423623 |
| 1737 | 2984509794 | 2984509177 | Bacteria | 5274802 |
| 1738 | 2984519509 | 2984518228 | Bacteria | 5277463 |
| 1739 | 2984538132 | 2984537506 | Bacteria | 5277481 |
| 1740 | 2984590423 | 2984587000 | Bacteria | 5263363 |
| 1741 | 2984604884 | 2984601300 | Bacteria | 5455244 |
| 1742 | 2989354738 | 2989349275 | Bacteria | 6349068 |
| 1743 | 2989773420 | 2989771324 | Bacteria | 5605128 |
| 1744 | 2989779715 | 2989776772 | Bacteria | 4843317 |
| 1745 | 2995394863 | 2995392953 | Bacteria | 4539380 |
| 1746 | 2996890112 | 2996887358 | Bacteria | 5795980 |
| 1747 | 2996895902 | 2996893221 | Bacteria | 5823108 |
| 1748 | 3002141381 | 3002141150 | Bacteria | 5254435 |
| 1749 | 3003934812 | 3003930520 | Bacteria | 5667563 |
| 1750 | 3005415629 | 3005409236 | Bacteria | 7188837 |
| 1751 | 3005418612 | 3005416602 | Bacteria | 7064308 |
| 1752 | 3005449129 | 3005445848 | Bacteria | 6906074 |
| 1753 | 3005455408 | 3005452660 | Bacteria | 5889319 |
| 1754 | 639649863 | 639633055 | Bacteria | 7751309 |
| 1755 | 643826988 | 643692032 | Bacteria | 6891900 |
| 1756 | 648735937 | 648276728 | Bacteria | 6968865 |
| 1757 | 650843361 | 650716007 | Bacteria | 5573770 |
| 1758 | 8003572957 | 8003570095 | Bacteria | 5747666 |
| 1759 | 8003994871 | 8003992118 | Bacteria | 7266902 |
| 1760 | 8004002624 | 8003999396 | Bacteria | 7063185 |
| 1761 | 8005249668 | 8005246636 | Bacteria | 4933972 |
| 1762 | 8005262167 | 8005258706 | Bacteria | 6184835 |
| 1763 | 8005281854 | 8005275841 | Bacteria | 6929066 |
| 1764 | 8005288848 | 8005282627 | Bacteria | 6675747 |
| 1765 | 8005294433 | 8005289223 | Bacteria | 6634003 |
| 1766 | 8005306816 | 8005301065 | Bacteria | 6614431 |
| 1767 | 8005310814 | 8005307578 | Bacteria | 7395396 |
| 1768 | 8005318496 | 8005314921 | Bacteria | 7072929 |
| 1769 | 8005324639 | 8005321885 | Bacteria | 5795980 |
| 1770 | 8005378335 | 8005376324 | Bacteria | 6590079 |
| 1771 | 8005383980 | 8005382845 | Bacteria | 6732062 |
| 1772 | 8005401307 | 8005395548 | Bacteria | 6806915 |
| 1773 | 8005434262 | 8005430974 | Bacteria | 6689030 |
| 1774 | 8005464476 | 8005460587 | Bacteria | 7157962 |
| 1775 | 8005488623 | 8005484373 | Bacteria | 6297373 |
| 1776 | 8005501519 | 8005497431 | Bacteria | 6477605 |
| 1777 | 8005547274 | 8005542996 | Bacteria | 7077758 |
| 1778 | 8005558526 | 8005556819 | Bacteria | 6908598 |
| 1779 | 8005566630 | 8005563573 | Bacteria | 7153261 |
| 1780 | 8005575081 | 8005570704 | Bacteria | 6957481 |
| 1781 | 8005622880 | 8005619151 | Bacteria | 7030230 |
| 1782 | 8005631819 | 8005626139 | Bacteria | 6534237 |
| 1783 | 8005649090 | 8005645114 | Bacteria | 6950293 |
| 1784 | 8005658655 | 8005658619 | Bacteria | 4500593 |
| 1785 | 8005672940 | 8005668836 | Bacteria | 6953162 |
| 1786 | 8005682329 | 8005682033 | Bacteria | 6726518 |
| 1787 | 8005693487 | 8005688590 | Bacteria | 6610080 |
| 1788 | 8005700708 | 8005695170 | Bacteria | 6912330 |
| 1789 | 8018133754 | 8018127388 | Bacteria | 7351159 |
| 1790 | 8018153299 | 8018150411 | Bacteria | 5549903 |
| 1791 | 8018170074 | 8018163183 | Bacteria | 7277977 |
| 1792 | 8018178600 | 8018176218 | Bacteria | 6896178 |
| 1793 | 8023687697 | 8023680758 | Bacteria | 7729763 |
| 1794 | 8024481640 | 8024479707 | Bacteria | 6954785 |
| 1795 | 8024487873 | 8024486573 | Bacteria | 6540512 |
| 1796 | 8024506093 | 8024501048 | Bacteria | 6427847 |
| 1797 | 8045867498 | 8045864390 | Bacteria | 5043873 |
| 1798 | 8046772037 | 8046767195 | Bacteria | 7547379 |
| 1799 | 8049295847 | 8049293176 | Bacteria | 6128433 |
| 1800 | 8054463363 | 8054460903 | Bacteria | 4872905 |
| 1801 | 8054565621 | 8054563764 | Bacteria | 5592885 |
| 1802 | 8055432123 | 8055431914 | Bacteria | 4551896 |
| 1803 | 8056381444 | 8056375014 | Bacteria | 7006639 |
| 1804 | 8056386887 | 8056382006 | Bacteria | 6408074 |
| 1805 | 8057577531 | 8057575449 | Bacteria | 7367519 |
| 1806 | 8057876677 | 8057874678 | Bacteria | 7494653 |
| 1807 | Ga0496119_0020826 | |||
| 1808 | JGI24739J22299_10056206 | |||
| 1809 | JGI24744J21845_10002172 | |||
| 1810 | JGI25156J39149_1000066 | |||
| 1811 | JGI25162J39368_1000488 | |||
| 1812 | JGI25154J39366_1000035 | |||
| 1813 | JGI25157J39369_1000036 | |||
| 1814 | JGI25157J39369_1000197 | |||
| 1815 | JGI25152J39213_1009568 | |||
| 1816 | JGI25159J45721_1000463 | |||
| 1817 | JGI25159J45721_1001920 | |||
| 1818 | JGI25151J46595_10001277 | |||
| 1819 | JGI25151J46595_10002842 | |||
| 1820 | JGI25151J46595_10032258 | |||
| 1821 | JGI25165J46597_1000676 | |||
| 1822 | JGI25165J46597_1001184 | |||
| 1823 | JGI25165J46597_1004445 | |||
| 1824 | rootH1_10034840 | |||
| 1825 | JGI25160J50197_1000100 | |||
| 1826 | JGI25160J50197_1001130 | |||
| 1827 | JGI25160J50197_1022014 | |||
| 1828 | JGI25161J50226_1000072 | |||
| 1829 | JGI25161J50226_1000104 | |||
| 1830 | JGI25161J50226_1000396 | |||
| 1831 | Ga0006562J51391_1020816 | |||
| 1832 | Ga0055526_1001414 | |||
| 1833 | Ga0055526_1017900 | |||
| 1834 | Ga0055526_1024203 | |||
| 1835 | Ga0055526_1028352 | |||
| 1836 | Ga0055524_1002189 | |||
| 1837 | Ga0055524_1005016 | |||
| 1838 | Ga0055524_1008630 | |||
| 1839 | Ga0055524_1010849 | |||
| 1840 | Ga0055524_1015401 | |||
| 1841 | Ga0055524_1025242 | |||
| 1842 | Ga0055536_1019029 | |||
| 1843 | Ga0055528_1000695 | |||
| 1844 | Ga0055528_1005647 | |||
| 1845 | Ga0055528_1008246 | |||
| 1846 | Ga0055528_1011300 | |||
| 1847 | Ga0055528_1021009 | |||
| 1848 | Ga0055530_10018329 | |||
| 1849 | Ga0055530_10056832 | |||
| 1850 | Ga0055540_1000752 | |||
| 1851 | Ga0055540_1015474 | |||
| 1852 | Ga0055540_1020091 | |||
| 1853 | Ga0055531_10023282 | |||
| 1854 | Ga0058692_1001306 | |||
| 1855 | Ga0058692_1002399 | |||
| 1856 | Ga0058692_1014818 | |||
| 1857 | Ga0055543_1000078 | |||
| 1858 | Ga0055543_1000280 | |||
| 1859 | Ga0065165_1000623 | |||
| 1860 | Ga0065165_1002557 | |||
| 1861 | Ga0065165_1023432 | |||
| 1862 | Ga0065714_10142918 | |||
| 1863 | Ga0065704_10159503 | |||
| 1864 | Ga0065712_10014529 | |||
| 1865 | Ga0065712_10284402 | |||
| 1866 | Ga0065707_10089177 | |||
| 1867 | Ga0070658_10000894 | |||
| 1868 | Ga0070658_10020960 | |||
| 1869 | Ga0070658_10065366 | |||
| 1870 | Ga0070658_10159182 | |||
| 1871 | Ga0070676_10037368 | |||
| 1872 | Ga0070683_100092079 | |||
| 1873 | Ga0070670_100000007 | |||
| 1874 | Ga0070670_100065624 | |||
| 1875 | Ga0070677_10152960 | |||
| 1876 | Ga0070682_100202478 | |||
| 1877 | Ga0068868_100056815 | |||
| 1878 | Ga0068868_100103395 | |||
| 1879 | Ga0070660_100003906 | |||
| 1880 | Ga0070660_100016734 | |||
| 1881 | Ga0070660_100026194 | |||
| 1882 | Ga0070661_100000711 | |||
| 1883 | Ga0070661_100010380 | |||
| 1884 | Ga0070661_100175746 | |||
| 1885 | Ga0070668_100000698 | |||
| 1886 | Ga0070668_100003566 | |||
| 1887 | Ga0070668_100015597 | |||
| 1888 | Ga0070668_100016864 | |||
| 1889 | Ga0070669_100017209 | |||
| 1890 | Ga0070675_100025813 | |||
| 1891 | Ga0070675_100138584 | |||
| 1892 | Ga0070671_100000680 | |||
| 1893 | Ga0070671_100018260 | |||
| 1894 | Ga0070671_100107571 | |||
| 1895 | Ga0070671_100256627 | |||
| 1896 | Ga0070674_100022758 | |||
| 1897 | Ga0070673_100135563 | |||
| 1898 | Ga0070688_100005746 | |||
| 1899 | Ga0070659_100088401 | |||
| 1900 | Ga0070659_100367919 | |||
| 1901 | Ga0070667_100000560 | |||
| 1902 | Ga0070667_100002368 | |||
| 1903 | Ga0070667_100033927 | |||
| 1904 | Ga0070667_100035836 | |||
| 1905 | Ga0070667_100039599 | |||
| 1906 | Ga0070694_100030566 | |||
| 1907 | Ga0070694_100139436 | |||
| 1908 | Ga0070663_100089633 | |||
| 1909 | Ga0070663_100109678 | |||
| 1910 | Ga0070663_100119414 | |||
| 1911 | Ga0070663_100308946 | |||
| 1912 | Ga0070678_100014493 | |||
| 1913 | Ga0070681_10034749 | |||
| 1914 | Ga0070681_10114505 | |||
| 1915 | Ga0070681_10131608 | |||
| 1916 | Ga0070681_10202347 | |||
| 1917 | Ga0070681_10701687 | |||
