F495758
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1808 | 794 | 3616 | 196 |
Family's Representative Sequence
| Representative Sequence | 3300048918|Ga0496115_0672631|Ga0496115_0672631_116_802 |
| Length | 228 |
| Sequence | MAQPISTQAGMMTATPRQGRVASIIVWSAATSGALAVLGAAALWFHYGTAVFFEVIMLWAMGGLRTVTAPAAIGGPFQLTDQAGQAVTEQSLKGKPTLIFFGFTHCPDVCPTSLFEISEVLKAMGTDADKVNAWFVSVDPERDTAAAMKDYLSSFDPHLKGLTGEPQAVAKVISAYRVYARKVPLKDGDYTMDHTALIYLMDRDGNFVAPFNLKRTPEEAAKDLKRYL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 2 | 2209111006 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 | Metagenome | Rhizosphere |
| 3 | 3300000041 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere | Metagenome | Rhizosphere |
| 4 | 3300000042 | Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young | Metagenome | Rhizosphere |
| 5 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 6 | 3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old | Metagenome | Rhizosphere |
| 7 | 3300000045 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere | Metagenome | Rhizosphere |
| 8 | 3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Metagenome | Rhizosphere |
| 9 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 10 | 3300001978 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 | Metagenome | Rhizosphere |
| 11 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 12 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 13 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 14 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 15 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 16 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 17 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 18 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 19 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 20 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 21 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 22 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 23 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 24 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 25 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 26 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 27 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 28 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 29 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 30 | 3300005276 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v1 | Metagenome | Rhizosphere |
| 31 | 3300005277 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) | Metagenome | Rhizosphere |
| 32 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 33 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 34 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 35 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 39 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 42 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 44 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 46 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 48 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 59 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 62 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 64 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 65 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 66 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 69 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 74 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 75 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 76 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 77 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 79 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 80 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 81 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 83 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 84 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 88 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 89 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 91 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 92 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 93 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 94 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 95 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 96 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 97 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 98 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 99 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 100 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 101 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 102 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 103 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 104 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 105 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 106 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 107 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 108 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 109 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 110 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 111 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 112 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 113 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 114 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 115 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 116 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 117 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 118 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 119 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 120 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 122 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 123 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 124 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 125 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 126 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 127 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 128 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300006941 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW | Metagenome | Nodule |
| 130 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 131 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 132 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 133 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 135 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 136 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 137 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 139 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 140 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 142 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 143 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 144 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 145 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 146 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 147 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 148 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 149 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 150 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 151 | 3300012492 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 | Metagenome | Rhizosphere |
| 152 | 3300012507 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 | Metagenome | Rhizosphere |
| 153 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 154 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 155 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 156 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 157 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 158 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 159 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 160 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 161 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 162 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 163 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 164 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 165 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 166 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 167 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 168 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 169 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 170 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 171 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 172 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 173 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 174 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 175 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 176 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 177 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 178 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 179 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 180 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 181 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 182 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 183 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 184 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 186 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 187 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 188 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 189 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 190 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 254 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 255 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 256 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 257 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 258 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 259 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 260 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 261 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 262 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 263 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 264 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 265 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 266 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 267 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 268 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 269 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 270 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 271 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 272 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 273 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 274 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 275 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 276 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 277 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 278 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 279 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 280 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 281 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 282 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 283 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 284 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 285 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 286 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 287 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 288 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 289 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 290 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 291 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 292 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 293 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 294 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 295 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 296 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 297 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 298 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 299 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 300 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 301 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 302 