F495756

General Info

Members Datasets Scaffolds Average Seq Length
1807 1073 3612 247

Family's Representative Sequence

Representative Sequence 3300048922|Ga0496119_0020826|Ga0496119_0020826_224_1120
Length 298
Sequence VIALLLDECGSIPYNAAIQHGKRGGRPVCGQTHSYVTLSPCASYEQNRGAMAGHSQFKNIMHRKGRQDAVRSKMFSKLGREITVAAKQGLPDPLMNPRLRLAIQNAKAQSMPKDNIERAIKKAAGNDGENYDEVRYEGRGPGGVMVIVEALTDNRNRTASNVRAAFTKSGGALGETGSAAFMFDRVGEIVYKISVGDADKVMEAAIEAGADDVQSGEEEHVILCAFEDIGEVSKALETALGEAESIKTIWKPQTNTELDEEKARSVLKLLNVLEDDDDVQNVYSNFEVSDEVMEKLSA

Samples

Sample ID Description Type Environment
1 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
4 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
5 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
6 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
7 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
8 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
9 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
10 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
11 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
12 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
13 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
14 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
15 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
16 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
17 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
18 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
19 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
20 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
21 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
22 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
23 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
24 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
25 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
26 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
27 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
28 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
29 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
30 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
31 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
32 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
33 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
34 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
35 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
36 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
37 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
38 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
39 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
40 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
41 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
42 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
43 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
44 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
45 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
46 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
47 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
48 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
49 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
50 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
51 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
52 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
53 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
54 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
55 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
56 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
57 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
58 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
59 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
60 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
61 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
62 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
63 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
64 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
65 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
66 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
67 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
68 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
69 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
70 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
71 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
72 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
73 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
74 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
75 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
76 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
77 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
78 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
79 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
80 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
81 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
82 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
84 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
85 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
86 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
87 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
88 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
89 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
90 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
91 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
92 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
93 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
94 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
95 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
96 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
97 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
98 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
99 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
100 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
101 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
102 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
103 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
104 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
105 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
106 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
107 3300009763 Root nodule microbial communities of legume samples collected from Mexico - Siratro Mexico nodule mix Metagenome Nodule
108 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
109 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
110 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
111 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
112 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
113 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
114 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
115 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
116 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
117 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
118 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
119 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
120 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
121 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
122 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
123 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
124 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
125 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
126 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
127 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
128 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
129 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
130 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
131 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
132 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
133 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
134 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
135 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
136 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
137 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
138 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
139 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
140 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
141 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
142 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
143 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
144 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
145 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
146 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
147 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
148 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
149 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
150 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
151 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
152 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
153 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
154 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
155 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
201 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
202 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
203 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
204 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
205 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
209 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
210 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
211 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
212 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
213 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
214 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
215 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
216 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
217 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
218 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
219 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
220 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
221 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
222 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
223 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
224 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
225 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
226 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
227 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
228 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
229 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
230 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
231 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
232 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
233 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
234 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
235 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
236 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
237 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
238 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
239 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
240 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
241 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
242 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
243 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
244 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
245 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
246 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
247 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
248 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
249 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
250 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
251 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
252 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
253 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
254 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
255 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
256 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
257 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
258 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
259 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
260 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
261 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
262 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
263 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
264 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
265 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
266 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
267 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
268 3300041907 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaT_extra_run Metatranscriptome Unclassified
269 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
270 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
271 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
272 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
273 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
274 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
275 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
276 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
277 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
278 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
279 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
280 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
281 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
282 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
283 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
284 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
285 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
286 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
287 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
288 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
289 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
290 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
291 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
292 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
293 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
294 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
295 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
296 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
297 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
298 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
299 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
300 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
301 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
302 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
303 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
304 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
305 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
306 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
307 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
308 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
309 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
310 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
311 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
312 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
313 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
314 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
315 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
316 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
317 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
318 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
319 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
320 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
321 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
322 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
323 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
324 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
325 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
326 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
327 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
328 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
329 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
330 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
331 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
332 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
333 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
334 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
335 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
336 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
337 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
338 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
339 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
340 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
341 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
342 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
343 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
344 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
345 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
346 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
347 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
348 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
349 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
350 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
351 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
352 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
353 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
354 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
355 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
356 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
357 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
358 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
359 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
360 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
361 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
362 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
363 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
364 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
365 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
366 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
367 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
368 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
369 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
370 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
371 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
372 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
373 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
374 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
375 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
376 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
377 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
378 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
379 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
380 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
381 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
382 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
383 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
384 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
385 3300049556 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
386 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
387 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
388 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
389 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
390 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
391 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
392 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
393 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
394 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
395 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
396 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
397 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
398 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
399 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
400 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
401 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
402 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
403 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
404 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
405 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
406 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
407 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
408 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
409 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
410 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
411 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
412 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
413 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
414 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
415 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
416 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
417 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
418 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
419 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
420 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
421 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
422 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
423 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
424 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
425 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
426 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
427 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
428 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
429 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
430 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
431 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
432 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
433 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
434 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
435 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
436 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
437 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
438 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
439 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
440 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
441 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
442 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
443 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
444 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
445 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
446 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
447 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
448 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
449 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
450 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
451 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
452 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
453 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
454 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
455 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
456 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
457 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
458 3300059509 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
459 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
460 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
461 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
462 3300059607 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
463 3300059609 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 227R_SD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
464 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
465 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
466 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
467 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
468 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
469 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
470 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
471 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
472 3300059660 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 161R_SW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
473 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
474 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
475 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
476 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
477 2509276019 Ensifer aridi TW10 Isolate Nodule
478 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
479 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
480 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
481 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
482 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
483 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
484 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
485 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
486 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
487 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
488 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
489 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
490 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
491 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
492 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
493 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
494 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
495 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
496 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
497 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
498 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
499 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
500 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
501 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
502 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
503 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
504 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
505 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
506 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
507 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
508 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
509 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
510 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
511 2516143018 Ensifer sp. BR816 Isolate Nodule
512 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
513 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
514 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
515 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
516 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
517 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
518 2523231067 Pleomorphomonas oryzae DSM 16300 Isolate Unclassified
519 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
520 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
521 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
522 2534681786 Brucella suis 92/29 Isolate Unclassified
523 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
524 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
525 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
526 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
527 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
528 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
529 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
530 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
531 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
532 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
533 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
534 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
535 2554235227 Arthrobacter sp. PAO19 Isolate Rhizosphere
536 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
537 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
538 2558860983 Allorhizobium undicola ATCC 700741 Isolate Rhizoplane
539 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
540 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
541 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
542 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
543 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
544 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
545 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
546 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
547 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
548 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
549 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
550 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
551 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
552 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
553 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
554 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
555 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
556 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
557 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
558 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
559 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
560 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
561 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
562 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
563 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
564 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
565 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
566 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
567 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
568 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
569 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
570 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
571 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
572 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
573 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
574 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
575 2643221546 Microbacterium sp. Root53 Isolate Unclassified
576 2643221550 Mesorhizobium sp. Root552 Isolate Unclassified
577 2643221558 Rhizobium sp. Root149 Isolate Unclassified
578 2643221564 Mesorhizobium sp. Root157 Isolate Unclassified
579 2643221568 Rhizobium sp. Root564 Isolate Unclassified
580 2643221582 Rhizobium sp. Root651 Isolate Unclassified
581 2643221599 Rhizobium sp. Root708 Isolate Unclassified
582 2643221607 Rhizobium sp. Root73 Isolate Unclassified
583 2643221618 Ensifer sp. Root231 Isolate Unclassified
584 2643221626 Ensifer sp. Root31 Isolate Unclassified
585 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
586 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
587 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
588 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
589 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
590 2643221655 Ensifer sp. Root1252 Isolate Unclassified
591 2643221659 Ensifer sp. Root127 Isolate Unclassified
592 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
593 2643221688 Rhizobium sp. Root482 Isolate Unclassified
594 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
595 2643221693 Rhizobium sp. Root491 Isolate Unclassified
596 2643221698 Ensifer sp. Root142 Isolate Unclassified
597 2643221712 Ensifer sp. Root258 Isolate Unclassified
598 2643221718 Rhizobium sp. Root268 Isolate Unclassified
599 2643221719 Rhizobium sp. Root274 Isolate Unclassified
600 2654587600 Glutamicibacter halophytocola KLBMP5180 Isolate Unclassified
601 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
602 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
603 2671180139 Chelativorans sp. A52C2 Isolate Unclassified
604 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
605 2718217882 Rhizobium sp. N741 Isolate Nodule
606 2718217927 Rhizobium sp. N324 Isolate Nodule
607 2718218009 Rhizobium sp. N561 Isolate Nodule
608 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
609 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
610 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
611 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
612 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
613 2718218363 Rhizobium sp. N113 Isolate Nodule
614 2718218365 Rhizobium sp. N731 Isolate Nodule
615 2718218366 Rhizobium sp. N621 Isolate Nodule
616 2718218423 Rhizobium sp. N941 Isolate Nodule
617 2721755514 Rhizobium sp. N6212 Isolate Nodule
618 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
619 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
620 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
621 2721755809 Rhizobium sp. N541 Isolate Nodule
622 2721755810 Rhizobium sp. N871 Isolate Nodule
623 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
624 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
625 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
626 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
627 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
628 2728369365 Rhizobium sp. N1341 Isolate Nodule
629 2728369397 Rhizobium sp. N1314 Isolate Nodule
630 2738541293 Rhizobium sp. GV031 Isolate Unclassified
631 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
632 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
633 2738543031 Pleomorphomonas sp. CF100 Isolate Unclassified
634 2751185800 Brucella pituitosa AA2 Isolate Unclassified
635 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
636 2757320392 Phyllobacterium leguminum ORS 1419 Isolate Nodule
637 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
638 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
639 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
640 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
641 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
642 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
643 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
644 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
645 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
646 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
647 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
648 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
649 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
650 2791355256 Rhizobium sp. M10 Isolate Nodule
651 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
652 2791355260 Rhizobium sp. L9 Isolate Nodule
653 2791355261 Rhizobium sp. J15 Isolate Nodule
654 2791355262 Rhizobium sp. M1 Isolate Nodule
655 2791355263 Rhizobium chutanense C5 Isolate Nodule
656 2791355264 Rhizobium sp. S9 Isolate Nodule
657 2791355265 Rhizobium sp. H4 Isolate Nodule
658 2791355266 Rhizobium sp. L43 Isolate Nodule
659 2791355267 Rhizobium sp. L18 Isolate Nodule
660 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
661 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
662 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
663 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
664 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
665 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
666 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
667 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
668 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
669 2802429633 Rhizobium anhuiense J3 Isolate Nodule
670 2802429634 Rhizobium anhuiense S10 Isolate Nodule
671 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
672 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
673 2802429637 Rhizobium anhuiense C15 Isolate Nodule
674 2808606370 Arthrobacter sp. SLBN-100 Isolate Unclassified
675 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
676 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
677 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
678 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
679 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
680 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
681 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
682 2833709550 Microbacterium sp. 3290 Isolate Rhizosphere
683 2837678835 Jiella endophytica CBS5Q-3 Isolate Unclassified
684 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
685 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
686 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
687 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
688 2838048938 Rhizobium pisi 27/80 Isolate Nodule
689 2838061910 Rhizobium phaseoli L15 Isolate Nodule
690 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
691 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
692 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
693 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
694 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
695 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
696 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
697 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
698 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
699 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
700 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
701 2841760612 Bosea sp. Tri-49 Isolate Nodule
702 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
703 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
704 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
705 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
706 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
707 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
708 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
709 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
710 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
711 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
712 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
713 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
714 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
715 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
716 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
717 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
718 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
719 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
720 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
721 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
722 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
723 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
724 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
725 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
726 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
727 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
728 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
729 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
730 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
731 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
732 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
733 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
734 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
735 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
736 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
737 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
738 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
739 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
740 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
741 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
742 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
743 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
744 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
745 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
746 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
747 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
748 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
749 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
750 2842694124 Methylopila sp. R-72369 Isolate Unclassified
751 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
752 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
753 2844104063 Bosea sp. Tri-39 Isolate Nodule
754 2844163670 Ensifer sp. 1H6 Isolate Unclassified
755 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
756 2844849076 Arthrobacter cupressi DSM 24664 Isolate Rhizosphere
757 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
758 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
759 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
760 2851246043 Bosea sp. Tri-54 Isolate Nodule
761 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
762 2852677369 Pseudoclavibacter sp. JAI123 Isolate Rhizosphere
763 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
764 2854911287 Brucella lupini LUP21 Isolate Unclassified
765 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
766 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
767 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
768 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
769 2857479173 Micrococcus sp. R-74225 Isolate Unclassified
770 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
771 2857632687 Micrococcus sp. R-73081 Isolate Unclassified
772 2857729791 Plantibacter sp. R-72288 Isolate Unclassified
773 2857740372 Paenarthrobacter sp. R-74611 Isolate Unclassified
774 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
775 2870801768 Micrococcus endophyticus DSM 17945 Isolate Unclassified
776 2870804320 Micrococcus yunnanensis DSM 21948 Isolate Unclassified
777 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
778 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
779 2891048133 Martelella lutilitoris GH2-6 Isolate Rhizosphere
780 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
781 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
782 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
783 2897561785 Pseudoclavibacter endophyticus EGI 60007 Isolate Unclassified
784 2899275550 Paracoccus hibiscisoli CCTCC AB2016182 Isolate Rhizosphere
785 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
786 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
787 2904497146 Arthrobacter sp. 1276 Isolate Rhizosphere
788 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
789 2904776348 Paenarthrobacter sp. 1092 Isolate Rhizosphere
790 2910809715 Paenarthrobacter sp. CM16 Isolate Unclassified
791 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
792 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
793 2915650412 Ochrobactrum sp. CM-21-5 Isolate Rhizosphere
794 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
795 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
796 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
797 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
798 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
799 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
800 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
801 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
802 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
803 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
804 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
805 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
806 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
807 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
808 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
809 2917554339 Chthonobacter rhizosphaerae yh7-1 Isolate Rhizosphere
810 2919034639 Paenarthrobacter nitroguajacolicus 247 Isolate Rhizosphere
811 2919059106 Arthrobacter sp. 1088 Isolate Rhizosphere
812 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
813 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
814 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
815 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
816 2919391150 Arthrobacter ipis 2973 Isolate Unclassified
817 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
818 2919538618 Paenarthrobacter nitroguajacolicus 3945 Isolate Unclassified
819 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
820 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
821 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
822 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
823 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
824 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
825 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
826 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
827 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
828 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
829 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
830 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
831 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
832 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
833 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
834 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
835 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
836 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
837 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
838 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
839 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
840 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
841 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
842 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
843 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
844 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
845 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
846 2928121344 Plantibacter flavus 1756 Isolate Rhizosphere
847 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
848 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
849 2932426870 Paenarthrobacter sp. 4246 Isolate Rhizosphere
850 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
851 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
852 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
853 2933418574 Jeotgalibacillus campisalis 4120 Isolate Rhizosphere
854 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
855 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
856 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
857 2933599457 Rhizobium phaseoli M3 Isolate Nodule
858 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
859 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
860 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
861 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
862 2936381700 Rhizobium chutanense C16 Isolate Unclassified
863 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
864 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
865 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
866 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
867 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
868 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
869 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
870 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
871 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
872 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
873 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
874 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
875 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
876 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
877 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
878 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
879 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
880 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
881 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
882 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
883 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
884 2939647034 Arthrobacter sp. 2762 Isolate Rhizosphere
885 2939669807 Kaistia defluvii 3207 Isolate Rhizosphere
886 2939674588 Arthrobacter bambusae 3552 Isolate Rhizosphere
887 2945941187 Arthrobacter pascens W1I14 Isolate Rhizosphere
888 2945956166 Arthrobacter globiformus W2I3 Isolate Rhizosphere
889 2946024296 Arthrobacter woluwensis W4I2 Isolate Rhizosphere
890 2953998280 Pseudarthrobacter sp. W1I19 Isolate Rhizosphere
891 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
892 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
893 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
894 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
895 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
896 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
897 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
898 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
899 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
900 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
901 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
902 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
903 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
904 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
905 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
906 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
907 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
908 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
909 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
910 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
911 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
912 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
913 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
914 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
915 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
916 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
917 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
918 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
919 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
920 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
921 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
922 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
923 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
924 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
925 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
926 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
927 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
928 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
929 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
930 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
931 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
932 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
933 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
934 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
935 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
936 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
937 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
938 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
939 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
940 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
941 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
942 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
943 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
944 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
945 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
946 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
947 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
948 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
949 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
950 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
951 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
952 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
953 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
954 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
955 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
956 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
957 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
958 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
959 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
960 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
961 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
962 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
963 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
964 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
965 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
966 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
967 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
968 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
969 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
970 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
971 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
972 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
973 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
974 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
975 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
976 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
977 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
978 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
979 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
980 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
981 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
982 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
983 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
984 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
985 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
986 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
987 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
988 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
989 2974302888 Pseudarthrobacter sp. SORGH_AS 212 Isolate Unclassified
990 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
991 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
992 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
993 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
994 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
995 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
996 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
997 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
998 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
999 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
1000 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
1001 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
1002 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
1003 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
1004 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
1005 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
1006 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
1007 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
1008 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
1009 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
1010 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
1011 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
1012 2995392953 Martelella limonii NBRC 109441 Isolate Unclassified
1013 2996887358 Rhizobium sp. R711 Isolate Nodule
1014 2996893221 Rhizobium sp. R635 Isolate Nodule
1015 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
1016 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
1017 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
1018 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
1019 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
1020 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
1021 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
1022 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
1023 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
1024 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
1025 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
1026 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
1027 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
1028 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
1029 8005258706 Rhizobium sp. R693 Isolate Nodule
1030 8005275841 Rhizobium sp. N4311 Isolate Nodule
1031 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
1032 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
1033 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
1034 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
1035 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
1036 8005321885 Rhizobium sp. R72 Isolate Nodule
1037 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
1038 8005382845 Rhizobium sp. R634 Isolate Nodule
1039 8005395548 Rhizobium sp. R339 Isolate Nodule
1040 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
1041 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
1042 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
1043 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
1044 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
1045 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
1046 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
1047 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
1048 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
1049 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
1050 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
1051 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
1052 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
1053 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
1054 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
1055 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
1056 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
1057 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
1058 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
1059 8018176218 Rhizobium sp. N122 Isolate Nodule
1060 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
1061 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
1062 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
1063 8024501048 Rhizobium sp. H4 Isolate Nodule
1064 8045864390 Aurantimonas endophytica KCTC 52296 Isolate Unclassified
1065 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
1066 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
1067 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
1068 8054563764 Acuticoccus kalidii M5D2P5 Isolate Unclassified
1069 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified
1070 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
1071 8056382006 Rhizobium croatiense 13T Isolate Nodule
1072 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
1073 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 64.36
Metatranscriptomes 2.55
Isolates 33.09