| 1918 | Ga0070707_100000419 | |||
| 1919 | Ga0070699_100478633 | |||
| 1920 | Ga0070699_100535106 | |||
| 1921 | Ga0070679_100010746 | |||
| 1922 | Ga0070679_100016613 | |||
| 1923 | Ga0070679_100128027 | |||
| 1924 | Ga0068853_100000320 | |||
| 1925 | Ga0068853_100364565 | |||
| 1926 | Ga0070665_100001645 | |||
| 1927 | Ga0070665_100002076 | |||
| 1928 | Ga0070665_100023709 | |||
| 1929 | Ga0070665_100036777 | |||
| 1930 | Ga0070665_100038919 | |||
| 1931 | Ga0070665_100213000 | |||
| 1932 | Ga0070665_100214059 | |||
| 1933 | Ga0070665_100494499 | |||
| 1934 | Ga0070704_100158381 | |||
| 1935 | Ga0068855_100237447 | |||
| 1936 | Ga0068855_100683284 | |||
| 1937 | Ga0070664_100095467 | |||
| 1938 | Ga0068857_100007929 | |||
| 1939 | Ga0068854_100016799 | |||
| 1940 | Ga0068854_100049485 | |||
| 1941 | Ga0068854_100063977 | |||
| 1942 | Ga0068854_100234496 | |||
| 1943 | Ga0068856_100039088 | |||
| 1944 | Ga0068856_100209447 | |||
| 1945 | Ga0068852_100005347 | |||
| 1946 | Ga0068852_100021220 | |||
| 1947 | Ga0068852_100057334 | |||
| 1948 | Ga0068852_100060942 | |||
| 1949 | Ga0068852_100128153 | |||
| 1950 | Ga0068852_100189602 | |||
| 1951 | Ga0068852_100586486 | |||
| 1952 | Ga0068859_100002330 | |||
| 1953 | Ga0068859_100004673 | |||
| 1954 | Ga0068859_100077898 | |||
| 1955 | Ga0068859_100086490 | |||
| 1956 | Ga0068864_100000095 | |||
| 1957 | Ga0068861_100167728 | |||
| 1958 | Ga0068851_10002754 | |||
| 1959 | Ga0068851_10009811 | |||
| 1960 | Ga0068851_10086230 | |||
| 1961 | Ga0068863_100000566 | |||
| 1962 | Ga0068863_100001255 | |||
| 1963 | Ga0068863_100001274 | |||
| 1964 | Ga0068863_100503216 | |||
| 1965 | Ga0068858_100000408 | |||
| 1966 | Ga0068858_100008334 | |||
| 1967 | Ga0068860_100000204 | |||
| 1968 | Ga0068860_100001329 | |||
| 1969 | Ga0068860_100114548 | |||
| 1970 | Ga0068860_100163268 | |||
| 1971 | Ga0068860_100486502 | |||
| 1972 | Ga0068862_100001099 | |||
| 1973 | Ga0068862_100384906 | |||
| 1974 | Ga0081455_10035277 | |||
| 1975 | Ga0081455_10089432 | |||
| 1976 | Ga0075365_10020781 | |||
| 1977 | Ga0075365_10028497 | |||
| 1978 | Ga0075365_10060257 | |||
| 1979 | Ga0075365_10075414 | |||
| 1980 | Ga0075365_10235632 | |||
| 1981 | Ga0075368_10006205 | |||
| 1982 | Ga0075363_100000517 | |||
| 1983 | Ga0075363_100081721 | |||
| 1984 | Ga0075364_10000330 | |||
| 1985 | Ga0075364_10004100 | |||
| 1986 | Ga0075364_10006116 | |||
| 1987 | Ga0075364_10018863 | |||
| 1988 | Ga0075364_10023387 | |||
| 1989 | Ga0075364_10109383 | |||
| 1990 | Ga0075432_10001362 | |||
| 1991 | Ga0075432_10025711 | |||
| 1992 | Ga0075362_10006339 | |||
| 1993 | Ga0075362_10028612 | |||
| 1994 | Ga0075367_10000817 | |||
| 1995 | Ga0075367_10001867 | |||
| 1996 | Ga0075367_10030850 | |||
| 1997 | Ga0075367_10035201 | |||
| 1998 | Ga0075367_10051829 | |||
| 1999 | Ga0075369_10002835 | |||
| 2000 | Ga0075369_10142406 | |||
| 2001 | Ga0075366_10003864 | |||
| 2002 | Ga0075366_10069473 | |||
| 2003 | Ga0097621_100638531 | |||
| 2004 | Ga0075370_10007174 | |||
| 2005 | Ga0075370_10137935 | |||
| 2006 | Ga0075428_100000308 | |||
| 2007 | Ga0075430_100175990 | |||
| 2008 | Ga0075431_100035633 | |||
| 2009 | Ga0075431_100117369 | |||
| 2010 | Ga0075433_10003167 | |||
| 2011 | Ga0075434_100040767 | |||
| 2012 | Ga0075434_100231538 | |||
| 2013 | Ga0075429_100326494 | |||
| 2014 | Ga0068865_100004923 | |||
| 2015 | Ga0075436_100107848 | |||
| 2016 | Ga0097620_100002330 | |||
| 2017 | Ga0097620_100004672 | |||
| 2018 | Ga0097620_100077898 | |||
| 2019 | Ga0097620_100086492 | |||
| 2020 | Ga0079104_1007879 | |||
| 2021 | Ga0099826_10001733 | |||
| 2022 | Ga0099826_10011457 | |||
| 2023 | Ga0099826_10085389 | |||
| 2024 | Ga0075435_100001016 | |||
| 2025 | Ga0075435_100126547 | |||
| 2026 | Ga0075435_100360360 | |||
| 2027 | Ga0105244_10005376 | |||
| 2028 | Ga0105244_10024640 | |||
| 2029 | Ga0105244_10054329 | |||
| 2030 | Ga0105250_10048314 | |||
| 2031 | Ga0105240_10000019 | |||
| 2032 | Ga0105240_10008822 | |||
| 2033 | Ga0105240_10034181 | |||
| 2034 | Ga0105240_10133643 | |||
| 2035 | Ga0105240_10162229 | |||
| 2036 | Ga0105240_10784889 | |||
| 2037 | Ga0111539_10009545 | |||
| 2038 | Ga0114129_10002076 | |||
| 2039 | Ga0105243_10009086 | |||
| 2040 | Ga0105243_10102408 | |||
| 2041 | Ga0105243_10251776 | |||
| 2042 | Ga0105243_10498429 | |||
| 2043 | Ga0105241_10134827 | |||
| 2044 | Ga0105248_10000956 | |||
| 2045 | Ga0105248_10002867 | |||
| 2046 | Ga0105248_10022410 | |||
| 2047 | Ga0105248_10333479 | |||
| 2048 | Ga0105248_10433136 | |||
| 2049 | Ga0105248_10956889 | |||
| 2050 | Ga0105248_11187341 | |||
| 2051 | Ga0105237_10000734 | |||
| 2052 | Ga0105237_10013543 | |||
| 2053 | Ga0105238_10130517 | |||
| 2054 | Ga0105238_10131601 | |||
| 2055 | Ga0105238_10141831 | |||
| 2056 | Ga0105238_10257715 | |||
| 2057 | Ga0105238_10308719 | |||
| 2058 | Ga0105249_10002691 | |||
| 2059 | Ga0105249_10085780 | |||
| 2060 | Ga0123340_1060268 | |||
| 2061 | Ga0123341_1000014 | |||
| 2062 | Ga0123342_1013040 | |||
| 2063 | Ga0123342_1035140 | |||
| 2064 | Ga0105239_10000574 | |||
| 2065 | Ga0105239_10038018 | |||
| 2066 | Ga0105239_10152314 | |||
| 2067 | Ga0105246_10003419 | |||
| 2068 | Ga0105246_10006000 | |||
| 2069 | Ga0105246_10033470 | |||
| 2070 | Ga0157314_1002199 | |||
| 2071 | Ga0157373_10041542 | |||
| 2072 | Ga0157373_10109717 | |||
| 2073 | Ga0157373_10235596 | |||
| 2074 | Ga0157373_10528331 | |||
| 2075 | Ga0157371_10000002 | |||
| 2076 | Ga0157371_10009588 | |||
| 2077 | Ga0157370_10000131 | |||
| 2078 | Ga0157370_10000246 | |||
| 2079 | Ga0157370_10036865 | |||
| 2080 | Ga0157370_10101533 | |||
| 2081 | Ga0157369_10017091 | |||
| 2082 | Ga0157369_10058336 | |||
| 2083 | Ga0157369_10088543 | |||
| 2084 | Ga0157369_10162395 | |||
| 2085 | Ga0157369_10215221 | |||
| 2086 | Ga0157369_10492205 | |||
| 2087 | Ga0163162_10002377 | |||
| 2088 | Ga0163162_10027041 | |||
| 2089 | Ga0157375_10183886 | |||
| 2090 | Ga0157375_10257464 | |||
| 2091 | Ga0157375_10281673 | |||
| 2092 | Ga0157375_10408714 | |||
| 2093 | Ga0157375_10921504 | |||
| 2094 | Ga0163163_10000523 | |||
| 2095 | Ga0182008_10015150 | |||
| 2096 | Ga0182008_10016782 | |||
| 2097 | Ga0157379_10006347 | |||
| 2098 | Ga0157379_10009511 | |||
| 2099 | Ga0157379_10126411 | |||
| 2100 | Ga0182006_1034649 | |||
| 2101 | Ga0182007_10006425 | |||
| 2102 | Ga0183363_1150 | |||
| 2103 | Ga0163161_10306703 | |||
| 2104 | Ga0206353_10568533 | |||
| 2105 | Ga0214544_1000893 | |||
| 2106 | Ga0214542_1000115 | |||
| 2107 | Ga0214542_1010937 | |||
| 2108 | Ga0214543_1000008 | |||
| 2109 | Ga0214543_1000098 | |||
| 2110 | Ga0213872_10111147 | |||
| 2111 | Ga0213875_10002358 | |||
| 2112 | Ga0213875_10151488 | |||
| 2113 | Ga0228711_1000003 | |||
| 2114 | Ga0228710_1000003 | |||
| 2115 | Ga0209435_100005 | |||
| 2116 | Ga0209436_100023 | |||
| 2117 | Ga0209436_100027 | |||
| 2118 | Ga0209436_103154 | |||
| 2119 | Ga0209437_100058 | |||
| 2120 | Ga0209437_100313 | |||
| 2121 | Ga0209437_114590 | |||
| 2122 | Ga0207425_1000058 | |||
| 2123 | Ga0207425_1006058 | |||
| 2124 | Ga0207425_1008224 | |||
| 2125 | Ga0207425_1014838 | |||
| 2126 | Ga0209646_1000011 | |||
| 2127 | Ga0209026_1000008 | |||
| 2128 | Ga0209759_1000004 | |||
| 2129 | Ga0209129_1000080 | |||
| 2130 | Ga0209129_1000107 | |||
| 2131 | Ga0209129_1000145 | |||
| 2132 | Ga0209129_1000605 | |||
| 2133 | Ga0209129_1000714 | |||
| 2134 | Ga0209129_1001284 | |||
| 2135 | Ga0209129_1001351 | |||
| 2136 | Ga0209129_1024521 | |||
| 2137 | Ga0209233_1000157 | |||
| 2138 | Ga0209233_1000354 | |||
| 2139 | Ga0209233_1000380 | |||
| 2140 | Ga0209673_1000060 | |||
| 2141 | Ga0209673_1000233 | |||
| 2142 | Ga0209673_1000781 | |||
| 2143 | Ga0209673_1001374 | |||
| 2144 | Ga0209673_1005142 | |||
| 2145 | Ga0209673_1010151 | |||