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 303 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 304 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 305 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 306 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 307 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 308 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 309 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 310 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 311 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 312 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 313 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 314 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 315 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 316 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 317 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 318 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 319 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 320 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 321 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 322 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 323 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 324 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 325 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 326 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 327 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 328 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 329 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 330 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 331 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 332 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 333 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 334 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 335 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 336 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 337 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 338 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 339 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 340 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 341 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 342 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 343 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 344 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 345 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 346 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 347 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 348 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 349 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 350 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 351 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 352 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 353 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 354 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 355 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 356 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 420 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 421 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 422 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 423 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 424 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 425 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 426 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 427 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 428 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 429 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 430 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 431 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 432 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 433 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 434 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 435 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 436 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 437 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 438 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 439 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 440 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 441 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 442 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 443 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 444 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 445 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 446 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 447 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 448 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 449 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 450 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 451 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 452 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 453 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 454 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 455 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 456 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 457 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 458 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 459 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 460 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 461 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 462 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 463 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 464 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 465 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 466 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 467 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 468 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 469 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 470 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 471 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 472 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 473 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 474 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 475 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 476 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 477 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 478 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 479 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 480 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 481 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 482 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 483 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 484 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 485 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 486 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 487 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 488 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 489 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 490 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 491 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 492 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 493 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 494 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 495 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 496 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 497 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 498 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 499 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 500 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 501 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 502 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 503 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 504 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 505 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 506 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 507 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 508 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 509 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 510 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 511 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 512 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 513 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 514 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 515 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 516 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 517 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 518 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 519 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 520 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 521 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 522 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 523 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 524 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 525 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 526 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 527 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 528 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 529 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 530 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 531 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 532 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 533 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 534 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 535 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 536 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 537 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 538 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 539 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 540 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 541 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 542 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 543 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 544 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 545 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 546 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 547 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 548 | 3300053124 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere | Metagenome | Endosphere |
| 549 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 550 | 3300053128 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere | Metagenome | Endosphere |
| 551 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 552 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 553 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 554 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 555 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 556 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 557 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 558 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 559 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 560 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 561 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 562 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 563 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 564 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 565 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 566 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 567 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 568 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 569 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 570 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 571 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 572 | 3300053722 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 endosphere | Metagenome | Endosphere |