Biome Distribution

Category Percentage (%)
Aerial Root 0.28
Bulb 0
Endosphere 10.85
Nodule 22.86
Rhizoplane 3.93
Rhizosphere 50.36
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496119_0020826 3300048922 Bacteria 4763
2 JGI24739J22299_10056206 3300001989 Bacteria 1256
3 JGI24744J21845_10002172 3300002077 Bacteria 3986
4 JGI25156J39149_1000066 3300002705 Bacteria 82816
5 JGI25162J39368_1000488 3300002737 Bacteria 30289
6 JGI25154J39366_1000035 3300002738 Bacteria 172224
7 JGI25157J39369_1000036 3300002741 Bacteria 133671
8 JGI25157J39369_1000197 3300002741 Bacteria 51019
9 JGI25152J39213_1009568 3300002773 Bacteria 2292
10 JGI25159J45721_1000463 3300002987 Bacteria 18770
11 JGI25159J45721_1001920 3300002987 Bacteria 8309
12 JGI25151J46595_10001277 3300003187 Bacteria 17761
13 JGI25151J46595_10002842 3300003187 Bacteria 9972
14 JGI25151J46595_10032258 3300003187 Bacteria 2033
15 JGI25165J46597_1000676 3300003214 Bacteria 27457
16 JGI25165J46597_1001184 3300003214 Bacteria 15921
17 JGI25165J46597_1004445 3300003214 Bacteria 3010
18 rootH1_10034840 3300003323 Bacteria 3538
19 JGI25160J50197_1000100 3300003354 Bacteria 86646
20 JGI25160J50197_1001130 3300003354 Bacteria 13639
21 JGI25160J50197_1022014 3300003354 Bacteria 1878
22 JGI25161J50226_1000072 3300003374 Bacteria 86646
23 JGI25161J50226_1000104 3300003374 Bacteria 67942
24 JGI25161J50226_1000396 3300003374 Bacteria 21728
25 Ga0006562J51391_1020816 3300003578 Bacteria 3830
26 Ga0055526_1001414 3300003771 Bacteria 17081
27 Ga0055526_1017900 3300003771 Bacteria 2676
28 Ga0055526_1024203 3300003771 Bacteria 1996
29 Ga0055526_1028352 3300003771 Bacteria 1696
30 Ga0055524_1002189 3300003775 Bacteria 10270
31 Ga0055524_1005016 3300003775 Bacteria 5995
32 Ga0055524_1008630 3300003775 Bacteria 4219
33 Ga0055524_1010849 3300003775 Bacteria 3602
34 Ga0055524_1015401 3300003775 Bacteria 2790
35 Ga0055524_1025242 3300003775 Bacteria 1865
36 Ga0055536_1019029 3300003781 Bacteria 2175
37 Ga0055528_1000695 3300003790 Bacteria 23949
38 Ga0055528_1005647 3300003790 Bacteria 5775
39 Ga0055528_1008246 3300003790 Bacteria 4499
40 Ga0055528_1011300 3300003790 Bacteria 3559
41 Ga0055528_1021009 3300003790 Bacteria 2092
42 Ga0055530_10018329 3300003791 Bacteria 2162
43 Ga0055530_10056832 3300003791 Bacteria 887
44 Ga0055540_1000752 3300003792 Bacteria 21989
45 Ga0055540_1015474 3300003792 Bacteria 2218
46 Ga0055540_1020091 3300003792 Bacteria 1778
47 Ga0055531_10023282 3300003794 Bacteria 2329
48 Ga0058692_1001306 3300003856 Bacteria 9405
49 Ga0058692_1002399 3300003856 Bacteria 6287
50 Ga0058692_1014818 3300003856 Bacteria 1776
51 Ga0055543_1000078 3300004625 Bacteria 85340
52 Ga0055543_1000280 3300004625 Bacteria 37509
53 Ga0065165_1000623 3300005262 Bacteria 51455
54 Ga0065165_1002557 3300005262 Bacteria 15059
55 Ga0065165_1023432 3300005262 Bacteria 2093
56 Ga0065714_10142918 3300005288 Bacteria 1146
57 Ga0065704_10159503 3300005289 Bacteria 1357
58 Ga0065712_10014529 3300005290 Bacteria 2633
59 Ga0065712_10284402 3300005290 Bacteria 889
60 Ga0065707_10089177 3300005295 Bacteria 4445
61 Ga0070658_10000894 3300005327 Bacteria 25535
62 Ga0070658_10020960 3300005327 Bacteria 5236
63 Ga0070658_10065366 3300005327 Bacteria 2968
64 Ga0070658_10159182 3300005327 Bacteria 1894
65 Ga0070676_10037368 3300005328 Bacteria 2800
66 Ga0070683_100092079 3300005329 Bacteria 2847
67 Ga0070670_100000007 3300005331 Bacteria 318672
68 Ga0070670_100065624 3300005331 Bacteria 3114
69 Ga0070677_10152960 3300005333 Bacteria 1075
70 Ga0070682_100202478 3300005337 Bacteria 1401
71 Ga0068868_100056815 3300005338 Bacteria 3091
72 Ga0068868_100103395 3300005338 Bacteria 2307
73 Ga0070660_100003906 3300005339 Bacteria 10299
74 Ga0070660_100016734 3300005339 Bacteria 5331
75 Ga0070660_100026194 3300005339 Bacteria 4340
76 Ga0070661_100000711 3300005344 Bacteria 24382
77 Ga0070661_100010380 3300005344 Bacteria 6474
78 Ga0070661_100175746 3300005344 Bacteria 1628
79 Ga0070668_100000698 3300005347 Bacteria 22911
80 Ga0070668_100003566 3300005347 Bacteria 11477
81 Ga0070668_100015597 3300005347 Bacteria 5679
82 Ga0070668_100016864 3300005347 Bacteria 5462
83 Ga0070669_100017209 3300005353 Bacteria 5157
84 Ga0070675_100025813 3300005354 Bacteria 4711
85 Ga0070675_100138584 3300005354 Bacteria 2078
86 Ga0070671_100000680 3300005355 Bacteria 24388
87 Ga0070671_100018260 3300005355 Bacteria 5696
88 Ga0070671_100107571 3300005355 Bacteria 2341
89 Ga0070671_100256627 3300005355 Bacteria 1485
90 Ga0070674_100022758 3300005356 Bacteria 4044
91 Ga0070673_100135563 3300005364 Bacteria 2072
92 Ga0070688_100005746 3300005365 Bacteria 6557
93 Ga0070659_100088401 3300005366 Bacteria 2481
94 Ga0070659_100367919 3300005366 Bacteria 1209
95 Ga0070667_100000560 3300005367 Bacteria 36828
96 Ga0070667_100002368 3300005367 Bacteria 16509
97 Ga0070667_100033927 3300005367 Bacteria 4269
98 Ga0070667_100035836 3300005367 Bacteria 4158
99 Ga0070667_100039599 3300005367 Bacteria 3951
100 Ga0070694_100030566 3300005444 Bacteria 3525
101 Ga0070694_100139436 3300005444 Bacteria 1759
102 Ga0070663_100089633 3300005455 Bacteria 2276
103 Ga0070663_100109678 3300005455 Bacteria 2072
104 Ga0070663_100119414 3300005455 Bacteria 1990
105 Ga0070663_100308946 3300005455 Bacteria 1268
106 Ga0070678_100014493 3300005456 Bacteria 4976
107 Ga0070681_10034749 3300005458 Bacteria 5062
108 Ga0070681_10114505 3300005458 Bacteria 2635
109 Ga0070681_10131608 3300005458 Bacteria 2434
110 Ga0070681_10202347 3300005458 Bacteria 1904
111 Ga0070681_10701687 3300005458 Bacteria 928
112 Ga0070707_100000419 3300005468 Bacteria 41972
113 Ga0070699_100478633 3300005518 Bacteria 1130
114 Ga0070699_100535106 3300005518 Bacteria 1066
115 Ga0070679_100010746 3300005530 Bacteria 8694
116 Ga0070679_100016613 3300005530 Bacteria 7107
117 Ga0070679_100128027 3300005530 Bacteria 2521
118 Ga0068853_100000320 3300005539 Bacteria 33466
119 Ga0068853_100364565 3300005539 Bacteria 1347
120 Ga0070665_100001645 3300005548 Bacteria 25760
121 Ga0070665_100002076 3300005548 Bacteria 22480
122 Ga0070665_100023709 3300005548 Bacteria 6181
123 Ga0070665_100036777 3300005548 Bacteria 4923
124 Ga0070665_100038919 3300005548 Bacteria 4781
125 Ga0070665_100213000 3300005548 Bacteria 1933
126 Ga0070665_100214059 3300005548 Bacteria 1928
127 Ga0070665_100494499 3300005548 Bacteria 1234
128 Ga0070704_100158381 3300005549 Bacteria 1788
129 Ga0068855_100237447 3300005563 Bacteria 2038
130 Ga0068855_100683284 3300005563 Bacteria 1100
131 Ga0070664_100095467 3300005564 Bacteria 2579
132 Ga0068857_100007929 3300005577 Bacteria 9164
133 Ga0068854_100016799 3300005578 Bacteria 4884
134 Ga0068854_100049485 3300005578 Bacteria 3002
135 Ga0068854_100063977 3300005578 Bacteria 2671
136 Ga0068854_100234496 3300005578 Bacteria 1458
137 Ga0068856_100039088 3300005614 Bacteria 4659
138 Ga0068856_100209447 3300005614 Bacteria 1964
139 Ga0068852_100005347 3300005616 Bacteria 9172
140 Ga0068852_100021220 3300005616 Bacteria 5180
141 Ga0068852_100057334 3300005616 Bacteria 3370
142 Ga0068852_100060942 3300005616 Bacteria 3277
143 Ga0068852_100128153 3300005616 Bacteria 2333
144 Ga0068852_100189602 3300005616 Bacteria 1939
145 Ga0068852_100586486 3300005616 Bacteria 1118
146 Ga0068859_100002330 3300005617 Bacteria 19304
147 Ga0068859_100004673 3300005617 Bacteria 13948
148 Ga0068859_100077898 3300005617 Bacteria 3356
149 Ga0068859_100086490 3300005617 Bacteria 3182
150 Ga0068864_100000095 3300005618 Bacteria 91554
151 Ga0068861_100167728 3300005719 Bacteria 1817
152 Ga0068851_10002754 3300005834 Bacteria 7742
153 Ga0068851_10009811 3300005834 Bacteria 4459
154 Ga0068851_10086230 3300005834 Bacteria 1647
155 Ga0068863_100000566 3300005841 Bacteria 37590
156 Ga0068863_100001255 3300005841 Bacteria 25283
157 Ga0068863_100001274 3300005841 Bacteria 25120
158 Ga0068863_100503216 3300005841 Bacteria 1193
159 Ga0068858_100000408 3300005842 Bacteria 44660
160 Ga0068858_100008334 3300005842 Bacteria 9973
161 Ga0068860_100000204 3300005843 Bacteria 93995
162 Ga0068860_100001329 3300005843 Bacteria 26865
163 Ga0068860_100114548 3300005843 Bacteria 2578
164 Ga0068860_100163268 3300005843 Bacteria 2149
165 Ga0068860_100486502 3300005843 Bacteria 1230
166 Ga0068862_100001099 3300005844 Bacteria 25679
167 Ga0068862_100384906 3300005844 Bacteria 1309
168 Ga0081455_10035277 3300005937 Bacteria 4473
169 Ga0081455_10089432 3300005937 Bacteria 2499
170 Ga0075365_10020781 3300006038 Bacteria 4078
171 Ga0075365_10028497 3300006038 Bacteria 3563
172 Ga0075365_10060257 3300006038 Bacteria 2532
173 Ga0075365_10075414 3300006038 Bacteria 2276
174 Ga0075365_10235632 3300006038 Bacteria 1285
175 Ga0075368_10006205 3300006042 Bacteria 4165
176 Ga0075363_100000517 3300006048 Bacteria 12410
177 Ga0075363_100081721 3300006048 Bacteria 1768
178 Ga0075364_10000330 3300006051 Bacteria 23530
179 Ga0075364_10004100 3300006051 Bacteria 8361
180 Ga0075364_10006116 3300006051 Bacteria 7047
181 Ga0075364_10018863 3300006051 Bacteria 4326
182 Ga0075364_10023387 3300006051 Bacteria 3913
183 Ga0075364_10109383 3300006051 Bacteria 1843
184 Ga0075432_10001362 3300006058 Bacteria 7938
185 Ga0075432_10025711 3300006058 Bacteria 2020
186 Ga0075362_10006339 3300006177 Bacteria 4406
187 Ga0075362_10028612 3300006177 Bacteria 2394
188 Ga0075367_10000817 3300006178 Bacteria 12303
189 Ga0075367_10001867 3300006178 Bacteria 9309
190 Ga0075367_10030850 3300006178 Bacteria 3076
191 Ga0075367_10035201 3300006178 Bacteria 2897
192 Ga0075367_10051829 3300006178 Bacteria 2427
193 Ga0075369_10002835 3300006186 Bacteria 6244
194 Ga0075369_10142406 3300006186 Bacteria 1094
195 Ga0075366_10003864 3300006195 Bacteria 7981
196 Ga0075366_10069473 3300006195 Bacteria 2096
197 Ga0097621_100638531 3300006237 Bacteria 976
198 Ga0075370_10007174 3300006353 Bacteria 5661
199 Ga0075370_10137935 3300006353 Bacteria 1425
200 Ga0075428_100000308 3300006844 Bacteria 48042
201 Ga0075430_100175990 3300006846 Bacteria 1780
202 Ga0075431_100035633 3300006847 Bacteria 5123
203 Ga0075431_100117369 3300006847 Bacteria 2746
204 Ga0075433_10003167 3300006852 Bacteria 12677
205 Ga0075434_100040767 3300006871 Bacteria 4599
206 Ga0075434_100231538 3300006871 Bacteria 1867
207 Ga0075429_100326494 3300006880 Bacteria 1343
208 Ga0068865_100004923 3300006881 Bacteria 8073
209 Ga0075436_100107848 3300006914 Bacteria 1942
210 Ga0097620_100002330 3300006931 Bacteria 19304
211 Ga0097620_100004672 3300006931 Bacteria 13948
212 Ga0097620_100077898 3300006931 Bacteria 3356
213 Ga0097620_100086492 3300006931 Bacteria 3182
214 Ga0079104_1007879 3300006946 Bacteria 3797
215 Ga0099826_10001733 3300006948 Bacteria 13457
216 Ga0099826_10011457 3300006948 Bacteria 6672
217 Ga0099826_10085389 3300006948 Bacteria 1949
218 Ga0075435_100001016 3300007076 Bacteria 17788
219 Ga0075435_100126547 3300007076 Bacteria 2136
220 Ga0075435_100360360 3300007076 Bacteria 1247
221 Ga0105244_10005376 3300009036 Bacteria 8524
222 Ga0105244_10024640 3300009036 Bacteria 3281
223 Ga0105244_10054329 3300009036 Bacteria 2032
224 Ga0105250_10048314 3300009092 Bacteria 1707
225 Ga0105240_10000019 3300009093 Bacteria 406211
226 Ga0105240_10008822 3300009093 Bacteria 14360
227 Ga0105240_10034181 3300009093 Bacteria 6560
228 Ga0105240_10133643 3300009093 Bacteria 2973
229 Ga0105240_10162229 3300009093 Bacteria 2654
230 Ga0105240_10784889 3300009093 Bacteria 1033
231 Ga0111539_10009545 3300009094 Bacteria 12248
232 Ga0114129_10002076 3300009147 Bacteria 27550
233 Ga0105243_10009086 3300009148 Bacteria 7594
234 Ga0105243_10102408 3300009148 Bacteria 2379
235 Ga0105243_10251776 3300009148 Bacteria 1577
236 Ga0105243_10498429 3300009148 Bacteria 1153
237 Ga0105241_10134827 3300009174 Bacteria 2003
238 Ga0105248_10000956 3300009177 Bacteria 32210
239 Ga0105248_10002867 3300009177 Bacteria 19138
240 Ga0105248_10022410 3300009177 Bacteria 7006
241 Ga0105248_10333479 3300009177 Bacteria 1708
242 Ga0105248_10433136 3300009177 Bacteria 1481
243 Ga0105248_10956889 3300009177 Bacteria 967
244 Ga0105248_11187341 3300009177 Bacteria 863
245 Ga0105237_10000734 3300009545 Bacteria 45223
246 Ga0105237_10013543 3300009545 Bacteria 8546
247 Ga0105238_10130517 3300009551 Bacteria 2491
248 Ga0105238_10131601 3300009551 Bacteria 2480
249 Ga0105238_10141831 3300009551 Bacteria 2379
250 Ga0105238_10257715 3300009551 Bacteria 1723
251 Ga0105238_10308719 3300009551 Bacteria 1566
252 Ga0105249_10002691 3300009553 Bacteria 15363
253 Ga0105249_10085780 3300009553 Bacteria 2935
254 Ga0123340_1060268 3300009763 Bacteria 1110
255 Ga0123341_1000014 3300009765 Bacteria 91980
256 Ga0123342_1013040 3300009766 Bacteria 8447
257 Ga0123342_1035140 3300009766 Bacteria 2158
258 Ga0105239_10000574 3300010375 Bacteria 52563
259 Ga0105239_10038018 3300010375 Bacteria 5275
260 Ga0105239_10152314 3300010375 Bacteria 2581
261 Ga0105246_10003419 3300011119 Bacteria 9623
262 Ga0105246_10006000 3300011119 Bacteria 7418
263 Ga0105246_10033470 3300011119 Bacteria 3417
264 Ga0157314_1002199 3300012500 Bacteria 1350
265 Ga0157373_10041542 3300013100 Bacteria 3290
266 Ga0157373_10109717 3300013100 Bacteria 1940
267 Ga0157373_10235596 3300013100 Bacteria 1293
268 Ga0157373_10528331 3300013100 Bacteria 854
269 Ga0157371_10000002 3300013102 Bacteria 665040
270 Ga0157371_10009588 3300013102 Bacteria 7615
271 Ga0157370_10000131 3300013104 Bacteria 89805
272 Ga0157370_10000246 3300013104 Bacteria 69424
273 Ga0157370_10036865 3300013104 Bacteria 4743
274 Ga0157370_10101533 3300013104 Bacteria 2694
275 Ga0157369_10017091 3300013105 Bacteria 8152
276 Ga0157369_10058336 3300013105 Bacteria 4164
277 Ga0157369_10088543 3300013105 Bacteria 3304
278 Ga0157369_10162395 3300013105 Bacteria 2357
279 Ga0157369_10215221 3300013105 Bacteria 2013
280 Ga0157369_10492205 3300013105 Bacteria 1269
281 Ga0163162_10002377 3300013306 Bacteria 17690
282 Ga0163162_10027041 3300013306 Bacteria 5673
283 Ga0157375_10183886 3300013308 Bacteria 2243
284 Ga0157375_10257464 3300013308 Bacteria 1906
285 Ga0157375_10281673 3300013308 Bacteria 1825
286 Ga0157375_10408714 3300013308 Bacteria 1524
287 Ga0157375_10921504 3300013308 Bacteria 1017
288 Ga0163163_10000523 3300014325 Bacteria 34253
289 Ga0182008_10015150 3300014497 Bacteria 4029
290 Ga0182008_10016782 3300014497 Bacteria 3798
291 Ga0157379_10006347 3300014968 Bacteria 10183
292 Ga0157379_10009511 3300014968 Bacteria 8464
293 Ga0157379_10126411 3300014968 Bacteria 2300
294 Ga0182006_1034649 3300015261 Bacteria 2018
295 Ga0182007_10006425 3300015262 Bacteria 5043
296 Ga0183363_1150 3300015690 Bacteria 17320
297 Ga0163161_10306703 3300017792 Bacteria 1252
298 Ga0206353_10568533 3300020082 Bacteria 842
299 Ga0214544_1000893 3300021320 Bacteria 58796
300 Ga0214542_1000115 3300021321 Bacteria 109873
301 Ga0214542_1010937 3300021321 Bacteria 12829
302 Ga0214543_1000008 3300021327 Bacteria 385680
303 Ga0214543_1000098 3300021327 Bacteria 109894
304 Ga0213872_10111147 3300021361 Bacteria 1217
305 Ga0213875_10002358 3300021388 Bacteria 11392
306 Ga0213875_10151488 3300021388 Bacteria 1087
307 Ga0228711_1000003 3300022739 Bacteria 258118
308 Ga0228710_1000003 3300022740 Bacteria 262981
309 Ga0209435_100005 3300025206 Bacteria 573745
310 Ga0209436_100023 3300025208 Bacteria 96401
311 Ga0209436_100027 3300025208 Bacteria 87534
312 Ga0209436_103154 3300025208 Bacteria 4518
313 Ga0209437_100058 3300025233 Bacteria 357279
314 Ga0209437_100313 3300025233 Bacteria 64057
315 Ga0209437_114590 3300025233 Bacteria 1091
316 Ga0207425_1000058 3300025245 Bacteria 149214
317 Ga0207425_1006058 3300025245 Bacteria 3358
318 Ga0207425_1008224 3300025245 Bacteria 2687
319 Ga0207425_1014838 3300025245 Bacteria 1763
320 Ga0209646_1000011 3300025246 Bacteria 573745
321 Ga0209026_1000008 3300025250 Bacteria 573745
322 Ga0209759_1000004 3300025256 Bacteria 573745
323 Ga0209129_1000080 3300025258 Bacteria 186416
324 Ga0209129_1000107 3300025258 Bacteria 154705
325 Ga0209129_1000145 3300025258 Bacteria 115927
326 Ga0209129_1000605 3300025258 Bacteria 24282
327 Ga0209129_1000714 3300025258 Bacteria 21436
328 Ga0209129_1001284 3300025258 Bacteria 14344
329 Ga0209129_1001351 3300025258 Bacteria 13854
330 Ga0209129_1024521 3300025258 Bacteria 1061
331 Ga0209233_1000157 3300025261 Bacteria 164269
332 Ga0209233_1000354 3300025261 Bacteria 42911
333 Ga0209233_1000380 3300025261 Bacteria 38801
334 Ga0209673_1000060 3300025273 Bacteria 263602
335 Ga0209673_1000233 3300025273 Bacteria 108504
336 Ga0209673_1000781 3300025273 Bacteria 42606
337 Ga0209673_1001374 3300025273 Bacteria 23942
338 Ga0209673_1005142 3300025273 Bacteria 6693
339 Ga0209673_1010151 3300025273 Bacteria 3998
340 Ga0209673_1014773 3300025273 Bacteria 3005
341 Ga0209673_1016024 3300025273 Bacteria 2819
342 Ga0209130_1000083 3300025284 Bacteria 162582
343 Ga0209130_1000173 3300025284 Bacteria 92248
344 Ga0209675_1019772 3300025291 Bacteria 1843
345 Ga0209676_1009832 3300025292 Bacteria 4068
346 Ga0209025_1000052 3300025294 Bacteria 324648
347 Ga0209025_1000083 3300025294 Bacteria 265556
348 Ga0209025_1000255 3300025294 Bacteria 125764
349 Ga0209025_1000350 3300025294 Bacteria 99649
350 Ga0209025_1002871 3300025294 Bacteria 17276
351 Ga0209025_1004678 3300025294 Bacteria 11692
352 Ga0209025_1015394 3300025294 Bacteria 4613
353 Ga0209025_1026479 3300025294 Bacteria 2910
354 Ga0209564_1000116 3300025295 Bacteria 207889
355 Ga0209564_1000125 3300025295 Bacteria 201709
356 Ga0209564_1001273 3300025295 Bacteria 27736
357 Ga0209564_1003981 3300025295 Bacteria 9378
358 Ga0209564_1006272 3300025295 Bacteria 6478
359 Ga0209564_1010520 3300025295 Bacteria 4249
360 Ga0209758_1000090 3300025297 Bacteria 246564
361 Ga0209758_1000839 3300025297 Bacteria 42882
362 Ga0209758_1000928 3300025297 Bacteria 39646
363 Ga0209758_1001034 3300025297 Bacteria 36440
364 Ga0209758_1001969 3300025297 Bacteria 22184
365 Ga0209758_1003215 3300025297 Bacteria 15224
366 Ga0209758_1009519 3300025297 Bacteria 6017
367 Ga0209758_1015321 3300025297 Bacteria 3982
368 Ga0209050_1003361 3300025298 Bacteria 11915
369 Ga0209050_1005007 3300025298 Bacteria 8609
370 Ga0209256_1000302 3300025299 Bacteria 86634
371 Ga0209256_1001684 3300025299 Bacteria 21424
372 Ga0209256_1001904 3300025299 Bacteria 19087
373 Ga0209256_1006695 3300025299 Bacteria 5984
374 Ga0209256_1007478 3300025299 Bacteria 5371
375 Ga0209256_1009497 3300025299 Bacteria 4255
376 Ga0207426_1000047 3300025302 Bacteria 417011
377 Ga0207426_1000173 3300025302 Bacteria 162697
378 Ga0207426_1000276 3300025302 Bacteria 106148
379 Ga0207426_1001540 3300025302 Bacteria 18739
380 Ga0209051_1000217 3300025303 Bacteria 97218
381 Ga0209051_1003071 3300025303 Bacteria 11278
382 Ga0209051_1013849 3300025303 Bacteria 3805
383 Ga0209051_1017658 3300025303 Bacteria 3182
384 Ga0209051_1023760 3300025303 Bacteria 2540
385 Ga0209051_1044997 3300025303 Bacteria 1532
386 Ga0209257_1002359 3300025304 Bacteria 18962
387 Ga0209257_1003258 3300025304 Bacteria 14215
388 Ga0209257_1026373 3300025304 Bacteria 1960
389 Ga0207697_10000777 3300025315 Bacteria 18070
390 Ga0207697_10016313 3300025315 Bacteria 3059
391 Ga0207656_10007056 3300025321 Bacteria 4079
392 Ga0207655_1002973 3300025728 Bacteria 13016
393 Ga0207655_1003408 3300025728 Bacteria 11860
394 Ga0207688_10143968 3300025901 Bacteria 1404
395 Ga0207680_10151896 3300025903 Bacteria 1544
396 Ga0207647_10023166 3300025904 Bacteria 4111
397 Ga0207647_10032365 3300025904 Bacteria 3360
398 Ga0207647_10190198 3300025904 Bacteria 1190
399 Ga0207685_10104462 3300025905 Bacteria 1217
400 Ga0207645_10003790 3300025907 Bacteria 11354
401 Ga0207705_10285350 3300025909 Bacteria 1264
402 Ga0207705_10428792 3300025909 Bacteria 1024
403 Ga0207654_10131782 3300025911 Bacteria 1583
404 Ga0207707_10070567 3300025912 Bacteria 3044
405 Ga0207707_10236088 3300025912 Bacteria 1590
406 Ga0207695_10000049 3300025913 Bacteria 406233
407 Ga0207695_10002646 3300025913 Bacteria 26177
408 Ga0207695_10169998 3300025913 Bacteria 2106
409 Ga0207695_10326655 3300025913 Bacteria 1423
410 Ga0207671_10000423 3300025914 Bacteria 58526
411 Ga0207660_10046649 3300025917 Bacteria 3058
412 Ga0207657_10013840 3300025919 Bacteria 7895
413 Ga0207657_10033074 3300025919 Bacteria 4665
414 Ga0207657_10060202 3300025919 Bacteria 3259
415 Ga0207649_10007286 3300025920 Bacteria 6016
416 Ga0207649_10028688 3300025920 Bacteria 3278
417 Ga0207649_10132015 3300025920 Bacteria 1698
418 Ga0207652_10046917 3300025921 Bacteria 3689
419 Ga0207652_10245788 3300025921 Bacteria 1613
420 Ga0207681_10010940 3300025923 Bacteria 5574