| 2146 | Ga0209673_1014773 | |||
| 2147 | Ga0209673_1016024 | |||
| 2148 | Ga0209130_1000083 | |||
| 2149 | Ga0209130_1000173 | |||
| 2150 | Ga0209675_1019772 | |||
| 2151 | Ga0209676_1009832 | |||
| 2152 | Ga0209025_1000052 | |||
| 2153 | Ga0209025_1000083 | |||
| 2154 | Ga0209025_1000255 | |||
| 2155 | Ga0209025_1000350 | |||
| 2156 | Ga0209025_1002871 | |||
| 2157 | Ga0209025_1004678 | |||
| 2158 | Ga0209025_1015394 | |||
| 2159 | Ga0209025_1026479 | |||
| 2160 | Ga0209564_1000116 | |||
| 2161 | Ga0209564_1000125 | |||
| 2162 | Ga0209564_1001273 | |||
| 2163 | Ga0209564_1003981 | |||
| 2164 | Ga0209564_1006272 | |||
| 2165 | Ga0209564_1010520 | |||
| 2166 | Ga0209758_1000090 | |||
| 2167 | Ga0209758_1000839 | |||
| 2168 | Ga0209758_1000928 | |||
| 2169 | Ga0209758_1001034 | |||
| 2170 | Ga0209758_1001969 | |||
| 2171 | Ga0209758_1003215 | |||
| 2172 | Ga0209758_1009519 | |||
| 2173 | Ga0209758_1015321 | |||
| 2174 | Ga0209050_1003361 | |||
| 2175 | Ga0209050_1005007 | |||
| 2176 | Ga0209256_1000302 | |||
| 2177 | Ga0209256_1001684 | |||
| 2178 | Ga0209256_1001904 | |||
| 2179 | Ga0209256_1006695 | |||
| 2180 | Ga0209256_1007478 | |||
| 2181 | Ga0209256_1009497 | |||
| 2182 | Ga0207426_1000047 | |||
| 2183 | Ga0207426_1000173 | |||
| 2184 | Ga0207426_1000276 | |||
| 2185 | Ga0207426_1001540 | |||
| 2186 | Ga0209051_1000217 | |||
| 2187 | Ga0209051_1003071 | |||
| 2188 | Ga0209051_1013849 | |||
| 2189 | Ga0209051_1017658 | |||
| 2190 | Ga0209051_1023760 | |||
| 2191 | Ga0209051_1044997 | |||
| 2192 | Ga0209257_1002359 | |||
| 2193 | Ga0209257_1003258 | |||
| 2194 | Ga0209257_1026373 | |||
| 2195 | Ga0207697_10000777 | |||
| 2196 | Ga0207697_10016313 | |||
| 2197 | Ga0207656_10007056 | |||
| 2198 | Ga0207655_1002973 | |||
| 2199 | Ga0207655_1003408 | |||
| 2200 | Ga0207688_10143968 | |||
| 2201 | Ga0207680_10151896 | |||
| 2202 | Ga0207647_10023166 | |||
| 2203 | Ga0207647_10032365 | |||
| 2204 | Ga0207647_10190198 | |||
| 2205 | Ga0207685_10104462 | |||
| 2206 | Ga0207645_10003790 | |||
| 2207 | Ga0207705_10285350 | |||
| 2208 | Ga0207705_10428792 | |||
| 2209 | Ga0207654_10131782 | |||
| 2210 | Ga0207707_10070567 | |||
| 2211 | Ga0207707_10236088 | |||
| 2212 | Ga0207695_10000049 | |||
| 2213 | Ga0207695_10002646 | |||
| 2214 | Ga0207695_10169998 | |||
| 2215 | Ga0207695_10326655 | |||
| 2216 | Ga0207671_10000423 | |||
| 2217 | Ga0207660_10046649 | |||
| 2218 | Ga0207657_10013840 | |||
| 2219 | Ga0207657_10033074 | |||
| 2220 | Ga0207657_10060202 | |||
| 2221 | Ga0207649_10007286 | |||
| 2222 | Ga0207649_10028688 | |||
| 2223 | Ga0207649_10132015 | |||
| 2224 | Ga0207652_10046917 | |||
| 2225 | Ga0207652_10245788 | |||
| 2226 | Ga0207681_10010940 | |||
| 2227 | Ga0207681_10017969 | |||
| 2228 | Ga0207694_10017871 | |||
| 2229 | Ga0207694_10025064 | |||
| 2230 | Ga0207694_10058549 | |||
| 2231 | Ga0207694_10208913 | |||
| 2232 | Ga0207694_10254897 | |||
| 2233 | Ga0207650_10000030 | |||
| 2234 | Ga0207650_10007621 | |||
| 2235 | Ga0207650_10023252 | |||
| 2236 | Ga0207650_10551031 | |||
| 2237 | Ga0207644_10001318 | |||
| 2238 | Ga0207644_10012003 | |||
| 2239 | Ga0207644_10088856 | |||
| 2240 | Ga0207690_10014391 | |||
| 2241 | Ga0207690_10061781 | |||
| 2242 | Ga0207709_10019698 | |||
| 2243 | Ga0207709_10107250 | |||
| 2244 | Ga0207709_10150025 | |||
| 2245 | Ga0207669_10096773 | |||
| 2246 | Ga0207704_10000732 | |||
| 2247 | Ga0207691_10002449 | |||
| 2248 | Ga0207711_10001411 | |||
| 2249 | Ga0207711_10003037 | |||
| 2250 | Ga0207711_10064476 | |||
| 2251 | Ga0207711_10093560 | |||
| 2252 | Ga0207711_10341662 | |||
| 2253 | Ga0207661_10125732 | |||
| 2254 | Ga0207679_10521673 | |||
| 2255 | Ga0207667_10039773 | |||
| 2256 | Ga0207667_10050469 | |||
| 2257 | Ga0207667_10181735 | |||
| 2258 | Ga0207667_10556790 | |||
| 2259 | Ga0207667_10787625 | |||
| 2260 | Ga0207651_10134629 | |||
| 2261 | Ga0207712_10001578 | |||
| 2262 | Ga0207712_10575403 | |||
| 2263 | Ga0207668_10000010 | |||
| 2264 | Ga0207668_10000502 | |||
| 2265 | Ga0207668_10011325 | |||
| 2266 | Ga0207668_10148790 | |||
| 2267 | Ga0207668_10543076 | |||
| 2268 | Ga0207640_10018321 | |||
| 2269 | Ga0207640_10037509 | |||
| 2270 | Ga0207640_10054952 | |||
| 2271 | Ga0207640_10090944 | |||
| 2272 | Ga0207640_10214772 | |||
| 2273 | Ga0207658_10000810 | |||
| 2274 | Ga0207658_10004019 | |||
| 2275 | Ga0207658_10101217 | |||
| 2276 | Ga0207658_10589461 | |||
| 2277 | Ga0207677_10656124 | |||
| 2278 | Ga0207703_10000171 | |||
| 2279 | Ga0207703_10001817 | |||
| 2280 | Ga0207639_10008114 | |||
| 2281 | Ga0207639_10018028 | |||
| 2282 | Ga0207639_10190099 | |||
| 2283 | Ga0207639_10206687 | |||
| 2284 | Ga0207639_10258988 | |||
| 2285 | Ga0207678_10000075 | |||
| 2286 | Ga0207678_10015962 | |||
| 2287 | Ga0207678_10153082 | |||
| 2288 | Ga0207702_10035243 | |||
| 2289 | Ga0207702_10040011 | |||
| 2290 | Ga0207702_10074658 | |||
| 2291 | Ga0207641_10000007 | |||
| 2292 | Ga0207641_10001223 | |||
| 2293 | Ga0207641_10059544 | |||
| 2294 | Ga0207641_10072576 | |||
| 2295 | Ga0207641_10409698 | |||
| 2296 | Ga0207676_10000095 | |||
| 2297 | Ga0207676_10000268 | |||
| 2298 | Ga0207674_10005582 | |||
| 2299 | Ga0207674_10067558 | |||
| 2300 | Ga0207674_10217523 | |||
| 2301 | Ga0207674_10298985 | |||
| 2302 | Ga0207683_10002422 | |||
| 2303 | Ga0207698_10012352 | |||
| 2304 | Ga0207698_10096926 | |||
| 2305 | Ga0207698_10666257 | |||
| 2306 | Ga0209281_1000068 | |||
| 2307 | Ga0209281_1000081 | |||
| 2308 | Ga0209281_1000269 | |||
| 2309 | Ga0209371_1000003 | |||
| 2310 | Ga0209371_1001970 | |||
| 2311 | Ga0209371_1004843 | |||
| 2312 | Ga0209282_1000040 | |||
| 2313 | Ga0209282_1005392 | |||
| 2314 | Ga0209813_10002642 | |||
| 2315 | Ga0207428_10028693 | |||
| 2316 | Ga0207428_10331709 | |||
| 2317 | Ga0268266_10001182 | |||
| 2318 | Ga0268266_10003080 | |||
| 2319 | Ga0268266_10018839 | |||
| 2320 | Ga0268266_10048496 | |||
| 2321 | Ga0268266_10070595 | |||
| 2322 | Ga0268266_10079092 | |||
| 2323 | Ga0268266_10109764 | |||
| 2324 | Ga0268266_10165162 | |||
| 2325 | Ga0268266_10198594 | |||
| 2326 | Ga0268265_10009764 | |||
| 2327 | Ga0268265_10020309 | |||
| 2328 | Ga0268265_10591016 | |||
| 2329 | Ga0268264_10000125 | |||
| 2330 | Ga0268264_10006798 | |||
| 2331 | Ga0268264_10040817 | |||
| 2332 | Ga0268264_10095086 | |||
| 2333 | Ga0265319_1026846 | |||
| 2334 | Ga0265334_10015152 | |||
| 2335 | Ga0265318_10000001 | |||
| 2336 | Ga0265318_10045221 | |||
| 2337 | Ga0307517_10001755 | |||
| 2338 | Ga0307517_10051943 | |||
| 2339 | Ga0307515_10000017 | |||
| 2340 | Ga0307515_10108497 | |||
| 2341 | Ga0265338_10001954 | |||
| 2342 | Ga0265338_10020392 | |||
| 2343 | Ga0265338_10107543 | |||
| 2344 | Ga0265338_10135374 | |||
| 2345 | Ga0265338_10196329 | |||
| 2346 | Ga0268256_1000004 | |||
| 2347 | Ga0268256_1001045 | |||
| 2348 | Ga0268256_1002352 | |||
| 2349 | Ga0316181_1198668 | |||
| 2350 | Ga0265325_10004909 | |||
| 2351 | Ga0307513_10001025 | |||
| 2352 | Ga0307513_10003675 | |||
| 2353 | Ga0307513_10022270 | |||
| 2354 | Ga0307513_10238617 | |||
| 2355 | Ga0307408_100009834 | |||
| 2356 | Ga0307408_100024062 | |||
| 2357 | Ga0307408_100125185 | |||
| 2358 | Ga0307408_100147439 | |||
| 2359 | Ga0307408_100237683 | |||
| 2360 | Ga0307408_100324237 | |||
| 2361 | Ga0307408_100442502 | |||
| 2362 | Ga0265313_10004959 | |||
| 2363 | Ga0265313_10005514 | |||
| 2364 | Ga0265342_10033039 | |||
| 2365 | Ga0307405_10005651 | |||
| 2366 | Ga0307405_10038653 | |||
| 2367 | Ga0307405_10087614 | |||
| 2368 | Ga0316577_10056427 | |||
| 2369 | Ga0307413_10017665 | |||
| 2370 | Ga0307413_10021565 | |||
| 2371 | Ga0307413_10031744 | |||
| 2372 | Ga0307413_10132346 | |||
| 2373 | Ga0307413_10347617 | |||
| 2374 | Ga0307413_10368866 | |||
| 2375 | Ga0307413_10368993 | |||
| 2376 | Ga0307410_10023042 | |||