| 573 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 574 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 575 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 576 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 577 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 578 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 579 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 580 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 581 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 582 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 583 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 584 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 585 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 586 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 587 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 588 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 589 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 590 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 591 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 592 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 593 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 594 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 595 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 596 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 597 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 598 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 599 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 600 | 2602042107 | Bradyrhizobium sp. NFR13 | Isolate | Rhizoplane |
| 601 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 602 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 603 | 2643221651 | Afipia sp. Root123D2 | Isolate | Unclassified |
| 604 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 605 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 606 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 607 | 2791355199 | |||
| 608 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 609 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 610 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 611 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 612 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 613 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 614 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 615 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 616 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 617 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 618 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 619 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 620 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 621 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 622 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 623 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 624 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 625 | 2824732956 | Bradyrhizobium sp. HAMBI 2153 | Isolate | Unclassified |
| 626 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 627 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 628 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 629 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 630 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 631 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 632 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 633 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 634 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 635 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 636 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 637 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 638 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 639 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 640 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 641 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 642 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 643 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 644 | 2857524615 | Tardiphaga sp. R-73074 | Isolate | Unclassified |
| 645 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 646 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 647 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 648 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 649 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 650 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 651 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 652 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 653 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 654 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 655 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 656 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 657 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 658 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 659 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 660 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 661 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 662 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 663 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 664 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 665 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 666 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 667 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 668 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 669 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 670 | 2893066018 | Tardiphaga sp. P9-11 | Isolate | Unclassified |
| 671 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 672 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 673 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 674 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 675 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 676 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 677 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 678 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 679 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 680 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 681 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 682 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 683 | 2919073203 | Tardiphaga robiniae 1155 | Isolate | Unclassified |
| 684 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 685 | 2922368715 | |||
| 686 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 687 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 688 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 689 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 690 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 691 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 692 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 693 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 694 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 695 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 696 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 697 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 698 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 699 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 700 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 701 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 702 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 703 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 704 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 705 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 706 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 707 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 708 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 709 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 710 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 711 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 712 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 713 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 714 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 715 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 716 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 717 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 718 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 719 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 720 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 721 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 722 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 723 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 724 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 725 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 726 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 727 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 728 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 729 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 730 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 731 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 732 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 733 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 734 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 735 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 736 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 737 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 738 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 739 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 740 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 741 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 742 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 743 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 744 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 745 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 746 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 747 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 748 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 749 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 750 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 751 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 752 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 753 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 754 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 755 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 756 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 757 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 758 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 759 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 760 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 761 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 762 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 763 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 764 | 8016530956 | Bradyrhizobium sp. LM6.11 | Isolate | Nodule |
| 765 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 766 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 767 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 768 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 769 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 770 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 771 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 772 | 8016603502 | Bradyrhizobium sp. LB7.2 | Isolate | Nodule |
| 773 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 774 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 775 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 776 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 777 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
| 778 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 779 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 780 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 781 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 782 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 783 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 784 | 8019629233 | Bradyrhizobium sp. GM6.1 | Isolate | Nodule |
| 785 | 8019638758 | Bradyrhizobium sp. GM5.1 | Isolate | Nodule |
| 786 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 787 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 788 | 8019678201 | Bradyrhizobium sp. GM0.4 | Isolate | Nodule |
| 789 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 790 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 791 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 792 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