421 Ga0207681_10017969 3300025923 Bacteria 4447
422 Ga0207694_10017871 3300025924 Bacteria 5360
423 Ga0207694_10025064 3300025924 Bacteria 4532
424 Ga0207694_10058549 3300025924 Bacteria 2996
425 Ga0207694_10208913 3300025924 Bacteria 1590
426 Ga0207694_10254897 3300025924 Bacteria 1436
427 Ga0207650_10000030 3300025925 Bacteria 235824
428 Ga0207650_10007621 3300025925 Bacteria 7375
429 Ga0207650_10023252 3300025925 Bacteria 4393
430 Ga0207650_10551031 3300025925 Bacteria 967
431 Ga0207644_10001318 3300025931 Bacteria 15943
432 Ga0207644_10012003 3300025931 Bacteria 5745
433 Ga0207644_10088856 3300025931 Bacteria 2299
434 Ga0207690_10014391 3300025932 Bacteria 4779
435 Ga0207690_10061781 3300025932 Bacteria 2548
436 Ga0207709_10019698 3300025935 Bacteria 3798
437 Ga0207709_10107250 3300025935 Bacteria 1860
438 Ga0207709_10150025 3300025935 Bacteria 1613
439 Ga0207669_10096773 3300025937 Bacteria 1939
440 Ga0207704_10000732 3300025938 Bacteria 14438
441 Ga0207691_10002449 3300025940 Bacteria 18143
442 Ga0207711_10001411 3300025941 Bacteria 22498
443 Ga0207711_10003037 3300025941 Bacteria 14667
444 Ga0207711_10064476 3300025941 Bacteria 3164
445 Ga0207711_10093560 3300025941 Bacteria 2648
446 Ga0207711_10341662 3300025941 Bacteria 1385
447 Ga0207661_10125732 3300025944 Bacteria 2190
448 Ga0207679_10521673 3300025945 Bacteria 1063
449 Ga0207667_10039773 3300025949 Bacteria 5008
450 Ga0207667_10050469 3300025949 Bacteria 4389
451 Ga0207667_10181735 3300025949 Bacteria 2160
452 Ga0207667_10556790 3300025949 Bacteria 1159
453 Ga0207667_10787625 3300025949 Bacteria 948
454 Ga0207651_10134629 3300025960 Bacteria 1898
455 Ga0207712_10001578 3300025961 Bacteria 15345
456 Ga0207712_10575403 3300025961 Bacteria 971
457 Ga0207668_10000010 3300025972 Bacteria 185249
458 Ga0207668_10000502 3300025972 Bacteria 24518
459 Ga0207668_10011325 3300025972 Bacteria 5414
460 Ga0207668_10148790 3300025972 Bacteria 1810
461 Ga0207668_10543076 3300025972 Bacteria 1006
462 Ga0207640_10018321 3300025981 Bacteria 4113
463 Ga0207640_10037509 3300025981 Bacteria 3050
464 Ga0207640_10054952 3300025981 Bacteria 2606
465 Ga0207640_10090944 3300025981 Bacteria 2113
466 Ga0207640_10214772 3300025981 Bacteria 1468
467 Ga0207658_10000810 3300025986 Bacteria 26172
468 Ga0207658_10004019 3300025986 Bacteria 10294
469 Ga0207658_10101217 3300025986 Bacteria 2257
470 Ga0207658_10589461 3300025986 Bacteria 998
471 Ga0207677_10656124 3300026023 Bacteria 927
472 Ga0207703_10000171 3300026035 Bacteria 75791
473 Ga0207703_10001817 3300026035 Bacteria 19028
474 Ga0207639_10008114 3300026041 Bacteria 7179
475 Ga0207639_10018028 3300026041 Bacteria 5009
476 Ga0207639_10190099 3300026041 Bacteria 1753
477 Ga0207639_10206687 3300026041 Bacteria 1687
478 Ga0207639_10258988 3300026041 Bacteria 1520
479 Ga0207678_10000075 3300026067 Bacteria 79006
480 Ga0207678_10015962 3300026067 Bacteria 6596
481 Ga0207678_10153082 3300026067 Bacteria 1969
482 Ga0207702_10035243 3300026078 Bacteria 4184
483 Ga0207702_10040011 3300026078 Bacteria 3930
484 Ga0207702_10074658 3300026078 Bacteria 2927
485 Ga0207641_10000007 3300026088 Bacteria 441443
486 Ga0207641_10001223 3300026088 Bacteria 25730
487 Ga0207641_10059544 3300026088 Bacteria 3252
488 Ga0207641_10072576 3300026088 Bacteria 2964
489 Ga0207641_10409698 3300026088 Bacteria 1303
490 Ga0207676_10000095 3300026095 Bacteria 80405
491 Ga0207676_10000268 3300026095 Bacteria 45354
492 Ga0207674_10005582 3300026116 Bacteria 14914
493 Ga0207674_10067558 3300026116 Bacteria 3599
494 Ga0207674_10217523 3300026116 Bacteria 1859
495 Ga0207674_10298985 3300026116 Bacteria 1558
496 Ga0207683_10002422 3300026121 Bacteria 16293
497 Ga0207698_10012352 3300026142 Bacteria 5585
498 Ga0207698_10096926 3300026142 Bacteria 2432
499 Ga0207698_10666257 3300026142 Bacteria 1032
500 Ga0209281_1000068 3300027111 Bacteria 280238
501 Ga0209281_1000081 3300027111 Bacteria 258084
502 Ga0209281_1000269 3300027111 Bacteria 100505
503 Ga0209371_1000003 3300027312 Bacteria 1122971
504 Ga0209371_1001970 3300027312 Bacteria 12422
505 Ga0209371_1004843 3300027312 Bacteria 5644
506 Ga0209282_1000040 3300027666 Bacteria 127969
507 Ga0209282_1005392 3300027666 Bacteria 7844
508 Ga0209813_10002642 3300027866 Bacteria 4120
509 Ga0207428_10028693 3300027907 Bacteria 4621
510 Ga0207428_10331709 3300027907 Bacteria 1122
511 Ga0268266_10001182 3300028379 Bacteria 32222
512 Ga0268266_10003080 3300028379 Bacteria 17040
513 Ga0268266_10018839 3300028379 Bacteria 5883
514 Ga0268266_10048496 3300028379 Bacteria 3641
515 Ga0268266_10070595 3300028379 Bacteria 3026
516 Ga0268266_10079092 3300028379 Bacteria 2862
517 Ga0268266_10109764 3300028379 Bacteria 2443
518 Ga0268266_10165162 3300028379 Bacteria 2005
519 Ga0268266_10198594 3300028379 Bacteria 1835
520 Ga0268265_10009764 3300028380 Bacteria 6480
521 Ga0268265_10020309 3300028380 Bacteria 4635
522 Ga0268265_10591016 3300028380 Bacteria 1059
523 Ga0268264_10000125 3300028381 Bacteria 186416
524 Ga0268264_10006798 3300028381 Bacteria 9609
525 Ga0268264_10040817 3300028381 Bacteria 3834
526 Ga0268264_10095086 3300028381 Bacteria 2578
527 Ga0265319_1026846 3300028563 Bacteria 2047
528 Ga0265334_10015152 3300028573 Bacteria 3207
529 Ga0265318_10000001 3300028577 Bacteria 500711
530 Ga0265318_10045221 3300028577 Bacteria 1664
531 Ga0307517_10001755 3300028786 Bacteria 35724
532 Ga0307517_10051943 3300028786 Bacteria 4122
533 Ga0307515_10000017 3300028794 Bacteria 550465
534 Ga0307515_10108497 3300028794 Bacteria 3270
535 Ga0265338_10001954 3300028800 Bacteria 32161
536 Ga0265338_10020392 3300028800 Bacteria 6973
537 Ga0265338_10107543 3300028800 Bacteria 2255
538 Ga0265338_10135374 3300028800 Bacteria 1938
539 Ga0265338_10196329 3300028800 Bacteria 1525
540 Ga0268256_1000004 3300030500 Bacteria 1122967
541 Ga0268256_1001045 3300030500 Bacteria 18558
542 Ga0268256_1002352 3300030500 Bacteria 9744
543 Ga0316181_1198668 3300030744 Bacteria 2128
544 Ga0265325_10004909 3300031241 Bacteria 8349
545 Ga0307513_10001025 3300031456 Bacteria 40478
546 Ga0307513_10003675 3300031456 Bacteria 20751
547 Ga0307513_10022270 3300031456 Bacteria 7454
548 Ga0307513_10238617 3300031456 Bacteria 1625
549 Ga0307408_100009834 3300031548 Bacteria 6303
550 Ga0307408_100024062 3300031548 Bacteria 4154
551 Ga0307408_100125185 3300031548 Bacteria 1997
552 Ga0307408_100147439 3300031548 Bacteria 1854
553 Ga0307408_100237683 3300031548 Bacteria 1495
554 Ga0307408_100324237 3300031548 Bacteria 1298
555 Ga0307408_100442502 3300031548 Bacteria 1125
556 Ga0265313_10004959 3300031595 Bacteria 9959
557 Ga0265313_10005514 3300031595 Bacteria 9274
558 Ga0265342_10033039 3300031712 Bacteria 3185
559 Ga0307405_10005651 3300031731 Bacteria 6059
560 Ga0307405_10038653 3300031731 Bacteria 2879
561 Ga0307405_10087614 3300031731 Bacteria 2052
562 Ga0316577_10056427 3300031733 Bacteria 2192
563 Ga0307413_10017665 3300031824 Bacteria 3721
564 Ga0307413_10021565 3300031824 Bacteria 3453
565 Ga0307413_10031744 3300031824 Bacteria 2985
566 Ga0307413_10132346 3300031824 Bacteria 1709
567 Ga0307413_10347617 3300031824 Bacteria 1143
568 Ga0307413_10368866 3300031824 Bacteria 1114
569 Ga0307413_10368993 3300031824 Bacteria 1114
570 Ga0307410_10023042 3300031852 Bacteria 3862
571 Ga0307410_10066580 3300031852 Bacteria 2482
572 Ga0307410_10122282 3300031852 Bacteria 1900
573 Ga0307410_10124450 3300031852 Bacteria 1885
574 Ga0307410_10136708 3300031852 Bacteria 1807
575 Ga0307410_10233966 3300031852 Bacteria 1420
576 Ga0307410_10325903 3300031852 Bacteria 1220
577 Ga0307406_10005179 3300031901 Bacteria 7118
578 Ga0307406_10284958 3300031901 Bacteria 1262
579 Ga0307407_10052043 3300031903 Bacteria 2350
580 Ga0307407_10079070 3300031903 Bacteria 1983
581 Ga0307412_10001366 3300031911 Bacteria 13566
582 Ga0307412_10076509 3300031911 Bacteria 2299
583 Ga0307412_10163356 3300031911 Bacteria 1657
584 Ga0307412_10219959 3300031911 Bacteria 1455
585 Ga0307412_10411022 3300031911 Bacteria 1104
586 Ga0315914_1000002 3300031967 Bacteria 365357
587 Ga0307409_100003695 3300031995 Bacteria 8390
588 Ga0307409_100059958 3300031995 Bacteria 2965
589 Ga0307409_100065009 3300031995 Bacteria 2868
590 Ga0307409_100261492 3300031995 Bacteria 1588
591 Ga0307409_100489087 3300031995 Bacteria 1196
592 Ga0307416_100017153 3300032002 Bacteria 5056
593 Ga0307416_100073294 3300032002 Bacteria 2854
594 Ga0307416_100154821 3300032002 Bacteria 2108
595 Ga0307416_101099398 3300032002 Bacteria 899
596 Ga0307414_10297741 3300032004 Bacteria 1363
597 Ga0307414_10435879 3300032004 Bacteria 1146
598 Ga0307414_10578581 3300032004 Bacteria 1004
599 Ga0307411_10634820 3300032005 Bacteria 923
600 Ga0307415_100047280 3300032126 Bacteria 2896
601 Ga0307415_100065634 3300032126 Bacteria 2530
602 Ga0307415_100080857 3300032126 Bacteria 2320
603 Ga0307415_100448254 3300032126 Bacteria 1115
604 Ga0307510_10006103 3300033180 Bacteria 14357
605 Ga0315913_1000016 3300033430 Bacteria 113410
606 Ga0315915_1000005 3300033464 Bacteria 397591
607 Ga0373950_0016026 3300034818 Bacteria 1278
608 Ga0373932_0018430 3300035112 Bacteria 1805
609 Ga0316574_0090561 3300035398 Bacteria 1950
610 Ga0373931_0265539 3300035691 Bacteria 1049
611 Ga0373935_0490795 3300035692 Bacteria 891
612 Ga0373927_0044424 3300035695 Bacteria 2875
613 Ga0316584_0034277 3300036712 Bacteria 3764
614 Ga0373925_0009202 3300037068 Bacteria 7191
615 Ga0373925_0504157 3300037068 Bacteria 994
616 Ga0395899_0000003 3300037312 Bacteria 1232684
617 Ga0395899_0000124 3300037312 Bacteria 122011
618 Ga0395899_0005798 3300037312 Bacteria 9583
619 Ga0395899_0015986 3300037312 Bacteria 5723
620 Ga0395899_0020222 3300037312 Bacteria 5051
621 Ga0395899_0072195 3300037312 Bacteria 2525
622 Ga0395899_0079490 3300037312 Bacteria 2388
623 Ga0395899_0119762 3300037312 Bacteria 1887
624 Ga0395899_0277617 3300037312 Bacteria 1141
625 Ga0395900_0000086 3300037418 Bacteria 171749
626 Ga0395900_0009282 3300037418 Bacteria 10087
627 Ga0395900_0028659 3300037418 Bacteria 5706
628 Ga0395900_0078265 3300037418 Bacteria 3397
629 Ga0395900_0091409 3300037418 Bacteria 3128
630 Ga0395900_0094959 3300037418 Bacteria 3063
631 Ga0395900_0231388 3300037418 Bacteria 1858
632 Ga0395900_0375663 3300037418 Bacteria 1390
633 Ga0395900_0586863 3300037418 Bacteria 1056
634 Ga0395898_0000285 3300037466 Bacteria 122279
635 Ga0395898_0005320 3300037466 Bacteria 13914
636 Ga0395898_0015026 3300037466 Bacteria 7947
637 Ga0395898_0020253 3300037466 Bacteria 6758
638 Ga0395898_0054630 3300037466 Bacteria 3896
639 Ga0395898_0057927 3300037466 Bacteria 3773
640 Ga0395898_0138141 3300037466 Bacteria 2333
641 Ga0395898_0675954 3300037466 Bacteria 974
642 Ga0395898_0713937 3300037466 Bacteria 944
643 Ga0395905_0000133 3300037471 Bacteria 123500
644 Ga0395905_0001192 3300037471 Bacteria 32515
645 Ga0395905_0009040 3300037471 Bacteria 9773
646 Ga0395905_0022646 3300037471 Bacteria 5939
647 Ga0395905_0032485 3300037471 Bacteria 4909
648 Ga0395905_0047993 3300037471 Bacteria 4001
649 Ga0395905_0049175 3300037471 Bacteria 3951
650 Ga0395905_0057256 3300037471 Bacteria 3646
651 Ga0395905_0075745 3300037471 Bacteria 3153
652 Ga0436364_0477303 3300037853 Bacteria 13445
653 Ga0436364_1483550 3300037853 Bacteria 1809
654 Ga0395901_0000092 3300038443 Bacteria 121976
655 Ga0395901_0059169 3300038443 Bacteria 3986
656 Ga0395901_0135851 3300038443 Bacteria 2585
657 Ga0395901_0272901 3300038443 Bacteria 1758
658 Ga0395901_0278815 3300038443 Bacteria 1737
659 Ga0395901_0320703 3300038443 Bacteria 1603
660 Ga0395901_0357710 3300038443 Bacteria 1506
661 Ga0395901_0433940 3300038443 Bacteria 1345
662 Ga0395901_0718362 3300038443 Bacteria 995
663 Ga0436365_0172426 3300039437 Bacteria 2802
664 Ga0436360_0128350 3300039438 Bacteria 9271
665 Ga0436361_1068301 3300039447 Bacteria 3639
666 Ga0439436_0018565 3300041404 Bacteria 2079
667 Ga0439438_002499 3300041405 Bacteria 7818
668 Ga0439439_0000167 3300041406 Bacteria 9811
669 Ga0439447_017353 3300041407 Bacteria 1960
670 Ga0439466_0005649 3300041411 Bacteria 4768
671 Ga0439465_0043450 3300041413 Bacteria 1458
672 Ga0451787_375456 3300041441 Bacteria 1432
673 Ga0451791_0372016 3300041451 Bacteria 1210
674 Ga0451797_0412961 3300041453 Bacteria 1554
675 Ga0451797_1592940 3300041453 Bacteria 1033
676 Ga0451845_0403339 3300041501 Bacteria 1628
677 Ga0451847_0456571 3300041503 Bacteria 1192
678 Ga0451849_0249873 3300041505 Bacteria 2624
679 Ga0451855_0519245 3300041511 Bacteria 1193
680 Ga0451853_3280964 3300041512 Bacteria 1704
681 Ga0451853_3662635 3300041512 Bacteria 1872
682 Ga0452268_08108 3300041907 Bacteria 1192
683 Ga0439431_0024355 3300041997 Bacteria 1472
684 Ga0439433_0000009 3300041999 Bacteria 32735
685 Ga0439433_0000060 3300041999 Bacteria 13464
686 Ga0439433_0031738 3300041999 Bacteria 1210
687 Ga0439442_003183 3300042002 Bacteria 3249
688 Ga0439432_003007 3300042006 Bacteria 6276
689 Ga0439432_021736 3300042006 Bacteria 2124
690 Ga0439449_0000822 3300042007 Bacteria 11997
691 Ga0439449_0010414 3300042007 Bacteria 3511
692 Ga0439449_0017291 3300042007 Bacteria 2707
693 Ga0439449_0022734 3300042007 Bacteria 2347
694 Ga0439449_0022817 3300042007 Bacteria 2342
695 Ga0439449_0038752 3300042007 Bacteria 1772
696 Ga0439449_0072326 3300042007 Bacteria 1270
697 Ga0439452_023439 3300042010 Bacteria 1589
698 Ga0439454_024146 3300042011 Bacteria 917
699 Ga0439457_000415 3300042014 Bacteria 12228
700 Ga0439457_002076 3300042014 Bacteria 5858
701 Ga0439462_0000333 3300042015 Bacteria 8843
702 Ga0439462_0004265 3300042015 Bacteria 3478
703 Ga0439462_0063684 3300042015 Bacteria 998
704 Ga0450919_000036 3300042121 Bacteria 11386
705 Ga0450923_033312 3300042125 Bacteria 1059
706 Ga0439446_0007611 3300042156 Bacteria 2853
707 Ga0450908_000417 3300042184 Bacteria 8196
708 Ga0450909_000690 3300042185 Bacteria 4515
709 Ga0439434_0005303 3300042435 Bacteria 3770
710 Ga0439435_0017110 3300042436 Bacteria 1828
711 Ga0450918_004267 3300042531 Bacteria 2615
712 Ga0466972_0070585 3300044658 Bacteria 1667
713 Ga0453683_0000002 3300044673 Bacteria 1244396
714 Ga0453683_0000848 3300044673 Bacteria 29516
715 Ga0453683_0007480 3300044673 Bacteria 7406
716 Ga0466961_0171647 3300044693 Bacteria 1349
717 Ga0466963_0000551 3300044694 Bacteria 17610
718 Ga0466963_0013745 3300044694 Bacteria 4979
719 Ga0453684_0000006 3300044712 Bacteria 1364191
720 Ga0453684_0000048 3300044712 Bacteria 559743
721 Ga0453684_0544482 3300044712 Bacteria 1279
722 Ga0466968_0101030 3300044735 Bacteria 1288
723 Ga0466970_0046089 3300044765 Bacteria 2322
724 Ga0466957_0241358 3300044842 Bacteria 1199
725 Ga0466960_0155106 3300044901 Bacteria 1226
726 Ga0451576_0186193 3300045051 Bacteria 2168
727 Ga0451576_0213557 3300045051 Bacteria 2015
728 Ga0466958_0012379 3300045836 Bacteria 4832
729 Ga0466958_0063741 3300045836 Bacteria 2248
730 Ga0466958_0147632 3300045836 Bacteria 1482
731 Ga0466967_0005549 3300045976 Bacteria 8760
732 Ga0466967_0015125 3300045976 Bacteria 6041
733 Ga0466967_0032079 3300045976 Bacteria 4432
734 Ga0466967_0064140 3300045976 Bacteria 3266
735 Ga0466967_0217932 3300045976 Bacteria 1812
736 Ga0495638_0006458 3300046460 Bacteria 8530
737 Ga0495653_0008062 3300046463 Bacteria 8627
738 Ga0495653_0038307 3300046463 Bacteria 3763
739 Ga0495650_0045538 3300046471 Bacteria 1847
740 Ga0495580_0048533 3300046472 Bacteria 3005
741 Ga0495582_0026943 3300046473 Bacteria 3149
742 Ga0495605_0056839 3300046474 Bacteria 1886
743 Ga0495639_0002717 3300046475 Bacteria 7689
744 Ga0495639_0125428 3300046475 Bacteria 1227
745 Ga0495662_0032753 3300046476 Bacteria 2511
746 Ga0495662_0125037 3300046476 Bacteria 1263
747 Ga0495607_0184233 3300046501 Bacteria 1045
748 Ga0495606_0003931 3300046507 Bacteria 15287
749 Ga0495606_0040817 3300046507 Bacteria 3116
750 Ga0495608_0094790 3300046511 Bacteria 1929
751 Ga0495610_0011758 3300046512 Bacteria 5317
752 Ga0495616_0036341 3300046513 Bacteria 2542
753 Ga0495618_0293807 3300046514 Bacteria 1011
754 Ga0495618_0335582 3300046514 Bacteria 934
755 Ga0495618_0374818 3300046514 Bacteria 874
756 Ga0495620_0137895 3300046515 Bacteria 955
757 Ga0495620_0141682 3300046515 Bacteria 940
758 Ga0495630_0135225 3300046517 Bacteria 1873
759 Ga0495632_0028927 3300046519 Bacteria 2890
760 Ga0495643_0025280 3300046522 Bacteria 3361
761 Ga0495648_0044152 3300046524 Bacteria 2785
762 Ga0495654_0000635 3300046530 Bacteria 27690
763 Ga0495654_0065960 3300046530 Bacteria 1727
764 Ga0495665_0004205 3300046531 Bacteria 7768
765 Ga0495665_0006628 3300046531 Bacteria 6249
766 Ga0495586_0000879 3300046535 Bacteria 17184
767 Ga0495586_0017309 3300046535 Bacteria 3831
768 Ga0495587_0003433 3300046536 Bacteria 10569
769 Ga0495587_0275380 3300046536 Bacteria 944
770 Ga0495609_0005705 3300046538 Bacteria 6481
771 Ga0495645_0001581 3300046543 Bacteria 15422
772 Ga0495667_0004009 3300046559 Bacteria 9890
773 Ga0495667_0097009 3300046559 Bacteria 1908
774 Ga0495667_0289715 3300046559 Bacteria 1038
775 Ga0495668_0004368 3300046616 Bacteria 10085
776 Ga0495668_0018076 3300046616 Bacteria 4080
777 Ga0495668_0270723 3300046616 Bacteria 930
778 Ga0495625_0105363 3300046660 Bacteria 1932
779 Ga0495625_0134729 3300046660 Bacteria 1670
780 Ga0495625_0153701 3300046660 Bacteria 1545
781 Ga0495625_0207939 3300046660 Bacteria 1288
782 Ga0495635_0025255 3300046663 Bacteria 4138
783 Ga0495659_0010930 3300046664 Bacteria 2923
784 Ga0495661_0122459 3300046665 Bacteria 1435
785 Ga0495588_0001385 3300046674 Bacteria 10360
786 Ga0495588_0003429 3300046674 Bacteria 6891
787 Ga0495588_0007477 3300046674 Bacteria 4974
788 Ga0495588_0059848 3300046674 Bacteria 1971
789 Ga0495657_0040369 3300046675 Bacteria 3201
790 Ga0495657_0073272 3300046675 Bacteria 2231
791 Ga0495599_0224696 3300046678 Bacteria 1148
792 Ga0495623_0034629 3300046679 Bacteria 3238
793 Ga0495669_0000009 3300046684 Bacteria 165516
794 Ga0495669_0000153 3300046684 Bacteria 44276
795 Ga0495669_0091910 3300046684 Bacteria 1402
796 Ga0495613_0300963 3300046689 Bacteria 1110
797 Ga0495670_0058999 3300046691 Bacteria 1926
798 Ga0495670_0105887 3300046691 Bacteria 1452
799 Ga0495600_0020885 3300046809 Bacteria 4190
800 Ga0495581_0043902 3300047315 Bacteria 2585
801 Ga0495604_0031099 3300047317 Bacteria 4236
802 Ga0495636_0050778 3300047318 Bacteria 1737
803 Ga0495674_0505928 3300047319 Bacteria 966
804 Ga0495680_0016626 3300047322 Bacteria 6313
805 Ga0495687_051636 3300047443 Bacteria 1743
806 Ga0495675_0026688 3300047444 Bacteria 3682
807 Ga0495681_0060428 3300047470 Bacteria 1749
808 Ga0495684_0077973 3300047471 Bacteria 2514
809 Ga0495686_0000852 3300047472 Bacteria 39191
810 Ga0495686_0008302 3300047472 Bacteria 7637
811 Ga0495686_0094384 3300047472 Bacteria 1813
812 Ga0495593_0019117 3300047673 Bacteria 3845
813 Ga0496100_0013260 3300048903 Bacteria 4747
814 Ga0496100_0081076 3300048903 Bacteria 2191
815 Ga0496101_0017290 3300048904 Bacteria 4890
816 Ga0496101_0044320 3300048904 Bacteria 3182
817 Ga0496101_0059675 3300048904 Bacteria 2766
818 Ga0496101_0060189 3300048904 Bacteria 2755
819 Ga0496101_0271258 3300048904 Bacteria 1324
820 Ga0496102_0005681 3300048905 Bacteria 10589
821 Ga0496102_0005930 3300048905 Bacteria 10404
822 Ga0496102_0016011 3300048905 Bacteria 6545
823 Ga0496102_0069810 3300048905 Bacteria 3225
824 Ga0496103_0002113 3300048906 Bacteria 12648
825 Ga0496103_0007511 3300048906 Bacteria 6496
826 Ga0496103_0064827 3300048906 Bacteria 2278
827 Ga0496103_0108511 3300048906 Bacteria 1761
828 Ga0496104_0045979 3300048907 Bacteria 4107
829 Ga0496104_0157489 3300048907 Bacteria 2179
830 Ga0496105_0017399 3300048908 Bacteria 5762
831 Ga0496105_0028335 3300048908 Bacteria 4580
832 Ga0496105_0031283 3300048908 Bacteria 4363
833 Ga0496106_0009583 3300048909 Bacteria 7150
834 Ga0496106_0052469 3300048909 Bacteria 3076
835 Ga0496106_0115013 3300048909 Bacteria 2098
836 Ga0496107_0009215 3300048910 Bacteria 6840
837 Ga0496107_0011077 3300048910 Bacteria 6274
838 Ga0496107_0022043 3300048910 Bacteria 4499
839 Ga0496107_0096943 3300048910 Bacteria 2158
840 Ga0496108_0328271 3300048911 Bacteria 1334
841 Ga0496109_0013737 3300048912 Bacteria 7035
842 Ga0496109_0160319 3300048912 Bacteria 2107
843 Ga0496109_0167366 3300048912 Bacteria 2061
844 Ga0496109_0425294 3300048912 Bacteria 1255
845 Ga0496110_0019081 3300048913 Bacteria 5764
846 Ga0496110_0066728 3300048913 Bacteria 3182
847 Ga0496110_0070903 3300048913 Bacteria 3089
848 Ga0496110_0311837 3300048913 Bacteria 1433
849 Ga0496110_0371985 3300048913 Bacteria 1302