| 2377 | Ga0307410_10066580 | |||
| 2378 | Ga0307410_10122282 | |||
| 2379 | Ga0307410_10124450 | |||
| 2380 | Ga0307410_10136708 | |||
| 2381 | Ga0307410_10233966 | |||
| 2382 | Ga0307410_10325903 | |||
| 2383 | Ga0307406_10005179 | |||
| 2384 | Ga0307406_10284958 | |||
| 2385 | Ga0307407_10052043 | |||
| 2386 | Ga0307407_10079070 | |||
| 2387 | Ga0307412_10001366 | |||
| 2388 | Ga0307412_10076509 | |||
| 2389 | Ga0307412_10163356 | |||
| 2390 | Ga0307412_10219959 | |||
| 2391 | Ga0307412_10411022 | |||
| 2392 | Ga0315914_1000002 | |||
| 2393 | Ga0307409_100003695 | |||
| 2394 | Ga0307409_100059958 | |||
| 2395 | Ga0307409_100065009 | |||
| 2396 | Ga0307409_100261492 | |||
| 2397 | Ga0307409_100489087 | |||
| 2398 | Ga0307416_100017153 | |||
| 2399 | Ga0307416_100073294 | |||
| 2400 | Ga0307416_100154821 | |||
| 2401 | Ga0307416_101099398 | |||
| 2402 | Ga0307414_10297741 | |||
| 2403 | Ga0307414_10435879 | |||
| 2404 | Ga0307414_10578581 | |||
| 2405 | Ga0307411_10634820 | |||
| 2406 | Ga0307415_100047280 | |||
| 2407 | Ga0307415_100065634 | |||
| 2408 | Ga0307415_100080857 | |||
| 2409 | Ga0307415_100448254 | |||
| 2410 | Ga0307510_10006103 | |||
| 2411 | Ga0315913_1000016 | |||
| 2412 | Ga0315915_1000005 | |||
| 2413 | Ga0373950_0016026 | |||
| 2414 | Ga0373932_0018430 | |||
| 2415 | Ga0316574_0090561 | |||
| 2416 | Ga0373931_0265539 | |||
| 2417 | Ga0373935_0490795 | |||
| 2418 | Ga0373927_0044424 | |||
| 2419 | Ga0316584_0034277 | |||
| 2420 | Ga0373925_0009202 | |||
| 2421 | Ga0373925_0504157 | |||
| 2422 | Ga0395899_0000003 | |||
| 2423 | Ga0395899_0000124 | |||
| 2424 | Ga0395899_0005798 | |||
| 2425 | Ga0395899_0015986 | |||
| 2426 | Ga0395899_0020222 | |||
| 2427 | Ga0395899_0072195 | |||
| 2428 | Ga0395899_0079490 | |||
| 2429 | Ga0395899_0119762 | |||
| 2430 | Ga0395899_0277617 | |||
| 2431 | Ga0395900_0000086 | |||
| 2432 | Ga0395900_0009282 | |||
| 2433 | Ga0395900_0028659 | |||
| 2434 | Ga0395900_0078265 | |||
| 2435 | Ga0395900_0091409 | |||
| 2436 | Ga0395900_0094959 | |||
| 2437 | Ga0395900_0231388 | |||
| 2438 | Ga0395900_0375663 | |||
| 2439 | Ga0395900_0586863 | |||
| 2440 | Ga0395898_0000285 | |||
| 2441 | Ga0395898_0005320 | |||
| 2442 | Ga0395898_0015026 | |||
| 2443 | Ga0395898_0020253 | |||
| 2444 | Ga0395898_0054630 | |||
| 2445 | Ga0395898_0057927 | |||
| 2446 | Ga0395898_0138141 | |||
| 2447 | Ga0395898_0675954 | |||
| 2448 | Ga0395898_0713937 | |||
| 2449 | Ga0395905_0000133 | |||
| 2450 | Ga0395905_0001192 | |||
| 2451 | Ga0395905_0009040 | |||
| 2452 | Ga0395905_0022646 | |||
| 2453 | Ga0395905_0032485 | |||
| 2454 | Ga0395905_0047993 | |||
| 2455 | Ga0395905_0049175 | |||
| 2456 | Ga0395905_0057256 | |||
| 2457 | Ga0395905_0075745 | |||
| 2458 | Ga0436364_0477303 | |||
| 2459 | Ga0436364_1483550 | |||
| 2460 | Ga0395901_0000092 | |||
| 2461 | Ga0395901_0059169 | |||
| 2462 | Ga0395901_0135851 | |||
| 2463 | Ga0395901_0272901 | |||
| 2464 | Ga0395901_0278815 | |||
| 2465 | Ga0395901_0320703 | |||
| 2466 | Ga0395901_0357710 | |||
| 2467 | Ga0395901_0433940 | |||
| 2468 | Ga0395901_0718362 | |||
| 2469 | Ga0436365_0172426 | |||
| 2470 | Ga0436360_0128350 | |||
| 2471 | Ga0436361_1068301 | |||
| 2472 | Ga0439436_0018565 | |||
| 2473 | Ga0439438_002499 | |||
| 2474 | Ga0439439_0000167 | |||
| 2475 | Ga0439447_017353 | |||
| 2476 | Ga0439466_0005649 | |||
| 2477 | Ga0439465_0043450 | |||
| 2478 | Ga0451787_375456 | |||
| 2479 | Ga0451791_0372016 | |||
| 2480 | Ga0451797_0412961 | |||
| 2481 | Ga0451797_1592940 | |||
| 2482 | Ga0451845_0403339 | |||
| 2483 | Ga0451847_0456571 | |||
| 2484 | Ga0451849_0249873 | |||
| 2485 | Ga0451855_0519245 | |||
| 2486 | Ga0451853_3280964 | |||
| 2487 | Ga0451853_3662635 | |||
| 2488 | Ga0452268_08108 | |||
| 2489 | Ga0439431_0024355 | |||
| 2490 | Ga0439433_0000009 | |||
| 2491 | Ga0439433_0000060 | |||
| 2492 | Ga0439433_0031738 | |||
| 2493 | Ga0439442_003183 | |||
| 2494 | Ga0439432_003007 | |||
| 2495 | Ga0439432_021736 | |||
| 2496 | Ga0439449_0000822 | |||
| 2497 | Ga0439449_0010414 | |||
| 2498 | Ga0439449_0017291 | |||
| 2499 | Ga0439449_0022734 | |||
| 2500 | Ga0439449_0022817 | |||
| 2501 | Ga0439449_0038752 | |||
| 2502 | Ga0439449_0072326 | |||
| 2503 | Ga0439452_023439 | |||
| 2504 | Ga0439454_024146 | |||
| 2505 | Ga0439457_000415 | |||
| 2506 | Ga0439457_002076 | |||
| 2507 | Ga0439462_0000333 | |||
| 2508 | Ga0439462_0004265 | |||
| 2509 | Ga0439462_0063684 | |||
| 2510 | Ga0450919_000036 | |||
| 2511 | Ga0450923_033312 | |||
| 2512 | Ga0439446_0007611 | |||
| 2513 | Ga0450908_000417 | |||
| 2514 | Ga0450909_000690 | |||
| 2515 | Ga0439434_0005303 | |||
| 2516 | Ga0439435_0017110 | |||
| 2517 | Ga0450918_004267 | |||
| 2518 | Ga0466972_0070585 | |||
| 2519 | Ga0453683_0000002 | |||
| 2520 | Ga0453683_0000848 | |||
| 2521 | Ga0453683_0007480 | |||
| 2522 | Ga0466961_0171647 | |||
| 2523 | Ga0466963_0000551 | |||
| 2524 | Ga0466963_0013745 | |||
| 2525 | Ga0453684_0000006 | |||
| 2526 | Ga0453684_0000048 | |||
| 2527 | Ga0453684_0544482 | |||
| 2528 | Ga0466968_0101030 | |||
| 2529 | Ga0466970_0046089 | |||
| 2530 | Ga0466957_0241358 | |||
| 2531 | Ga0466960_0155106 | |||
| 2532 | Ga0451576_0186193 | |||
| 2533 | Ga0451576_0213557 | |||
| 2534 | Ga0466958_0012379 | |||
| 2535 | Ga0466958_0063741 | |||
| 2536 | Ga0466958_0147632 | |||
| 2537 | Ga0466967_0005549 | |||
| 2538 | Ga0466967_0015125 | |||
| 2539 | Ga0466967_0032079 | |||
| 2540 | Ga0466967_0064140 | |||
| 2541 | Ga0466967_0217932 | |||
| 2542 | Ga0495638_0006458 | |||
| 2543 | Ga0495653_0008062 | |||
| 2544 | Ga0495653_0038307 | |||
| 2545 | Ga0495650_0045538 | |||
| 2546 | Ga0495580_0048533 | |||
| 2547 | Ga0495582_0026943 | |||
| 2548 | Ga0495605_0056839 | |||
| 2549 | Ga0495639_0002717 | |||
| 2550 | Ga0495639_0125428 | |||
| 2551 | Ga0495662_0032753 | |||
| 2552 | Ga0495662_0125037 | |||
| 2553 | Ga0495607_0184233 | |||
| 2554 | Ga0495606_0003931 | |||
| 2555 | Ga0495606_0040817 | |||
| 2556 | Ga0495608_0094790 | |||
| 2557 | Ga0495610_0011758 | |||
| 2558 | Ga0495616_0036341 | |||
| 2559 | Ga0495618_0293807 | |||
| 2560 | Ga0495618_0335582 | |||
| 2561 | Ga0495618_0374818 | |||
| 2562 | Ga0495620_0137895 | |||
| 2563 | Ga0495620_0141682 | |||
| 2564 | Ga0495630_0135225 | |||
| 2565 | Ga0495632_0028927 | |||
| 2566 | Ga0495643_0025280 | |||
| 2567 | Ga0495648_0044152 | |||
| 2568 | Ga0495654_0000635 | |||
| 2569 | Ga0495654_0065960 | |||
| 2570 | Ga0495665_0004205 | |||
| 2571 | Ga0495665_0006628 | |||
| 2572 | Ga0495586_0000879 | |||
| 2573 | Ga0495586_0017309 | |||
| 2574 | Ga0495587_0003433 | |||
| 2575 | Ga0495587_0275380 | |||
| 2576 | Ga0495609_0005705 | |||
| 2577 | Ga0495645_0001581 | |||
| 2578 | Ga0495667_0004009 | |||
| 2579 | Ga0495667_0097009 | |||
| 2580 | Ga0495667_0289715 | |||
| 2581 | Ga0495668_0004368 | |||
| 2582 | Ga0495668_0018076 | |||
| 2583 | Ga0495668_0270723 | |||
| 2584 | Ga0495625_0105363 | |||
| 2585 | Ga0495625_0134729 | |||
| 2586 | Ga0495625_0153701 | |||
| 2587 | Ga0495625_0207939 | |||
| 2588 | Ga0495635_0025255 | |||
| 2589 | Ga0495659_0010930 | |||
| 2590 | Ga0495661_0122459 | |||
| 2591 | Ga0495588_0001385 | |||
| 2592 | Ga0495588_0003429 | |||
| 2593 | Ga0495588_0007477 | |||
| 2594 | Ga0495588_0059848 | |||
| 2595 | Ga0495657_0040369 | |||
| 2596 | Ga0495657_0073272 | |||
| 2597 | Ga0495599_0224696 | |||
| 2598 | Ga0495623_0034629 | |||
| 2599 | Ga0495669_0000009 | |||
| 2600 | Ga0495669_0000153 | |||
| 2601 | Ga0495669_0091910 | |||
| 2602 | Ga0495613_0300963 | |||
| 2603 | Ga0495670_0058999 | |||
| 2604 | Ga0495670_0105887 | |||
| 2605 | Ga0495600_0020885 | |||
| 2606 | Ga0495581_0043902 | |||
| 2607 | Ga0495604_0031099 | |||
| 2608 | Ga0495636_0050778 | |||
| 2609 | Ga0495674_0505928 | |||
| 2610 | Ga0495680_0016626 | |||
| 2611 | Ga0495687_051636 | |||