| 793 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
| 794 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 88.1 |
| Metatranscriptomes | 0.11 |
| Isolates | 11.79 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 10.62 |
| Nodule | 9.35 |
| Rhizoplane | 5.75 |
| Rhizosphere | 67.15 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0496115_0672631 | 3300048918 | Bacteria | 816 |
| 2 | 2214911863 | 2209111006 | Bacteria | 6897 |
| 3 | ARcpr5oldR_c000133 | 3300000041 | Bacteria | 12591 |
| 4 | ARSoilYngRDRAFT_c00291 | 3300000042 | Bacteria | 7340 |
| 5 | ARcpr5yngRDRAFT_c000655 | 3300000043 | Bacteria | 4330 |
| 6 | ARSoilOldRDRAFT_c000255 | 3300000044 | Bacteria | 7753 |
| 7 | ARCol0oldRDRAFT_c00602 | 3300000045 | Bacteria | 3181 |
| 8 | ARCol0yngRDRAFT_1000207 | 3300000652 | Bacteria | 9953 |
| 9 | JGI24746J21847_1002330 | 3300001977 | Bacteria | 3035 |
| 10 | JGI24747J21853_1001618 | 3300001978 | Bacteria | 1717 |
| 11 | JGI24740J21852_10008161 | 3300001979 | Bacteria | 4197 |
| 12 | JGI24739J22299_10002133 | 3300001989 | Bacteria | 7581 |
| 13 | JGI24739J22299_10014522 | 3300001989 | Bacteria | 2865 |
| 14 | JGI24737J22298_10006524 | 3300001990 | Bacteria | 3980 |
| 15 | JGI24735J21928_10015500 | 3300002067 | Bacteria | 2377 |
| 16 | JGI24750J21931_1000306 | 3300002070 | Bacteria | 8424 |
| 17 | JGI24738J21930_10016858 | 3300002075 | Bacteria | 1539 |
| 18 | JGI24738J21930_10035803 | 3300002075 | Bacteria | 1011 |
| 19 | JGI24738J21930_10036983 | 3300002075 | Bacteria | 993 |
| 20 | JGI24749J21850_1006556 | 3300002076 | Bacteria | 1621 |
| 21 | JGI24034J26672_10000938 | 3300002239 | Bacteria | 3791 |
| 22 | JGI24742J22300_10002042 | 3300002244 | Bacteria | 3221 |
| 23 | JGI25406J46586_10031728 | 3300003203 | Bacteria | 1972 |
| 24 | JGI25153J46596_10001604 | 3300003215 | Bacteria | 13406 |
| 25 | JGI25153J46596_10002291 | 3300003215 | Bacteria | 11151 |
| 26 | JGI25153J46596_10007925 | 3300003215 | Bacteria | 5150 |
| 27 | JGI25153J46596_10008998 | 3300003215 | Bacteria | 4701 |
| 28 | JGI25160J50197_1005286 | 3300003354 | Bacteria | 5401 |
| 29 | JGI25160J50197_1014867 | 3300003354 | Bacteria | 2580 |
| 30 | JGI25404J52841_10010453 | 3300003659 | Bacteria | 1995 |
| 31 | JGI25404J52841_10021243 | 3300003659 | Bacteria | 1406 |
| 32 | Ga0055542_1008419 | 3300003762 | Bacteria | 2022 |
| 33 | Ga0055529_1005529 | 3300003763 | Bacteria | 1818 |
| 34 | Ga0055524_1045134 | 3300003775 | Bacteria | 1064 |
| 35 | Ga0055531_10005524 | 3300003794 | Bacteria | 7383 |
| 36 | Ga0055531_10007473 | 3300003794 | Bacteria | 5954 |
| 37 | Ga0055543_1002707 | 3300004625 | Bacteria | 5668 |
| 38 | Ga0065165_1005568 | 3300005262 | Bacteria | 7001 |
| 39 | Ga0065165_1005760 | 3300005262 | Bacteria | 6795 |
| 40 | Ga0065717_1005363 | 3300005276 | Bacteria | 897 |
| 41 | Ga0065716_1001632 | 3300005277 | Bacteria | 4804 |
| 42 | Ga0065704_10006824 | 3300005289 | Bacteria | 3982 |
| 43 | Ga0065712_10089599 | 3300005290 | Bacteria | 2462 |
| 44 | Ga0065715_10008670 | 3300005293 | Bacteria | 2483 |
| 45 | Ga0070658_10015577 | 3300005327 | Bacteria | 6080 |
| 46 | Ga0070658_10036212 | 3300005327 | Bacteria | 3977 |
| 47 | Ga0070676_10015450 | 3300005328 | Bacteria | 4212 |
| 48 | Ga0070676_10052710 | 3300005328 | Bacteria | 2393 |
| 49 | Ga0070676_10089122 | 3300005328 | Bacteria | 1887 |
| 50 | Ga0070683_100014076 | 3300005329 | Bacteria | 6987 |
| 51 | Ga0070683_100048868 | 3300005329 | Bacteria | 3911 |
| 52 | Ga0070690_100009976 | 3300005330 | Bacteria | 5512 |
| 53 | Ga0070690_100027758 | 3300005330 | Bacteria | 3501 |
| 54 | Ga0070690_100066780 | 3300005330 | Bacteria | 2329 |
| 55 | Ga0070690_100111027 | 3300005330 | Bacteria | 1829 |
| 56 | Ga0070670_100415516 | 3300005331 | Bacteria | 1189 |
| 57 | Ga0070670_100924178 | 3300005331 | Bacteria | 791 |
| 58 | Ga0070677_10197425 | 3300005333 | Bacteria | 969 |
| 59 | Ga0068869_100005362 | 3300005334 | Bacteria | 8057 |
| 60 | Ga0068869_100317735 | 3300005334 | Bacteria | 1262 |
| 61 | Ga0070666_10089682 | 3300005335 | Bacteria | 2111 |
| 62 | Ga0070680_100090465 | 3300005336 | Bacteria | 2534 |
| 63 | Ga0070680_100152353 | 3300005336 | Bacteria | 1941 |
| 64 | Ga0070680_100848572 | 3300005336 | Bacteria | 787 |
| 65 | Ga0070682_100697350 | 3300005337 | Bacteria | 814 |
| 66 | Ga0068868_100035101 | 3300005338 | Bacteria | 3874 |
| 67 | Ga0068868_100298087 | 3300005338 | Bacteria | 1369 |
| 68 | Ga0068868_100562192 | 3300005338 | Bacteria | 1006 |
| 69 | Ga0068868_100882916 | 3300005338 | Bacteria | 811 |
| 70 | Ga0070660_100040041 | 3300005339 | Bacteria | 3564 |
| 71 | Ga0070660_100167888 | 3300005339 | Bacteria | 1771 |
| 72 | Ga0070660_100416169 | 3300005339 | Bacteria | 1112 |
| 73 | Ga0070689_100040860 | 3300005340 | Bacteria | 3557 |
| 74 | Ga0070689_100131274 | 3300005340 | Bacteria | 2009 |
| 75 | Ga0070691_10087613 | 3300005341 | Bacteria | 1531 |
| 76 | Ga0070687_100054857 | 3300005343 | Bacteria | 2078 |
| 77 | Ga0070687_100357555 | 3300005343 | Bacteria | 944 |
| 78 | Ga0070661_100088583 | 3300005344 | Bacteria | 2291 |
| 79 | Ga0070661_100280880 | 3300005344 | Bacteria | 1291 |
| 80 | Ga0070661_100347137 | 3300005344 | Bacteria | 1164 |
| 81 | Ga0070692_10068790 | 3300005345 | Bacteria | 1882 |
| 82 | Ga0070692_10104648 | 3300005345 | Bacteria | 1556 |
| 83 | Ga0070668_100103090 | 3300005347 | Bacteria | 2263 |
| 84 | Ga0070668_100184183 | 3300005347 | Bacteria | 1707 |
| 85 | Ga0070668_100219502 | 3300005347 | Bacteria | 1567 |
| 86 | Ga0070668_100237557 | 3300005347 | Bacteria | 1508 |
| 87 | Ga0070668_100408606 | 3300005347 | Bacteria | 1160 |
| 88 | Ga0070668_100946368 | 3300005347 | Bacteria | 772 |
| 89 | Ga0070669_100009523 | 3300005353 | Bacteria | 6917 |
| 90 | Ga0070669_100113283 | 3300005353 | Bacteria | 2060 |
| 91 | Ga0070669_100280062 | 3300005353 | Bacteria | 1336 |
| 92 | Ga0070675_100034164 | 3300005354 | Bacteria | 4126 |
| 93 | Ga0070675_100785894 | 3300005354 | Bacteria | 870 |
| 94 | Ga0070671_100018470 | 3300005355 | Bacteria | 5664 |
| 95 | Ga0070671_100055481 | 3300005355 | Bacteria | 3296 |
| 96 | Ga0070671_100116779 | 3300005355 | Bacteria | 2243 |
| 97 | Ga0070671_100131073 | 3300005355 | Bacteria | 2112 |
| 98 | Ga0070671_100348255 | 3300005355 | Bacteria | 1264 |
| 99 | Ga0070671_101013859 | 3300005355 | Bacteria | 728 |
| 100 | Ga0070674_100931401 | 3300005356 | Bacteria | 759 |
| 101 | Ga0070673_100006016 | 3300005364 | Bacteria | 7853 |
| 102 | Ga0070673_100018157 | 3300005364 | Bacteria | 5020 |
| 103 | Ga0070688_100054184 | 3300005365 | Bacteria | 2511 |
| 104 | Ga0070688_100090194 | 3300005365 | Bacteria | 2001 |
| 105 | Ga0070688_100221599 | 3300005365 | Bacteria | 1333 |
| 106 | Ga0070688_100435879 | 3300005365 | Bacteria | 977 |
| 107 | Ga0070688_100677469 | 3300005365 | Bacteria | 796 |
| 108 | Ga0070659_100099578 | 3300005366 | Bacteria | 2338 |
| 109 | Ga0070659_100101942 | 3300005366 | Bacteria | 2310 |
| 110 | Ga0070659_100207172 | 3300005366 | Bacteria | 1615 |
| 111 | Ga0070659_100397832 | 3300005366 | Bacteria | 1162 |
| 112 | Ga0070667_100039791 | 3300005367 | Bacteria | 3941 |
| 113 | Ga0070667_100107058 | 3300005367 | Bacteria | 2420 |
| 114 | Ga0070667_100163512 | 3300005367 | Bacteria | 1962 |
| 115 | Ga0070667_100221243 | 3300005367 | Bacteria | 1685 |
| 116 | Ga0070667_100913355 | 3300005367 | Bacteria | 818 |
| 117 | Ga0070709_10008600 | 3300005434 | Bacteria | 5612 |
| 118 | Ga0070709_10428499 | 3300005434 | Bacteria | 993 |
| 119 | Ga0070709_10513607 | 3300005434 | Bacteria | 912 |
| 120 | Ga0070714_100134185 | 3300005435 | Bacteria | 2215 |
| 121 | Ga0070714_100227095 | 3300005435 | Bacteria | 1718 |
| 122 | Ga0070714_100276899 | 3300005435 | Bacteria | 1558 |
| 123 | Ga0070713_100052651 | 3300005436 | Bacteria | 3370 |
| 124 | Ga0070713_100072884 | 3300005436 | Bacteria | 2906 |
| 125 | Ga0070713_100089043 | 3300005436 | Bacteria | 2651 |
| 126 | Ga0070713_100409266 | 3300005436 | Bacteria | 1268 |
| 127 | Ga0070710_10092909 | 3300005437 | Bacteria | 1783 |
| 128 | Ga0070710_10185989 | 3300005437 | Bacteria | 1304 |
| 129 | Ga0070701_10121852 | 3300005438 | Bacteria | 1470 |
| 130 | Ga0070701_10170190 | 3300005438 | Bacteria | 1268 |
| 131 | Ga0070711_100087269 | 3300005439 | Bacteria | 2239 |
| 132 | Ga0070711_100769677 | 3300005439 | Bacteria | 815 |
| 133 | Ga0070705_100019679 | 3300005440 | Bacteria | 3557 |
| 134 | Ga0070705_100165611 | 3300005440 | Bacteria | 1482 |
| 135 | Ga0070705_100918351 | 3300005440 | Bacteria | 705 |
| 136 | Ga0070700_100674932 | 3300005441 | Bacteria | 818 |
| 137 | Ga0070708_100544521 | 3300005445 | Bacteria | 1095 |
| 138 | Ga0070663_100002910 | 3300005455 | Bacteria | 9738 |
| 139 | Ga0070663_100049267 | 3300005455 | Bacteria | 2990 |
| 140 | Ga0070663_100051460 | 3300005455 | Bacteria | 2934 |
| 141 | Ga0070663_100064014 | 3300005455 | Bacteria | 2657 |
| 142 | Ga0070663_100146590 | 3300005455 | Bacteria | 1806 |
| 143 | Ga0070663_100239861 | 3300005455 | Bacteria | 1430 |
| 144 | Ga0070663_100449802 | 3300005455 | Bacteria | 1061 |
| 145 | Ga0070663_100511551 | 3300005455 | Bacteria | 998 |
| 146 | Ga0070678_100029230 | 3300005456 | Bacteria | 3771 |
| 147 | Ga0070678_100123916 | 3300005456 | Bacteria | 2042 |
| 148 | Ga0070678_100272630 | 3300005456 | Bacteria | 1428 |
| 149 | Ga0070678_100281527 | 3300005456 | Bacteria | 1406 |
| 150 | Ga0070678_100294563 | 3300005456 | Bacteria | 1377 |
| 151 | Ga0070662_100594283 | 3300005457 | Bacteria | 930 |
| 152 | Ga0070681_10040915 | 3300005458 | Bacteria | 4643 |
| 153 | Ga0068867_100024117 | 3300005459 | Bacteria | 4359 |
| 154 | Ga0068867_100266579 | 3300005459 | Bacteria | 1398 |
| 155 | Ga0070685_10007220 | 3300005466 | Bacteria | 5678 |
| 156 | Ga0070685_10377599 | 3300005466 | Bacteria | 976 |
| 157 | Ga0070685_10528455 | 3300005466 | Bacteria | 839 |
| 158 | Ga0070685_10658080 | 3300005466 | Bacteria | 760 |
| 159 | Ga0070698_100900917 | 3300005471 | Bacteria | 830 |
| 160 | Ga0070699_100387440 | 3300005518 | Bacteria | 1262 |
| 161 | Ga0070679_100045216 | 3300005530 | Bacteria | 4388 |
| 162 | Ga0070679_100870406 | 3300005530 | Bacteria | 844 |
| 163 | Ga0070684_100041708 | 3300005535 | Bacteria | 3958 |
| 164 | Ga0070684_100056864 | 3300005535 | Bacteria | 3415 |
| 165 | Ga0070684_100427083 | 3300005535 | Bacteria | 1224 |
| 166 | Ga0070684_100834814 | 3300005535 | Bacteria | 862 |
| 167 | Ga0070684_100913162 | 3300005535 | Bacteria | 823 |
| 168 | Ga0068853_100029132 | 3300005539 | Bacteria | 4651 |
| 169 | Ga0068853_100037194 | 3300005539 | Bacteria | 4141 |
| 170 | Ga0068853_100154051 | 3300005539 | Bacteria | 2070 |
| 171 | Ga0068853_100176657 | 3300005539 | Bacteria | 1935 |
| 172 | Ga0068853_100178589 | 3300005539 | Bacteria | 1924 |
| 173 | Ga0068853_100216523 | 3300005539 | Bacteria | 1747 |
| 174 | Ga0068853_100286910 | 3300005539 | Bacteria | 1518 |
| 175 | Ga0070672_100074275 | 3300005543 | Bacteria | 2712 |
| 176 | Ga0070672_101216951 | 3300005543 | Bacteria | 671 |
| 177 | Ga0070686_100138899 | 3300005544 | Bacteria | 1689 |
| 178 | Ga0070686_100140554 | 3300005544 | Bacteria | 1680 |
| 179 | Ga0070695_100007606 | 3300005545 | Bacteria | 6419 |
| 180 | Ga0070695_100143920 | 3300005545 | Bacteria | 1656 |
| 181 | Ga0070696_100764698 | 3300005546 | Bacteria | 793 |
| 182 | Ga0070693_100068169 | 3300005547 | Bacteria | 2088 |
| 183 | Ga0070693_100150542 | 3300005547 | Bacteria | 1473 |
| 184 | Ga0070693_100157753 | 3300005547 | Bacteria | 1443 |
| 185 | Ga0070693_100454721 | 3300005547 | Bacteria | 899 |
| 186 | Ga0070665_100028785 | 3300005548 | Bacteria | 5594 |
| 187 | Ga0070665_100029858 | 3300005548 | Bacteria | 5486 |
| 188 | Ga0070665_100116177 | 3300005548 | Bacteria | 2678 |
| 189 | Ga0070665_100119192 | 3300005548 | Bacteria | 2641 |
| 190 | Ga0070665_100218932 | 3300005548 | Bacteria | 1904 |
| 191 | Ga0070665_100329012 | 3300005548 | Bacteria | 1532 |
| 192 | Ga0070665_100427495 | 3300005548 | Bacteria | 1333 |
| 193 | Ga0070665_100432315 | 3300005548 | Bacteria | 1325 |
| 194 | Ga0070665_100501426 | 3300005548 | Bacteria | 1225 |
| 195 | Ga0070704_100050220 | 3300005549 | Bacteria | 2930 |
| 196 | Ga0070704_100306814 | 3300005549 | Bacteria | 1324 |
| 197 | Ga0070704_100328155 | 3300005549 | Bacteria | 1284 |
| 198 | Ga0068855_100043022 | 3300005563 | Bacteria | 5352 |
| 199 | Ga0068855_100076846 | 3300005563 | Bacteria | 3874 |
| 200 | Ga0068855_100082873 | 3300005563 | Bacteria | 3716 |
| 201 | Ga0068855_100180572 | 3300005563 | Bacteria | 2386 |