850 Ga0496111_0002534 3300048914 Bacteria 11025
851 Ga0496111_0028422 3300048914 Bacteria 3962
852 Ga0496111_0114775 3300048914 Bacteria 1985
853 Ga0496111_0157767 3300048914 Bacteria 1684
854 Ga0496111_0236973 3300048914 Bacteria 1355
855 Ga0496111_0266716 3300048914 Bacteria 1270
856 Ga0496112_0000720 3300048915 Bacteria 22965
857 Ga0496112_0057323 3300048915 Bacteria 3835
858 Ga0496112_0126747 3300048915 Bacteria 2523
859 Ga0496112_0251571 3300048915 Bacteria 1718
860 Ga0496113_0044249 3300048916 Bacteria 3297
861 Ga0496113_0044795 3300048916 Bacteria 3279
862 Ga0496114_0034913 3300048917 Bacteria 4152
863 Ga0496114_0066033 3300048917 Bacteria 3032
864 Ga0496114_0093662 3300048917 Bacteria 2554
865 Ga0496115_0024704 3300048918 Bacteria 4673
866 Ga0496115_0110781 3300048918 Bacteria 2255
867 Ga0496115_0136398 3300048918 Bacteria 2023
868 Ga0496115_0198520 3300048918 Bacteria 1657
869 Ga0496115_0544471 3300048918 Bacteria 928
870 Ga0496116_0000471 3300048919 Bacteria 55687
871 Ga0496116_0006412 3300048919 Bacteria 10676
872 Ga0496116_0021816 3300048919 Bacteria 4817
873 Ga0496116_0032549 3300048919 Bacteria 3714
874 Ga0496116_0045918 3300048919 Bacteria 2952
875 Ga0496117_0000052 3300048920 Bacteria 280463
876 Ga0496117_0000926 3300048920 Bacteria 44886
877 Ga0496117_0002079 3300048920 Bacteria 26445
878 Ga0496117_0022166 3300048920 Bacteria 5101
879 Ga0496117_0028573 3300048920 Bacteria 4316
880 Ga0496118_0000792 3300048921 Bacteria 50632
881 Ga0496118_0001977 3300048921 Bacteria 29110
882 Ga0496118_0015866 3300048921 Bacteria 6945
883 Ga0496118_0023162 3300048921 Bacteria 5404
884 Ga0496119_0005539 3300048922 Bacteria 12029
885 Ga0496119_0007934 3300048922 Bacteria 9446
886 Ga0496119_0012383 3300048922 Bacteria 6935
887 Ga0496119_0023594 3300048922 Bacteria 4355
888 Ga0496119_0028943 3300048922 Bacteria 3769
889 Ga0496119_0064456 3300048922 Bacteria 2175
890 Ga0496119_0089163 3300048922 Bacteria 1757
891 Ga0496120_0000019 3300048923 Bacteria 260115
892 Ga0496120_0005030 3300048923 Bacteria 10720
893 Ga0496120_0099216 3300048923 Bacteria 1542
894 Ga0496120_0099510 3300048923 Bacteria 1539
895 Ga0496121_0000003 3300048924 Bacteria 1191431
896 Ga0496121_0000442 3300048924 Bacteria 81890
897 Ga0496121_0007187 3300048924 Bacteria 13486
898 Ga0496121_0009686 3300048924 Bacteria 11033
899 Ga0496121_0032256 3300048924 Bacteria 4766
900 Ga0496121_0149771 3300048924 Bacteria 1718
901 Ga0496122_0000042 3300048925 Bacteria 280482
902 Ga0496122_0000053 3300048925 Bacteria 260120
903 Ga0496122_0008527 3300048925 Bacteria 11027
904 Ga0496122_0018036 3300048925 Bacteria 6546
905 Ga0496122_0030136 3300048925 Bacteria 4555
906 Ga0496123_0000030 3300048926 Bacteria 291764
907 Ga0496123_0000038 3300048926 Bacteria 260120
908 Ga0496123_0006991 3300048926 Bacteria 10763
909 Ga0496123_0014925 3300048926 Bacteria 6404
910 Ga0496123_0032380 3300048926 Bacteria 3787
911 Ga0496123_0034916 3300048926 Bacteria 3593
912 Ga0496123_0205788 3300048926 Bacteria 1004
913 Ga0496124_0001932 3300048927 Bacteria 28393
914 Ga0496124_0009594 3300048927 Bacteria 9924
915 Ga0496124_0010356 3300048927 Bacteria 9451
916 Ga0496124_0021455 3300048927 Bacteria 5950
917 Ga0496124_0022392 3300048927 Bacteria 5793
918 Ga0496124_0035547 3300048927 Bacteria 4357
919 Ga0496124_0046484 3300048927 Bacteria 3716
920 Ga0496124_0054364 3300048927 Bacteria 3389
921 Ga0496124_0076409 3300048927 Bacteria 2764
922 Ga0496124_0099570 3300048927 Bacteria 2357
923 Ga0496124_0120441 3300048927 Bacteria 2098
924 Ga0496124_0152582 3300048927 Bacteria 1810
925 Ga0496124_0253426 3300048927 Bacteria 1300
926 Ga0496125_0000170 3300048928 Bacteria 145369
927 Ga0496125_0000611 3300048928 Bacteria 60631
928 Ga0496125_0044183 3300048928 Bacteria 3771
929 Ga0496125_0229273 3300048928 Bacteria 1189
930 Ga0496125_0250537 3300048928 Bacteria 1117
931 Ga0496126_0000640 3300048929 Bacteria 65206
932 Ga0496126_0002372 3300048929 Bacteria 25676
933 Ga0496126_0067226 3300048929 Bacteria 3202
934 Ga0496126_0290682 3300048929 Bacteria 1351
935 Ga0501309_019150 3300049129 Bacteria 950
936 Ga0501304_001866 3300049160 Bacteria 1408
937 Ga0501305_030646 3300049161 Bacteria 837
938 Ga0501312_013804 3300049528 Bacteria 1128
939 Ga0501314_002497 3300049530 Bacteria 1426
940 Ga0501315_002817 3300049531 Bacteria 1681
941 Ga0501317_005340 3300049533 Bacteria 1372
942 Ga0501318_000524 3300049534 Bacteria 2500
943 Ga0501318_005739 3300049534 Bacteria 1243
944 Ga0501320_003313 3300049536 Bacteria 1358
945 Ga0501321_001114 3300049537 Bacteria 2042
946 Ga0501321_016663 3300049537 Bacteria 876
947 Ga0501323_005732 3300049539 Bacteria 1370
948 Ga0501340_003880 3300049556 Bacteria 923
949 Ga0501031_0014277 3300049568 Bacteria 5166
950 Ga0501031_0097270 3300049568 Bacteria 1921
951 Ga0501031_0119662 3300049568 Bacteria 1720
952 Ga0501032_0005338 3300049569 Bacteria 9563
953 Ga0501032_0006157 3300049569 Bacteria 8829
954 Ga0501032_0035359 3300049569 Bacteria 3416
955 Ga0501032_0094584 3300049569 Bacteria 1981
956 Ga0501032_0102286 3300049569 Bacteria 1898
957 Ga0501032_0252081 3300049569 Bacteria 1146
958 Ga0501033_0000318 3300049570 Bacteria 45707
959 Ga0501033_0012344 3300049570 Bacteria 6520
960 Ga0501033_0015989 3300049570 Bacteria 5684
961 Ga0501033_0055013 3300049570 Bacteria 2942
962 Ga0501033_0056189 3300049570 Bacteria 2910
963 Ga0501033_0078764 3300049570 Bacteria 2418
964 Ga0501033_0105754 3300049570 Bacteria 2051
965 Ga0501033_0265589 3300049570 Bacteria 1214
966 Ga0501033_0323046 3300049570 Bacteria 1084
967 Ga0501034_0000016 3300049571 Bacteria 289751
968 Ga0501034_0000076 3300049571 Bacteria 174683
969 Ga0501034_0025717 3300049571 Bacteria 5995
970 Ga0501034_0026667 3300049571 Bacteria 5880
971 Ga0501034_0040959 3300049571 Bacteria 4687
972 Ga0501034_0059256 3300049571 Bacteria 3846
973 Ga0501034_0207206 3300049571 Bacteria 1917
974 Ga0501034_0215982 3300049571 Bacteria 1871
975 Ga0501034_0216044 3300049571 Bacteria 1871
976 Ga0501034_0258522 3300049571 Bacteria 1684
977 Ga0501034_0427048 3300049571 Bacteria 1245
978 Ga0501034_0450970 3300049571 Bacteria 1204
979 Ga0501034_0615653 3300049571 Bacteria 990
980 Ga0501034_0734672 3300049571 Bacteria 883
981 Ga0501034_0795656 3300049571 Bacteria 838
982 Ga0501036_0140654 3300049572 Bacteria 2037
983 Ga0501036_0654182 3300049572 Bacteria 870
984 Ga0501037_0000136 3300049573 Bacteria 68536
985 Ga0501037_0001333 3300049573 Bacteria 18111
986 Ga0501037_0091212 3300049573 Bacteria 2203
987 Ga0501037_0107536 3300049573 Bacteria 2010
988 Ga0501037_0180281 3300049573 Bacteria 1499
989 Ga0501037_0223331 3300049573 Bacteria 1324
990 Ga0501037_0384396 3300049573 Bacteria 964
991 Ga0501038_0073537 3300049574 Bacteria 2894
992 Ga0501038_0093115 3300049574 Bacteria 2522
993 Ga0501038_0150328 3300049574 Bacteria 1899
994 Ga0501038_0195184 3300049574 Bacteria 1627
995 Ga0501038_0210752 3300049574 Bacteria 1554
996 Ga0501038_0212880 3300049574 Bacteria 1545
997 Ga0501038_0331652 3300049574 Bacteria 1188
998 Ga0501039_0001974 3300049575 Bacteria 15213
999 Ga0501039_0050313 3300049575 Bacteria 3223
1000 Ga0501039_0337716 3300049575 Bacteria 1184
1001 Ga0501043_0000006 3300049579 Bacteria 234413
1002 Ga0501043_0009632 3300049579 Bacteria 7572
1003 Ga0501043_0027393 3300049579 Bacteria 4474
1004 Ga0501043_0045511 3300049579 Bacteria 3452
1005 Ga0501043_0083456 3300049579 Bacteria 2512
1006 Ga0501043_0107807 3300049579 Bacteria 2188
1007 Ga0501043_0132071 3300049579 Bacteria 1956
1008 Ga0501043_0337247 3300049579 Bacteria 1147
1009 Ga0501043_0346549 3300049579 Bacteria 1129
1010 Ga0501046_0000060 3300049580 Bacteria 125548
1011 Ga0501046_0011131 3300049580 Bacteria 7705
1012 Ga0501046_0045243 3300049580 Bacteria 3498
1013 Ga0501046_0110512 3300049580 Bacteria 2100
1014 Ga0501046_0115621 3300049580 Bacteria 2045
1015 Ga0501047_0000130 3300049581 Bacteria 91144
1016 Ga0501047_0005754 3300049581 Bacteria 11671
1017 Ga0501047_0023767 3300049581 Bacteria 5884
1018 Ga0501047_0047434 3300049581 Bacteria 4150
1019 Ga0501047_0066121 3300049581 Bacteria 3485
1020 Ga0501047_0078348 3300049581 Bacteria 3178
1021 Ga0501047_0139393 3300049581 Bacteria 2304
1022 Ga0501047_0159167 3300049581 Bacteria 2130
1023 Ga0501047_0176911 3300049581 Bacteria 2001
1024 Ga0501047_0314545 3300049581 Bacteria 1406
1025 Ga0501047_0577825 3300049581 Bacteria 947
1026 Ga0501047_0768892 3300049581 Bacteria 779
1027 Ga0501048_0088984 3300049582 Bacteria 2178
1028 Ga0501048_0314151 3300049582 Bacteria 1116
1029 Ga0501067_0001850 3300049583 Bacteria 11641
1030 Ga0501067_0001904 3300049583 Bacteria 11473
1031 Ga0501067_0011547 3300049583 Bacteria 4895
1032 Ga0501067_0089570 3300049583 Bacteria 1707
1033 Ga0501068_0183464 3300049584 Bacteria 1324
1034 Ga0501068_0194072 3300049584 Bacteria 1287
1035 Ga0501069_0000024 3300049585 Bacteria 117140
1036 Ga0501069_0058776 3300049585 Bacteria 2145
1037 Ga0501069_0065714 3300049585 Bacteria 2028
1038 Ga0501069_0265020 3300049585 Bacteria 1003
1039 Ga0501070_0000093 3300049586 Bacteria 76623
1040 Ga0501070_0001628 3300049586 Bacteria 19920
1041 Ga0501070_0028127 3300049586 Bacteria 4714
1042 Ga0501070_0048150 3300049586 Bacteria 3541
1043 Ga0501070_0063370 3300049586 Bacteria 3062
1044 Ga0501070_0104466 3300049586 Bacteria 2342
1045 Ga0501070_0137356 3300049586 Bacteria 2018
1046 Ga0501071_0019991 3300049587 Bacteria 4651
1047 Ga0501071_0134088 3300049587 Bacteria 1842
1048 Ga0501072_0344501 3300049588 Bacteria 1183
1049 Ga0501073_0001043 3300049589 Bacteria 20024
1050 Ga0501073_0006499 3300049589 Bacteria 8696
1051 Ga0501073_0031644 3300049589 Bacteria 3775
1052 Ga0501073_0048885 3300049589 Bacteria 2967
1053 Ga0501073_0132018 3300049589 Bacteria 1731
1054 Ga0501073_0215651 3300049589 Bacteria 1326
1055 Ga0501073_0286184 3300049589 Bacteria 1137
1056 Ga0501074_0000011 3300049590 Bacteria 93181
1057 Ga0501074_0067201 3300049590 Bacteria 2578
1058 Ga0501074_0218449 3300049590 Bacteria 1357
1059 Ga0501075_0585000 3300049591 Bacteria 852
1060 Ga0501076_0095588 3300049592 Bacteria 2393
1061 Ga0501076_0327444 3300049592 Bacteria 1257
1062 Ga0501233_022834 3300049668 Bacteria 1355
1063 Ga0501249_014808 3300049679 Bacteria 1664
1064 Ga0501079_0203850 3300049741 Bacteria 1545
1065 Ga0501080_0000004 3300049742 Bacteria 180905
1066 Ga0501080_0001346 3300049742 Bacteria 20520
1067 Ga0501080_0014444 3300049742 Bacteria 7274
1068 Ga0501080_0015694 3300049742 Bacteria 6983
1069 Ga0501080_0165199 3300049742 Bacteria 2043
1070 Ga0501080_0270799 3300049742 Bacteria 1546
1071 Ga0501080_0609410 3300049742 Bacteria 969
1072 Ga0501083_0000097 3300049744 Bacteria 59474
1073 Ga0501083_0006732 3300049744 Bacteria 8154
1074 Ga0501083_0036629 3300049744 Bacteria 3345
1075 Ga0501083_0068497 3300049744 Bacteria 2361
1076 Ga0501083_0075083 3300049744 Bacteria 2245
1077 Ga0501083_0114881 3300049744 Bacteria 1768
1078 Ga0501083_0377277 3300049744 Bacteria 922
1079 Ga0501280_004583 3300049776 Bacteria 2020
1080 Ga0501035_0000068 3300049822 Bacteria 128392
1081 Ga0501035_0000191 3300049822 Bacteria 75056
1082 Ga0501035_0005628 3300049822 Bacteria 11834
1083 Ga0501035_0015558 3300049822 Bacteria 7018
1084 Ga0501035_0024244 3300049822 Bacteria 5564
1085 Ga0501035_0037531 3300049822 Bacteria 4387
1086 Ga0501035_0050175 3300049822 Bacteria 3740
1087 Ga0501035_0150104 3300049822 Bacteria 2023
1088 Ga0501035_0167838 3300049822 Bacteria 1897
1089 Ga0501035_0215972 3300049822 Bacteria 1639
1090 Ga0501035_0238499 3300049822 Bacteria 1547
1091 Ga0501035_0251803 3300049822 Bacteria 1499
1092 Ga0501035_0272035 3300049822 Bacteria 1433
1093 Ga0501035_0433632 3300049822 Bacteria 1089
1094 Ga0501044_0000096 3300049823 Bacteria 109532
1095 Ga0501044_0000227 3300049823 Bacteria 70875
1096 Ga0501044_0015336 3300049823 Bacteria 8254
1097 Ga0501044_0034145 3300049823 Bacteria 5338
1098 Ga0501044_0091334 3300049823 Bacteria 3071
1099 Ga0501044_0095974 3300049823 Bacteria 2987
1100 Ga0501044_0216393 3300049823 Bacteria 1868
1101 Ga0501044_0223969 3300049823 Bacteria 1830
1102 Ga0501044_0278545 3300049823 Bacteria 1607
1103 Ga0501044_0492252 3300049823 Bacteria 1128
1104 Ga0501045_0111485 3300049824 Bacteria 2028
1105 nmdc:mga03683_23695_c1 3300050489 Bacteria 2394
1106 nmdc:mga03683_4150_c1 3300050489 Bacteria 4766
1107 nmdc:mga03n38_985_c1 3300050490 Bacteria 7777
1108 nmdc:mga00v17_13099_c1 3300050491 Bacteria 4595
1109 nmdc:mga00v17_1452_c1 3300050491 Bacteria 12404
1110 nmdc:mga00v17_30044_c1 3300050491 Bacteria 3194
1111 nmdc:mga00v17_3294_c1 3300050491 Bacteria 8327
1112 nmdc:mga00v17_346_c2 3300050491 Bacteria 15851
1113 nmdc:mga00v17_34837_c1 3300050491 Bacteria 2993
1114 nmdc:mga00v17_5491_c1 3300050491 Bacteria 6680
1115 nmdc:mga00v17_55_c1 3300050491 Bacteria 72029
1116 nmdc:mga0yw44_10019_c1 3300050492 Bacteria 2331
1117 nmdc:mga0yw44_113102_c1 3300050492 Bacteria 1741
1118 nmdc:mga0yw44_13785_c1 3300050492 Bacteria 4270
1119 nmdc:mga0yw44_18133_c1 3300050492 Bacteria 3849
1120 nmdc:mga0yw44_18651_c1 3300050492 Bacteria 3806
1121 nmdc:mga0yw44_221381_c1 3300050492 Bacteria 1254
1122 nmdc:mga0yw44_42753_c1 3300050492 Bacteria 2703
1123 nmdc:mga0yw44_55885_c1 3300050492 Bacteria 2403
1124 nmdc:mga0yw44_57531_c1 3300050492 Bacteria 2372
1125 nmdc:mga0k408_2026_c1 3300050493 Bacteria 10850
1126 nmdc:mga0k408_22262_c1 3300050493 Bacteria 3568
1127 nmdc:mga06z11_168428_c1 3300050494 Bacteria 1256
1128 nmdc:mga06z11_42828_c1 3300050494 Bacteria 2273
1129 nmdc:mga06z11_6363_c1 3300050494 Bacteria 4798
1130 nmdc:mga04h51_19483_c1 3300050495 Bacteria 2013
1131 nmdc:mga04h51_24571_c1 3300050495 Bacteria 1847
1132 nmdc:mga07m45_19471_c1 3300050496 Bacteria 3678
1133 nmdc:mga07m45_48666_c1 3300050496 Bacteria 2385
1134 nmdc:mga05p37_13210_c1 3300050507 Bacteria 9885
1135 nmdc:mga09592_299655_c1 3300050508 Bacteria 1394
1136 nmdc:mga0qj67_140319_c1 3300050509 Bacteria 1959
1137 nmdc:mga06r32_141587_c1 3300050510 Bacteria 2381
1138 nmdc:mga06r32_145692_c1 3300050510 Bacteria 2346
1139 nmdc:mga06r32_254070_c1 3300050510 Bacteria 1745
1140 nmdc:mga08y16_19492_c1 3300050511 Bacteria 7151
1141 nmdc:mga0n895_235902_c1 3300050512 Bacteria 1856
1142 nmdc:mga0n895_235970_c1 3300050512 Bacteria 1856
1143 nmdc:mga0rr50_201022_c1 3300050513 Bacteria 1637
1144 nmdc:mga08x19_24076_c1 3300050514 Bacteria 3781
1145 nmdc:mga0a205_670708_c1 3300050515 Bacteria 887
1146 nmdc:mga0a205_69791_c1 3300050515 Bacteria 3393
1147 nmdc:mga0sz30_32_c1 3300050516 Bacteria 54057
1148 Ga0495612_0077729 3300053078 Bacteria 1391
1149 Ga0495595_0114375 3300053084 Bacteria 1311
1150 Ga0495619_0006691 3300053085 Bacteria 7292
1151 Ga0495619_0124989 3300053085 Bacteria 1765
1152 Ga0495619_0218437 3300053085 Bacteria 1320
1153 Ga0500578_0031483 3300053086 Bacteria 3408
1154 Ga0500641_0000724 3300053096 Bacteria 11934
1155 Ga0500555_043140 3300053103 Bacteria 1251
1156 Ga0500556_0000245 3300053104 Bacteria 44002
1157 Ga0500569_015440 3300053109 Bacteria 1912
1158 Ga0500593_000184 3300053117 Bacteria 25269
1159 Ga0500595_050259 3300053119 Bacteria 1295
1160 Ga0500618_000337 3300053125 Bacteria 33703
1161 Ga0500658_0000832 3300053134 Bacteria 12692
1162 Ga0500561_0001332 3300053137 Bacteria 4016
1163 Ga0500568_0000004 3300053139 Bacteria 621666
1164 Ga0500568_0000066 3300053139 Bacteria 104826
1165 Ga0500568_0002568 3300053139 Bacteria 10581
1166 Ga0500590_000975 3300053148 Bacteria 11070
1167 Ga0500616_0000677 3300053153 Bacteria 39945
1168 Ga0500616_0002705 3300053153 Bacteria 14398
1169 Ga0500616_0010398 3300053153 Bacteria 5571
1170 Ga0500616_0056498 3300053153 Bacteria 2049
1171 Ga0501084_0047108 3300054114 Bacteria 3611
1172 Ga0587066_009767 3300059490 Bacteria 1367
1173 Ga0587077_007087 3300059493 Bacteria 1618
1174 Ga0587077_011570 3300059493 Bacteria 1391
1175 Ga0587077_039791 3300059493 Bacteria 938
1176 Ga0587080_011972 3300059503 Bacteria 1305
1177 Ga0587085_025967 3300059506 Bacteria 930
1178 Ga0587086_003962 3300059507 Bacteria 1523
1179 Ga0587088_009540 3300059508 Bacteria 1399
1180 Ga0587088_055478 3300059508 Bacteria 788
1181 Ga0587089_004516 3300059509 Bacteria 1537
1182 Ga0587090_003549 3300059510 Bacteria 1822
1183 Ga0587090_017559 3300059510 Bacteria 1083
1184 Ga0587094_025508 3300059513 Bacteria 886
1185 Ga0587106_005895 3300059605 Bacteria 1422
1186 Ga0587125_002729 3300059607 Bacteria 1444
1187 Ga0587131_000391 3300059609 Bacteria 1722
1188 Ga0587101_006661 3300059623 Bacteria 1335
1189 Ga0587101_026602 3300059623 Bacteria 874
1190 Ga0587115_006083 3300059626 Bacteria 1380
1191 Ga0587128_003881 3300059630 Bacteria 1698
1192 Ga0587062_002913 3300059639 Bacteria 1680
1193 Ga0587062_021918 3300059639 Bacteria 913
1194 Ga0587067_034787 3300059640 Bacteria 950
1195 Ga0587068_005894 3300059641 Bacteria 1693
1196 Ga0587072_002513 3300059643 Bacteria 2461
1197 Ga0587072_004020 3300059643 Bacteria 2106
1198 Ga0587072_011351 3300059643 Bacteria 1456
1199 Ga0587079_039765 3300059647 Bacteria 945
1200 Ga0587124_001124 3300059660 Bacteria 1670
1201 Ga0501082_0058170 3300060353 Bacteria 3330
1202 Ga0501082_0090625 3300060353 Bacteria 2640
1203 Ga0501082_0121513 3300060353 Bacteria 2264
1204 Ga0501082_0272645 3300060353 Bacteria 1473
1205 Ga0466962_0010536 3300061719 Bacteria 4448
1206 Ga0466962_0071935 3300061719 Bacteria 1652
1207 Ga0466962_0104240 3300061719 Bacteria 1363
1208 Ga0530510_0083423 3300061734 Bacteria 2327
1209 2509109744 2508501122 Bacteria 6292184
1210 2509379278 2509276019 Bacteria 6802256
1211 2509447786 2509276033 Bacteria 7180565
1212 2510134698 2510065019 Bacteria 6903379
1213 2510307322 2510065057 Bacteria 6649661
1214 2510842495 2510461069 Bacteria 5505000
1215 2510896049 2510461076 Bacteria 8618824
1216 2511136686 2510917022 Bacteria 6504556
1217 2511171482 2510917026 Bacteria 7046020
1218 2511187187 2510917028 Bacteria 6185411
1219 2511200458 2510917030 Bacteria 7460662
1220 2511392381 2511231027 Bacteria 5013807
1221 2511502896 2511231052 Bacteria 6974333
1222 2512534138 2512047086 Bacteria 6850303
1223 2512974027 2512875026 Bacteria 6861065
1224 2513573250 2513237084 Bacteria 7231967
1225 2513578499 2513237085 Bacteria 7695351
1226 2513584116 2513237086 Bacteria 7265287
1227 2513599087 2513237088 Bacteria 6927906
1228 2513602256 2513237089 Bacteria 6553624
1229 2513616988 2513237091 Bacteria 6900273
1230 2513631463 2513237093 Bacteria 7545552
1231 2513710604 2513237103 Bacteria 7647401
1232 2513867574 2513237138 Bacteria 7368160
1233 2513882001 2513237140 Bacteria 7076289
1234 2513905533 2513237143 Bacteria 6664116
1235 2513985486 2513237156 Bacteria 6402557
1236 2514003899 2513237160 Bacteria 6650282
1237 2514023413 2513237162 Bacteria 7468464
1238 2515113789 2515075009 Bacteria 7288508
1239 2515610446 2515154107 Bacteria 6795637
1240 2515634653 2515154113 Bacteria 7807172
1241 2515645303 2515154114 Bacteria 7848616
1242 2515660891 2515154116 Bacteria 7552979
1243 2515743511 2515154134 Bacteria 7220242
1244 2516205136 2516143018 Bacteria 6951533
1245 2516894302 2516653046 Bacteria 6989037
1246 2517037400 2516653077 Bacteria 7555578
1247 2517077700 2516653085 Bacteria 7346596
1248 2517096499 2517093000 Bacteria 7412387
1249 2517410596 2517287029 Bacteria 6905599
1250 2517570909 2517487022 Bacteria 7227575
1251 2523469464 2523231067 Bacteria 5230452
1252 2524451769 2524023207 Bacteria 6813453
1253 2524462068 2524023209 Bacteria 6679728
1254 2530646816 2529292951 Bacteria 6916614
1255 2535485788 2534681786 Bacteria 3308809
1256 2535519577 2534681796 Bacteria 7146037
1257 2537876439 2537561587 Bacteria 5425293
1258 2551674721 2551306084 Bacteria 8942552
1259 2551685469 2551306085 Bacteria 7347181
1260 2551693876 2551306086 Bacteria 6843938
1261 2551698535 2551306087 Bacteria 7351905
1262 2551713413 2551306089 Bacteria 7162724
1263 2551717355 2551306090 Bacteria 7953713
1264 2551730383 2551306091 Bacteria 7086830
1265 2551736235 2551306092 Bacteria 6992595
1266 2551741347 2551306093 Bacteria 7064773
1267 2554245230 2554235003 Bacteria 5877155
1268 2555229954 2554235227 Bacteria 3637389
1269 2558860318 2558860100 Bacteria 8458965
1270 2559296940 2558860242 Bacteria 5568029
1271 2561468095 2558860983 Bacteria 4133860
1272 2585167913 2582581283 Bacteria 6030556
1273 2585204877 2582581294 Bacteria 6626667
1274 2585224936 2582581298 Bacteria 7315509
1275 2585227649 2582581299 Bacteria 6518058
1276 2585257664 2582581304 Bacteria 5831370
1277 2585265473 2582581306 Bacteria 6450535
1278 2585274157 2582581307 Bacteria 6597605
1279 2585280430 2582581308 Bacteria 7413247