| 2612 | Ga0495675_0026688 | |||
| 2613 | Ga0495681_0060428 | |||
| 2614 | Ga0495684_0077973 | |||
| 2615 | Ga0495686_0000852 | |||
| 2616 | Ga0495686_0008302 | |||
| 2617 | Ga0495686_0094384 | |||
| 2618 | Ga0495593_0019117 | |||
| 2619 | Ga0496100_0013260 | |||
| 2620 | Ga0496100_0081076 | |||
| 2621 | Ga0496101_0017290 | |||
| 2622 | Ga0496101_0044320 | |||
| 2623 | Ga0496101_0059675 | |||
| 2624 | Ga0496101_0060189 | |||
| 2625 | Ga0496101_0271258 | |||
| 2626 | Ga0496102_0005681 | |||
| 2627 | Ga0496102_0005930 | |||
| 2628 | Ga0496102_0016011 | |||
| 2629 | Ga0496102_0069810 | |||
| 2630 | Ga0496103_0002113 | |||
| 2631 | Ga0496103_0007511 | |||
| 2632 | Ga0496103_0064827 | |||
| 2633 | Ga0496103_0108511 | |||
| 2634 | Ga0496104_0045979 | |||
| 2635 | Ga0496104_0157489 | |||
| 2636 | Ga0496105_0017399 | |||
| 2637 | Ga0496105_0028335 | |||
| 2638 | Ga0496105_0031283 | |||
| 2639 | Ga0496106_0009583 | |||
| 2640 | Ga0496106_0052469 | |||
| 2641 | Ga0496106_0115013 | |||
| 2642 | Ga0496107_0009215 | |||
| 2643 | Ga0496107_0011077 | |||
| 2644 | Ga0496107_0022043 | |||
| 2645 | Ga0496107_0096943 | |||
| 2646 | Ga0496108_0328271 | |||
| 2647 | Ga0496109_0013737 | |||
| 2648 | Ga0496109_0160319 | |||
| 2649 | Ga0496109_0167366 | |||
| 2650 | Ga0496109_0425294 | |||
| 2651 | Ga0496110_0019081 | |||
| 2652 | Ga0496110_0066728 | |||
| 2653 | Ga0496110_0070903 | |||
| 2654 | Ga0496110_0311837 | |||
| 2655 | Ga0496110_0371985 | |||
| 2656 | Ga0496111_0002534 | |||
| 2657 | Ga0496111_0028422 | |||
| 2658 | Ga0496111_0114775 | |||
| 2659 | Ga0496111_0157767 | |||
| 2660 | Ga0496111_0236973 | |||
| 2661 | Ga0496111_0266716 | |||
| 2662 | Ga0496112_0000720 | |||
| 2663 | Ga0496112_0057323 | |||
| 2664 | Ga0496112_0126747 | |||
| 2665 | Ga0496112_0251571 | |||
| 2666 | Ga0496113_0044249 | |||
| 2667 | Ga0496113_0044795 | |||
| 2668 | Ga0496114_0034913 | |||
| 2669 | Ga0496114_0066033 | |||
| 2670 | Ga0496114_0093662 | |||
| 2671 | Ga0496115_0024704 | |||
| 2672 | Ga0496115_0110781 | |||
| 2673 | Ga0496115_0136398 | |||
| 2674 | Ga0496115_0198520 | |||
| 2675 | Ga0496115_0544471 | |||
| 2676 | Ga0496116_0000471 | |||
| 2677 | Ga0496116_0006412 | |||
| 2678 | Ga0496116_0021816 | |||
| 2679 | Ga0496116_0032549 | |||
| 2680 | Ga0496116_0045918 | |||
| 2681 | Ga0496117_0000052 | |||
| 2682 | Ga0496117_0000926 | |||
| 2683 | Ga0496117_0002079 | |||
| 2684 | Ga0496117_0022166 | |||
| 2685 | Ga0496117_0028573 | |||
| 2686 | Ga0496118_0000792 | |||
| 2687 | Ga0496118_0001977 | |||
| 2688 | Ga0496118_0015866 | |||
| 2689 | Ga0496118_0023162 | |||
| 2690 | Ga0496119_0005539 | |||
| 2691 | Ga0496119_0007934 | |||
| 2692 | Ga0496119_0012383 | |||
| 2693 | Ga0496119_0023594 | |||
| 2694 | Ga0496119_0028943 | |||
| 2695 | Ga0496119_0064456 | |||
| 2696 | Ga0496119_0089163 | |||
| 2697 | Ga0496120_0000019 | |||
| 2698 | Ga0496120_0005030 | |||
| 2699 | Ga0496120_0099216 | |||
| 2700 | Ga0496120_0099510 | |||
| 2701 | Ga0496121_0000003 | |||
| 2702 | Ga0496121_0000442 | |||
| 2703 | Ga0496121_0007187 | |||
| 2704 | Ga0496121_0009686 | |||
| 2705 | Ga0496121_0032256 | |||
| 2706 | Ga0496121_0149771 | |||
| 2707 | Ga0496122_0000042 | |||
| 2708 | Ga0496122_0000053 | |||
| 2709 | Ga0496122_0008527 | |||
| 2710 | Ga0496122_0018036 | |||
| 2711 | Ga0496122_0030136 | |||
| 2712 | Ga0496123_0000030 | |||
| 2713 | Ga0496123_0000038 | |||
| 2714 | Ga0496123_0006991 | |||
| 2715 | Ga0496123_0014925 | |||
| 2716 | Ga0496123_0032380 | |||
| 2717 | Ga0496123_0034916 | |||
| 2718 | Ga0496123_0205788 | |||
| 2719 | Ga0496124_0001932 | |||
| 2720 | Ga0496124_0009594 | |||
| 2721 | Ga0496124_0010356 | |||
| 2722 | Ga0496124_0021455 | |||
| 2723 | Ga0496124_0022392 | |||
| 2724 | Ga0496124_0035547 | |||
| 2725 | Ga0496124_0046484 | |||
| 2726 | Ga0496124_0054364 | |||
| 2727 | Ga0496124_0076409 | |||
| 2728 | Ga0496124_0099570 | |||
| 2729 | Ga0496124_0120441 | |||
| 2730 | Ga0496124_0152582 | |||
| 2731 | Ga0496124_0253426 | |||
| 2732 | Ga0496125_0000170 | |||
| 2733 | Ga0496125_0000611 | |||
| 2734 | Ga0496125_0044183 | |||
| 2735 | Ga0496125_0229273 | |||
| 2736 | Ga0496125_0250537 | |||
| 2737 | Ga0496126_0000640 | |||
| 2738 | Ga0496126_0002372 | |||
| 2739 | Ga0496126_0067226 | |||
| 2740 | Ga0496126_0290682 | |||
| 2741 | Ga0501309_019150 | |||
| 2742 | Ga0501304_001866 | |||
| 2743 | Ga0501305_030646 | |||
| 2744 | Ga0501312_013804 | |||
| 2745 | Ga0501314_002497 | |||
| 2746 | Ga0501315_002817 | |||
| 2747 | Ga0501317_005340 | |||
| 2748 | Ga0501318_000524 | |||
| 2749 | Ga0501318_005739 | |||
| 2750 | Ga0501320_003313 | |||
| 2751 | Ga0501321_001114 | |||
| 2752 | Ga0501321_016663 | |||
| 2753 | Ga0501323_005732 | |||
| 2754 | Ga0501340_003880 | |||
| 2755 | Ga0501031_0014277 | |||
| 2756 | Ga0501031_0097270 | |||
| 2757 | Ga0501031_0119662 | |||
| 2758 | Ga0501032_0005338 | |||
| 2759 | Ga0501032_0006157 | |||
| 2760 | Ga0501032_0035359 | |||
| 2761 | Ga0501032_0094584 | |||
| 2762 | Ga0501032_0102286 | |||
| 2763 | Ga0501032_0252081 | |||
| 2764 | Ga0501033_0000318 | |||
| 2765 | Ga0501033_0012344 | |||
| 2766 | Ga0501033_0015989 | |||
| 2767 | Ga0501033_0055013 | |||
| 2768 | Ga0501033_0056189 | |||
| 2769 | Ga0501033_0078764 | |||
| 2770 | Ga0501033_0105754 | |||
| 2771 | Ga0501033_0265589 | |||
| 2772 | Ga0501033_0323046 | |||
| 2773 | Ga0501034_0000016 | |||
| 2774 | Ga0501034_0000076 | |||
| 2775 | Ga0501034_0025717 | |||
| 2776 | Ga0501034_0026667 | |||
| 2777 | Ga0501034_0040959 | |||
| 2778 | Ga0501034_0059256 | |||
| 2779 | Ga0501034_0207206 | |||
| 2780 | Ga0501034_0215982 | |||
| 2781 | Ga0501034_0216044 | |||
| 2782 | Ga0501034_0258522 | |||
| 2783 | Ga0501034_0427048 | |||
| 2784 | Ga0501034_0450970 | |||
| 2785 | Ga0501034_0615653 | |||
| 2786 | Ga0501034_0734672 | |||
| 2787 | Ga0501034_0795656 | |||
| 2788 | Ga0501036_0140654 | |||
| 2789 | Ga0501036_0654182 | |||
| 2790 | Ga0501037_0000136 | |||
| 2791 | Ga0501037_0001333 | |||
| 2792 | Ga0501037_0091212 | |||
| 2793 | Ga0501037_0107536 | |||
| 2794 | Ga0501037_0180281 | |||
| 2795 | Ga0501037_0223331 | |||
| 2796 | Ga0501037_0384396 | |||
| 2797 | Ga0501038_0073537 | |||
| 2798 | Ga0501038_0093115 | |||
| 2799 | Ga0501038_0150328 | |||
| 2800 | Ga0501038_0195184 | |||
| 2801 | Ga0501038_0210752 | |||
| 2802 | Ga0501038_0212880 | |||
| 2803 | Ga0501038_0331652 | |||
| 2804 | Ga0501039_0001974 | |||
| 2805 | Ga0501039_0050313 | |||
| 2806 | Ga0501039_0337716 | |||
| 2807 | Ga0501043_0000006 | |||
| 2808 | Ga0501043_0009632 | |||
| 2809 | Ga0501043_0027393 | |||
| 2810 | Ga0501043_0045511 | |||
| 2811 | Ga0501043_0083456 | |||
| 2812 | Ga0501043_0107807 | |||
| 2813 | Ga0501043_0132071 | |||
| 2814 | Ga0501043_0337247 | |||
| 2815 | Ga0501043_0346549 | |||
| 2816 | Ga0501046_0000060 | |||
| 2817 | Ga0501046_0011131 | |||
| 2818 | Ga0501046_0045243 | |||
| 2819 | Ga0501046_0110512 | |||
| 2820 | Ga0501046_0115621 | |||
| 2821 | Ga0501047_0000130 | |||
| 2822 | Ga0501047_0005754 | |||
| 2823 | Ga0501047_0023767 | |||
| 2824 | Ga0501047_0047434 | |||
| 2825 | Ga0501047_0066121 | |||
| 2826 | Ga0501047_0078348 | |||
| 2827 | Ga0501047_0139393 | |||
| 2828 | Ga0501047_0159167 | |||
| 2829 | Ga0501047_0176911 | |||
| 2830 | Ga0501047_0314545 | |||
| 2831 | Ga0501047_0577825 | |||
| 2832 | Ga0501047_0768892 | |||
| 2833 | Ga0501048_0088984 | |||
| 2834 | Ga0501048_0314151 | |||
| 2835 | Ga0501067_0001850 | |||
| 2836 | Ga0501067_0001904 | |||
| 2837 | Ga0501067_0011547 | |||
| 2838 | Ga0501067_0089570 | |||
| 2839 | Ga0501068_0183464 | |||
| 2840 | Ga0501068_0194072 | |||
| 2841 | Ga0501069_0000024 | |||
| 2842 | Ga0501069_0058776 | |||
| 2843 | Ga0501069_0065714 | |||
| 2844 | Ga0501069_0265020 | |||
| 2845 | Ga0501070_0000093 | |||
| 2846 | Ga0501070_0001628 | |||
| 2847 | Ga0501070_0028127 | |||
| 2848 | Ga0501070_0048150 | |||