| 202 | Ga0068855_100745078 | 3300005563 | Bacteria | 1045 |
| 203 | Ga0070664_100190239 | 3300005564 | Bacteria | 1828 |
| 204 | Ga0070664_100231718 | 3300005564 | Bacteria | 1655 |
| 205 | Ga0070664_100353167 | 3300005564 | Bacteria | 1338 |
| 206 | Ga0070664_100934811 | 3300005564 | Bacteria | 814 |
| 207 | Ga0068857_100003131 | 3300005577 | Bacteria | 13690 |
| 208 | Ga0068857_100016900 | 3300005577 | Bacteria | 6393 |
| 209 | Ga0068857_100048283 | 3300005577 | Bacteria | 3779 |
| 210 | Ga0068857_100111718 | 3300005577 | Bacteria | 2457 |
| 211 | Ga0068857_100633257 | 3300005577 | Bacteria | 1012 |
| 212 | Ga0068854_100009446 | 3300005578 | Bacteria | 6297 |
| 213 | Ga0068854_100025141 | 3300005578 | Bacteria | 4085 |
| 214 | Ga0068854_100110432 | 3300005578 | Bacteria | 2073 |
| 215 | Ga0068854_100211228 | 3300005578 | Bacteria | 1531 |
| 216 | Ga0068856_100048827 | 3300005614 | Bacteria | 4171 |
| 217 | Ga0068856_100052613 | 3300005614 | Bacteria | 4016 |
| 218 | Ga0068856_100085326 | 3300005614 | Bacteria | 3136 |
| 219 | Ga0068856_100174867 | 3300005614 | Bacteria | 2159 |
| 220 | Ga0068856_100175839 | 3300005614 | Bacteria | 2153 |
| 221 | Ga0068856_100559691 | 3300005614 | Bacteria | 1165 |
| 222 | Ga0068856_100909849 | 3300005614 | Bacteria | 899 |
| 223 | Ga0068856_101037630 | 3300005614 | Bacteria | 838 |
| 224 | Ga0070702_100033101 | 3300005615 | Bacteria | 2840 |
| 225 | Ga0068852_100050524 | 3300005616 | Bacteria | 3563 |
| 226 | Ga0068852_100207146 | 3300005616 | Bacteria | 1858 |
| 227 | Ga0068852_100223772 | 3300005616 | Bacteria | 1791 |
| 228 | Ga0068852_100317394 | 3300005616 | Bacteria | 1512 |
| 229 | Ga0068852_100426684 | 3300005616 | Bacteria | 1309 |
| 230 | Ga0068852_100469452 | 3300005616 | Bacteria | 1249 |
| 231 | Ga0068852_100614239 | 3300005616 | Bacteria | 1092 |
| 232 | Ga0068859_100013930 | 3300005617 | Bacteria | 8068 |
| 233 | Ga0068859_100087512 | 3300005617 | Bacteria | 3163 |
| 234 | Ga0068859_100408141 | 3300005617 | Bacteria | 1454 |
| 235 | Ga0068864_100000501 | 3300005618 | Bacteria | 33748 |
| 236 | Ga0068864_100059311 | 3300005618 | Bacteria | 3310 |
| 237 | Ga0068864_100107715 | 3300005618 | Bacteria | 2479 |
| 238 | Ga0068864_100140430 | 3300005618 | Bacteria | 2178 |
| 239 | Ga0068864_100594319 | 3300005618 | Bacteria | 1073 |
| 240 | Ga0068864_101241109 | 3300005618 | Bacteria | 745 |
| 241 | Ga0068866_10009096 | 3300005718 | Bacteria | 4210 |
| 242 | Ga0068866_10081275 | 3300005718 | Bacteria | 1740 |
| 243 | Ga0068866_10498061 | 3300005718 | Bacteria | 806 |
| 244 | Ga0068861_100108219 | 3300005719 | Bacteria | 2223 |
| 245 | Ga0068861_100137095 | 3300005719 | Bacteria | 1992 |
| 246 | Ga0068861_100172566 | 3300005719 | Bacteria | 1793 |
| 247 | Ga0068851_10001649 | 3300005834 | Bacteria | 9784 |
| 248 | Ga0068851_10048827 | 3300005834 | Bacteria | 2145 |
| 249 | Ga0068870_10017790 | 3300005840 | Bacteria | 3420 |
| 250 | Ga0068870_10789204 | 3300005840 | Bacteria | 663 |
| 251 | Ga0068863_100001487 | 3300005841 | Bacteria | 23230 |
| 252 | Ga0068863_100114649 | 3300005841 | Bacteria | 2567 |
| 253 | Ga0068863_100641427 | 3300005841 | Bacteria | 1053 |
| 254 | Ga0068863_100880978 | 3300005841 | Bacteria | 895 |
| 255 | Ga0068863_101239055 | 3300005841 | Bacteria | 752 |
| 256 | Ga0068858_100008725 | 3300005842 | Bacteria | 9733 |
| 257 | Ga0068858_100160649 | 3300005842 | Bacteria | 2116 |
| 258 | Ga0068858_100205803 | 3300005842 | Bacteria | 1862 |
| 259 | Ga0068858_100362857 | 3300005842 | Bacteria | 1388 |
| 260 | Ga0068858_100568185 | 3300005842 | Bacteria | 1098 |
| 261 | Ga0068858_100635724 | 3300005842 | Bacteria | 1036 |
| 262 | Ga0068860_100087752 | 3300005843 | Bacteria | 2961 |
| 263 | Ga0068860_100196348 | 3300005843 | Bacteria | 1954 |
| 264 | Ga0068860_100495997 | 3300005843 | Bacteria | 1219 |
| 265 | Ga0068860_100971666 | 3300005843 | Bacteria | 867 |
| 266 | Ga0068860_101021522 | 3300005843 | Bacteria | 845 |
| 267 | Ga0068862_100130981 | 3300005844 | Bacteria | 2218 |
| 268 | Ga0068862_100194451 | 3300005844 | Bacteria | 1827 |
| 269 | Ga0081455_10013105 | 3300005937 | Bacteria | 8218 |
| 270 | Ga0081455_10028472 | 3300005937 | Bacteria | 5105 |
| 271 | Ga0081455_10058469 | 3300005937 | Bacteria | 3262 |
| 272 | Ga0081455_10062151 | 3300005937 | Bacteria | 3140 |
| 273 | Ga0081455_10134396 | 3300005937 | Bacteria | 1930 |
| 274 | Ga0081455_10448569 | 3300005937 | Bacteria | 882 |
| 275 | Ga0081538_10001497 | 3300005981 | Bacteria | 23974 |
| 276 | Ga0081538_10024144 | 3300005981 | Bacteria | 4339 |
| 277 | Ga0081540_1001924 | 3300005983 | Bacteria | 17404 |
| 278 | Ga0081540_1003483 | 3300005983 | Bacteria | 12420 |
| 279 | Ga0081540_1003507 | 3300005983 | Bacteria | 12383 |
| 280 | Ga0081540_1003700 | 3300005983 | Bacteria | 11979 |
| 281 | Ga0081540_1005593 | 3300005983 | Bacteria | 9355 |
| 282 | Ga0081540_1015557 | 3300005983 | Bacteria | 4812 |
| 283 | Ga0081540_1020696 | 3300005983 | Bacteria | 3946 |
| 284 | Ga0081540_1021821 | 3300005983 | Bacteria | 3798 |
| 285 | Ga0081540_1028835 | 3300005983 | Bacteria | 3106 |
| 286 | Ga0081540_1031643 | 3300005983 | Bacteria | 2904 |
| 287 | Ga0081540_1120057 | 3300005983 | Bacteria | 1093 |
| 288 | Ga0081539_10000902 | 3300005985 | Bacteria | 56412 |
| 289 | Ga0081539_10027917 | 3300005985 | Bacteria | 3562 |
| 290 | Ga0081539_10057458 | 3300005985 | Bacteria | 2153 |
| 291 | Ga0081539_10064732 | 3300005985 | Bacteria | 1988 |
| 292 | Ga0070717_10002469 | 3300006028 | Bacteria | 13054 |
| 293 | Ga0070717_10009912 | 3300006028 | Bacteria | 7170 |
| 294 | Ga0075365_10063057 | 3300006038 | Bacteria | 2481 |
| 295 | Ga0075365_10086275 | 3300006038 | Bacteria | 2133 |
| 296 | Ga0075365_10169763 | 3300006038 | Bacteria | 1522 |
| 297 | Ga0075365_10307594 | 3300006038 | Bacteria | 1116 |
| 298 | Ga0075365_10356903 | 3300006038 | Bacteria | 1030 |
| 299 | Ga0075368_10001108 | 3300006042 | Bacteria | 8493 |
| 300 | Ga0075368_10002847 | 3300006042 | Bacteria | 5710 |
| 301 | Ga0075368_10054261 | 3300006042 | Bacteria | 1596 |
| 302 | Ga0075368_10090766 | 3300006042 | Bacteria | 1249 |
| 303 | Ga0075368_10175460 | 3300006042 | Bacteria | 902 |
| 304 | Ga0075363_100000927 | 3300006048 | Bacteria | 10358 |
| 305 | Ga0075363_100060388 | 3300006048 | Bacteria | 2041 |
| 306 | Ga0075363_100061555 | 3300006048 | Bacteria | 2023 |
| 307 | Ga0075363_100190898 | 3300006048 | Bacteria | 1168 |
| 308 | Ga0075364_10008079 | 3300006051 | Bacteria | 6275 |
| 309 | Ga0075364_10050941 | 3300006051 | Bacteria | 2703 |
| 310 | Ga0075364_10292635 | 3300006051 | Bacteria | 1108 |
| 311 | Ga0070715_10062008 | 3300006163 | Bacteria | 1644 |
| 312 | Ga0070712_100172423 | 3300006175 | Bacteria | 1680 |
| 313 | Ga0075362_10061018 | 3300006177 | Bacteria | 1705 |
| 314 | Ga0075362_10102719 | 3300006177 | Bacteria | 1338 |
| 315 | Ga0075362_10186107 | 3300006177 | Bacteria | 1007 |
| 316 | Ga0075367_10004564 | 3300006178 | Bacteria | 6776 |
| 317 | Ga0075367_10009741 | 3300006178 | Bacteria | 5031 |
| 318 | Ga0075367_10036765 | 3300006178 | Bacteria | 2841 |
| 319 | Ga0075367_10153038 | 3300006178 | Bacteria | 1432 |
| 320 | Ga0075367_10187760 | 3300006178 | Bacteria | 1289 |
| 321 | Ga0075367_10195404 | 3300006178 | Bacteria | 1263 |
| 322 | Ga0075367_10196260 | 3300006178 | Bacteria | 1260 |
| 323 | Ga0075369_10073524 | 3300006186 | Bacteria | 1507 |
| 324 | Ga0075369_10097144 | 3300006186 | Bacteria | 1319 |
| 325 | Ga0075369_10107742 | 3300006186 | Bacteria | 1254 |
| 326 | Ga0075369_10147979 | 3300006186 | Bacteria | 1073 |
| 327 | Ga0075366_10046923 | 3300006195 | Bacteria | 2560 |
| 328 | Ga0075366_10050585 | 3300006195 | Bacteria | 2468 |
| 329 | Ga0075366_10319496 | 3300006195 | Bacteria | 951 |
| 330 | Ga0097621_100022827 | 3300006237 | Bacteria | 4861 |
| 331 | Ga0097621_100515650 | 3300006237 | Bacteria | 1084 |
| 332 | Ga0097621_100655409 | 3300006237 | Bacteria | 963 |
| 333 | Ga0097621_101068740 | 3300006237 | Bacteria | 757 |
| 334 | Ga0075370_10017300 | 3300006353 | Bacteria | 3894 |
| 335 | Ga0075370_10041149 | 3300006353 | Bacteria | 2608 |
| 336 | Ga0075370_10181981 | 3300006353 | Bacteria | 1237 |
| 337 | Ga0075370_10274611 | 3300006353 | Bacteria | 1001 |
| 338 | Ga0075370_10422841 | 3300006353 | Bacteria | 801 |
| 339 | Ga0068871_100099573 | 3300006358 | Bacteria | 2433 |
| 340 | Ga0068871_100481333 | 3300006358 | Bacteria | 1116 |
| 341 | Ga0075428_100097833 | 3300006844 | Bacteria | 3199 |
| 342 | Ga0075431_100092449 | 3300006847 | Bacteria | 3122 |
| 343 | Ga0075431_100186659 | 3300006847 | Bacteria | 2126 |
| 344 | Ga0075433_10269939 | 3300006852 | Bacteria | 1508 |
| 345 | Ga0068865_100044064 | 3300006881 | Bacteria | 3052 |
| 346 | Ga0068865_100110189 | 3300006881 | Bacteria | 2030 |
| 347 | Ga0068865_100628337 | 3300006881 | Bacteria | 910 |
| 348 | Ga0075436_100143930 | 3300006914 | Bacteria | 1676 |
| 349 | Ga0097620_100013930 | 3300006931 | Bacteria | 8068 |
| 350 | Ga0097620_100087516 | 3300006931 | Bacteria | 3163 |
| 351 | Ga0097620_100408153 | 3300006931 | Bacteria | 1454 |
| 352 | Ga0099825_1032185 | 3300006941 | Bacteria | 2152 |
| 353 | Ga0099824_1009990 | 3300006942 | Bacteria | 11429 |
| 354 | Ga0075435_100134829 | 3300007076 | Bacteria | 2067 |
| 355 | Ga0075435_100179331 | 3300007076 | Bacteria | 1790 |
| 356 | Ga0099795_10117307 | 3300007788 | Bacteria | 1061 |
| 357 | Ga0105251_10093367 | 3300009011 | Bacteria | 1380 |
| 358 | Ga0105244_10020920 | 3300009036 | Bacteria | 3625 |
| 359 | Ga0105250_10026210 | 3300009092 | Bacteria | 2348 |
| 360 | Ga0105240_10002869 | 3300009093 | Bacteria | 27260 |
| 361 | Ga0105240_10005590 | 3300009093 | Bacteria | 18678 |
| 362 | Ga0105240_10175899 | 3300009093 | Bacteria | 2530 |
| 363 | Ga0105240_10203680 | 3300009093 | Bacteria | 2317 |
| 364 | Ga0105240_10208525 | 3300009093 | Bacteria | 2285 |
| 365 | Ga0105240_10481297 | 3300009093 | Bacteria | 1384 |
| 366 | Ga0105240_11110202 | 3300009093 | Bacteria | 841 |
| 367 | Ga0111539_10004905 | 3300009094 | Bacteria | 17416 |
| 368 | Ga0111539_10094534 | 3300009094 | Bacteria | 3512 |
| 369 | Ga0111539_10530111 | 3300009094 | Bacteria | 1372 |
| 370 | Ga0111539_11271021 | 3300009094 | Bacteria | 854 |
| 371 | Ga0105245_10013591 | 3300009098 | Bacteria | 7092 |
| 372 | Ga0105245_10188048 | 3300009098 | Bacteria | 1976 |
| 373 | Ga0105245_10270594 | 3300009098 | Bacteria | 1657 |
| 374 | Ga0105245_10372016 | 3300009098 | Bacteria | 1421 |
| 375 | Ga0105247_10033384 | 3300009101 | Bacteria | 3130 |
| 376 | Ga0105247_10246097 | 3300009101 | Bacteria | 1220 |
| 377 | Ga0105247_10782551 | 3300009101 | Bacteria | 726 |
| 378 | Ga0114129_10128894 | 3300009147 | Bacteria | 3476 |
| 379 | Ga0114129_10154066 | 3300009147 | Bacteria | 3144 |
| 380 | Ga0114129_10234985 | 3300009147 | Bacteria | 2467 |
| 381 | Ga0105243_10027119 | 3300009148 | Bacteria | 4388 |
| 382 | Ga0105243_10259638 | 3300009148 | Bacteria | 1555 |
| 383 | Ga0105243_10390440 | 3300009148 | Bacteria | 1290 |
| 384 | Ga0105243_10552937 | 3300009148 | Bacteria | 1100 |
| 385 | Ga0105241_10012442 | 3300009174 | Bacteria | 6237 |
| 386 | Ga0105241_10031939 | 3300009174 | Bacteria | 3943 |
| 387 | Ga0105241_10036477 | 3300009174 | Bacteria | 3700 |
| 388 | Ga0105241_10051683 | 3300009174 | Bacteria | 3135 |
| 389 | Ga0105241_10327541 | 3300009174 | Bacteria | 1323 |
| 390 | Ga0105241_10478148 | 3300009174 | Bacteria | 1107 |
| 391 | Ga0105241_10524537 | 3300009174 | Bacteria | 1060 |
| 392 | Ga0105242_10036698 | 3300009176 | Bacteria | 3933 |
| 393 | Ga0105248_10070776 | 3300009177 | Bacteria | 3917 |
| 394 | Ga0105248_10100059 | 3300009177 | Bacteria | 3267 |
| 395 | Ga0105248_10354898 | 3300009177 | Bacteria | 1651 |
| 396 | Ga0105248_10398030 | 3300009177 | Bacteria | 1551 |
| 397 | Ga0105237_10053520 | 3300009545 | Bacteria | 4048 |
| 398 | Ga0105237_10141670 | 3300009545 | Bacteria | 2398 |
| 399 | Ga0105237_10604311 | 3300009545 | Bacteria | 1104 |
| 400 | Ga0105238_10003573 | 3300009551 | Bacteria | 15499 |
| 401 | Ga0105238_10051142 | 3300009551 | Bacteria | 4156 |
| 402 | Ga0105238_10202973 | 3300009551 | Bacteria | 1958 |
| 403 | Ga0105238_10236890 | 3300009551 | Bacteria | 1802 |
| 404 | Ga0105238_10294543 | 3300009551 | Bacteria | 1605 |
| 405 | Ga0105238_10344350 | 3300009551 | Bacteria | 1479 |
| 406 | Ga0105238_10745575 | 3300009551 | Bacteria | 993 |
| 407 | Ga0105238_11302977 | 3300009551 | Bacteria | 752 |
| 408 | Ga0105249_10137615 | 3300009553 | Bacteria | 2339 |
| 409 | Ga0099796_10059076 | 3300010159 | Bacteria | 1353 |