1280 2585322703 2582581315 Bacteria 7318924
1281 2585330820 2582581316 Bacteria 7774528
1282 2585388426 2582581865 Bacteria 6644329
1283 2585403379 2582581867 Bacteria 7184437
1284 2585529610 2585427526 Bacteria 7258840
1285 2585532658 2585427527 Bacteria 7273426
1286 2585541156 2585427528 Bacteria 6842387
1287 2585547492 2585427529 Bacteria 7395659
1288 2585554326 2585427530 Bacteria 7383882
1289 2585560606 2585427531 Bacteria 6992870
1290 2585823675 2585427590 Bacteria 6824633
1291 2585839919 2585427593 Bacteria 7141551
1292 2585845182 2585427594 Bacteria 6180594
1293 2585898817 2585427608 Bacteria 6544331
1294 2585903596 2585427609 Bacteria 6667127
1295 2585997029 2585427633 Bacteria 6413184
1296 2586001630 2585427634 Bacteria 6455027
1297 2587981284 2585428125 Bacteria 6662905
1298 2599334827 2599185156 Bacteria 5403036
1299 2599420683 2599185170 Bacteria 7295545
1300 2599604630 2599185210 Bacteria 5624189
1301 2599722496 2599185236 Bacteria 6875203
1302 2600373762 2600254933 Bacteria 4750527
1303 2601611213 2600255279 Bacteria 5605316
1304 2601747986 2600255308 Bacteria 5611129
1305 2616295420 2615840624 Bacteria 6557588
1306 2616307271 2615840626 Bacteria 7921970
1307 2616554814 2615840698 Bacteria 7319877
1308 2643752063 2643221546 Bacteria 2910897
1309 2643771423 2643221550 Bacteria 4619371
1310 2643813151 2643221558 Bacteria 5460675
1311 2643836882 2643221564 Bacteria 4193379
1312 2643858255 2643221568 Bacteria 5187270
1313 2643916954 2643221582 Bacteria 5804683
1314 2644006264 2643221599 Bacteria 6292121
1315 2644050975 2643221607 Bacteria 6314006
1316 2644108590 2643221618 Bacteria 7717186
1317 2644145636 2643221626 Bacteria 8069654
1318 2644191533 2643221634 Bacteria 6705461
1319 2644205478 2643221636 Bacteria 6583769
1320 2644209959 2643221637 Bacteria 5345260
1321 2644241715 2643221643 Bacteria 5749658
1322 2644299143 2643221653 Bacteria 4569637
1323 2644312287 2643221655 Bacteria 7722067
1324 2644335916 2643221659 Bacteria 7890716
1325 2644483879 2643221686 Bacteria 6310811
1326 2644496275 2643221688 Bacteria 5260751
1327 2644500312 2643221689 Bacteria 6042950
1328 2644521182 2643221693 Bacteria 5513853
1329 2644546773 2643221698 Bacteria 7756764
1330 2644617970 2643221712 Bacteria 7729434
1331 2644653510 2643221718 Bacteria 5345506
1332 2644657371 2643221719 Bacteria 4568197
1333 2655032658 2654587600 Bacteria 3911798
1334 2657684076 2657244999 Bacteria 5946535
1335 2671112068 2667528174 Bacteria 6435400
1336 2671691851 2671180139 Bacteria 4196045
1337 2692314613 2690316117 Bacteria 6800650
1338 2719182468 2718217882 Bacteria 6556348
1339 2719387127 2718217927 Bacteria 6972593
1340 2719733187 2718218009 Bacteria 6478651
1341 2720493191 2718218199 Bacteria 6740745
1342 2720614668 2718218232 Bacteria 6720332
1343 2720621441 2718218233 Bacteria 6662049
1344 2720632769 2718218235 Bacteria 6630699
1345 2720776493 2718218269 Bacteria 6906114
1346 2721148581 2718218363 Bacteria 6524337
1347 2721159967 2718218365 Bacteria 6274507
1348 2721165395 2718218366 Bacteria 6425255
1349 2721400762 2718218423 Bacteria 6438183
1350 2722841565 2721755514 Bacteria 6424414
1351 2723028081 2721755556 Bacteria 6745503
1352 2723561712 2721755684 Bacteria 6859907
1353 2723568341 2721755685 Bacteria 6704835
1354 2724039575 2721755809 Bacteria 6438790
1355 2724045943 2721755810 Bacteria 6479005
1356 2724091100 2721755819 Bacteria 6906405
1357 2724105606 2721755822 Bacteria 6726041
1358 2724111433 2721755823 Bacteria 6752556
1359 2725947685 2724679232 Bacteria 7646494
1360 2730109017 2728369352 Bacteria 6745171
1361 2730165703 2728369365 Bacteria 6555560
1362 2730299599 2728369397 Bacteria 6274511
1363 2738800600 2738541293 Bacteria 7065685
1364 2738944407 2738541317 Bacteria 5340176
1365 2739035708 2738541333 Bacteria 7106503
1366 2739351717 2738543031 Bacteria 5769731
1367 2753360177 2751185800 Bacteria 5467370
1368 2753458711 2751185821 Bacteria 6189929
1369 2757570491 2757320392 Bacteria 3737298
1370 2758642500 2758568016 Bacteria 5645291
1371 2765467283 2765235802 Bacteria 5618596
1372 2766065469 2765235942 Bacteria 7445910
1373 2770198098 2767802442 Bacteria 5747986
1374 2776269947 2775506902 Bacteria 6208009
1375 2776281064 2775506904 Bacteria 5954060
1376 2776914462 2775507049 Bacteria 6284736
1377 2778175888 2775507266 Bacteria 7392367
1378 2792582639 2791355082 Bacteria 5973319
1379 2792622899 2791355091 Bacteria 6135441
1380 2792629153 2791355092 Bacteria 6248105
1381 2792640494 2791355094 Bacteria 7011481
1382 2793281714 2791355253 Bacteria 5171699
1383 2793293780 2791355256 Bacteria 6798008
1384 2793313196 2791355259 Bacteria 7254731
1385 2793319857 2791355260 Bacteria 6598818
1386 2793328139 2791355261 Bacteria 6661293
1387 2793333235 2791355262 Bacteria 6774204
1388 2793343818 2791355263 Bacteria 6872478
1389 2793347238 2791355264 Bacteria 6429314
1390 2793356625 2791355265 Bacteria 6539969
1391 2793362916 2791355266 Bacteria 7116587
1392 2793370058 2791355267 Bacteria 7222458
1393 2802718001 2802428858 Bacteria 6636079
1394 2802725148 2802428859 Bacteria 6667919
1395 2802730728 2802428860 Bacteria 6525526
1396 2802738075 2802428861 Bacteria 6534206
1397 2802744055 2802428862 Bacteria 6633353
1398 2802750934 2802428863 Bacteria 6410669
1399 2804753235 2802429268 Bacteria 6094027
1400 2805930706 2802429605 Bacteria 6875453
1401 2805934179 2802429606 Bacteria 6346811
1402 2806044695 2802429633 Bacteria 7341974
1403 2806052895 2802429634 Bacteria 7083200
1404 2806059195 2802429635 Bacteria 7650140
1405 2806068142 2802429636 Bacteria 7597525
1406 2806074262 2802429637 Bacteria 7067217
1407 2808891465 2808606370 Bacteria 4942454
1408 2808987456 2808606387 Bacteria 5697198
1409 2819243714 2818991272 Bacteria 4622173
1410 2819557226 2818991439 Bacteria 6907412
1411 2819609728 2818991448 Bacteria 6772224
1412 2819639827 2818991453 Bacteria 7181617
1413 2819685550 2818991461 Bacteria 7026071
1414 2821126037 2821123053 Bacteria 7836056
1415 2833710890 2833709550 Bacteria 4008291
1416 2837679087 2837678835 Bacteria 5252418
1417 2838018968 2838016132 Bacteria 6577831
1418 2838024432 2838022645 Bacteria 6494267
1419 2838033007 2838029111 Bacteria 6603031
1420 2838046389 2838042994 Bacteria 6046894
1421 2838051316 2838048938 Bacteria 6044578
1422 2838063706 2838061910 Bacteria 6794874
1423 2838664969 2838661181 Bacteria 7385261
1424 2838678233 2838675328 Bacteria 4909118
1425 2838691466 2838686498 Bacteria 7807632
1426 2838716861 2838714209 Bacteria 5525906
1427 2838722529 2838719591 Bacteria 5523910
1428 2838727610 2838724970 Bacteria 4908691
1429 2838733425 2838729681 Bacteria 7400765
1430 2838737486 2838736955 Bacteria 5760694
1431 2838746003 2838742623 Bacteria 7396178
1432 2839998041 2839993093 Bacteria 5512535
1433 2840765654 2840764183 Bacteria 6358399
1434 2841766481 2841760612 Bacteria 6454112
1435 2841842145 2841840854 Bacteria 5761912
1436 2841849216 2841846520 Bacteria 5345850
1437 2841853715 2841851746 Bacteria 7532261
1438 2841861713 2841859092 Bacteria 5436171
1439 2841868320 2841864319 Bacteria 6742987
1440 2842128035 2842124991 Bacteria 5346824
1441 2842133126 2842130223 Bacteria 4909145
1442 2842141924 2842140634 Bacteria 5759631
1443 2842155120 2842152218 Bacteria 4908957
1444 2842162278 2842156927 Bacteria 6894975
1445 2842169834 2842163707 Bacteria 6916235
1446 2842173619 2842170452 Bacteria 5525737
1447 2842178741 2842175837 Bacteria 4908771
1448 2842185204 2842180545 Bacteria 6888678
1449 2842189968 2842187318 Bacteria 5524014
1450 2842199975 2842198810 Bacteria 6608673
1451 2842214282 2842211629 Bacteria 5523832
1452 2842227001 2842224351 Bacteria 5524473
1453 2842233691 2842229732 Bacteria 7475766
1454 2842247735 2842243621 Bacteria 7421798
1455 2842253893 2842250916 Bacteria 6579627
1456 2842261997 2842257432 Bacteria 7401195
1457 2842266474 2842264693 Bacteria 6472963
1458 2842275940 2842271015 Bacteria 7807131
1459 2842288929 2842285085 Bacteria 6011953
1460 2842298567 2842298080 Bacteria 6123127
1461 2842308076 2842304105 Bacteria 7023636
1462 2842316167 2842311132 Bacteria 6616990
1463 2842321542 2842317721 Bacteria 6793725
1464 2842344858 2842341865 Bacteria 7003929
1465 2842362419 2842357229 Bacteria 6485165
1466 2842369363 2842363717 Bacteria 6844742
1467 2842398667 2842395702 Bacteria 6780583
1468 2842406404 2842402390 Bacteria 6681310
1469 2842413169 2842409023 Bacteria 6687331
1470 2842419812 2842415677 Bacteria 6596907
1471 2842429793 2842428310 Bacteria 6767288
1472 2842436547 2842434925 Bacteria 6502746
1473 2842444250 2842441272 Bacteria 6769273
1474 2842450889 2842447887 Bacteria 6754142
1475 2842464214 2842462802 Bacteria 6588055
1476 2842470876 2842469257 Bacteria 6752936
1477 2842479740 2842475841 Bacteria 6603183
1478 2842493122 2842489311 Bacteria 6620893
1479 2842499308 2842495871 Bacteria 6820686
1480 2842506916 2842502639 Bacteria 6604161
1481 2842510595 2842509118 Bacteria 6850950
1482 2842518021 2842515876 Bacteria 5436280
1483 2842695232 2842694124 Bacteria 4063419
1484 2842874745 2842871566 Bacteria 4827117
1485 2842925953 2842922631 Bacteria 5824079
1486 2844106248 2844104063 Bacteria 6440972
1487 2844169135 2844163670 Bacteria 7266046
1488 2844457640 2844454524 Bacteria 7952546
1489 2844849107 2844849076 Bacteria 4091819
1490 2847420337 2847417321 Bacteria 6913799
1491 2848995149 2848992105 Bacteria 6810864
1492 2850082216 2850079185 Bacteria 6848280
1493 2851246604 2851246043 Bacteria 6439203
1494 2852391046 2852387548 Bacteria 8025568
1495 2852679308 2852677369 Bacteria 3768884
1496 2854900356 2854896431 Bacteria 5869725
1497 2854912979 2854911287 Bacteria 5582813
1498 2854920188 2854916844 Bacteria 5725939
1499 2855826937 2855825444 Bacteria 6785811
1500 2855842333 2855839649 Bacteria 7135830
1501 2855878530 2855872281 Bacteria 6964271
1502 2857481066 2857479173 Bacteria 2469263
1503 2857532599 2857531043 Bacteria 6754041
1504 2857634796 2857632687 Bacteria 2448521
1505 2857732661 2857729791 Bacteria 4040535
1506 2857741918 2857740372 Bacteria 4782044
1507 2858803148 2858800743 Bacteria 6603254
1508 2870802353 2870801768 Bacteria 2710986
1509 2870804435 2870804320 Bacteria 2552467
1510 2889793273 2889790730 Bacteria 5689708
1511 2889917474 2889914905 Bacteria 5702301
1512 2891049307 2891048133 Bacteria 4447501
1513 2891377603 2891373044 Bacteria 5202277
1514 2894654054 2894652903 Bacteria 4587256
1515 2895882162 2895880812 Bacteria 11255272
1516 2897563324 2897561785 Bacteria 3256946
1517 2899275900 2899275550 Bacteria 3958688
1518 2899792801 2899792073 Bacteria 4926588
1519 2899845462 2899845264 Bacteria 5672268
1520 2904498055 2904497146 Bacteria 4731781
1521 2904580339 2904578770 Bacteria 5302906
1522 2904777413 2904776348 Bacteria 4658726
1523 2910810629 2910809715 Bacteria 4982797
1524 2913299750 2913295892 Bacteria 6333755
1525 2913309026 2913308742 Bacteria 5350706
1526 2915654220 2915650412 Bacteria 4288180
1527 2915980456 2915980308 Bacteria 6624279
1528 2915987745 2915986958 Bacteria 6739310
1529 2915999004 2915993759 Bacteria 7016183
1530 2916006173 2916000859 Bacteria 6865702
1531 2916013013 2916007675 Bacteria 6898660
1532 2916015605 2916014648 Bacteria 6946486
1533 2916022472 2916021584 Bacteria 6854472
1534 2916029080 2916028427 Bacteria 6748433
1535 2916038408 2916035215 Bacteria 6755766
1536 2916044834 2916041962 Bacteria 6820487
1537 2916054076 2916048683 Bacteria 6543552
1538 2916058153 2916055098 Bacteria 6758838
1539 2916067034 2916061851 Bacteria 6737736
1540 2916068878 2916068649 Bacteria 6943657
1541 2916077371 2916076590 Bacteria 6596108
1542 2917556592 2917554339 Bacteria 4987857
1543 2919034785 2919034639 Bacteria 4763403
1544 2919062256 2919059106 Bacteria 4991624
1545 2919104412 2919100787 Bacteria 7710546
1546 2919117052 2919114240 Bacteria 5700270
1547 2919119985 2919119836 Bacteria 5208557
1548 2919169778 2919166419 Bacteria 4952238
1549 2919393814 2919391150 Bacteria 4884741
1550 2919410553 2919408235 Bacteria 6149349
1551 2919540250 2919538618 Bacteria 4677069
1552 2920828594 2920822456 Bacteria 6897201
1553 2921202914 2921201388 Bacteria 6926299
1554 2921214573 2921208531 Bacteria 6745326
1555 2921242582 2921237296 Bacteria 6876710
1556 2921250181 2921244191 Bacteria 6568419
1557 2921252274 2921250672 Bacteria 6677771
1558 2921257553 2921257292 Bacteria 6808382
1559 2921270835 2921263974 Bacteria 6864552
1560 2921282897 2921282425 Bacteria 6826397
1561 2921292583 2921289301 Bacteria 7316391
1562 2921300944 2921296804 Bacteria 7176999
1563 2923558920 2923556063 Bacteria 6793593
1564 2924149317 2924144063 Bacteria 6883928
1565 2924155467 2924150972 Bacteria 7169444
1566 2924163257 2924158325 Bacteria 7188855
1567 2924171844 2924165586 Bacteria 7260590
1568 2924176975 2924172951 Bacteria 6749356
1569 2924186278 2924179722 Bacteria 6843264
1570 2924191599 2924186466 Bacteria 6876637
1571 2924195010 2924193448 Bacteria 6955718
1572 2924201627 2924200457 Bacteria 6757188
1573 2924213498 2924207177 Bacteria 6917007
1574 2924220819 2924214083 Bacteria 7080103
1575 2924221861 2924221636 Bacteria 7113495
1576 2924233362 2924228884 Bacteria 6633132
1577 2926758565 2926754445 Bacteria 5964435
1578 2926763903 2926760298 Bacteria 5505990
1579 2928123002 2928121344 Bacteria 3972376
1580 2928523093 2928521798 Bacteria 4960112
1581 2929141293 2929138655 Bacteria 5810547
1582 2932428080 2932426870 Bacteria 4547726
1583 2933009501 2933006813 Bacteria 4912075
1584 2933013650 2933011516 Bacteria 5439334
1585 2933023329 2933016740 Bacteria 6355406
1586 2933421403 2933418574 Bacteria 4476724
1587 2933574525 2933570622 Bacteria 7023390
1588 2933589126 2933586486 Bacteria 7667493
1589 2933598108 2933594066 Bacteria 5594265
1590 2933604733 2933599457 Bacteria 5858799
1591 2935899873 2935894831 Bacteria 6620579
1592 2935907043 2935901341 Bacteria 7341747
1593 2936375012 2936367885 Bacteria 7324495
1594 2936380703 2936375103 Bacteria 6652732
1595 2936382127 2936381700 Bacteria 7006523
1596 2936999940 2936996657 Bacteria 6298727
1597 2937007084 2937002841 Bacteria 6934057
1598 2937010940 2937009748 Bacteria 6746052
1599 2937018274 2937016420 Bacteria 6782579
1600 2937025757 2937023124 Bacteria 6815156
1601 2937033103 2937029754 Bacteria 6424026
1602 2937036605 2937036028 Bacteria 6846469
1603 2937044044 2937042894 Bacteria 6741576
1604 2937055686 2937049772 Bacteria 6757901
1605 2937058405 2937056579 Bacteria 7107896
1606 2937067448 2937063883 Bacteria 7199456
1607 2937074772 2937071275 Bacteria 6984483
1608 2937078522 2937078374 Bacteria 6610289
1609 2937091353 2937084907 Bacteria 6618516
1610 2937092748 2937091812 Bacteria 6979387
1611 2937104948 2937098957 Bacteria 7249374
1612 2937111743 2937106411 Bacteria 6947143
1613 2937114938 2937113482 Bacteria 6505872
1614 2937121445 2937119839 Bacteria 6597547
1615 2937129421 2937126314 Bacteria 6771275
1616 2937848507 2937843397 Bacteria 5256375
1617 2939648500 2939647034 Bacteria 4681660
1618 2939672282 2939669807 Bacteria 5028511
1619 2939675455 2939674588 Bacteria 4844420
1620 2945942901 2945941187 Bacteria 4682474
1621 2945959353 2945956166 Bacteria 5110334
1622 2946025612 2946024296 Bacteria 3508095
1623 2954000048 2953998280 Bacteria 4812144
1624 2954013542 2954011201 Bacteria 4762601
1625 2957377547 2957375807 Bacteria 6425588
1626 2957387668 2957382221 Bacteria 6737050
1627 2957389887 2957388812 Bacteria 6778072
1628 2957397419 2957395598 Bacteria 6822399
1629 2957404648 2957402308 Bacteria 6741770
1630 2957409116 2957408893 Bacteria 6558585
1631 2957420698 2957415311 Bacteria 6991633
1632 2957426439 2957422303 Bacteria 7172205
1633 2957435751 2957430029 Bacteria 7022557
1634 2957437280 2957437181 Bacteria 6568994
1635 2957449450 2957443900 Bacteria 6869977
1636 2957452316 2957450854 Bacteria 6765715
1637 2957458678 2957457609 Bacteria 6967680
1638 2957469699 2957464669 Bacteria 6568877
1639 2957472117 2957471148 Bacteria 6797643
1640 2957484463 2957478035 Bacteria 6756658
1641 2957490933 2957484790 Bacteria 6703082
1642 2957496286 2957491536 Bacteria 6695180
1643 2957499363 2957498199 Bacteria 7126688
1644 2957509074 2957505466 Bacteria 7253085
1645 2960585453 2960584000 Bacteria 6864594
1646 2960591170 2960591022 Bacteria 6622873
1647 2960602272 2960597568 Bacteria 6550735
1648 2960609602 2960603979 Bacteria 6898737
1649 2960614320 2960610863 Bacteria 6691244
1650 2960623449 2960617483 Bacteria 6727748
1651 2960627996 2960624210 Bacteria 6875384
1652 2960636548 2960631154 Bacteria 6732508
1653 2960640534 2960637947 Bacteria 7296468
1654 2960651546 2960645483 Bacteria 7211087
1655 2960653175 2960652885 Bacteria 7083688
1656 2960665373 2960660292 Bacteria 7041660
1657 2960672542 2960667422 Bacteria 6763020
1658 2960676329 2960674078 Bacteria 6609048
1659 2960682538 2960680706 Bacteria 6624464
1660 2960692454 2960687367 Bacteria 6535474
1661 2960696899 2960693952 Bacteria 6749742
1662 2964612910 2964607997 Bacteria 7101408
1663 2964619734 2964615318 Bacteria 6809089
1664 2964628294 2964621998 Bacteria 6834995
1665 2964630953 2964628898 Bacteria 7083044
1666 2964637105 2964636051 Bacteria 7091832
1667 2964644732 2964643177 Bacteria 6820887
1668 2964651413 2964649959 Bacteria 6675118
1669 2964657701 2964656573 Bacteria 7100150
1670 2964666565 2964663802 Bacteria 7019362
1671 2964674593 2964670856 Bacteria 6851364
1672 2964679552 2964678106 Bacteria 6792020
1673 2964687360 2964685014 Bacteria 6839111
1674 2964692327 2964691889 Bacteria 6802758
1675 2964702620 2964698721 Bacteria 6765331
1676 2964711110 2964705432 Bacteria 7114648
1677 2964713287 2964712639 Bacteria 6695970
1678 2964722456 2964719344 Bacteria 7286602
1679 2967670785 2967664464 Bacteria 6948836
1680 2967672818 2967671571 Bacteria 7021409
1681 2967685301 2967678726 Bacteria 7264382
1682 2967689311 2967686174 Bacteria 6678622
1683 2967696258 2967693043 Bacteria 6804451
1684 2967701413 2967699805 Bacteria 6854538
1685 2967713838 2967706974 Bacteria 7186053
1686 2967719980 2967714385 Bacteria 7000047
1687 2967727768 2967721400 Bacteria 7073753
1688 2967732595 2967728569 Bacteria 6641507
1689 2967735288 2967735183 Bacteria 6827012
1690 2967745522 2967742019 Bacteria 6794534
1691 2967752343 2967748971 Bacteria 6733771
1692 2967759268 2967755722 Bacteria 6814706
1693 2967766867 2967762386 Bacteria 6923502
1694 2967770536 2967769361 Bacteria 6587838
1695 2967777554 2967775926 Bacteria 6738189
1696 2970025890 2970019648 Bacteria 7072033
1697 2970028196 2970026789 Bacteria 6785236
1698 2970035020 2970033650 Bacteria 7118744
1699 2970042493 2970040964 Bacteria 6731123
1700 2970053489 2970047711 Bacteria 7088379
1701 2970056063 2970054988 Bacteria 6611507
1702 2970063048 2970061556 Bacteria 7099761
1703 2970074494 2970068827 Bacteria 7123112
1704 2970079216 2970076120 Bacteria 6697332
1705 2970087812 2970082768 Bacteria 6183754
1706 2970089159 2970088815 Bacteria 6933825
1707 2970100291 2970095765 Bacteria 6936963
1708 2970103788 2970102677 Bacteria 6812532
1709 2970116134 2970109326 Bacteria 6863976
1710 2970121249 2970116247 Bacteria 6501857
1711 2970126038 2970122695 Bacteria 6625855
1712 2970130170 2970129317 Bacteria 6806560
1713 2970141212 2970136068 Bacteria 7207982
1714 2970146524 2970143518 Bacteria 6446480
1715 2970150523 2970149975 Bacteria 6779706
1716 2970159310 2970156795 Bacteria 7168044
1717 2970166822 2970164137 Bacteria 6861252
1718 2970173481 2970170962 Bacteria 6876229
1719 2970180679 2970177841 Bacteria 6768001
1720 2970191545 2970184632 Bacteria 7054431
1721 2970196263 2970191845 Bacteria 7032787
1722 2974306751 2974302888 Bacteria 4369871
1723 2977519839 2977516862 Bacteria 6940108
1724 2977528019 2977523885 Bacteria 6960446
1725 2977534247 2977530762 Bacteria 6951399
1726 2977541103 2977537788 Bacteria 6929320
1727 2977548089 2977544691 Bacteria 6875412
1728 2977552173 2977551784 Bacteria 7125765
1729 2977560069 2977558990 Bacteria 6863948
1730 2977567261 2977565890 Bacteria 6901543
1731 2977574862 2977572785 Bacteria 6763888
1732 2977579846 2977579622 Bacteria 6772100
1733 2978972197 2978969890 Bacteria 5400756
1734 2979090999 2979089926 Bacteria 5670289
1735 2979096525 2979095461 Bacteria 5669583
1736 2979102258 2979100975 Bacteria 5423623
1737 2984509794 2984509177 Bacteria 5274802
1738 2984519509 2984518228 Bacteria 5277463
1739 2984538132 2984537506 Bacteria 5277481
1740 2984590423 2984587000 Bacteria 5263363
1741 2984604884 2984601300 Bacteria 5455244
1742 2989354738 2989349275 Bacteria 6349068
1743 2989773420 2989771324 Bacteria 5605128
1744 2989779715 2989776772 Bacteria 4843317