| 2849 | Ga0501070_0063370 | |||
| 2850 | Ga0501070_0104466 | |||
| 2851 | Ga0501070_0137356 | |||
| 2852 | Ga0501071_0019991 | |||
| 2853 | Ga0501071_0134088 | |||
| 2854 | Ga0501072_0344501 | |||
| 2855 | Ga0501073_0001043 | |||
| 2856 | Ga0501073_0006499 | |||
| 2857 | Ga0501073_0031644 | |||
| 2858 | Ga0501073_0048885 | |||
| 2859 | Ga0501073_0132018 | |||
| 2860 | Ga0501073_0215651 | |||
| 2861 | Ga0501073_0286184 | |||
| 2862 | Ga0501074_0000011 | |||
| 2863 | Ga0501074_0067201 | |||
| 2864 | Ga0501074_0218449 | |||
| 2865 | Ga0501075_0585000 | |||
| 2866 | Ga0501076_0095588 | |||
| 2867 | Ga0501076_0327444 | |||
| 2868 | Ga0501233_022834 | |||
| 2869 | Ga0501249_014808 | |||
| 2870 | Ga0501079_0203850 | |||
| 2871 | Ga0501080_0000004 | |||
| 2872 | Ga0501080_0001346 | |||
| 2873 | Ga0501080_0014444 | |||
| 2874 | Ga0501080_0015694 | |||
| 2875 | Ga0501080_0165199 | |||
| 2876 | Ga0501080_0270799 | |||
| 2877 | Ga0501080_0609410 | |||
| 2878 | Ga0501083_0000097 | |||
| 2879 | Ga0501083_0006732 | |||
| 2880 | Ga0501083_0036629 | |||
| 2881 | Ga0501083_0068497 | |||
| 2882 | Ga0501083_0075083 | |||
| 2883 | Ga0501083_0114881 | |||
| 2884 | Ga0501083_0377277 | |||
| 2885 | Ga0501280_004583 | |||
| 2886 | Ga0501035_0000068 | |||
| 2887 | Ga0501035_0000191 | |||
| 2888 | Ga0501035_0005628 | |||
| 2889 | Ga0501035_0015558 | |||
| 2890 | Ga0501035_0024244 | |||
| 2891 | Ga0501035_0037531 | |||
| 2892 | Ga0501035_0050175 | |||
| 2893 | Ga0501035_0150104 | |||
| 2894 | Ga0501035_0167838 | |||
| 2895 | Ga0501035_0215972 | |||
| 2896 | Ga0501035_0238499 | |||
| 2897 | Ga0501035_0251803 | |||
| 2898 | Ga0501035_0272035 | |||
| 2899 | Ga0501035_0433632 | |||
| 2900 | Ga0501044_0000096 | |||
| 2901 | Ga0501044_0000227 | |||
| 2902 | Ga0501044_0015336 | |||
| 2903 | Ga0501044_0034145 | |||
| 2904 | Ga0501044_0091334 | |||
| 2905 | Ga0501044_0095974 | |||
| 2906 | Ga0501044_0216393 | |||
| 2907 | Ga0501044_0223969 | |||
| 2908 | Ga0501044_0278545 | |||
| 2909 | Ga0501044_0492252 | |||
| 2910 | Ga0501045_0111485 | |||
| 2911 | nmdc:mga03683_23695_c1 | |||
| 2912 | nmdc:mga03683_4150_c1 | |||
| 2913 | nmdc:mga03n38_985_c1 | |||
| 2914 | nmdc:mga00v17_13099_c1 | |||
| 2915 | nmdc:mga00v17_1452_c1 | |||
| 2916 | nmdc:mga00v17_30044_c1 | |||
| 2917 | nmdc:mga00v17_3294_c1 | |||
| 2918 | nmdc:mga00v17_346_c2 | |||
| 2919 | nmdc:mga00v17_34837_c1 | |||
| 2920 | nmdc:mga00v17_5491_c1 | |||
| 2921 | nmdc:mga00v17_55_c1 | |||
| 2922 | nmdc:mga0yw44_10019_c1 | |||
| 2923 | nmdc:mga0yw44_113102_c1 | |||
| 2924 | nmdc:mga0yw44_13785_c1 | |||
| 2925 | nmdc:mga0yw44_18133_c1 | |||
| 2926 | nmdc:mga0yw44_18651_c1 | |||
| 2927 | nmdc:mga0yw44_221381_c1 | |||
| 2928 | nmdc:mga0yw44_42753_c1 | |||
| 2929 | nmdc:mga0yw44_55885_c1 | |||
| 2930 | nmdc:mga0yw44_57531_c1 | |||
| 2931 | nmdc:mga0k408_2026_c1 | |||
| 2932 | nmdc:mga0k408_22262_c1 | |||
| 2933 | nmdc:mga06z11_168428_c1 | |||
| 2934 | nmdc:mga06z11_42828_c1 | |||
| 2935 | nmdc:mga06z11_6363_c1 | |||
| 2936 | nmdc:mga04h51_19483_c1 | |||
| 2937 | nmdc:mga04h51_24571_c1 | |||
| 2938 | nmdc:mga07m45_19471_c1 | |||
| 2939 | nmdc:mga07m45_48666_c1 | |||
| 2940 | nmdc:mga05p37_13210_c1 | |||
| 2941 | nmdc:mga09592_299655_c1 | |||
| 2942 | nmdc:mga0qj67_140319_c1 | |||
| 2943 | nmdc:mga06r32_141587_c1 | |||
| 2944 | nmdc:mga06r32_145692_c1 | |||
| 2945 | nmdc:mga06r32_254070_c1 | |||
| 2946 | nmdc:mga08y16_19492_c1 | |||
| 2947 | nmdc:mga0n895_235902_c1 | |||
| 2948 | nmdc:mga0n895_235970_c1 | |||
| 2949 | nmdc:mga0rr50_201022_c1 | |||
| 2950 | nmdc:mga08x19_24076_c1 | |||
| 2951 | nmdc:mga0a205_670708_c1 | |||
| 2952 | nmdc:mga0a205_69791_c1 | |||
| 2953 | nmdc:mga0sz30_32_c1 | |||
| 2954 | Ga0495612_0077729 | |||
| 2955 | Ga0495595_0114375 | |||
| 2956 | Ga0495619_0006691 | |||
| 2957 | Ga0495619_0124989 | |||
| 2958 | Ga0495619_0218437 | |||
| 2959 | Ga0500578_0031483 | |||
| 2960 | Ga0500641_0000724 | |||
| 2961 | Ga0500555_043140 | |||
| 2962 | Ga0500556_0000245 | |||
| 2963 | Ga0500569_015440 | |||
| 2964 | Ga0500593_000184 | |||
| 2965 | Ga0500595_050259 | |||
| 2966 | Ga0500618_000337 | |||
| 2967 | Ga0500658_0000832 | |||
| 2968 | Ga0500561_0001332 | |||
| 2969 | Ga0500568_0000004 | |||
| 2970 | Ga0500568_0000066 | |||
| 2971 | Ga0500568_0002568 | |||
| 2972 | Ga0500590_000975 | |||
| 2973 | Ga0500616_0000677 | |||
| 2974 | Ga0500616_0002705 | |||
| 2975 | Ga0500616_0010398 | |||
| 2976 | Ga0500616_0056498 | |||
| 2977 | Ga0501084_0047108 | |||
| 2978 | Ga0587066_009767 | |||
| 2979 | Ga0587077_007087 | |||
| 2980 | Ga0587077_011570 | |||
| 2981 | Ga0587077_039791 | |||
| 2982 | Ga0587080_011972 | |||
| 2983 | Ga0587085_025967 | |||
| 2984 | Ga0587086_003962 | |||
| 2985 | Ga0587088_009540 | |||
| 2986 | Ga0587088_055478 | |||
| 2987 | Ga0587089_004516 | |||
| 2988 | Ga0587090_003549 | |||
| 2989 | Ga0587090_017559 | |||
| 2990 | Ga0587094_025508 | |||
| 2991 | Ga0587106_005895 | |||
| 2992 | Ga0587125_002729 | |||
| 2993 | Ga0587131_000391 | |||
| 2994 | Ga0587101_006661 | |||
| 2995 | Ga0587101_026602 | |||
| 2996 | Ga0587115_006083 | |||
| 2997 | Ga0587128_003881 | |||
| 2998 | Ga0587062_002913 | |||
| 2999 | Ga0587062_021918 | |||
| 3000 | Ga0587067_034787 | |||
| 3001 | Ga0587068_005894 | |||
| 3002 | Ga0587072_002513 | |||
| 3003 | Ga0587072_004020 | |||
| 3004 | Ga0587072_011351 | |||
| 3005 | Ga0587079_039765 | |||
| 3006 | Ga0587124_001124 | |||
| 3007 | Ga0501082_0058170 | |||
| 3008 | Ga0501082_0090625 | |||
| 3009 | Ga0501082_0121513 | |||
| 3010 | Ga0501082_0272645 | |||
| 3011 | Ga0466962_0010536 | |||
| 3012 | Ga0466962_0071935 | |||
| 3013 | Ga0466962_0104240 | |||
| 3014 | Ga0530510_0083423 | |||
| 3015 | 2509109744 | |||
| 3016 | 2509379278 | |||
| 3017 | 2509447786 | |||
| 3018 | 2510134698 | |||
| 3019 | 2510307322 | |||
| 3020 | 2510842495 | |||
| 3021 | 2510896049 | |||
| 3022 | 2511136686 | |||
| 3023 | 2511171482 | |||
| 3024 | 2511187187 | |||
| 3025 | 2511200458 | |||
| 3026 | 2511392381 | |||
| 3027 | 2511502896 | |||
| 3028 | 2512534138 | |||
| 3029 | 2512974027 | |||
| 3030 | 2513573250 | |||
| 3031 | 2513578499 | |||
| 3032 | 2513584116 | |||
| 3033 | 2513599087 | |||
| 3034 | 2513602256 | |||
| 3035 | 2513616988 | |||
| 3036 | 2513631463 | |||
| 3037 | 2513710604 | |||
| 3038 | 2513867574 | |||
| 3039 | 2513882001 | |||
| 3040 | 2513905533 | |||
| 3041 | 2513985486 | |||
| 3042 | 2514003899 | |||
| 3043 | 2514023413 | |||
| 3044 | 2515113789 | |||
| 3045 | 2515610446 | |||
| 3046 | 2515634653 | |||
| 3047 | 2515645303 | |||
| 3048 | 2515660891 | |||
| 3049 | 2515743511 | |||
| 3050 | 2516205136 | |||
| 3051 | 2516894302 | |||
| 3052 | 2517037400 | |||
| 3053 | 2517077700 | |||
| 3054 | 2517096499 | |||
| 3055 | 2517410596 | |||
| 3056 | 2517570909 | |||
| 3057 | 2523469464 | |||
| 3058 | 2524451769 | |||
| 3059 | 2524462068 | |||
| 3060 | 2530646816 | |||
| 3061 | 2535485788 | |||
| 3062 | 2535519577 | |||
| 3063 | 2537876439 | |||
| 3064 | 2551674721 | |||
| 3065 | 2551685469 | |||
| 3066 | 2551693876 | |||
| 3067 | 2551698535 | |||
| 3068 | 2551713413 | |||
| 3069 | 2551717355 | |||
| 3070 | 2551730383 | |||
| 3071 | 2551736235 | |||
| 3072 | 2551741347 | |||
| 3073 | 2554245230 | |||
| 3074 | 2555229954 | |||
| 3075 | 2558860318 | |||
| 3076 | 2559296940 | |||
| 3077 | 2561468095 | |||
| 3078 | 2585167913 | |||
| 3079 | 2585204877 | |||
| 3080 | 2585224936 | |||
| 3081 | 2585227649 | |||
| 3082 | 2585257664 | |||
| 3083 | 2585265473 | |||
| 3084 | 2585274157 | |||
| 3085 | 2585280430 | |||
| 3086 | 2585322703 | |||
| 3087 | 2585330820 | |||
| 3088 | 2585388426 | |||
| 3089 | 2585403379 | |||
| 3090 | 2585529610 | |||
| 3091 | 2585532658 | |||
| 3092 | 2585541156 | |||
| 3093 | 2585547492 | |||
| 3094 | 2585554326 | |||
| 3095 | 2585560606 | |||
| 3096 | 2585823675 | |||