| 410 | Ga0099796_10088345 | 3300010159 | Bacteria | 1148 |
| 411 | Ga0099796_10093277 | 3300010159 | Bacteria | 1122 |
| 412 | Ga0105239_10077327 | 3300010375 | Bacteria | 3662 |
| 413 | Ga0105239_10078453 | 3300010375 | Bacteria | 3634 |
| 414 | Ga0105239_10155502 | 3300010375 | Bacteria | 2553 |
| 415 | Ga0105239_10175241 | 3300010375 | Bacteria | 2398 |
| 416 | Ga0105239_10193691 | 3300010375 | Bacteria | 2276 |
| 417 | Ga0105239_10687272 | 3300010375 | Bacteria | 1170 |
| 418 | Ga0105239_10729634 | 3300010375 | Bacteria | 1134 |
| 419 | Ga0105239_10938440 | 3300010375 | Bacteria | 994 |
| 420 | Ga0105239_11262763 | 3300010375 | Bacteria | 852 |
| 421 | Ga0105246_10037876 | 3300011119 | Bacteria | 3238 |
| 422 | Ga0105246_10041752 | 3300011119 | Bacteria | 3102 |
| 423 | Ga0105246_10054890 | 3300011119 | Bacteria | 2747 |
| 424 | Ga0105246_10148416 | 3300011119 | Bacteria | 1772 |
| 425 | Ga0157335_1000327 | 3300012492 | Bacteria | 2093 |
| 426 | Ga0157342_1001487 | 3300012507 | Bacteria | 1750 |
| 427 | Ga0157373_10872817 | 3300013100 | Bacteria | 666 |
| 428 | Ga0157371_10043766 | 3300013102 | Bacteria | 3188 |
| 429 | Ga0157371_10060376 | 3300013102 | Bacteria | 2689 |
| 430 | Ga0157371_10520451 | 3300013102 | Bacteria | 880 |
| 431 | Ga0157370_10066426 | 3300013104 | Bacteria | 3411 |
| 432 | Ga0157370_10329548 | 3300013104 | Bacteria | 1408 |
| 433 | Ga0157370_11203856 | 3300013104 | Bacteria | 683 |
| 434 | Ga0157369_11544308 | 3300013105 | Bacteria | 675 |
| 435 | Ga0157374_10008247 | 3300013296 | Bacteria | 8898 |
| 436 | Ga0157374_10046569 | 3300013296 | Bacteria | 4017 |
| 437 | Ga0157374_10071735 | 3300013296 | Bacteria | 3266 |
| 438 | Ga0157374_10136090 | 3300013296 | Bacteria | 2382 |
| 439 | Ga0157378_10087734 | 3300013297 | Bacteria | 2822 |
| 440 | Ga0157378_11532830 | 3300013297 | Bacteria | 711 |
| 441 | Ga0157378_12031012 | 3300013297 | Bacteria | 625 |
| 442 | Ga0163162_10025808 | 3300013306 | Bacteria | 5808 |
| 443 | Ga0163162_10064631 | 3300013306 | Bacteria | 3704 |
| 444 | Ga0163162_10660475 | 3300013306 | Bacteria | 1169 |
| 445 | Ga0163162_10672659 | 3300013306 | Bacteria | 1158 |
| 446 | Ga0163162_10802306 | 3300013306 | Bacteria | 1059 |
| 447 | Ga0163162_11146949 | 3300013306 | Bacteria | 881 |
| 448 | Ga0157372_10052804 | 3300013307 | Bacteria | 4527 |
| 449 | Ga0157372_10799747 | 3300013307 | Bacteria | 1096 |
| 450 | Ga0157375_10003919 | 3300013308 | Bacteria | 12910 |
| 451 | Ga0157375_10122365 | 3300013308 | Bacteria | 2713 |
| 452 | Ga0157375_10533056 | 3300013308 | Bacteria | 1337 |
| 453 | Ga0157375_10687289 | 3300013308 | Bacteria | 1177 |
| 454 | Ga0157375_11223191 | 3300013308 | Bacteria | 882 |
| 455 | Ga0163163_10001518 | 3300014325 | Bacteria | 19614 |
| 456 | Ga0163163_10006923 | 3300014325 | Bacteria | 9955 |
| 457 | Ga0163163_10019540 | 3300014325 | Bacteria | 6363 |
| 458 | Ga0163163_10174446 | 3300014325 | Bacteria | 2196 |
| 459 | Ga0163163_10322527 | 3300014325 | Bacteria | 1598 |
| 460 | Ga0163163_11327748 | 3300014325 | Bacteria | 781 |
| 461 | Ga0157380_10393451 | 3300014326 | Bacteria | 1312 |
| 462 | Ga0157380_10453269 | 3300014326 | Bacteria | 1232 |
| 463 | Ga0182008_10418122 | 3300014497 | Bacteria | 723 |
| 464 | Ga0157377_10047910 | 3300014745 | Bacteria | 2396 |
| 465 | Ga0157377_10279935 | 3300014745 | Bacteria | 1093 |
| 466 | Ga0157377_10302362 | 3300014745 | Bacteria | 1056 |
| 467 | Ga0157379_10047563 | 3300014968 | Bacteria | 3827 |
| 468 | Ga0157379_10162444 | 3300014968 | Bacteria | 2016 |
| 469 | Ga0157379_10504128 | 3300014968 | Bacteria | 1122 |
| 470 | Ga0157376_10034361 | 3300014969 | Bacteria | 4094 |
| 471 | Ga0157376_10312044 | 3300014969 | Bacteria | 1492 |
| 472 | Ga0157376_10813144 | 3300014969 | Bacteria | 948 |
| 473 | Ga0163161_10035313 | 3300017792 | Bacteria | 3578 |
| 474 | Ga0206350_10496500 | 3300020080 | Bacteria | 1010 |
| 475 | Ga0214544_1000007 | 3300021320 | Bacteria | 379989 |
| 476 | Ga0214542_1000007 | 3300021321 | Bacteria | 291816 |
| 477 | Ga0214545_1000006 | 3300021324 | Bacteria | 291693 |
| 478 | Ga0214543_1000009 | 3300021327 | Bacteria | 384302 |
| 479 | Ga0213872_10024035 | 3300021361 | Bacteria | 2803 |
| 480 | Ga0213872_10130788 | 3300021361 | Bacteria | 1106 |
| 481 | Ga0213874_10060029 | 3300021377 | Bacteria | 1189 |
| 482 | Ga0213876_10266907 | 3300021384 | Bacteria | 910 |
| 483 | Ga0213875_10033755 | 3300021388 | Bacteria | 2418 |
| 484 | Ga0213871_10000146 | 3300021441 | Bacteria | 7325 |
| 485 | Ga0209563_101691 | 3300025230 | Bacteria | 5589 |
| 486 | Ga0209677_101315 | 3300025253 | Bacteria | 10976 |
| 487 | Ga0209148_1000645 | 3300025254 | Bacteria | 30288 |
| 488 | Ga0209233_1001380 | 3300025261 | Bacteria | 9636 |
| 489 | Ga0209233_1003243 | 3300025261 | Bacteria | 5767 |
| 490 | Ga0209233_1037669 | 3300025261 | Bacteria | 1073 |
| 491 | Ga0209455_1002521 | 3300025272 | Bacteria | 7020 |
| 492 | Ga0207673_1001791 | 3300025290 | Bacteria | 2386 |
| 493 | Ga0209564_1000384 | 3300025295 | Bacteria | 80490 |
| 494 | Ga0209564_1009905 | 3300025295 | Bacteria | 4462 |
| 495 | Ga0209758_1000015 | 3300025297 | Bacteria | 851943 |
| 496 | Ga0209758_1000389 | 3300025297 | Bacteria | 75919 |
| 497 | Ga0209758_1000716 | 3300025297 | Bacteria | 48984 |
| 498 | Ga0209758_1001056 | 3300025297 | Bacteria | 36006 |
| 499 | Ga0209758_1003447 | 3300025297 | Bacteria | 14374 |
| 500 | Ga0209758_1010182 | 3300025297 | Bacteria | 5679 |
| 501 | Ga0209758_1029178 | 3300025297 | Bacteria | 2313 |
| 502 | Ga0209256_1008939 | 3300025299 | Bacteria | 4509 |
| 503 | Ga0209256_1018664 | 3300025299 | Bacteria | 2241 |
| 504 | Ga0209256_1059422 | 3300025299 | Bacteria | 895 |
| 505 | Ga0207426_1000380 | 3300025302 | Bacteria | 76046 |
| 506 | Ga0207426_1002496 | 3300025302 | Bacteria | 11628 |
| 507 | Ga0207426_1012053 | 3300025302 | Bacteria | 3265 |
| 508 | Ga0209257_1001378 | 3300025304 | Bacteria | 29161 |
| 509 | Ga0207697_10002563 | 3300025315 | Bacteria | 9356 |
| 510 | Ga0207697_10009251 | 3300025315 | Bacteria | 4262 |
| 511 | Ga0207697_10059109 | 3300025315 | Bacteria | 1593 |
| 512 | Ga0207697_10194223 | 3300025315 | Bacteria | 892 |
| 513 | Ga0207656_10001912 | 3300025321 | Bacteria | 6929 |
| 514 | Ga0207682_10002547 | 3300025893 | Bacteria | 8133 |
| 515 | Ga0207682_10231886 | 3300025893 | Bacteria | 856 |
| 516 | Ga0207692_10089754 | 3300025898 | Bacteria | 1664 |
| 517 | Ga0207642_10103933 | 3300025899 | Bacteria | 1432 |
| 518 | Ga0207642_10194177 | 3300025899 | Bacteria | 1116 |
| 519 | Ga0207710_10044132 | 3300025900 | Bacteria | 1985 |
| 520 | Ga0207688_10000420 | 3300025901 | Bacteria | 19959 |
| 521 | Ga0207688_10017559 | 3300025901 | Bacteria | 3889 |
| 522 | Ga0207688_10050406 | 3300025901 | Bacteria | 2330 |
| 523 | Ga0207688_10050480 | 3300025901 | Bacteria | 2329 |
| 524 | Ga0207688_10174879 | 3300025901 | Bacteria | 1278 |
| 525 | Ga0207680_10490956 | 3300025903 | Bacteria | 874 |
| 526 | Ga0207680_10511850 | 3300025903 | Bacteria | 855 |
| 527 | Ga0207647_10001208 | 3300025904 | Bacteria | 19845 |
| 528 | Ga0207647_10016448 | 3300025904 | Bacteria | 5049 |
| 529 | Ga0207647_10079788 | 3300025904 | Bacteria | 1964 |
| 530 | Ga0207645_10006423 | 3300025907 | Bacteria | 8438 |
| 531 | Ga0207645_10100017 | 3300025907 | Bacteria | 1870 |
| 532 | Ga0207645_10433108 | 3300025907 | Bacteria | 887 |
| 533 | Ga0207643_10000085 | 3300025908 | Bacteria | 61372 |
| 534 | Ga0207643_10032606 | 3300025908 | Bacteria | 2910 |
| 535 | Ga0207705_10029513 | 3300025909 | Bacteria | 3909 |
| 536 | Ga0207705_10371550 | 3300025909 | Bacteria | 1104 |
| 537 | Ga0207705_10432624 | 3300025909 | Bacteria | 1019 |
| 538 | Ga0207654_10016717 | 3300025911 | Bacteria | 3823 |
| 539 | Ga0207654_10021104 | 3300025911 | Bacteria | 3460 |
| 540 | Ga0207654_10030175 | 3300025911 | Bacteria | 2974 |
| 541 | Ga0207654_10235208 | 3300025911 | Bacteria | 1222 |
| 542 | Ga0207654_10346568 | 3300025911 | Bacteria | 1022 |
| 543 | Ga0207654_10412185 | 3300025911 | Bacteria | 941 |
| 544 | Ga0207707_10141145 | 3300025912 | Bacteria | 2106 |
| 545 | Ga0207707_10345952 | 3300025912 | Bacteria | 1281 |
| 546 | Ga0207695_10000065 | 3300025913 | Bacteria | 336949 |
| 547 | Ga0207695_10000463 | 3300025913 | Bacteria | 88316 |
| 548 | Ga0207695_10051076 | 3300025913 | Bacteria | 4344 |
| 549 | Ga0207695_10066058 | 3300025913 | Bacteria | 3717 |
| 550 | Ga0207695_11075822 | 3300025913 | Bacteria | 684 |
| 551 | Ga0207671_10051470 | 3300025914 | Bacteria | 3052 |
| 552 | Ga0207671_10662964 | 3300025914 | Bacteria | 831 |
| 553 | Ga0207693_10024379 | 3300025915 | Bacteria | 4800 |
| 554 | Ga0207693_10029000 | 3300025915 | Bacteria | 4374 |
| 555 | Ga0207693_10092560 | 3300025915 | Bacteria | 2369 |
| 556 | Ga0207693_10179546 | 3300025915 | Bacteria | 1665 |
| 557 | Ga0207693_10298720 | 3300025915 | Bacteria | 1261 |
| 558 | Ga0207663_10011980 | 3300025916 | Bacteria | 4673 |
| 559 | Ga0207663_10028990 | 3300025916 | Bacteria | 3246 |
| 560 | Ga0207663_10634833 | 3300025916 | Bacteria | 842 |
| 561 | Ga0207660_10111408 | 3300025917 | Bacteria | 2060 |
| 562 | Ga0207660_10413330 | 3300025917 | Bacteria | 1087 |
| 563 | Ga0207662_10021760 | 3300025918 | Bacteria | 3668 |
| 564 | Ga0207657_10031172 | 3300025919 | Bacteria | 4833 |
| 565 | Ga0207657_10090739 | 3300025919 | Bacteria | 2550 |
| 566 | Ga0207657_10163922 | 3300025919 | Bacteria | 1804 |
| 567 | Ga0207649_10141082 | 3300025920 | Bacteria | 1649 |
| 568 | Ga0207649_10220110 | 3300025920 | Bacteria | 1352 |
| 569 | Ga0207649_10248428 | 3300025920 | Bacteria | 1280 |
| 570 | Ga0207649_10443872 | 3300025920 | Bacteria | 978 |
| 571 | Ga0207652_10156845 | 3300025921 | Bacteria | 2039 |
| 572 | Ga0207652_10290508 | 3300025921 | Bacteria | 1475 |
| 573 | Ga0207652_10328042 | 3300025921 | Bacteria | 1382 |
| 574 | Ga0207652_11157539 | 3300025921 | Bacteria | 675 |
| 575 | Ga0207681_10101564 | 3300025923 | Bacteria | 2075 |
| 576 | Ga0207681_10223112 | 3300025923 | Bacteria | 1459 |
| 577 | Ga0207681_10660236 | 3300025923 | Bacteria | 867 |
| 578 | Ga0207694_10000234 | 3300025924 | Bacteria | 53453 |
| 579 | Ga0207694_10060225 | 3300025924 | Bacteria | 2954 |
| 580 | Ga0207694_10084867 | 3300025924 | Bacteria | 2491 |
| 581 | Ga0207694_10428654 | 3300025924 | Bacteria | 1102 |
| 582 | Ga0207650_10018107 | 3300025925 | Bacteria | 4939 |
| 583 | Ga0207659_10007937 | 3300025926 | Bacteria | 6563 |
| 584 | Ga0207659_10049744 | 3300025926 | Bacteria | 2974 |
| 585 | Ga0207687_10007762 | 3300025927 | Bacteria | 7038 |
| 586 | Ga0207687_10041286 | 3300025927 | Bacteria | 3167 |
| 587 | Ga0207687_10144203 | 3300025927 | Bacteria | 1810 |
| 588 | Ga0207687_10270049 | 3300025927 | Bacteria | 1359 |
| 589 | Ga0207700_10007273 | 3300025928 | Bacteria | 6756 |
| 590 | Ga0207700_10341530 | 3300025928 | Bacteria | 1302 |
| 591 | Ga0207664_10071467 | 3300025929 | Bacteria | 2795 |
| 592 | Ga0207664_10117460 | 3300025929 | Bacteria | 2221 |
| 593 | Ga0207664_10905504 | 3300025929 | Bacteria | 792 |
| 594 | Ga0207644_10024752 | 3300025931 | Bacteria | 4123 |
| 595 | Ga0207644_10091140 | 3300025931 | Bacteria | 2272 |
| 596 | Ga0207644_10295385 | 3300025931 | Bacteria | 1304 |
| 597 | Ga0207644_10422523 | 3300025931 | Bacteria | 1092 |
| 598 | Ga0207690_10041750 | 3300025932 | Bacteria | 3008 |
| 599 | Ga0207690_10205636 | 3300025932 | Bacteria | 1498 |
| 600 | Ga0207690_10252474 | 3300025932 | Bacteria | 1363 |
| 601 | Ga0207690_10292065 | 3300025932 | Bacteria | 1273 |
| 602 | Ga0207706_10088251 | 3300025933 | Bacteria | 2727 |
| 603 | Ga0207706_10094123 | 3300025933 | Bacteria | 2635 |
| 604 | Ga0207706_10134965 | 3300025933 | Bacteria | 2171 |
| 605 | Ga0207686_10261568 | 3300025934 | Bacteria | 1269 |
| 606 | Ga0207686_10327329 | 3300025934 | Bacteria | 1147 |
| 607 | Ga0207709_10053693 | 3300025935 | Bacteria | 2481 |
| 608 | Ga0207709_10370573 | 3300025935 | Bacteria | 1087 |
| 609 | Ga0207709_10503279 | 3300025935 | Bacteria | 946 |
| 610 | Ga0207670_10002363 | 3300025936 | Bacteria | 9882 |
| 611 | Ga0207670_10102427 | 3300025936 | Bacteria | 2047 |
| 612 | Ga0207670_10663123 | 3300025936 | Bacteria | 861 |
| 613 | Ga0207670_11084032 | 3300025936 | Bacteria | 676 |
| 614 | Ga0207669_10459115 | 3300025937 | Bacteria | 1011 |
| 615 | Ga0207669_10912080 | 3300025937 | Bacteria | 734 |
| 616 | Ga0207704_10124351 | 3300025938 | Bacteria | 1772 |
| 617 | Ga0207704_10150475 | 3300025938 | Bacteria | 1641 |
| 618 | Ga0207704_10395641 | 3300025938 | Bacteria | 1089 |