1745 2995394863 2995392953 Bacteria 4539380
1746 2996890112 2996887358 Bacteria 5795980
1747 2996895902 2996893221 Bacteria 5823108
1748 3002141381 3002141150 Bacteria 5254435
1749 3003934812 3003930520 Bacteria 5667563
1750 3005415629 3005409236 Bacteria 7188837
1751 3005418612 3005416602 Bacteria 7064308
1752 3005449129 3005445848 Bacteria 6906074
1753 3005455408 3005452660 Bacteria 5889319
1754 639649863 639633055 Bacteria 7751309
1755 643826988 643692032 Bacteria 6891900
1756 648735937 648276728 Bacteria 6968865
1757 650843361 650716007 Bacteria 5573770
1758 8003572957 8003570095 Bacteria 5747666
1759 8003994871 8003992118 Bacteria 7266902
1760 8004002624 8003999396 Bacteria 7063185
1761 8005249668 8005246636 Bacteria 4933972
1762 8005262167 8005258706 Bacteria 6184835
1763 8005281854 8005275841 Bacteria 6929066
1764 8005288848 8005282627 Bacteria 6675747
1765 8005294433 8005289223 Bacteria 6634003
1766 8005306816 8005301065 Bacteria 6614431
1767 8005310814 8005307578 Bacteria 7395396
1768 8005318496 8005314921 Bacteria 7072929
1769 8005324639 8005321885 Bacteria 5795980
1770 8005378335 8005376324 Bacteria 6590079
1771 8005383980 8005382845 Bacteria 6732062
1772 8005401307 8005395548 Bacteria 6806915
1773 8005434262 8005430974 Bacteria 6689030
1774 8005464476 8005460587 Bacteria 7157962
1775 8005488623 8005484373 Bacteria 6297373
1776 8005501519 8005497431 Bacteria 6477605
1777 8005547274 8005542996 Bacteria 7077758
1778 8005558526 8005556819 Bacteria 6908598
1779 8005566630 8005563573 Bacteria 7153261
1780 8005575081 8005570704 Bacteria 6957481
1781 8005622880 8005619151 Bacteria 7030230
1782 8005631819 8005626139 Bacteria 6534237
1783 8005649090 8005645114 Bacteria 6950293
1784 8005658655 8005658619 Bacteria 4500593
1785 8005672940 8005668836 Bacteria 6953162
1786 8005682329 8005682033 Bacteria 6726518
1787 8005693487 8005688590 Bacteria 6610080
1788 8005700708 8005695170 Bacteria 6912330
1789 8018133754 8018127388 Bacteria 7351159
1790 8018153299 8018150411 Bacteria 5549903
1791 8018170074 8018163183 Bacteria 7277977
1792 8018178600 8018176218 Bacteria 6896178
1793 8023687697 8023680758 Bacteria 7729763
1794 8024481640 8024479707 Bacteria 6954785
1795 8024487873 8024486573 Bacteria 6540512
1796 8024506093 8024501048 Bacteria 6427847
1797 8045867498 8045864390 Bacteria 5043873
1798 8046772037 8046767195 Bacteria 7547379
1799 8049295847 8049293176 Bacteria 6128433
1800 8054463363 8054460903 Bacteria 4872905
1801 8054565621 8054563764 Bacteria 5592885
1802 8055432123 8055431914 Bacteria 4551896
1803 8056381444 8056375014 Bacteria 7006639
1804 8056386887 8056382006 Bacteria 6408074
1805 8057577531 8057575449 Bacteria 7367519
1806 8057876677 8057874678 Bacteria 7494653
1807 Ga0496119_0020826
1808 JGI24739J22299_10056206
1809 JGI24744J21845_10002172
1810 JGI25156J39149_1000066
1811 JGI25162J39368_1000488
1812 JGI25154J39366_1000035
1813 JGI25157J39369_1000036
1814 JGI25157J39369_1000197
1815 JGI25152J39213_1009568
1816 JGI25159J45721_1000463
1817 JGI25159J45721_1001920
1818 JGI25151J46595_10001277
1819 JGI25151J46595_10002842
1820 JGI25151J46595_10032258
1821 JGI25165J46597_1000676
1822 JGI25165J46597_1001184
1823 JGI25165J46597_1004445
1824 rootH1_10034840
1825 JGI25160J50197_1000100
1826 JGI25160J50197_1001130
1827 JGI25160J50197_1022014
1828 JGI25161J50226_1000072
1829 JGI25161J50226_1000104
1830 JGI25161J50226_1000396
1831 Ga0006562J51391_1020816
1832 Ga0055526_1001414
1833 Ga0055526_1017900
1834 Ga0055526_1024203
1835 Ga0055526_1028352
1836 Ga0055524_1002189
1837 Ga0055524_1005016
1838 Ga0055524_1008630
1839 Ga0055524_1010849
1840 Ga0055524_1015401
1841 Ga0055524_1025242
1842 Ga0055536_1019029
1843 Ga0055528_1000695
1844 Ga0055528_1005647
1845 Ga0055528_1008246
1846 Ga0055528_1011300
1847 Ga0055528_1021009
1848 Ga0055530_10018329
1849 Ga0055530_10056832
1850 Ga0055540_1000752
1851 Ga0055540_1015474
1852 Ga0055540_1020091
1853 Ga0055531_10023282
1854 Ga0058692_1001306
1855 Ga0058692_1002399
1856 Ga0058692_1014818
1857 Ga0055543_1000078
1858 Ga0055543_1000280
1859 Ga0065165_1000623
1860 Ga0065165_1002557
1861 Ga0065165_1023432
1862 Ga0065714_10142918
1863 Ga0065704_10159503
1864 Ga0065712_10014529
1865 Ga0065712_10284402
1866 Ga0065707_10089177
1867 Ga0070658_10000894
1868 Ga0070658_10020960
1869 Ga0070658_10065366
1870 Ga0070658_10159182
1871 Ga0070676_10037368
1872 Ga0070683_100092079
1873 Ga0070670_100000007
1874 Ga0070670_100065624
1875 Ga0070677_10152960
1876 Ga0070682_100202478
1877 Ga0068868_100056815
1878 Ga0068868_100103395
1879 Ga0070660_100003906
1880 Ga0070660_100016734
1881 Ga0070660_100026194
1882 Ga0070661_100000711
1883 Ga0070661_100010380
1884 Ga0070661_100175746
1885 Ga0070668_100000698
1886 Ga0070668_100003566
1887 Ga0070668_100015597
1888 Ga0070668_100016864
1889 Ga0070669_100017209
1890 Ga0070675_100025813
1891 Ga0070675_100138584
1892 Ga0070671_100000680
1893 Ga0070671_100018260
1894 Ga0070671_100107571
1895 Ga0070671_100256627
1896 Ga0070674_100022758
1897 Ga0070673_100135563
1898 Ga0070688_100005746
1899 Ga0070659_100088401
1900 Ga0070659_100367919
1901 Ga0070667_100000560
1902 Ga0070667_100002368
1903 Ga0070667_100033927
1904 Ga0070667_100035836
1905 Ga0070667_100039599
1906 Ga0070694_100030566
1907 Ga0070694_100139436
1908 Ga0070663_100089633
1909 Ga0070663_100109678
1910 Ga0070663_100119414
1911 Ga0070663_100308946
1912 Ga0070678_100014493
1913 Ga0070681_10034749
1914 Ga0070681_10114505
1915 Ga0070681_10131608
1916 Ga0070681_10202347
1917 Ga0070681_10701687
1918 Ga0070707_100000419
1919 Ga0070699_100478633
1920 Ga0070699_100535106
1921 Ga0070679_100010746
1922 Ga0070679_100016613
1923 Ga0070679_100128027
1924 Ga0068853_100000320
1925 Ga0068853_100364565
1926 Ga0070665_100001645
1927 Ga0070665_100002076
1928 Ga0070665_100023709
1929 Ga0070665_100036777
1930 Ga0070665_100038919
1931 Ga0070665_100213000
1932 Ga0070665_100214059
1933 Ga0070665_100494499
1934 Ga0070704_100158381
1935 Ga0068855_100237447
1936 Ga0068855_100683284
1937 Ga0070664_100095467
1938 Ga0068857_100007929
1939 Ga0068854_100016799
1940 Ga0068854_100049485
1941 Ga0068854_100063977
1942 Ga0068854_100234496
1943 Ga0068856_100039088
1944 Ga0068856_100209447
1945 Ga0068852_100005347
1946 Ga0068852_100021220
1947 Ga0068852_100057334
1948 Ga0068852_100060942
1949 Ga0068852_100128153
1950 Ga0068852_100189602
1951 Ga0068852_100586486
1952 Ga0068859_100002330
1953 Ga0068859_100004673
1954 Ga0068859_100077898
1955 Ga0068859_100086490
1956 Ga0068864_100000095
1957 Ga0068861_100167728
1958 Ga0068851_10002754
1959 Ga0068851_10009811
1960 Ga0068851_10086230
1961 Ga0068863_100000566
1962 Ga0068863_100001255
1963 Ga0068863_100001274
1964 Ga0068863_100503216
1965 Ga0068858_100000408
1966 Ga0068858_100008334
1967 Ga0068860_100000204
1968 Ga0068860_100001329
1969 Ga0068860_100114548
1970 Ga0068860_100163268
1971 Ga0068860_100486502
1972 Ga0068862_100001099
1973 Ga0068862_100384906
1974 Ga0081455_10035277
1975 Ga0081455_10089432
1976 Ga0075365_10020781
1977 Ga0075365_10028497
1978 Ga0075365_10060257
1979 Ga0075365_10075414
1980 Ga0075365_10235632
1981 Ga0075368_10006205
1982 Ga0075363_100000517
1983 Ga0075363_100081721
1984 Ga0075364_10000330
1985 Ga0075364_10004100
1986 Ga0075364_10006116
1987 Ga0075364_10018863
1988 Ga0075364_10023387
1989 Ga0075364_10109383
1990 Ga0075432_10001362
1991 Ga0075432_10025711
1992 Ga0075362_10006339
1993 Ga0075362_10028612
1994 Ga0075367_10000817
1995 Ga0075367_10001867
1996 Ga0075367_10030850
1997 Ga0075367_10035201
1998 Ga0075367_10051829
1999 Ga0075369_10002835
2000 Ga0075369_10142406
2001 Ga0075366_10003864
2002 Ga0075366_10069473
2003 Ga0097621_100638531
2004 Ga0075370_10007174
2005 Ga0075370_10137935
2006 Ga0075428_100000308
2007 Ga0075430_100175990
2008 Ga0075431_100035633
2009 Ga0075431_100117369
2010 Ga0075433_10003167
2011 Ga0075434_100040767
2012 Ga0075434_100231538
2013 Ga0075429_100326494
2014 Ga0068865_100004923
2015 Ga0075436_100107848
2016 Ga0097620_100002330
2017 Ga0097620_100004672
2018 Ga0097620_100077898
2019 Ga0097620_100086492
2020 Ga0079104_1007879
2021 Ga0099826_10001733
2022 Ga0099826_10011457
2023 Ga0099826_10085389
2024 Ga0075435_100001016
2025 Ga0075435_100126547
2026 Ga0075435_100360360
2027 Ga0105244_10005376
2028 Ga0105244_10024640
2029 Ga0105244_10054329
2030 Ga0105250_10048314
2031 Ga0105240_10000019
2032 Ga0105240_10008822
2033 Ga0105240_10034181
2034 Ga0105240_10133643
2035 Ga0105240_10162229
2036 Ga0105240_10784889
2037 Ga0111539_10009545
2038 Ga0114129_10002076
2039 Ga0105243_10009086
2040 Ga0105243_10102408
2041 Ga0105243_10251776
2042 Ga0105243_10498429
2043 Ga0105241_10134827
2044 Ga0105248_10000956
2045 Ga0105248_10002867
2046 Ga0105248_10022410
2047 Ga0105248_10333479
2048 Ga0105248_10433136
2049 Ga0105248_10956889
2050 Ga0105248_11187341
2051 Ga0105237_10000734
2052 Ga0105237_10013543
2053 Ga0105238_10130517
2054 Ga0105238_10131601
2055 Ga0105238_10141831
2056 Ga0105238_10257715
2057 Ga0105238_10308719
2058 Ga0105249_10002691
2059 Ga0105249_10085780
2060 Ga0123340_1060268
2061 Ga0123341_1000014
2062 Ga0123342_1013040
2063 Ga0123342_1035140
2064 Ga0105239_10000574
2065 Ga0105239_10038018
2066 Ga0105239_10152314
2067 Ga0105246_10003419
2068 Ga0105246_10006000
2069 Ga0105246_10033470
2070 Ga0157314_1002199
2071 Ga0157373_10041542
2072 Ga0157373_10109717
2073 Ga0157373_10235596
2074 Ga0157373_10528331
2075 Ga0157371_10000002
2076 Ga0157371_10009588
2077 Ga0157370_10000131
2078 Ga0157370_10000246
2079 Ga0157370_10036865
2080 Ga0157370_10101533
2081 Ga0157369_10017091
2082 Ga0157369_10058336
2083 Ga0157369_10088543
2084 Ga0157369_10162395
2085 Ga0157369_10215221
2086 Ga0157369_10492205
2087 Ga0163162_10002377
2088 Ga0163162_10027041
2089 Ga0157375_10183886
2090 Ga0157375_10257464
2091 Ga0157375_10281673
2092 Ga0157375_10408714
2093 Ga0157375_10921504
2094 Ga0163163_10000523
2095 Ga0182008_10015150
2096 Ga0182008_10016782
2097 Ga0157379_10006347
2098 Ga0157379_10009511
2099 Ga0157379_10126411
2100 Ga0182006_1034649
2101 Ga0182007_10006425
2102 Ga0183363_1150
2103 Ga0163161_10306703
2104 Ga0206353_10568533
2105 Ga0214544_1000893
2106 Ga0214542_1000115
2107 Ga0214542_1010937
2108 Ga0214543_1000008
2109 Ga0214543_1000098
2110 Ga0213872_10111147
2111 Ga0213875_10002358
2112 Ga0213875_10151488
2113 Ga0228711_1000003
2114 Ga0228710_1000003
2115 Ga0209435_100005
2116 Ga0209436_100023
2117 Ga0209436_100027
2118 Ga0209436_103154
2119 Ga0209437_100058
2120 Ga0209437_100313
2121 Ga0209437_114590
2122 Ga0207425_1000058
2123 Ga0207425_1006058
2124 Ga0207425_1008224
2125 Ga0207425_1014838
2126 Ga0209646_1000011
2127 Ga0209026_1000008
2128 Ga0209759_1000004
2129 Ga0209129_1000080
2130 Ga0209129_1000107
2131 Ga0209129_1000145
2132 Ga0209129_1000605
2133 Ga0209129_1000714
2134 Ga0209129_1001284
2135 Ga0209129_1001351
2136 Ga0209129_1024521
2137 Ga0209233_1000157
2138 Ga0209233_1000354
2139 Ga0209233_1000380
2140 Ga0209673_1000060
2141 Ga0209673_1000233
2142 Ga0209673_1000781
2143 Ga0209673_1001374
2144 Ga0209673_1005142
2145 Ga0209673_1010151
2146 Ga0209673_1014773
2147 Ga0209673_1016024
2148 Ga0209130_1000083
2149 Ga0209130_1000173
2150 Ga0209675_1019772
2151 Ga0209676_1009832
2152 Ga0209025_1000052
2153 Ga0209025_1000083
2154 Ga0209025_1000255
2155 Ga0209025_1000350
2156 Ga0209025_1002871
2157 Ga0209025_1004678
2158 Ga0209025_1015394
2159 Ga0209025_1026479
2160 Ga0209564_1000116
2161 Ga0209564_1000125
2162 Ga0209564_1001273
2163 Ga0209564_1003981
2164 Ga0209564_1006272
2165 Ga0209564_1010520
2166 Ga0209758_1000090
2167 Ga0209758_1000839
2168 Ga0209758_1000928
2169 Ga0209758_1001034
2170 Ga0209758_1001969
2171 Ga0209758_1003215
2172 Ga0209758_1009519
2173 Ga0209758_1015321
2174 Ga0209050_1003361
2175 Ga0209050_1005007
2176 Ga0209256_1000302
2177 Ga0209256_1001684
2178 Ga0209256_1001904
2179 Ga0209256_1006695
2180 Ga0209256_1007478
2181 Ga0209256_1009497
2182 Ga0207426_1000047
2183 Ga0207426_1000173
2184 Ga0207426_1000276
2185 Ga0207426_1001540
2186 Ga0209051_1000217
2187 Ga0209051_1003071
2188 Ga0209051_1013849
2189 Ga0209051_1017658
2190 Ga0209051_1023760
2191 Ga0209051_1044997
2192 Ga0209257_1002359
2193 Ga0209257_1003258
2194 Ga0209257_1026373
2195 Ga0207697_10000777
2196 Ga0207697_10016313
2197 Ga0207656_10007056
2198 Ga0207655_1002973
2199 Ga0207655_1003408
2200 Ga0207688_10143968
2201 Ga0207680_10151896
2202 Ga0207647_10023166
2203 Ga0207647_10032365
2204 Ga0207647_10190198
2205 Ga0207685_10104462
2206 Ga0207645_10003790
2207 Ga0207705_10285350
2208 Ga0207705_10428792
2209 Ga0207654_10131782
2210 Ga0207707_10070567
2211 Ga0207707_10236088
2212 Ga0207695_10000049
2213 Ga0207695_10002646
2214 Ga0207695_10169998
2215 Ga0207695_10326655
2216 Ga0207671_10000423
2217 Ga0207660_10046649
2218 Ga0207657_10013840
2219 Ga0207657_10033074
2220 Ga0207657_10060202
2221 Ga0207649_10007286
2222 Ga0207649_10028688
2223 Ga0207649_10132015
2224 Ga0207652_10046917
2225 Ga0207652_10245788
2226 Ga0207681_10010940
2227 Ga0207681_10017969
2228 Ga0207694_10017871
2229 Ga0207694_10025064
2230 Ga0207694_10058549
2231 Ga0207694_10208913
2232 Ga0207694_10254897
2233 Ga0207650_10000030
2234 Ga0207650_10007621
2235 Ga0207650_10023252
2236 Ga0207650_10551031
2237 Ga0207644_10001318
2238 Ga0207644_10012003
2239 Ga0207644_10088856
2240 Ga0207690_10014391
2241 Ga0207690_10061781
2242 Ga0207709_10019698
2243 Ga0207709_10107250
2244 Ga0207709_10150025
2245 Ga0207669_10096773
2246 Ga0207704_10000732
2247 Ga0207691_10002449
2248 Ga0207711_10001411
2249 Ga0207711_10003037
2250 Ga0207711_10064476
2251 Ga0207711_10093560
2252 Ga0207711_10341662
2253 Ga0207661_10125732
2254 Ga0207679_10521673
2255 Ga0207667_10039773
2256 Ga0207667_10050469
2257 Ga0207667_10181735
2258 Ga0207667_10556790
2259 Ga0207667_10787625
2260 Ga0207651_10134629
2261 Ga0207712_10001578
2262 Ga0207712_10575403
2263 Ga0207668_10000010
2264 Ga0207668_10000502
2265 Ga0207668_10011325
2266 Ga0207668_10148790
2267 Ga0207668_10543076
2268 Ga0207640_10018321
2269 Ga0207640_10037509
2270 Ga0207640_10054952
2271 Ga0207640_10090944
2272 Ga0207640_10214772
2273 Ga0207658_10000810
2274 Ga0207658_10004019
2275 Ga0207658_10101217
2276 Ga0207658_10589461
2277 Ga0207677_10656124
2278 Ga0207703_10000171
2279 Ga0207703_10001817
2280 Ga0207639_10008114
2281 Ga0207639_10018028
2282 Ga0207639_10190099
2283 Ga0207639_10206687
2284 Ga0207639_10258988
2285 Ga0207678_10000075
2286 Ga0207678_10015962
2287 Ga0207678_10153082
2288 Ga0207702_10035243
2289 Ga0207702_10040011
2290 Ga0207702_10074658
2291 Ga0207641_10000007
2292 Ga0207641_10001223
2293 Ga0207641_10059544
2294 Ga0207641_10072576
2295 Ga0207641_10409698
2296 Ga0207676_10000095
2297 Ga0207676_10000268
2298 Ga0207674_10005582
2299 Ga0207674_10067558
2300 Ga0207674_10217523
2301 Ga0207674_10298985
2302 Ga0207683_10002422
2303 Ga0207698_10012352
2304 Ga0207698_10096926
2305 Ga0207698_10666257
2306 Ga0209281_1000068
2307 Ga0209281_1000081
2308 Ga0209281_1000269
2309 Ga0209371_1000003
2310 Ga0209371_1001970
2311 Ga0209371_1004843
2312 Ga0209282_1000040
2313 Ga0209282_1005392
2314 Ga0209813_10002642
2315 Ga0207428_10028693
2316 Ga0207428_10331709
2317 Ga0268266_10001182
2318 Ga0268266_10003080
2319 Ga0268266_10018839
2320 Ga0268266_10048496
2321 Ga0268266_10070595
2322 Ga0268266_10079092
2323 Ga0268266_10109764
2324 Ga0268266_10165162
2325 Ga0268266_10198594
2326 Ga0268265_10009764
2327 Ga0268265_10020309
2328 Ga0268265_10591016
2329 Ga0268264_10000125
2330 Ga0268264_10006798
2331 Ga0268264_10040817
2332 Ga0268264_10095086
2333 Ga0265319_1026846
2334 Ga0265334_10015152
2335 Ga0265318_10000001
2336 Ga0265318_10045221
2337 Ga0307517_10001755
2338 Ga0307517_10051943
2339 Ga0307515_10000017
2340 Ga0307515_10108497
2341 Ga0265338_10001954
2342 Ga0265338_10020392
2343 Ga0265338_10107543
2344 Ga0265338_10135374
2345 Ga0265338_10196329
2346 Ga0268256_1000004
2347 Ga0268256_1001045
2348 Ga0268256_1002352
2349 Ga0316181_1198668
2350 Ga0265325_10004909
2351 Ga0307513_10001025
2352 Ga0307513_10003675
2353 Ga0307513_10022270
2354 Ga0307513_10238617
2355 Ga0307408_100009834
2356 Ga0307408_100024062
2357 Ga0307408_100125185
2358 Ga0307408_100147439
2359 Ga0307408_100237683
2360 Ga0307408_100324237
2361 Ga0307408_100442502
2362 Ga0265313_10004959
2363 Ga0265313_10005514
2364 Ga0265342_10033039
2365 Ga0307405_10005651
2366 Ga0307405_10038653
2367 Ga0307405_10087614
2368 Ga0316577_10056427
2369 Ga0307413_10017665
2370 Ga0307413_10021565
2371 Ga0307413_10031744
2372 Ga0307413_10132346
2373 Ga0307413_10347617
2374 Ga0307413_10368866
2375 Ga0307413_10368993
2376 Ga0307410_10023042
2377 Ga0307410_10066580
2378 Ga0307410_10122282
2379 Ga0307410_10124450
2380 Ga0307410_10136708
2381 Ga0307410_10233966
2382 Ga0307410_10325903
2383 Ga0307406_10005179
2384 Ga0307406_10284958
2385 Ga0307407_10052043
2386 Ga0307407_10079070
2387 Ga0307412_10001366
2388 Ga0307412_10076509
2389 Ga0307412_10163356
2390 Ga0307412_10219959
2391 Ga0307412_10411022
2392 Ga0315914_1000002
2393 Ga0307409_100003695
2394 Ga0307409_100059958
2395 Ga0307409_100065009
2396 Ga0307409_100261492
2397 Ga0307409_100489087
2398 Ga0307416_100017153
2399 Ga0307416_100073294
2400 Ga0307416_100154821
2401 Ga0307416_101099398
2402 Ga0307414_10297741
2403 Ga0307414_10435879
2404 Ga0307414_10578581
2405 Ga0307411_10634820
2406 Ga0307415_100047280
2407 Ga0307415_100065634
2408 Ga0307415_100080857
2409 Ga0307415_100448254
2410 Ga0307510_10006103
2411 Ga0315913_1000016
2412 Ga0315915_1000005
2413 Ga0373950_0016026
2414 Ga0373932_0018430
2415 Ga0316574_0090561
2416 Ga0373931_0265539
2417 Ga0373935_0490795
2418 Ga0373927_0044424
2419 Ga0316584_0034277
2420 Ga0373925_0009202
2421 Ga0373925_0504157
2422 Ga0395899_0000003
2423 Ga0395899_0000124
2424 Ga0395899_0005798
2425 Ga0395899_0015986
2426 Ga0395899_0020222
2427 Ga0395899_0072195
2428 Ga0395899_0079490
2429 Ga0395899_0119762
2430 Ga0395899_0277617
2431 Ga0395900_0000086
2432 Ga0395900_0009282
2433 Ga0395900_0028659
2434 Ga0395900_0078265
2435 Ga0395900_0091409
2436 Ga0395900_0094959
2437 Ga0395900_0231388
2438 Ga0395900_0375663
2439 Ga0395900_0586863
2440 Ga0395898_0000285
2441 Ga0395898_0005320
2442 Ga0395898_0015026
2443 Ga0395898_0020253
2444 Ga0395898_0054630
2445 Ga0395898_0057927
2446 Ga0395898_0138141
2447 Ga0395898_0675954
2448 Ga0395898_0713937
2449 Ga0395905_0000133
2450 Ga0395905_0001192
2451 Ga0395905_0009040
2452 Ga0395905_0022646
2453 Ga0395905_0032485
2454 Ga0395905_0047993
2455 Ga0395905_0049175
2456 Ga0395905_0057256
2457 Ga0395905_0075745
2458 Ga0436364_0477303
2459 Ga0436364_1483550
2460 Ga0395901_0000092
2461 Ga0395901_0059169
2462 Ga0395901_0135851
2463 Ga0395901_0272901
2464 Ga0395901_0278815
2465 Ga0395901_0320703
2466 Ga0395901_0357710
2467 Ga0395901_0433940
2468 Ga0395901_0718362
2469 Ga0436365_0172426
2470 Ga0436360_0128350
2471 Ga0436361_1068301
2472 Ga0439436_0018565
2473 Ga0439438_002499
2474 Ga0439439_0000167
2475 Ga0439447_017353
2476 Ga0439466_0005649
2477 Ga0439465_0043450
2478 Ga0451787_375456
2479 Ga0451791_0372016
2480 Ga0451797_0412961
2481 Ga0451797_1592940
2482 Ga0451845_0403339
2483 Ga0451847_0456571
2484 Ga0451849_0249873
2485 Ga0451855_0519245
2486 Ga0451853_3280964
2487 Ga0451853_3662635
2488 Ga0452268_08108
2489 Ga0439431_0024355
2490 Ga0439433_0000009
2491 Ga0439433_0000060
2492 Ga0439433_0031738
2493 Ga0439442_003183
2494 Ga0439432_003007
2495 Ga0439432_021736
2496 Ga0439449_0000822
2497 Ga0439449_0010414
2498 Ga0439449_0017291
2499 Ga0439449_0022734
2500 Ga0439449_0022817
2501 Ga0439449_0038752
2502 Ga0439449_0072326
2503 Ga0439452_023439
2504 Ga0439454_024146
2505 Ga0439457_000415
2506 Ga0439457_002076
2507 Ga0439462_0000333
2508 Ga0439462_0004265
2509 Ga0439462_0063684
2510 Ga0450919_000036
2511 Ga0450923_033312
2512 Ga0439446_0007611
2513 Ga0450908_000417
2514 Ga0450909_000690
2515 Ga0439434_0005303
2516 Ga0439435_0017110
2517 Ga0450918_004267
2518 Ga0466972_0070585
2519 Ga0453683_0000002
2520 Ga0453683_0000848
2521 Ga0453683_0007480
2522 Ga0466961_0171647
2523 Ga0466963_0000551
2524 Ga0466963_0013745
2525 Ga0453684_0000006
2526 Ga0453684_0000048
2527 Ga0453684_0544482
2528 Ga0466968_0101030
2529 Ga0466970_0046089
2530 Ga0466957_0241358
2531 Ga0466960_0155106
2532 Ga0451576_0186193
2533 Ga0451576_0213557
2534 Ga0466958_0012379
2535 Ga0466958_0063741
2536 Ga0466958_0147632
2537 Ga0466967_0005549
2538 Ga0466967_0015125
2539 Ga0466967_0032079
2540 Ga0466967_0064140
2541 Ga0466967_0217932
2542 Ga0495638_0006458
2543 Ga0495653_0008062
2544 Ga0495653_0038307
2545 Ga0495650_0045538
2546 Ga0495580_0048533
2547 Ga0495582_0026943
2548 Ga0495605_0056839