| 3097 | 2585839919 | |||
| 3098 | 2585845182 | |||
| 3099 | 2585898817 | |||
| 3100 | 2585903596 | |||
| 3101 | 2585997029 | |||
| 3102 | 2586001630 | |||
| 3103 | 2587981284 | |||
| 3104 | 2599334827 | |||
| 3105 | 2599420683 | |||
| 3106 | 2599604630 | |||
| 3107 | 2599722496 | |||
| 3108 | 2600373762 | |||
| 3109 | 2601611213 | |||
| 3110 | 2601747986 | |||
| 3111 | 2616295420 | |||
| 3112 | 2616307271 | |||
| 3113 | 2616554814 | |||
| 3114 | 2643752063 | |||
| 3115 | 2643771423 | |||
| 3116 | 2643813151 | |||
| 3117 | 2643836882 | |||
| 3118 | 2643858255 | |||
| 3119 | 2643916954 | |||
| 3120 | 2644006264 | |||
| 3121 | 2644050975 | |||
| 3122 | 2644108590 | |||
| 3123 | 2644145636 | |||
| 3124 | 2644191533 | |||
| 3125 | 2644205478 | |||
| 3126 | 2644209959 | |||
| 3127 | 2644241715 | |||
| 3128 | 2644299143 | |||
| 3129 | 2644312287 | |||
| 3130 | 2644335916 | |||
| 3131 | 2644483879 | |||
| 3132 | 2644496275 | |||
| 3133 | 2644500312 | |||
| 3134 | 2644521182 | |||
| 3135 | 2644546773 | |||
| 3136 | 2644617970 | |||
| 3137 | 2644653510 | |||
| 3138 | 2644657371 | |||
| 3139 | 2655032658 | |||
| 3140 | 2657684076 | |||
| 3141 | 2671112068 | |||
| 3142 | 2671691851 | |||
| 3143 | 2692314613 | |||
| 3144 | 2719182468 | |||
| 3145 | 2719387127 | |||
| 3146 | 2719733187 | |||
| 3147 | 2720493191 | |||
| 3148 | 2720614668 | |||
| 3149 | 2720621441 | |||
| 3150 | 2720632769 | |||
| 3151 | 2720776493 | |||
| 3152 | 2721148581 | |||
| 3153 | 2721159967 | |||
| 3154 | 2721165395 | |||
| 3155 | 2721400762 | |||
| 3156 | 2722841565 | |||
| 3157 | 2723028081 | |||
| 3158 | 2723561712 | |||
| 3159 | 2723568341 | |||
| 3160 | 2724039575 | |||
| 3161 | 2724045943 | |||
| 3162 | 2724091100 | |||
| 3163 | 2724105606 | |||
| 3164 | 2724111433 | |||
| 3165 | 2725947685 | |||
| 3166 | 2730109017 | |||
| 3167 | 2730165703 | |||
| 3168 | 2730299599 | |||
| 3169 | 2738800600 | |||
| 3170 | 2738944407 | |||
| 3171 | 2739035708 | |||
| 3172 | 2739351717 | |||
| 3173 | 2753360177 | |||
| 3174 | 2753458711 | |||
| 3175 | 2757570491 | |||
| 3176 | 2758642500 | |||
| 3177 | 2765467283 | |||
| 3178 | 2766065469 | |||
| 3179 | 2770198098 | |||
| 3180 | 2776269947 | |||
| 3181 | 2776281064 | |||
| 3182 | 2776914462 | |||
| 3183 | 2778175888 | |||
| 3184 | 2792582639 | |||
| 3185 | 2792622899 | |||
| 3186 | 2792629153 | |||
| 3187 | 2792640494 | |||
| 3188 | 2793281714 | |||
| 3189 | 2793293780 | |||
| 3190 | 2793313196 | |||
| 3191 | 2793319857 | |||
| 3192 | 2793328139 | |||
| 3193 | 2793333235 | |||
| 3194 | 2793343818 | |||
| 3195 | 2793347238 | |||
| 3196 | 2793356625 | |||
| 3197 | 2793362916 | |||
| 3198 | 2793370058 | |||
| 3199 | 2802718001 | |||
| 3200 | 2802725148 | |||
| 3201 | 2802730728 | |||
| 3202 | 2802738075 | |||
| 3203 | 2802744055 | |||
| 3204 | 2802750934 | |||
| 3205 | 2804753235 | |||
| 3206 | 2805930706 | |||
| 3207 | 2805934179 | |||
| 3208 | 2806044695 | |||
| 3209 | 2806052895 | |||
| 3210 | 2806059195 | |||
| 3211 | 2806068142 | |||
| 3212 | 2806074262 | |||
| 3213 | 2808891465 | |||
| 3214 | 2808987456 | |||
| 3215 | 2819243714 | |||
| 3216 | 2819557226 | |||
| 3217 | 2819609728 | |||
| 3218 | 2819639827 | |||
| 3219 | 2819685550 | |||
| 3220 | 2821126037 | |||
| 3221 | 2833710890 | |||
| 3222 | 2837679087 | |||
| 3223 | 2838018968 | |||
| 3224 | 2838024432 | |||
| 3225 | 2838033007 | |||
| 3226 | 2838046389 | |||
| 3227 | 2838051316 | |||
| 3228 | 2838063706 | |||
| 3229 | 2838664969 | |||
| 3230 | 2838678233 | |||
| 3231 | 2838691466 | |||
| 3232 | 2838716861 | |||
| 3233 | 2838722529 | |||
| 3234 | 2838727610 | |||
| 3235 | 2838733425 | |||
| 3236 | 2838737486 | |||
| 3237 | 2838746003 | |||
| 3238 | 2839998041 | |||
| 3239 | 2840765654 | |||
| 3240 | 2841766481 | |||
| 3241 | 2841842145 | |||
| 3242 | 2841849216 | |||
| 3243 | 2841853715 | |||
| 3244 | 2841861713 | |||
| 3245 | 2841868320 | |||
| 3246 | 2842128035 | |||
| 3247 | 2842133126 | |||
| 3248 | 2842141924 | |||
| 3249 | 2842155120 | |||
| 3250 | 2842162278 | |||
| 3251 | 2842169834 | |||
| 3252 | 2842173619 | |||
| 3253 | 2842178741 | |||
| 3254 | 2842185204 | |||
| 3255 | 2842189968 | |||
| 3256 | 2842199975 | |||
| 3257 | 2842214282 | |||
| 3258 | 2842227001 | |||
| 3259 | 2842233691 | |||
| 3260 | 2842247735 | |||
| 3261 | 2842253893 | |||
| 3262 | 2842261997 | |||
| 3263 | 2842266474 | |||
| 3264 | 2842275940 | |||
| 3265 | 2842288929 | |||
| 3266 | 2842298567 | |||
| 3267 | 2842308076 | |||
| 3268 | 2842316167 | |||
| 3269 | 2842321542 | |||
| 3270 | 2842344858 | |||
| 3271 | 2842362419 | |||
| 3272 | 2842369363 | |||
| 3273 | 2842398667 | |||
| 3274 | 2842406404 | |||
| 3275 | 2842413169 | |||
| 3276 | 2842419812 | |||
| 3277 | 2842429793 | |||
| 3278 | 2842436547 | |||
| 3279 | 2842444250 | |||
| 3280 | 2842450889 | |||
| 3281 | 2842464214 | |||
| 3282 | 2842470876 | |||
| 3283 | 2842479740 | |||
| 3284 | 2842493122 | |||
| 3285 | 2842499308 | |||
| 3286 | 2842506916 | |||
| 3287 | 2842510595 | |||
| 3288 | 2842518021 | |||
| 3289 | 2842695232 | |||
| 3290 | 2842874745 | |||
| 3291 | 2842925953 | |||
| 3292 | 2844106248 | |||
| 3293 | 2844169135 | |||
| 3294 | 2844457640 | |||
| 3295 | 2844849107 | |||
| 3296 | 2847420337 | |||
| 3297 | 2848995149 | |||
| 3298 | 2850082216 | |||
| 3299 | 2851246604 | |||
| 3300 | 2852391046 | |||
| 3301 | 2852679308 | |||
| 3302 | 2854900356 | |||
| 3303 | 2854912979 | |||
| 3304 | 2854920188 | |||
| 3305 | 2855826937 | |||
| 3306 | 2855842333 | |||
| 3307 | 2855878530 | |||
| 3308 | 2857481066 | |||
| 3309 | 2857532599 | |||
| 3310 | 2857634796 | |||
| 3311 | 2857732661 | |||
| 3312 | 2857741918 | |||
| 3313 | 2858803148 | |||
| 3314 | 2870802353 | |||
| 3315 | 2870804435 | |||
| 3316 | 2889793273 | |||
| 3317 | 2889917474 | |||
| 3318 | 2891049307 | |||
| 3319 | 2891377603 | |||
| 3320 | 2894654054 | |||
| 3321 | 2895882162 | |||
| 3322 | 2897563324 | |||
| 3323 | 2899275900 | |||
| 3324 | 2899792801 | |||
| 3325 | 2899845462 | |||
| 3326 | 2904498055 | |||
| 3327 | 2904580339 | |||
| 3328 | 2904777413 | |||
| 3329 | 2910810629 | |||
| 3330 | 2913299750 | |||
| 3331 | 2913309026 | |||
| 3332 | 2915654220 | |||
| 3333 | 2915980456 | |||
| 3334 | 2915987745 | |||
| 3335 | 2915999004 | |||
| 3336 | 2916006173 | |||
| 3337 | 2916013013 | |||
| 3338 | 2916015605 | |||
| 3339 | 2916022472 | |||
| 3340 | 2916029080 | |||
| 3341 | 2916038408 | |||
| 3342 | 2916044834 | |||
| 3343 | 2916054076 | |||
| 3344 | 2916058153 | |||
| 3345 | 2916067034 | |||
| 3346 | 2916068878 | |||
| 3347 | 2916077371 | |||
| 3348 | 2917556592 | |||
| 3349 | 2919034785 | |||
| 3350 | 2919062256 | |||
| 3351 | 2919104412 | |||
| 3352 | 2919117052 | |||
| 3353 | 2919119985 | |||
| 3354 | 2919169778 | |||
| 3355 | 2919393814 | |||
| 3356 | 2919410553 | |||
| 3357 | 2919540250 | |||
| 3358 | 2920828594 | |||
| 3359 | 2921202914 | |||
| 3360 | 2921214573 | |||
| 3361 | 2921242582 | |||
| 3362 | 2921250181 | |||
| 3363 | 2921252274 | |||
| 3364 | 2921257553 | |||
| 3365 | 2921270835 | |||
| 3366 | 2921282897 | |||
| 3367 | 2921292583 | |||
| 3368 | 2921300944 | |||
| 3369 | 2923558920 | |||
| 3370 | 2924149317 | |||
| 3371 | 2924155467 | |||
| 3372 | 2924163257 | |||
| 3373 | 2924171844 | |||
| 3374 | 2924176975 | |||
| 3375 | 2924186278 | |||
| 3376 | 2924191599 | |||
| 3377 | 2924195010 | |||
| 3378 | 2924201627 | |||
| 3379 | 2924213498 | |||
| 3380 | 2924220819 | |||
| 3381 | 2924221861 | |||
| 3382 | 2924233362 | |||
| 3383 | 2926758565 | |||
| 3384 | 2926763903 | |||
| 3385 | 2928123002 | |||
| 3386 | 2928523093 | |||
| 3387 | 2929141293 | |||
| 3388 | 2932428080 | |||
| 3389 | 2933009501 | |||
| 3390 | 2933013650 | |||
| 3391 | 2933023329 | |||
| 3392 | 2933421403 | |||
| 3393 | 2933574525 | |||
| 3394 | 2933589126 | |||
| 3395 | 2933598108 | |||