| 619 | Ga0207704_10471429 | 3300025938 | Bacteria | 1006 |
| 620 | Ga0207704_10747748 | 3300025938 | Bacteria | 813 |
| 621 | Ga0207665_10066129 | 3300025939 | Bacteria | 2460 |
| 622 | Ga0207691_10020632 | 3300025940 | Bacteria | 6229 |
| 623 | Ga0207691_10050325 | 3300025940 | Bacteria | 3815 |
| 624 | Ga0207691_10894046 | 3300025940 | Bacteria | 744 |
| 625 | Ga0207691_11025331 | 3300025940 | Bacteria | 688 |
| 626 | Ga0207711_10063221 | 3300025941 | Bacteria | 3195 |
| 627 | Ga0207711_10116539 | 3300025941 | Bacteria | 2382 |
| 628 | Ga0207711_10271550 | 3300025941 | Bacteria | 1560 |
| 629 | Ga0207689_10301654 | 3300025942 | Bacteria | 1328 |
| 630 | Ga0207689_10311360 | 3300025942 | Bacteria | 1306 |
| 631 | Ga0207661_10044110 | 3300025944 | Bacteria | 3522 |
| 632 | Ga0207661_10178147 | 3300025944 | Bacteria | 1855 |
| 633 | Ga0207679_10632009 | 3300025945 | Bacteria | 967 |
| 634 | Ga0207679_10866583 | 3300025945 | Bacteria | 825 |
| 635 | Ga0207667_10026572 | 3300025949 | Bacteria | 6319 |
| 636 | Ga0207667_10076155 | 3300025949 | Bacteria | 3482 |
| 637 | Ga0207667_10138057 | 3300025949 | Bacteria | 2510 |
| 638 | Ga0207667_10254262 | 3300025949 | Bacteria | 1797 |
| 639 | Ga0207667_10884633 | 3300025949 | Bacteria | 886 |
| 640 | Ga0207651_10002327 | 3300025960 | Bacteria | 9056 |
| 641 | Ga0207651_10010959 | 3300025960 | Bacteria | 5049 |
| 642 | Ga0207651_10532818 | 3300025960 | Bacteria | 1019 |
| 643 | Ga0207712_10107821 | 3300025961 | Bacteria | 2083 |
| 644 | Ga0207712_10263259 | 3300025961 | Bacteria | 1399 |
| 645 | Ga0207712_10618796 | 3300025961 | Bacteria | 938 |
| 646 | Ga0207668_10070733 | 3300025972 | Bacteria | 2489 |
| 647 | Ga0207668_10170887 | 3300025972 | Bacteria | 1704 |
| 648 | Ga0207668_10834618 | 3300025972 | Bacteria | 817 |
| 649 | Ga0207668_11128067 | 3300025972 | Bacteria | 703 |
| 650 | Ga0207640_10018424 | 3300025981 | Bacteria | 4104 |
| 651 | Ga0207640_10022981 | 3300025981 | Bacteria | 3742 |
| 652 | Ga0207658_10075608 | 3300025986 | Bacteria | 2563 |
| 653 | Ga0207658_10126621 | 3300025986 | Bacteria | 2045 |
| 654 | Ga0207658_10345610 | 3300025986 | Bacteria | 1294 |
| 655 | Ga0207677_10089177 | 3300026023 | Bacteria | 2238 |
| 656 | Ga0207677_10232838 | 3300026023 | Bacteria | 1485 |
| 657 | Ga0207677_10252562 | 3300026023 | Bacteria | 1433 |
| 658 | Ga0207703_10058879 | 3300026035 | Bacteria | 3137 |
| 659 | Ga0207703_10062109 | 3300026035 | Bacteria | 3060 |
| 660 | Ga0207703_10083826 | 3300026035 | Bacteria | 2664 |
| 661 | Ga0207703_10392340 | 3300026035 | Bacteria | 1286 |
| 662 | Ga0207703_10416304 | 3300026035 | Bacteria | 1249 |
| 663 | Ga0207639_10029190 | 3300026041 | Bacteria | 4036 |
| 664 | Ga0207639_10270426 | 3300026041 | Bacteria | 1490 |
| 665 | Ga0207639_10295019 | 3300026041 | Bacteria | 1431 |
| 666 | Ga0207639_10325906 | 3300026041 | Bacteria | 1365 |
| 667 | Ga0207639_10684825 | 3300026041 | Bacteria | 950 |
| 668 | Ga0207639_11407499 | 3300026041 | Bacteria | 654 |
| 669 | Ga0207678_10005146 | 3300026067 | Bacteria | 11722 |
| 670 | Ga0207678_10010843 | 3300026067 | Bacteria | 8008 |
| 671 | Ga0207678_10013588 | 3300026067 | Bacteria | 7151 |
| 672 | Ga0207678_10016226 | 3300026067 | Bacteria | 6537 |
| 673 | Ga0207678_10057915 | 3300026067 | Bacteria | 3334 |
| 674 | Ga0207678_10078637 | 3300026067 | Bacteria | 2824 |
| 675 | Ga0207678_10096321 | 3300026067 | Bacteria | 2529 |
| 676 | Ga0207678_10128205 | 3300026067 | Bacteria | 2164 |
| 677 | Ga0207708_10121050 | 3300026075 | Bacteria | 2039 |
| 678 | Ga0207702_10000098 | 3300026078 | Bacteria | 101326 |
| 679 | Ga0207702_10023104 | 3300026078 | Bacteria | 5157 |
| 680 | Ga0207702_10105618 | 3300026078 | Bacteria | 2494 |
| 681 | Ga0207702_10488414 | 3300026078 | Bacteria | 1199 |
| 682 | Ga0207702_10619569 | 3300026078 | Bacteria | 1063 |
| 683 | Ga0207641_10084753 | 3300026088 | Bacteria | 2759 |
| 684 | Ga0207641_10698471 | 3300026088 | Bacteria | 999 |
| 685 | Ga0207641_11209277 | 3300026088 | Bacteria | 755 |
| 686 | Ga0207641_11271659 | 3300026088 | Bacteria | 736 |
| 687 | Ga0207648_10001362 | 3300026089 | Bacteria | 26996 |
| 688 | Ga0207648_10016972 | 3300026089 | Bacteria | 6635 |
| 689 | Ga0207648_10620474 | 3300026089 | Bacteria | 998 |
| 690 | Ga0207676_10112306 | 3300026095 | Bacteria | 2282 |
| 691 | Ga0207676_10119808 | 3300026095 | Bacteria | 2217 |
| 692 | Ga0207676_10667316 | 3300026095 | Bacteria | 1005 |
| 693 | Ga0207674_10006546 | 3300026116 | Bacteria | 13700 |
| 694 | Ga0207674_10009002 | 3300026116 | Bacteria | 11471 |
| 695 | Ga0207674_10010216 | 3300026116 | Bacteria | 10662 |
| 696 | Ga0207674_10031549 | 3300026116 | Bacteria | 5565 |
| 697 | Ga0207674_10082038 | 3300026116 | Bacteria | 3226 |
| 698 | Ga0207675_100359610 | 3300026118 | Bacteria | 1428 |
| 699 | Ga0207683_10004914 | 3300026121 | Bacteria | 11496 |
| 700 | Ga0207683_10057619 | 3300026121 | Bacteria | 3410 |
| 701 | Ga0207683_10112867 | 3300026121 | Bacteria | 2434 |
| 702 | Ga0207683_10203433 | 3300026121 | Bacteria | 1800 |
| 703 | Ga0207683_10291838 | 3300026121 | Bacteria | 1491 |
| 704 | Ga0207683_10877124 | 3300026121 | Bacteria | 833 |
| 705 | Ga0207683_11092839 | 3300026121 | Bacteria | 740 |
| 706 | Ga0207683_11298497 | 3300026121 | Bacteria | 674 |
| 707 | Ga0207698_10105252 | 3300026142 | Bacteria | 2350 |
| 708 | Ga0207698_10192457 | 3300026142 | Bacteria | 1818 |
| 709 | Ga0207698_10218966 | 3300026142 | Bacteria | 1719 |
| 710 | Ga0207698_10327212 | 3300026142 | Bacteria | 1438 |
| 711 | Ga0207698_10384510 | 3300026142 | Bacteria | 1336 |
| 712 | Ga0207698_10476330 | 3300026142 | Bacteria | 1210 |
| 713 | Ga0207698_10705566 | 3300026142 | Bacteria | 1004 |
| 714 | Ga0207698_10717463 | 3300026142 | Bacteria | 996 |
| 715 | Ga0209389_1000168 | 3300027296 | Bacteria | 52990 |
| 716 | Ga0209389_1000180 | 3300027296 | Bacteria | 49331 |
| 717 | Ga0209589_1000015 | 3300027357 | Bacteria | 225913 |
| 718 | Ga0209589_1000570 | 3300027357 | Bacteria | 52985 |
| 719 | Ga0209489_100015 | 3300027361 | Bacteria | 225913 |
| 720 | Ga0209489_101190 | 3300027361 | Bacteria | 52985 |
| 721 | Ga0209489_101411 | 3300027361 | Bacteria | 49331 |
| 722 | Ga0209700_100025 | 3300027363 | Bacteria | 225913 |
| 723 | Ga0209700_101443 | 3300027363 | Bacteria | 49345 |
| 724 | Ga0209967_1015941 | 3300027364 | Bacteria | 1078 |
| 725 | Ga0210002_1003502 | 3300027617 | Bacteria | 2313 |
| 726 | Ga0209971_1034805 | 3300027682 | Bacteria | 1211 |
| 727 | Ga0209998_10011152 | 3300027717 | Bacteria | 1860 |
| 728 | Ga0209813_10169264 | 3300027866 | Bacteria | 793 |
| 729 | Ga0207428_10000664 | 3300027907 | Bacteria | 40266 |
| 730 | Ga0207428_10001593 | 3300027907 | Bacteria | 23627 |
| 731 | Ga0207428_10349709 | 3300027907 | Bacteria | 1088 |
| 732 | Ga0268266_10003266 | 3300028379 | Bacteria | 16328 |
| 733 | Ga0268266_10046072 | 3300028379 | Bacteria | 3733 |
| 734 | Ga0268266_10151210 | 3300028379 | Bacteria | 2092 |
| 735 | Ga0268266_10165793 | 3300028379 | Bacteria | 2001 |
| 736 | Ga0268266_10171356 | 3300028379 | Bacteria | 1970 |
| 737 | Ga0268266_10210008 | 3300028379 | Bacteria | 1785 |
| 738 | Ga0268266_10282367 | 3300028379 | Bacteria | 1544 |
| 739 | Ga0268265_10128769 | 3300028380 | Bacteria | 2099 |
| 740 | Ga0268265_10160149 | 3300028380 | Bacteria | 1910 |
| 741 | Ga0268265_10385096 | 3300028380 | Bacteria | 1291 |
| 742 | Ga0268264_10000049 | 3300028381 | Bacteria | 329992 |
| 743 | Ga0268264_10511294 | 3300028381 | Bacteria | 1173 |
| 744 | Ga0307517_10002508 | 3300028786 | Bacteria | 29345 |
| 745 | Ga0307517_10138270 | 3300028786 | Bacteria | 1722 |
| 746 | Ga0307517_10428677 | 3300028786 | Bacteria | 691 |
| 747 | Ga0307515_10069558 | 3300028794 | Bacteria | 4808 |
| 748 | Ga0307515_10113017 | 3300028794 | Bacteria | 3153 |
| 749 | Ga0265760_10052578 | 3300031090 | Bacteria | 1228 |
| 750 | Ga0265330_10081784 | 3300031235 | Bacteria | 1391 |
| 751 | Ga0265316_10462372 | 3300031344 | Bacteria | 909 |
| 752 | Ga0307513_10089886 | 3300031456 | Bacteria | 3134 |
| 753 | Ga0307509_10120233 | 3300031507 | Bacteria | 2606 |
| 754 | Ga0265313_10000510 | 3300031595 | Bacteria | 40838 |
| 755 | Ga0265313_10031496 | 3300031595 | Bacteria | 2718 |
| 756 | Ga0265313_10120675 | 3300031595 | Bacteria | 1144 |
| 757 | Ga0307508_10000046 | 3300031616 | Bacteria | 139709 |
| 758 | Ga0307508_10037024 | 3300031616 | Bacteria | 4390 |
| 759 | Ga0316579_10043783 | 3300031691 | Bacteria | 2083 |
| 760 | Ga0265314_10022525 | 3300031711 | Bacteria | 4825 |
| 761 | Ga0265314_10151442 | 3300031711 | Bacteria | 1422 |
| 762 | Ga0307516_10003810 | 3300031730 | Bacteria | 19133 |
| 763 | Ga0307516_10264467 | 3300031730 | Bacteria | 1409 |
| 764 | Ga0307405_10201212 | 3300031731 | Bacteria | 1447 |
| 765 | Ga0307413_10048793 | 3300031824 | Bacteria | 2533 |
| 766 | Ga0307410_10470799 | 3300031852 | Bacteria | 1029 |
| 767 | Ga0307407_10256037 | 3300031903 | Bacteria | 1202 |
| 768 | Ga0307409_101166958 | 3300031995 | Bacteria | 793 |
| 769 | Ga0307416_100240771 | 3300032002 | Bacteria | 1753 |
| 770 | Ga0307416_100416507 | 3300032002 | Bacteria | 1386 |
| 771 | Ga0307416_100668905 | 3300032002 | Bacteria | 1125 |
| 772 | Ga0307411_10236299 | 3300032005 | Bacteria | 1428 |
| 773 | Ga0307411_10588884 | 3300032005 | Bacteria | 955 |
| 774 | Ga0307415_100058305 | 3300032126 | Bacteria | 2658 |
| 775 | Ga0307415_101136264 | 3300032126 | Bacteria | 733 |
| 776 | Ga0307510_10003428 | 3300033180 | Bacteria | 18490 |
| 777 | Ga0307510_10195732 | 3300033180 | Bacteria | 1563 |
| 778 | Ga0315911_1000017 | 3300033442 | Bacteria | 161609 |
| 779 | Ga0373930_0025262 | 3300034816 | Bacteria | 1191 |
| 780 | Ga0373948_0002028 | 3300034817 | Bacteria | 2926 |
| 781 | Ga0373950_0001366 | 3300034818 | Bacteria | 3168 |
| 782 | Ga0373950_0029199 | 3300034818 | Bacteria | 1014 |
| 783 | Ga0373958_0000682 | 3300034819 | Bacteria | 4305 |
| 784 | Ga0373938_0000745 | 3300034957 | Bacteria | 5261 |
| 785 | Ga0373938_0001870 | 3300034957 | Bacteria | 3366 |
| 786 | Ga0373926_0010795 | 3300035083 | Bacteria | 3066 |
| 787 | Ga0373928_0000048 | 3300035084 | Bacteria | 20964 |
| 788 | Ga0373929_0000547 | 3300035085 | Bacteria | 7218 |
| 789 | Ga0373940_0000927 | 3300035088 | Bacteria | 4957 |
| 790 | Ga0373944_0020862 | 3300035089 | Bacteria | 1891 |
| 791 | Ga0373944_0129215 | 3300035089 | Bacteria | 877 |
| 792 | Ga0373949_0000821 | 3300035090 | Bacteria | 9896 |
| 793 | Ga0373951_0007246 | 3300035091 | Bacteria | 2522 |
| 794 | Ga0373952_0002299 | 3300035092 | Bacteria | 3445 |
| 795 | Ga0373923_0010736 | 3300035111 | Bacteria | 3341 |
| 796 | Ga0373923_0020082 | 3300035111 | Bacteria | 2592 |
| 797 | Ga0373932_0001773 | 3300035112 | Bacteria | 5813 |
| 798 | Ga0373932_0019787 | 3300035112 | Bacteria | 1758 |
| 799 | Ga0373936_0020155 | 3300035113 | Bacteria | 2588 |
| 800 | Ga0373936_0196083 | 3300035113 | Bacteria | 890 |
| 801 | Ga0373939_0001868 | 3300035114 | Bacteria | 5032 |
| 802 | Ga0373939_0014456 | 3300035114 | Bacteria | 2048 |
| 803 | Ga0373941_0000452 | 3300035115 | Bacteria | 8177 |
| 804 | Ga0373941_0000714 | 3300035115 | Bacteria | 6821 |
| 805 | Ga0373941_0108990 | 3300035115 | Bacteria | 974 |
| 806 | Ga0373945_0033172 | 3300035116 | Bacteria | 1834 |
| 807 | Ga0373953_0010228 | 3300035117 | Bacteria | 3256 |
| 808 | Ga0373954_0033716 | 3300035118 | Bacteria | 2369 |
| 809 | Ga0373954_0109719 | 3300035118 | Bacteria | 1334 |
| 810 | Ga0373956_0002568 | 3300035119 | Bacteria | 7375 |
| 811 | Ga0373957_0023794 | 3300035120 | Bacteria | 2193 |
| 812 | Ga0373960_0008309 | 3300035121 | Bacteria | 2484 |
| 813 | Ga0373960_0117172 | 3300035121 | Bacteria | 880 |
| 814 | Ga0373943_0012096 | 3300035170 | Bacteria | 3887 |
| 815 | Ga0373943_0018472 | 3300035170 | Bacteria | 3204 |
| 816 | Ga0373943_0023977 | 3300035170 | Bacteria | 2842 |
| 817 | Ga0373946_0046780 | 3300035171 | Bacteria | 1794 |
| 818 | Ga0373946_0249781 | 3300035171 | Bacteria | 865 |
| 819 | Ga0373955_0004901 | 3300035172 | Bacteria | 5970 |
| 820 | Ga0373955_0014739 | 3300035172 | Bacteria | 3812 |
| 821 | Ga0373955_0042433 | 3300035172 | Bacteria | 2442 |
| 822 | Ga0373942_0000844 | 3300035207 | Bacteria | 8415 |
| 823 | Ga0373942_0002802 | 3300035207 | Bacteria | 4152 |
| 824 | Ga0373962_0000546 | 3300035242 | Bacteria | 8445 |
| 825 | Ga0373962_0003526 | 3300035242 | Bacteria | 3760 |
| 826 | Ga0373924_0012982 | 3300035410 | Bacteria | 3123 |
| 827 | Ga0373924_0022820 | 3300035410 | Bacteria | 2449 |