2549 Ga0495639_0002717
2550 Ga0495639_0125428
2551 Ga0495662_0032753
2552 Ga0495662_0125037
2553 Ga0495607_0184233
2554 Ga0495606_0003931
2555 Ga0495606_0040817
2556 Ga0495608_0094790
2557 Ga0495610_0011758
2558 Ga0495616_0036341
2559 Ga0495618_0293807
2560 Ga0495618_0335582
2561 Ga0495618_0374818
2562 Ga0495620_0137895
2563 Ga0495620_0141682
2564 Ga0495630_0135225
2565 Ga0495632_0028927
2566 Ga0495643_0025280
2567 Ga0495648_0044152
2568 Ga0495654_0000635
2569 Ga0495654_0065960
2570 Ga0495665_0004205
2571 Ga0495665_0006628
2572 Ga0495586_0000879
2573 Ga0495586_0017309
2574 Ga0495587_0003433
2575 Ga0495587_0275380
2576 Ga0495609_0005705
2577 Ga0495645_0001581
2578 Ga0495667_0004009
2579 Ga0495667_0097009
2580 Ga0495667_0289715
2581 Ga0495668_0004368
2582 Ga0495668_0018076
2583 Ga0495668_0270723
2584 Ga0495625_0105363
2585 Ga0495625_0134729
2586 Ga0495625_0153701
2587 Ga0495625_0207939
2588 Ga0495635_0025255
2589 Ga0495659_0010930
2590 Ga0495661_0122459
2591 Ga0495588_0001385
2592 Ga0495588_0003429
2593 Ga0495588_0007477
2594 Ga0495588_0059848
2595 Ga0495657_0040369
2596 Ga0495657_0073272
2597 Ga0495599_0224696
2598 Ga0495623_0034629
2599 Ga0495669_0000009
2600 Ga0495669_0000153
2601 Ga0495669_0091910
2602 Ga0495613_0300963
2603 Ga0495670_0058999
2604 Ga0495670_0105887
2605 Ga0495600_0020885
2606 Ga0495581_0043902
2607 Ga0495604_0031099
2608 Ga0495636_0050778
2609 Ga0495674_0505928
2610 Ga0495680_0016626
2611 Ga0495687_051636
2612 Ga0495675_0026688
2613 Ga0495681_0060428
2614 Ga0495684_0077973
2615 Ga0495686_0000852
2616 Ga0495686_0008302
2617 Ga0495686_0094384
2618 Ga0495593_0019117
2619 Ga0496100_0013260
2620 Ga0496100_0081076
2621 Ga0496101_0017290
2622 Ga0496101_0044320
2623 Ga0496101_0059675
2624 Ga0496101_0060189
2625 Ga0496101_0271258
2626 Ga0496102_0005681
2627 Ga0496102_0005930
2628 Ga0496102_0016011
2629 Ga0496102_0069810
2630 Ga0496103_0002113
2631 Ga0496103_0007511
2632 Ga0496103_0064827
2633 Ga0496103_0108511
2634 Ga0496104_0045979
2635 Ga0496104_0157489
2636 Ga0496105_0017399
2637 Ga0496105_0028335
2638 Ga0496105_0031283
2639 Ga0496106_0009583
2640 Ga0496106_0052469
2641 Ga0496106_0115013
2642 Ga0496107_0009215
2643 Ga0496107_0011077
2644 Ga0496107_0022043
2645 Ga0496107_0096943
2646 Ga0496108_0328271
2647 Ga0496109_0013737
2648 Ga0496109_0160319
2649 Ga0496109_0167366
2650 Ga0496109_0425294
2651 Ga0496110_0019081
2652 Ga0496110_0066728
2653 Ga0496110_0070903
2654 Ga0496110_0311837
2655 Ga0496110_0371985
2656 Ga0496111_0002534
2657 Ga0496111_0028422
2658 Ga0496111_0114775
2659 Ga0496111_0157767
2660 Ga0496111_0236973
2661 Ga0496111_0266716
2662 Ga0496112_0000720
2663 Ga0496112_0057323
2664 Ga0496112_0126747
2665 Ga0496112_0251571
2666 Ga0496113_0044249
2667 Ga0496113_0044795
2668 Ga0496114_0034913
2669 Ga0496114_0066033
2670 Ga0496114_0093662
2671 Ga0496115_0024704
2672 Ga0496115_0110781
2673 Ga0496115_0136398
2674 Ga0496115_0198520
2675 Ga0496115_0544471
2676 Ga0496116_0000471
2677 Ga0496116_0006412
2678 Ga0496116_0021816
2679 Ga0496116_0032549
2680 Ga0496116_0045918
2681 Ga0496117_0000052
2682 Ga0496117_0000926
2683 Ga0496117_0002079
2684 Ga0496117_0022166
2685 Ga0496117_0028573
2686 Ga0496118_0000792
2687 Ga0496118_0001977
2688 Ga0496118_0015866
2689 Ga0496118_0023162
2690 Ga0496119_0005539
2691 Ga0496119_0007934
2692 Ga0496119_0012383
2693 Ga0496119_0023594
2694 Ga0496119_0028943
2695 Ga0496119_0064456
2696 Ga0496119_0089163
2697 Ga0496120_0000019
2698 Ga0496120_0005030
2699 Ga0496120_0099216
2700 Ga0496120_0099510
2701 Ga0496121_0000003
2702 Ga0496121_0000442
2703 Ga0496121_0007187
2704 Ga0496121_0009686
2705 Ga0496121_0032256
2706 Ga0496121_0149771
2707 Ga0496122_0000042
2708 Ga0496122_0000053
2709 Ga0496122_0008527
2710 Ga0496122_0018036
2711 Ga0496122_0030136
2712 Ga0496123_0000030
2713 Ga0496123_0000038
2714 Ga0496123_0006991
2715 Ga0496123_0014925
2716 Ga0496123_0032380
2717 Ga0496123_0034916
2718 Ga0496123_0205788
2719 Ga0496124_0001932
2720 Ga0496124_0009594
2721 Ga0496124_0010356
2722 Ga0496124_0021455
2723 Ga0496124_0022392
2724 Ga0496124_0035547
2725 Ga0496124_0046484
2726 Ga0496124_0054364
2727 Ga0496124_0076409
2728 Ga0496124_0099570
2729 Ga0496124_0120441
2730 Ga0496124_0152582
2731 Ga0496124_0253426
2732 Ga0496125_0000170
2733 Ga0496125_0000611
2734 Ga0496125_0044183
2735 Ga0496125_0229273
2736 Ga0496125_0250537
2737 Ga0496126_0000640
2738 Ga0496126_0002372
2739 Ga0496126_0067226
2740 Ga0496126_0290682
2741 Ga0501309_019150
2742 Ga0501304_001866
2743 Ga0501305_030646
2744 Ga0501312_013804
2745 Ga0501314_002497
2746 Ga0501315_002817
2747 Ga0501317_005340
2748 Ga0501318_000524
2749 Ga0501318_005739
2750 Ga0501320_003313
2751 Ga0501321_001114
2752 Ga0501321_016663
2753 Ga0501323_005732
2754 Ga0501340_003880
2755 Ga0501031_0014277
2756 Ga0501031_0097270
2757 Ga0501031_0119662
2758 Ga0501032_0005338
2759 Ga0501032_0006157
2760 Ga0501032_0035359
2761 Ga0501032_0094584
2762 Ga0501032_0102286
2763 Ga0501032_0252081
2764 Ga0501033_0000318
2765 Ga0501033_0012344
2766 Ga0501033_0015989
2767 Ga0501033_0055013
2768 Ga0501033_0056189
2769 Ga0501033_0078764
2770 Ga0501033_0105754
2771 Ga0501033_0265589
2772 Ga0501033_0323046
2773 Ga0501034_0000016
2774 Ga0501034_0000076
2775 Ga0501034_0025717
2776 Ga0501034_0026667
2777 Ga0501034_0040959
2778 Ga0501034_0059256
2779 Ga0501034_0207206
2780 Ga0501034_0215982
2781 Ga0501034_0216044
2782 Ga0501034_0258522
2783 Ga0501034_0427048
2784 Ga0501034_0450970
2785 Ga0501034_0615653
2786 Ga0501034_0734672
2787 Ga0501034_0795656
2788 Ga0501036_0140654
2789 Ga0501036_0654182
2790 Ga0501037_0000136
2791 Ga0501037_0001333
2792 Ga0501037_0091212
2793 Ga0501037_0107536
2794 Ga0501037_0180281
2795 Ga0501037_0223331
2796 Ga0501037_0384396
2797 Ga0501038_0073537
2798 Ga0501038_0093115
2799 Ga0501038_0150328
2800 Ga0501038_0195184
2801 Ga0501038_0210752
2802 Ga0501038_0212880
2803 Ga0501038_0331652
2804 Ga0501039_0001974
2805 Ga0501039_0050313
2806 Ga0501039_0337716
2807 Ga0501043_0000006
2808 Ga0501043_0009632
2809 Ga0501043_0027393
2810 Ga0501043_0045511
2811 Ga0501043_0083456
2812 Ga0501043_0107807
2813 Ga0501043_0132071
2814 Ga0501043_0337247
2815 Ga0501043_0346549
2816 Ga0501046_0000060
2817 Ga0501046_0011131
2818 Ga0501046_0045243
2819 Ga0501046_0110512
2820 Ga0501046_0115621
2821 Ga0501047_0000130
2822 Ga0501047_0005754
2823 Ga0501047_0023767
2824 Ga0501047_0047434
2825 Ga0501047_0066121
2826 Ga0501047_0078348
2827 Ga0501047_0139393
2828 Ga0501047_0159167
2829 Ga0501047_0176911
2830 Ga0501047_0314545
2831 Ga0501047_0577825
2832 Ga0501047_0768892
2833 Ga0501048_0088984
2834 Ga0501048_0314151
2835 Ga0501067_0001850
2836 Ga0501067_0001904
2837 Ga0501067_0011547
2838 Ga0501067_0089570
2839 Ga0501068_0183464
2840 Ga0501068_0194072
2841 Ga0501069_0000024
2842 Ga0501069_0058776
2843 Ga0501069_0065714
2844 Ga0501069_0265020
2845 Ga0501070_0000093
2846 Ga0501070_0001628
2847 Ga0501070_0028127
2848 Ga0501070_0048150
2849 Ga0501070_0063370
2850 Ga0501070_0104466
2851 Ga0501070_0137356
2852 Ga0501071_0019991
2853 Ga0501071_0134088
2854 Ga0501072_0344501
2855 Ga0501073_0001043
2856 Ga0501073_0006499
2857 Ga0501073_0031644
2858 Ga0501073_0048885
2859 Ga0501073_0132018
2860 Ga0501073_0215651
2861 Ga0501073_0286184
2862 Ga0501074_0000011
2863 Ga0501074_0067201
2864 Ga0501074_0218449
2865 Ga0501075_0585000
2866 Ga0501076_0095588
2867 Ga0501076_0327444
2868 Ga0501233_022834
2869 Ga0501249_014808
2870 Ga0501079_0203850
2871 Ga0501080_0000004
2872 Ga0501080_0001346
2873 Ga0501080_0014444
2874 Ga0501080_0015694
2875 Ga0501080_0165199
2876 Ga0501080_0270799
2877 Ga0501080_0609410
2878 Ga0501083_0000097
2879 Ga0501083_0006732
2880 Ga0501083_0036629
2881 Ga0501083_0068497
2882 Ga0501083_0075083
2883 Ga0501083_0114881
2884 Ga0501083_0377277
2885 Ga0501280_004583
2886 Ga0501035_0000068
2887 Ga0501035_0000191
2888 Ga0501035_0005628
2889 Ga0501035_0015558
2890 Ga0501035_0024244
2891 Ga0501035_0037531
2892 Ga0501035_0050175
2893 Ga0501035_0150104
2894 Ga0501035_0167838
2895 Ga0501035_0215972
2896 Ga0501035_0238499
2897 Ga0501035_0251803
2898 Ga0501035_0272035
2899 Ga0501035_0433632
2900 Ga0501044_0000096
2901 Ga0501044_0000227
2902 Ga0501044_0015336
2903 Ga0501044_0034145
2904 Ga0501044_0091334
2905 Ga0501044_0095974
2906 Ga0501044_0216393
2907 Ga0501044_0223969
2908 Ga0501044_0278545
2909 Ga0501044_0492252
2910 Ga0501045_0111485
2911 nmdc:mga03683_23695_c1
2912 nmdc:mga03683_4150_c1
2913 nmdc:mga03n38_985_c1
2914 nmdc:mga00v17_13099_c1
2915 nmdc:mga00v17_1452_c1
2916 nmdc:mga00v17_30044_c1
2917 nmdc:mga00v17_3294_c1
2918 nmdc:mga00v17_346_c2
2919 nmdc:mga00v17_34837_c1
2920 nmdc:mga00v17_5491_c1
2921 nmdc:mga00v17_55_c1
2922 nmdc:mga0yw44_10019_c1
2923 nmdc:mga0yw44_113102_c1
2924 nmdc:mga0yw44_13785_c1
2925 nmdc:mga0yw44_18133_c1
2926 nmdc:mga0yw44_18651_c1
2927 nmdc:mga0yw44_221381_c1
2928 nmdc:mga0yw44_42753_c1
2929 nmdc:mga0yw44_55885_c1
2930 nmdc:mga0yw44_57531_c1
2931 nmdc:mga0k408_2026_c1
2932 nmdc:mga0k408_22262_c1
2933 nmdc:mga06z11_168428_c1
2934 nmdc:mga06z11_42828_c1
2935 nmdc:mga06z11_6363_c1
2936 nmdc:mga04h51_19483_c1
2937 nmdc:mga04h51_24571_c1
2938 nmdc:mga07m45_19471_c1
2939 nmdc:mga07m45_48666_c1
2940 nmdc:mga05p37_13210_c1
2941 nmdc:mga09592_299655_c1
2942 nmdc:mga0qj67_140319_c1
2943 nmdc:mga06r32_141587_c1
2944 nmdc:mga06r32_145692_c1
2945 nmdc:mga06r32_254070_c1
2946 nmdc:mga08y16_19492_c1
2947 nmdc:mga0n895_235902_c1
2948 nmdc:mga0n895_235970_c1
2949 nmdc:mga0rr50_201022_c1
2950 nmdc:mga08x19_24076_c1
2951 nmdc:mga0a205_670708_c1
2952 nmdc:mga0a205_69791_c1
2953 nmdc:mga0sz30_32_c1
2954 Ga0495612_0077729
2955 Ga0495595_0114375
2956 Ga0495619_0006691
2957 Ga0495619_0124989
2958 Ga0495619_0218437
2959 Ga0500578_0031483
2960 Ga0500641_0000724
2961 Ga0500555_043140
2962 Ga0500556_0000245
2963 Ga0500569_015440
2964 Ga0500593_000184
2965 Ga0500595_050259
2966 Ga0500618_000337
2967 Ga0500658_0000832
2968 Ga0500561_0001332
2969 Ga0500568_0000004
2970 Ga0500568_0000066
2971 Ga0500568_0002568
2972 Ga0500590_000975
2973 Ga0500616_0000677
2974 Ga0500616_0002705
2975 Ga0500616_0010398
2976 Ga0500616_0056498
2977 Ga0501084_0047108
2978 Ga0587066_009767
2979 Ga0587077_007087
2980 Ga0587077_011570
2981 Ga0587077_039791
2982 Ga0587080_011972
2983 Ga0587085_025967
2984 Ga0587086_003962
2985 Ga0587088_009540
2986 Ga0587088_055478
2987 Ga0587089_004516
2988 Ga0587090_003549
2989 Ga0587090_017559
2990 Ga0587094_025508
2991 Ga0587106_005895
2992 Ga0587125_002729
2993 Ga0587131_000391
2994 Ga0587101_006661
2995 Ga0587101_026602
2996 Ga0587115_006083
2997 Ga0587128_003881
2998 Ga0587062_002913
2999 Ga0587062_021918
3000 Ga0587067_034787
3001 Ga0587068_005894
3002 Ga0587072_002513
3003 Ga0587072_004020
3004 Ga0587072_011351
3005 Ga0587079_039765
3006 Ga0587124_001124
3007 Ga0501082_0058170
3008 Ga0501082_0090625
3009 Ga0501082_0121513
3010 Ga0501082_0272645
3011 Ga0466962_0010536
3012 Ga0466962_0071935
3013 Ga0466962_0104240
3014 Ga0530510_0083423
3015 2509109744
3016 2509379278
3017 2509447786
3018 2510134698
3019 2510307322
3020 2510842495
3021 2510896049
3022 2511136686
3023 2511171482
3024 2511187187
3025 2511200458
3026 2511392381
3027 2511502896
3028 2512534138
3029 2512974027
3030 2513573250
3031 2513578499
3032 2513584116
3033 2513599087
3034 2513602256
3035 2513616988
3036 2513631463
3037 2513710604
3038 2513867574
3039 2513882001
3040 2513905533
3041 2513985486
3042 2514003899
3043 2514023413
3044 2515113789
3045 2515610446
3046 2515634653
3047 2515645303
3048 2515660891
3049 2515743511
3050 2516205136
3051 2516894302
3052 2517037400
3053 2517077700
3054 2517096499
3055 2517410596
3056 2517570909
3057 2523469464
3058 2524451769
3059 2524462068
3060 2530646816
3061 2535485788
3062 2535519577
3063 2537876439
3064 2551674721
3065 2551685469
3066 2551693876
3067 2551698535
3068 2551713413
3069 2551717355
3070 2551730383
3071 2551736235
3072 2551741347
3073 2554245230
3074 2555229954
3075 2558860318
3076 2559296940
3077 2561468095
3078 2585167913
3079 2585204877
3080 2585224936
3081 2585227649
3082 2585257664
3083 2585265473
3084 2585274157
3085 2585280430
3086 2585322703
3087 2585330820
3088 2585388426
3089 2585403379
3090 2585529610
3091 2585532658
3092 2585541156
3093 2585547492
3094 2585554326
3095 2585560606
3096 2585823675
3097 2585839919
3098 2585845182
3099 2585898817
3100 2585903596
3101 2585997029
3102 2586001630
3103 2587981284
3104 2599334827
3105 2599420683
3106 2599604630
3107 2599722496
3108 2600373762
3109 2601611213
3110 2601747986
3111 2616295420
3112 2616307271
3113 2616554814
3114 2643752063
3115 2643771423
3116 2643813151
3117 2643836882
3118 2643858255
3119 2643916954
3120 2644006264
3121 2644050975
3122 2644108590
3123 2644145636
3124 2644191533
3125 2644205478
3126 2644209959
3127 2644241715
3128 2644299143
3129 2644312287
3130 2644335916
3131 2644483879
3132 2644496275
3133 2644500312
3134 2644521182
3135 2644546773
3136 2644617970
3137 2644653510
3138 2644657371
3139 2655032658
3140 2657684076
3141 2671112068
3142 2671691851
3143 2692314613
3144 2719182468
3145 2719387127
3146 2719733187
3147 2720493191
3148 2720614668
3149 2720621441
3150 2720632769
3151 2720776493
3152 2721148581
3153 2721159967
3154 2721165395
3155 2721400762
3156 2722841565
3157 2723028081
3158 2723561712
3159 2723568341
3160 2724039575
3161 2724045943
3162 2724091100
3163 2724105606
3164 2724111433
3165 2725947685
3166 2730109017
3167 2730165703
3168 2730299599
3169 2738800600
3170 2738944407
3171 2739035708
3172 2739351717
3173 2753360177
3174 2753458711
3175 2757570491
3176 2758642500
3177 2765467283
3178 2766065469
3179 2770198098
3180 2776269947
3181 2776281064
3182 2776914462
3183 2778175888
3184 2792582639
3185 2792622899
3186 2792629153
3187 2792640494
3188 2793281714
3189 2793293780
3190 2793313196
3191 2793319857
3192 2793328139
3193 2793333235
3194 2793343818
3195 2793347238
3196 2793356625
3197 2793362916
3198 2793370058
3199 2802718001
3200 2802725148
3201 2802730728
3202 2802738075
3203 2802744055
3204 2802750934
3205 2804753235
3206 2805930706
3207 2805934179
3208 2806044695
3209 2806052895
3210 2806059195
3211 2806068142
3212 2806074262
3213 2808891465
3214 2808987456
3215 2819243714
3216 2819557226
3217 2819609728
3218 2819639827
3219 2819685550
3220 2821126037
3221 2833710890
3222 2837679087
3223 2838018968
3224 2838024432
3225 2838033007
3226 2838046389
3227 2838051316
3228 2838063706
3229 2838664969
3230 2838678233
3231 2838691466
3232 2838716861
3233 2838722529
3234 2838727610
3235 2838733425
3236 2838737486
3237 2838746003
3238 2839998041
3239 2840765654
3240 2841766481
3241 2841842145
3242 2841849216
3243 2841853715
3244 2841861713
3245 2841868320
3246 2842128035
3247 2842133126
3248 2842141924
3249 2842155120
3250 2842162278
3251 2842169834
3252 2842173619
3253 2842178741
3254 2842185204
3255 2842189968
3256 2842199975
3257 2842214282
3258 2842227001
3259 2842233691
3260 2842247735
3261 2842253893
3262 2842261997
3263 2842266474
3264 2842275940
3265 2842288929
3266 2842298567
3267 2842308076
3268 2842316167
3269 2842321542
3270 2842344858
3271 2842362419
3272 2842369363
3273 2842398667
3274 2842406404
3275 2842413169
3276 2842419812
3277 2842429793
3278 2842436547
3279 2842444250
3280 2842450889
3281 2842464214
3282 2842470876
3283 2842479740
3284 2842493122
3285 2842499308
3286 2842506916
3287 2842510595
3288 2842518021
3289 2842695232
3290 2842874745
3291 2842925953
3292 2844106248
3293 2844169135
3294 2844457640
3295 2844849107
3296 2847420337
3297 2848995149
3298 2850082216
3299 2851246604
3300 2852391046
3301 2852679308
3302 2854900356
3303 2854912979
3304 2854920188
3305 2855826937
3306 2855842333
3307 2855878530
3308 2857481066
3309 2857532599
3310 2857634796
3311 2857732661
3312 2857741918
3313 2858803148
3314 2870802353
3315 2870804435
3316 2889793273
3317 2889917474
3318 2891049307
3319 2891377603
3320 2894654054
3321 2895882162
3322 2897563324
3323 2899275900
3324 2899792801
3325 2899845462
3326 2904498055
3327 2904580339
3328 2904777413
3329 2910810629
3330 2913299750
3331 2913309026
3332 2915654220
3333 2915980456
3334 2915987745
3335 2915999004
3336 2916006173
3337 2916013013
3338 2916015605
3339 2916022472
3340 2916029080
3341 2916038408
3342 2916044834
3343 2916054076
3344 2916058153
3345 2916067034
3346 2916068878
3347 2916077371
3348 2917556592
3349 2919034785
3350 2919062256
3351 2919104412
3352 2919117052
3353 2919119985
3354 2919169778
3355 2919393814
3356 2919410553
3357 2919540250
3358 2920828594
3359 2921202914
3360 2921214573
3361 2921242582
3362 2921250181
3363 2921252274
3364 2921257553
3365 2921270835
3366 2921282897
3367 2921292583
3368 2921300944
3369 2923558920
3370 2924149317
3371 2924155467
3372 2924163257
3373 2924171844
3374 2924176975
3375 2924186278
3376 2924191599
3377 2924195010
3378 2924201627
3379 2924213498
3380 2924220819
3381 2924221861
3382 2924233362
3383 2926758565
3384 2926763903
3385 2928123002
3386 2928523093
3387 2929141293
3388 2932428080
3389 2933009501
3390 2933013650
3391 2933023329
3392 2933421403
3393 2933574525
3394 2933589126
3395 2933598108
3396 2933604733
3397 2935899873
3398 2935907043
3399 2936375012
3400 2936380703
3401 2936382127
3402 2936999940
3403 2937007084
3404 2937010940
3405 2937018274
3406 2937025757
3407 2937033103
3408 2937036605
3409 2937044044
3410 2937055686
3411 2937058405
3412 2937067448
3413 2937074772
3414 2937078522
3415 2937091353
3416 2937092748
3417 2937104948
3418 2937111743
3419 2937114938
3420 2937121445
3421 2937129421
3422 2937848507
3423 2939648500
3424 2939672282
3425 2939675455
3426 2945942901
3427 2945959353
3428 2946025612
3429 2954000048
3430 2954013542
3431 2957377547
3432 2957387668
3433 2957389887
3434 2957397419
3435 2957404648
3436 2957409116
3437 2957420698
3438 2957426439
3439 2957435751
3440 2957437280
3441 2957449450
3442 2957452316
3443 2957458678
3444 2957469699
3445 2957472117
3446 2957484463
3447 2957490933
3448 2957496286
3449 2957499363
3450 2957509074
3451 2960585453
3452 2960591170
3453 2960602272
3454 2960609602
3455 2960614320
3456 2960623449
3457 2960627996
3458 2960636548
3459 2960640534
3460 2960651546
3461 2960653175
3462 2960665373
3463 2960672542
3464 2960676329
3465 2960682538
3466 2960692454
3467 2960696899
3468 2964612910
3469 2964619734
3470 2964628294
3471 2964630953
3472 2964637105
3473 2964644732
3474 2964651413
3475 2964657701
3476 2964666565
3477 2964674593
3478 2964679552
3479 2964687360
3480 2964692327
3481 2964702620
3482 2964711110
3483 2964713287
3484 2964722456
3485 2967670785
3486 2967672818
3487 2967685301
3488 2967689311
3489 2967696258
3490 2967701413
3491 2967713838
3492 2967719980
3493 2967727768
3494 2967732595
3495 2967735288
3496 2967745522
3497 2967752343
3498 2967759268
3499 2967766867
3500 2967770536
3501 2967777554
3502 2970025890
3503 2970028196
3504 2970035020
3505 2970042493
3506 2970053489
3507 2970056063
3508 2970063048
3509 2970074494
3510 2970079216
3511 2970087812
3512 2970089159
3513 2970100291
3514 2970103788
3515 2970116134
3516 2970121249
3517 2970126038
3518 2970130170
3519 2970141212
3520 2970146524
3521 2970150523
3522 2970159310
3523 2970166822
3524 2970173481
3525 2970180679
3526 2970191545
3527 2970196263
3528 2974306751
3529 2977519839
3530 2977528019
3531 2977534247
3532 2977541103
3533 2977548089
3534 2977552173
3535 2977560069
3536 2977567261
3537 2977574862
3538 2977579846
3539 2978972197
3540 2979090999
3541 2979096525
3542 2979102258
3543 2984509794
3544 2984519509
3545 2984538132
3546 2984590423
3547 2984604884
3548 2989354738
3549 2989773420
3550 2989779715
3551 2995394863
3552 2996890112
3553 2996895902
3554 3002141381
3555 3003934812
3556 3005415629
3557 3005418612
3558 3005449129
3559 3005455408
3560 639649863
3561 643826988
3562 648735937
3563 650843361
3564 8003572957
3565 8003994871
3566 8004002624
3567 8005249668
3568 8005262167
3569 8005281854
3570 8005288848
3571 8005294433
3572 8005306816
3573 8005310814
3574 8005318496
3575 8005324639
3576 8005378335
3577 8005383980
3578 8005401307
3579 8005434262
3580 8005464476
3581 8005488623
3582 8005501519
3583 8005547274
3584 8005558526
3585 8005566630
3586 8005575081
3587 8005622880
3588 8005631819
3589 8005649090
3590 8005658655
3591 8005672940
3592 8005682329
3593 8005693487
3594 8005700708
3595 8018133754
3596 8018153299
3597 8018170074
3598 8018178600
3599 8023687697
3600 8024481640
3601 8024487873
3602 8024506093
3603 8045867498
3604 8046772037
3605 8049295847
3606 8054463363
3607 8054565621
3608 8055432123
3609 8056381444
3610 8056386887
3611 8057577531
3612 8057876677