| 3396 | 2933604733 | |||
| 3397 | 2935899873 | |||
| 3398 | 2935907043 | |||
| 3399 | 2936375012 | |||
| 3400 | 2936380703 | |||
| 3401 | 2936382127 | |||
| 3402 | 2936999940 | |||
| 3403 | 2937007084 | |||
| 3404 | 2937010940 | |||
| 3405 | 2937018274 | |||
| 3406 | 2937025757 | |||
| 3407 | 2937033103 | |||
| 3408 | 2937036605 | |||
| 3409 | 2937044044 | |||
| 3410 | 2937055686 | |||
| 3411 | 2937058405 | |||
| 3412 | 2937067448 | |||
| 3413 | 2937074772 | |||
| 3414 | 2937078522 | |||
| 3415 | 2937091353 | |||
| 3416 | 2937092748 | |||
| 3417 | 2937104948 | |||
| 3418 | 2937111743 | |||
| 3419 | 2937114938 | |||
| 3420 | 2937121445 | |||
| 3421 | 2937129421 | |||
| 3422 | 2937848507 | |||
| 3423 | 2939648500 | |||
| 3424 | 2939672282 | |||
| 3425 | 2939675455 | |||
| 3426 | 2945942901 | |||
| 3427 | 2945959353 | |||
| 3428 | 2946025612 | |||
| 3429 | 2954000048 | |||
| 3430 | 2954013542 | |||
| 3431 | 2957377547 | |||
| 3432 | 2957387668 | |||
| 3433 | 2957389887 | |||
| 3434 | 2957397419 | |||
| 3435 | 2957404648 | |||
| 3436 | 2957409116 | |||
| 3437 | 2957420698 | |||
| 3438 | 2957426439 | |||
| 3439 | 2957435751 | |||
| 3440 | 2957437280 | |||
| 3441 | 2957449450 | |||
| 3442 | 2957452316 | |||
| 3443 | 2957458678 | |||
| 3444 | 2957469699 | |||
| 3445 | 2957472117 | |||
| 3446 | 2957484463 | |||
| 3447 | 2957490933 | |||
| 3448 | 2957496286 | |||
| 3449 | 2957499363 | |||
| 3450 | 2957509074 | |||
| 3451 | 2960585453 | |||
| 3452 | 2960591170 | |||
| 3453 | 2960602272 | |||
| 3454 | 2960609602 | |||
| 3455 | 2960614320 | |||
| 3456 | 2960623449 | |||
| 3457 | 2960627996 | |||
| 3458 | 2960636548 | |||
| 3459 | 2960640534 | |||
| 3460 | 2960651546 | |||
| 3461 | 2960653175 | |||
| 3462 | 2960665373 | |||
| 3463 | 2960672542 | |||
| 3464 | 2960676329 | |||
| 3465 | 2960682538 | |||
| 3466 | 2960692454 | |||
| 3467 | 2960696899 | |||
| 3468 | 2964612910 | |||
| 3469 | 2964619734 | |||
| 3470 | 2964628294 | |||
| 3471 | 2964630953 | |||
| 3472 | 2964637105 | |||
| 3473 | 2964644732 | |||
| 3474 | 2964651413 | |||
| 3475 | 2964657701 | |||
| 3476 | 2964666565 | |||
| 3477 | 2964674593 | |||
| 3478 | 2964679552 | |||
| 3479 | 2964687360 | |||
| 3480 | 2964692327 | |||
| 3481 | 2964702620 | |||
| 3482 | 2964711110 | |||
| 3483 | 2964713287 | |||
| 3484 | 2964722456 | |||
| 3485 | 2967670785 | |||
| 3486 | 2967672818 | |||
| 3487 | 2967685301 | |||
| 3488 | 2967689311 | |||
| 3489 | 2967696258 | |||
| 3490 | 2967701413 | |||
| 3491 | 2967713838 | |||
| 3492 | 2967719980 | |||
| 3493 | 2967727768 | |||
| 3494 | 2967732595 | |||
| 3495 | 2967735288 | |||
| 3496 | 2967745522 | |||
| 3497 | 2967752343 | |||
| 3498 | 2967759268 | |||
| 3499 | 2967766867 | |||
| 3500 | 2967770536 | |||
| 3501 | 2967777554 | |||
| 3502 | 2970025890 | |||
| 3503 | 2970028196 | |||
| 3504 | 2970035020 | |||
| 3505 | 2970042493 | |||
| 3506 | 2970053489 | |||
| 3507 | 2970056063 | |||
| 3508 | 2970063048 | |||
| 3509 | 2970074494 | |||
| 3510 | 2970079216 | |||
| 3511 | 2970087812 | |||
| 3512 | 2970089159 | |||
| 3513 | 2970100291 | |||
| 3514 | 2970103788 | |||
| 3515 | 2970116134 | |||
| 3516 | 2970121249 | |||
| 3517 | 2970126038 | |||
| 3518 | 2970130170 | |||
| 3519 | 2970141212 | |||
| 3520 | 2970146524 | |||
| 3521 | 2970150523 | |||
| 3522 | 2970159310 | |||
| 3523 | 2970166822 | |||
| 3524 | 2970173481 | |||
| 3525 | 2970180679 | |||
| 3526 | 2970191545 | |||
| 3527 | 2970196263 | |||
| 3528 | 2974306751 | |||
| 3529 | 2977519839 | |||
| 3530 | 2977528019 | |||
| 3531 | 2977534247 | |||
| 3532 | 2977541103 | |||
| 3533 | 2977548089 | |||
| 3534 | 2977552173 | |||
| 3535 | 2977560069 | |||
| 3536 | 2977567261 | |||
| 3537 | 2977574862 | |||
| 3538 | 2977579846 | |||
| 3539 | 2978972197 | |||
| 3540 | 2979090999 | |||
| 3541 | 2979096525 | |||
| 3542 | 2979102258 | |||
| 3543 | 2984509794 | |||
| 3544 | 2984519509 | |||
| 3545 | 2984538132 | |||
| 3546 | 2984590423 | |||
| 3547 | 2984604884 | |||
| 3548 | 2989354738 | |||
| 3549 | 2989773420 | |||
| 3550 | 2989779715 | |||
| 3551 | 2995394863 | |||
| 3552 | 2996890112 | |||
| 3553 | 2996895902 | |||
| 3554 | 3002141381 | |||
| 3555 | 3003934812 | |||
| 3556 | 3005415629 | |||
| 3557 | 3005418612 | |||
| 3558 | 3005449129 | |||
| 3559 | 3005455408 | |||
| 3560 | 639649863 | |||
| 3561 | 643826988 | |||
| 3562 | 648735937 | |||
| 3563 | 650843361 | |||
| 3564 | 8003572957 | |||
| 3565 | 8003994871 | |||
| 3566 | 8004002624 | |||
| 3567 | 8005249668 | |||
| 3568 | 8005262167 | |||
| 3569 | 8005281854 | |||
| 3570 | 8005288848 | |||
| 3571 | 8005294433 | |||
| 3572 | 8005306816 | |||
| 3573 | 8005310814 | |||
| 3574 | 8005318496 | |||
| 3575 | 8005324639 | |||
| 3576 | 8005378335 | |||
| 3577 | 8005383980 | |||
| 3578 | 8005401307 | |||
| 3579 | 8005434262 | |||
| 3580 | 8005464476 | |||
| 3581 | 8005488623 | |||
| 3582 | 8005501519 | |||
| 3583 | 8005547274 | |||
| 3584 | 8005558526 | |||
| 3585 | 8005566630 | |||
| 3586 | 8005575081 | |||
| 3587 | 8005622880 | |||
| 3588 | 8005631819 | |||
| 3589 | 8005649090 | |||
| 3590 | 8005658655 | |||
| 3591 | 8005672940 | |||
| 3592 | 8005682329 | |||
| 3593 | 8005693487 | |||
| 3594 | 8005700708 | |||
| 3595 | 8018133754 | |||
| 3596 | 8018153299 | |||
| 3597 | 8018170074 | |||
| 3598 | 8018178600 | |||
| 3599 | 8023687697 | |||
| 3600 | 8024481640 | |||
| 3601 | 8024487873 | |||
| 3602 | 8024506093 | |||
| 3603 | 8045867498 | |||
| 3604 | 8046772037 | |||
| 3605 | 8049295847 | |||
| 3606 | 8054463363 | |||
| 3607 | 8054565621 | |||
| 3608 | 8055432123 | |||
| 3609 | 8056381444 | |||
| 3610 | 8056386887 | |||
| 3611 | 8057577531 | |||
| 3612 | 8057876677 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1mw7-assembly1.cif.gz_A | x-ray structure of y162_helpy northeast structural genomics consortium target pr6 | 0.9298 | 25 | 232 |
| 1mw7-assembly1.cif.gz_A | x-ray structure of y162_helpy northeast structural genomics consortium target pr6 | 0.8775 | 25 | 232 |
| 1lfp-assembly1.cif.gz_A | crystal structure of a conserved hypothetical protein aq1575 from aquifex aeolicus | 0.8613 | 18 | 238 |
| 7b9q-assembly1.cif.gz_A | the serp optimized structure of ribonucleotide reductase from rhodobacter sphaeroides | 0.7767 | 19 | 73 |
| 1kon-assembly1.cif.gz_A | crystal structure of e.coli yebc | 0.7695 | 3 | 239 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_I1K9D8_53_128_1.10.10.200 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Integrase, N-terminal zinc-binding domain | 0.958 | 5 | 80 | 1.10.10.200 |
| 1lfpA02 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;YebC, transcriptional regulation domain | 0.9566 | 82 | 238 | 3.30.70.980 |
| af_Q6F2Z2_64_139_1.10.10.200 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Integrase, N-terminal zinc-binding domain | 0.9562 | 9 | 81 | 1.10.10.200 |
| af_I1K9D8_53_128_1.10.10.200 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Integrase, N-terminal zinc-binding domain | 0.9461 | 5 | 80 | 1.10.10.200 |
| 1mw7A01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Integrase, N-terminal zinc-binding domain | 0.9419 | 27 | 80 | 1.10.10.200 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3D2R6N4-F1-model_v4 | YebC/PmpR family DNA-binding transcriptional regulator | 0.9735 | 32 | 135 |
GO:0003677
GO:0005829 |
| AF-A0A355RH01-F1-model_v4 | YebC/PmpR family DNA-binding transcriptional regulator | 0.9688 | 1 | 118 |
GO:0003677
GO:0005829 |
| AF-A0A2E3IMT4-F1-model_v4 | YebC/PmpR family DNA-binding transcriptional regulator | 0.9571 | 1 | 133 |
GO:0003677
GO:0005737 |
| AF-A0A1E5UAT0-F1-model_v4 | Probable transcriptional regulatory protein BHF72_0982 | 0.9559 | 22 | 239 |
GO:0003677
GO:0005829 GO:0006355 |
| AF-A0A7R9V5A2-F1-model_v4 | YebC/PmpR family DNA-binding transcriptional regulator | 0.9535 | 16 | 121 |
GO:0009507
|