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01709

Transcrip_reg

TACO1/YebC second and third domain

131

286

0.97

PF20772

TACO1_YebC_N

TACO1/YebC protein N-terminal domain

55

126

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
1mw7-assembly1.cif.gz_A x-ray structure of y162_helpy northeast structural genomics consortium target pr6 0.9298 25 232
1mw7-assembly1.cif.gz_A x-ray structure of y162_helpy northeast structural genomics consortium target pr6 0.8775 25 232
1lfp-assembly1.cif.gz_A crystal structure of a conserved hypothetical protein aq1575 from aquifex aeolicus 0.8613 18 238
7b9q-assembly1.cif.gz_A the serp optimized structure of ribonucleotide reductase from rhodobacter sphaeroides 0.7767 19 73
1kon-assembly1.cif.gz_A crystal structure of e.coli yebc 0.7695 3 239
ID Description Score Start End Superfamily
af_I1K9D8_53_128_1.10.10.200 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Integrase, N-terminal zinc-binding domain 0.958 5 80 1.10.10.200
1lfpA02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;YebC, transcriptional regulation domain 0.9566 82 238 3.30.70.980
af_Q6F2Z2_64_139_1.10.10.200 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Integrase, N-terminal zinc-binding domain 0.9562 9 81 1.10.10.200
af_I1K9D8_53_128_1.10.10.200 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Integrase, N-terminal zinc-binding domain 0.9461 5 80 1.10.10.200
1mw7A01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Integrase, N-terminal zinc-binding domain 0.9419 27 80 1.10.10.200
ID Description Score Start End GO Terms
AF-A0A3D2R6N4-F1-model_v4 YebC/PmpR family DNA-binding transcriptional regulator 0.9735 32 135 GO:0003677
GO:0005829
AF-A0A355RH01-F1-model_v4 YebC/PmpR family DNA-binding transcriptional regulator 0.9688 1 118 GO:0003677
GO:0005829
AF-A0A2E3IMT4-F1-model_v4 YebC/PmpR family DNA-binding transcriptional regulator 0.9571 1 133 GO:0003677
GO:0005737
AF-A0A1E5UAT0-F1-model_v4 Probable transcriptional regulatory protein BHF72_0982 0.9559 22 239 GO:0003677
GO:0005829
GO:0006355
AF-A0A7R9V5A2-F1-model_v4 YebC/PmpR family DNA-binding transcriptional regulator 0.9535 16 121 GO:0009507

Map