| 828 | Ga0373931_0009546 | 3300035691 | Bacteria | 4640 |
| 829 | Ga0373931_0047178 | 3300035691 | Bacteria | 2279 |
| 830 | Ga0373931_0136358 | 3300035691 | Bacteria | 1417 |
| 831 | Ga0373931_0214279 | 3300035691 | Bacteria | 1157 |
| 832 | Ga0373935_0019978 | 3300035692 | Bacteria | 4088 |
| 833 | Ga0373927_0000481 | 3300035695 | Bacteria | 30651 |
| 834 | Ga0373927_0052809 | 3300035695 | Bacteria | 2628 |
| 835 | Ga0373927_0089476 | 3300035695 | Bacteria | 1999 |
| 836 | Ga0373927_0101160 | 3300035695 | Bacteria | 1874 |
| 837 | Ga0373927_0125941 | 3300035695 | Bacteria | 1672 |
| 838 | Ga0373933_0003495 | 3300035724 | Bacteria | 8748 |
| 839 | Ga0373933_0040458 | 3300035724 | Bacteria | 2747 |
| 840 | Ga0373947_0000441 | 3300035725 | Bacteria | 23573 |
| 841 | Ga0373947_0574720 | 3300035725 | Bacteria | 768 |
| 842 | Ga0373937_0030955 | 3300036401 | Bacteria | 4845 |
| 843 | Ga0373937_0129490 | 3300036401 | Bacteria | 2356 |
| 844 | Ga0373937_0195842 | 3300036401 | Bacteria | 1899 |
| 845 | Ga0373937_0823972 | 3300036401 | Bacteria | 876 |
| 846 | Ga0373925_0005350 | 3300037068 | Bacteria | 9577 |
| 847 | Ga0373925_0018054 | 3300037068 | Bacteria | 5124 |
| 848 | Ga0373925_0048343 | 3300037068 | Bacteria | 3169 |
| 849 | Ga0373925_0313697 | 3300037068 | Bacteria | 1268 |
| 850 | Ga0395899_0258995 | 3300037312 | Bacteria | 1191 |
| 851 | Ga0395900_0000937 | 3300037418 | Bacteria | 38218 |
| 852 | Ga0395900_0288371 | 3300037418 | Bacteria | 1631 |
| 853 | Ga0395900_0355669 | 3300037418 | Bacteria | 1437 |
| 854 | Ga0395898_0012937 | 3300037466 | Bacteria | 8607 |
| 855 | Ga0395905_0003622 | 3300037471 | Bacteria | 16414 |
| 856 | Ga0395905_0100877 | 3300037471 | Bacteria | 2710 |
| 857 | Ga0395905_0107501 | 3300037471 | Bacteria | 2619 |
| 858 | Ga0395905_0506056 | 3300037471 | Bacteria | 1108 |
| 859 | Ga0436364_0666253 | 3300037853 | Bacteria | 5675 |
| 860 | Ga0436364_1169764 | 3300037853 | Bacteria | 928 |
| 861 | Ga0395901_0027708 | 3300038443 | Bacteria | 5825 |
| 862 | Ga0436365_0332538 | 3300039437 | Bacteria | 1458 |
| 863 | Ga0436360_0069163 | 3300039438 | Bacteria | 1323 |
| 864 | Ga0436360_0794626 | 3300039438 | Bacteria | 2225 |
| 865 | Ga0436361_0180263 | 3300039447 | Bacteria | 2601 |
| 866 | Ga0436361_0354921 | 3300039447 | Bacteria | 1354 |
| 867 | Ga0436361_0540936 | 3300039447 | Bacteria | 1468 |
| 868 | Ga0436363_0376673 | 3300039450 | Bacteria | 6417 |
| 869 | Ga0436363_1386220 | 3300039450 | Bacteria | 1331 |
| 870 | Ga0439465_0006502 | 3300041413 | Bacteria | 3715 |
| 871 | Ga0439465_0054106 | 3300041413 | Bacteria | 1320 |
| 872 | Ga0451791_0027799 | 3300041451 | Bacteria | 1184 |
| 873 | Ga0451797_0177233 | 3300041453 | Bacteria | 965 |
| 874 | Ga0451795_0644648 | 3300041456 | Bacteria | 1225 |
| 875 | Ga0451847_0937825 | 3300041503 | Bacteria | 871 |
| 876 | Ga0439464_0035696 | 3300042439 | Bacteria | 1405 |
| 877 | Ga0451577_0089386 | 3300042876 | Bacteria | 2749 |
| 878 | Ga0466972_0000171 | 3300044658 | Bacteria | 50915 |
| 879 | Ga0466972_0009381 | 3300044658 | Bacteria | 4918 |
| 880 | Ga0466972_0099558 | 3300044658 | Bacteria | 1376 |
| 881 | Ga0453683_0138434 | 3300044673 | Bacteria | 1536 |
| 882 | Ga0466965_0063765 | 3300044683 | Bacteria | 1844 |
| 883 | Ga0466966_0000287 | 3300044684 | Bacteria | 33106 |
| 884 | Ga0466966_0024099 | 3300044684 | Bacteria | 3984 |
| 885 | Ga0466961_0000126 | 3300044693 | Bacteria | 51032 |
| 886 | Ga0466963_0184624 | 3300044694 | Bacteria | 1456 |
| 887 | Ga0453684_0101204 | 3300044712 | Bacteria | 3526 |
| 888 | Ga0466971_0117504 | 3300044719 | Bacteria | 1230 |
| 889 | Ga0466968_0002951 | 3300044735 | Bacteria | 6282 |
| 890 | Ga0466968_0063072 | 3300044735 | Bacteria | 1602 |
| 891 | Ga0466957_0554122 | 3300044842 | Bacteria | 801 |
| 892 | Ga0466960_0011542 | 3300044901 | Bacteria | 3700 |
| 893 | Ga0466960_0049122 | 3300044901 | Bacteria | 2030 |
| 894 | Ga0466959_0003379 | 3300045049 | Bacteria | 10427 |
| 895 | Ga0451576_0060155 | 3300045051 | Bacteria | 3963 |
| 896 | Ga0466967_0203454 | 3300045976 | Bacteria | 1876 |
| 897 | Ga0466967_0603392 | 3300045976 | Bacteria | 1083 |
| 898 | Ga0495617_030202 | 3300046452 | Bacteria | 1822 |
| 899 | Ga0495592_0038636 | 3300046454 | Bacteria | 3590 |
| 900 | Ga0495592_0394284 | 3300046454 | Bacteria | 878 |
| 901 | Ga0495603_0000066 | 3300046455 | Bacteria | 45635 |
| 902 | Ga0495603_0027734 | 3300046455 | Bacteria | 3416 |
| 903 | Ga0495603_0068782 | 3300046455 | Bacteria | 2083 |
| 904 | Ga0495603_0086597 | 3300046455 | Bacteria | 1834 |
| 905 | Ga0495603_0130881 | 3300046455 | Bacteria | 1461 |
| 906 | Ga0495603_0237113 | 3300046455 | Bacteria | 1051 |
| 907 | Ga0495590_0025134 | 3300046457 | Bacteria | 2095 |
| 908 | Ga0495629_0006904 | 3300046459 | Bacteria | 8375 |
| 909 | Ga0495629_0018144 | 3300046459 | Bacteria | 5040 |
| 910 | Ga0495629_0105444 | 3300046459 | Bacteria | 1966 |
| 911 | Ga0495638_0005913 | 3300046460 | Bacteria | 8988 |
| 912 | Ga0495638_0067451 | 3300046460 | Bacteria | 2196 |
| 913 | Ga0495641_0019238 | 3300046461 | Bacteria | 3500 |
| 914 | Ga0495641_0107306 | 3300046461 | Bacteria | 1246 |
| 915 | Ga0495641_0247308 | 3300046461 | Bacteria | 802 |
| 916 | Ga0495651_0000667 | 3300046462 | Bacteria | 26661 |
| 917 | Ga0495651_0049589 | 3300046462 | Bacteria | 3241 |
| 918 | Ga0495651_0077600 | 3300046462 | Bacteria | 2514 |
| 919 | Ga0495580_0001382 | 3300046472 | Bacteria | 21285 |
| 920 | Ga0495580_0263001 | 3300046472 | Bacteria | 1180 |
| 921 | Ga0495582_0000298 | 3300046473 | Bacteria | 27399 |
| 922 | Ga0495582_0235013 | 3300046473 | Bacteria | 1050 |
| 923 | Ga0495605_0032010 | 3300046474 | Bacteria | 2682 |
| 924 | Ga0495605_0096196 | 3300046474 | Bacteria | 1366 |
| 925 | Ga0495605_0144963 | 3300046474 | Bacteria | 1063 |
| 926 | Ga0495605_0192831 | 3300046474 | Bacteria | 891 |
| 927 | Ga0495639_0000282 | 3300046475 | Bacteria | 25018 |
| 928 | Ga0495639_0054189 | 3300046475 | Bacteria | 1828 |
| 929 | Ga0495662_0000058 | 3300046476 | Bacteria | 37987 |
| 930 | Ga0495662_0233699 | 3300046476 | Bacteria | 906 |
| 931 | Ga0495664_0001603 | 3300046477 | Bacteria | 12028 |
| 932 | Ga0495664_0350670 | 3300046477 | Bacteria | 889 |
| 933 | Ga0495585_0005925 | 3300046492 | Bacteria | 7648 |
| 934 | Ga0495585_0087199 | 3300046492 | Bacteria | 1685 |
| 935 | Ga0495585_0126109 | 3300046492 | Bacteria | 1350 |
| 936 | Ga0495594_0000706 | 3300046499 | Bacteria | 17171 |
| 937 | Ga0495594_0027151 | 3300046499 | Bacteria | 3083 |
| 938 | Ga0495594_0074764 | 3300046499 | Bacteria | 1888 |
| 939 | Ga0495596_0019026 | 3300046500 | Bacteria | 2825 |
| 940 | Ga0495596_0052294 | 3300046500 | Bacteria | 1599 |
| 941 | Ga0495607_0019906 | 3300046501 | Bacteria | 4252 |
| 942 | Ga0495607_0074008 | 3300046501 | Bacteria | 1892 |
| 943 | Ga0495607_0170774 | 3300046501 | Bacteria | 1098 |
| 944 | Ga0495583_0077706 | 3300046506 | Bacteria | 1447 |
| 945 | Ga0495583_0191809 | 3300046506 | Bacteria | 833 |
| 946 | Ga0495606_0019769 | 3300046507 | Bacteria | 4992 |
| 947 | Ga0495606_0051430 | 3300046507 | Bacteria | 2687 |
| 948 | Ga0495606_0067970 | 3300046507 | Bacteria | 2255 |
| 949 | Ga0495606_0198615 | 3300046507 | Bacteria | 1145 |
| 950 | Ga0495608_0078741 | 3300046511 | Bacteria | 2143 |
| 951 | Ga0495608_0127015 | 3300046511 | Bacteria | 1633 |
| 952 | Ga0495610_0012760 | 3300046512 | Bacteria | 5030 |
| 953 | Ga0495610_0089433 | 3300046512 | Bacteria | 1398 |
| 954 | Ga0495610_0101939 | 3300046512 | Bacteria | 1284 |
| 955 | Ga0495610_0140936 | 3300046512 | Bacteria | 1038 |
| 956 | Ga0495616_0090402 | 3300046513 | Bacteria | 1450 |
| 957 | Ga0495618_0033089 | 3300046514 | Bacteria | 3240 |
| 958 | Ga0495618_0073141 | 3300046514 | Bacteria | 2182 |
| 959 | Ga0495618_0481714 | 3300046514 | Bacteria | 750 |
| 960 | Ga0495620_0107042 | 3300046515 | Bacteria | 1110 |
| 961 | Ga0495620_0135135 | 3300046515 | Bacteria | 966 |
| 962 | Ga0495628_0037494 | 3300046516 | Bacteria | 3886 |
| 963 | Ga0495628_0066468 | 3300046516 | Bacteria | 2819 |
| 964 | Ga0495630_0001425 | 3300046517 | Bacteria | 16552 |
| 965 | Ga0495630_0017239 | 3300046517 | Bacteria | 5289 |
| 966 | Ga0495630_0168514 | 3300046517 | Bacteria | 1668 |
| 967 | Ga0495631_0004059 | 3300046518 | Bacteria | 7868 |
| 968 | Ga0495631_0271736 | 3300046518 | Bacteria | 722 |
| 969 | Ga0495632_0038495 | 3300046519 | Bacteria | 2421 |
| 970 | Ga0495632_0180072 | 3300046519 | Bacteria | 968 |
| 971 | Ga0495632_0271742 | 3300046519 | Bacteria | 756 |
| 972 | Ga0495637_0055908 | 3300046520 | Bacteria | 1635 |
| 973 | Ga0495637_0144166 | 3300046520 | Bacteria | 902 |
| 974 | Ga0495637_0182295 | 3300046520 | Bacteria | 778 |
| 975 | Ga0495643_0007902 | 3300046522 | Bacteria | 6793 |
| 976 | Ga0495644_0004771 | 3300046523 | Bacteria | 5325 |
| 977 | Ga0495644_0164387 | 3300046523 | Bacteria | 851 |
| 978 | Ga0495648_0002045 | 3300046524 | Bacteria | 19136 |
| 979 | Ga0495648_0014359 | 3300046524 | Bacteria | 5802 |
| 980 | Ga0495648_0046198 | 3300046524 | Bacteria | 2701 |
| 981 | Ga0495648_0098016 | 3300046524 | Bacteria | 1624 |
| 982 | Ga0495648_0211530 | 3300046524 | Bacteria | 963 |
| 983 | Ga0495648_0363328 | 3300046524 | Bacteria | 657 |
| 984 | Ga0495663_0080918 | 3300046525 | Bacteria | 1046 |
| 985 | Ga0495666_0036914 | 3300046526 | Bacteria | 2378 |
| 986 | Ga0495666_0238691 | 3300046526 | Bacteria | 830 |
| 987 | Ga0495652_0036110 | 3300046529 | Bacteria | 4298 |
| 988 | Ga0495652_0237284 | 3300046529 | Bacteria | 1360 |
| 989 | Ga0495654_0092505 | 3300046530 | Bacteria | 1401 |
| 990 | Ga0495665_0000373 | 3300046531 | Bacteria | 22557 |
| 991 | Ga0495640_0014709 | 3300046533 | Bacteria | 5911 |
| 992 | Ga0495640_0028397 | 3300046533 | Bacteria | 4029 |
| 993 | Ga0495587_0042572 | 3300046536 | Bacteria | 2708 |
| 994 | Ga0495587_0045839 | 3300046536 | Bacteria | 2597 |
| 995 | Ga0495587_0067629 | 3300046536 | Bacteria | 2082 |
| 996 | Ga0495598_0012091 | 3300046537 | Bacteria | 2108 |
| 997 | Ga0495609_0139272 | 3300046538 | Bacteria | 1036 |
| 998 | Ga0495597_0027655 | 3300046542 | Bacteria | 2600 |
| 999 | Ga0495597_0074178 | 3300046542 | Bacteria | 1461 |
| 1000 | Ga0495645_0069970 | 3300046543 | Bacteria | 2533 |
| 1001 | Ga0495622_0012697 | 3300046557 | Bacteria | 3905 |
| 1002 | Ga0495622_0040321 | 3300046557 | Bacteria | 2173 |
| 1003 | Ga0495622_0062057 | 3300046557 | Bacteria | 1730 |
| 1004 | Ga0495622_0247552 | 3300046557 | Bacteria | 784 |
| 1005 | Ga0495633_0005887 | 3300046558 | Bacteria | 7373 |
| 1006 | Ga0495633_0158084 | 3300046558 | Bacteria | 1046 |
| 1007 | Ga0495667_0007317 | 3300046559 | Bacteria | 7491 |
| 1008 | Ga0495667_0016052 | 3300046559 | Bacteria | 5061 |
| 1009 | Ga0495667_0021985 | 3300046559 | Bacteria | 4300 |
| 1010 | Ga0495667_0023536 | 3300046559 | Bacteria | 4150 |
| 1011 | Ga0495667_0073041 | 3300046559 | Bacteria | 2235 |
| 1012 | Ga0495656_0000705 | 3300046615 | Bacteria | 10789 |
| 1013 | Ga0495656_0011792 | 3300046615 | Bacteria | 3212 |
| 1014 | Ga0495656_0030526 | 3300046615 | Bacteria | 2179 |
| 1015 | Ga0495656_0087987 | 3300046615 | Bacteria | 1415 |
| 1016 | Ga0495668_0024474 | 3300046616 | Bacteria | 3434 |
| 1017 | Ga0495668_0120327 | 3300046616 | Bacteria | 1436 |
| 1018 | Ga0495668_0197662 | 3300046616 | Bacteria | 1101 |
| 1019 | Ga0495668_0239637 | 3300046616 | Bacteria | 993 |
| 1020 | Ga0495634_0000502 | 3300046642 | Bacteria | 38371 |
| 1021 | Ga0495634_0251229 | 3300046642 | Bacteria | 1082 |
| 1022 | Ga0495611_0005467 | 3300046648 | Bacteria | 5426 |
| 1023 | Ga0495611_0126082 | 3300046648 | Bacteria | 1194 |
| 1024 | Ga0495611_0261026 | 3300046648 | Bacteria | 802 |
| 1025 | Ga0495625_0220532 | 3300046660 | Bacteria | 1243 |
| 1026 | Ga0495625_0255677 | 3300046660 | Bacteria | 1135 |
| 1027 | Ga0495625_0344122 | 3300046660 | Bacteria | 944 |
| 1028 | Ga0495625_0462677 | 3300046660 | Bacteria | 781 |
| 1029 | Ga0495635_0000178 | 3300046663 | Bacteria | 40063 |
| 1030 | Ga0495635_0053042 | 3300046663 | Bacteria | 2794 |
| 1031 | Ga0495635_0161792 | 3300046663 | Bacteria | 1523 |
| 1032 | Ga0495659_0014518 | 3300046664 | Bacteria | 2579 |
| 1033 | Ga0495659_0147917 | 3300046664 | Bacteria | 941 |
| 1034 | Ga0495661_0076948 | 3300046665 | Bacteria | 1934 |
| 1035 | Ga0495661_0159078 | 3300046665 | Bacteria | 1214 |
| 1036 | Ga0495661_0295958 | 3300046665 | Bacteria | 811 |
| 1037 | Ga0495588_0002644 | 3300046674 | Bacteria | 7677 |
| 1038 | Ga0495588_0011343 | 3300046674 | Bacteria | 4178 |
| 1039 | Ga0495588_0063410 | 3300046674 | Bacteria | 1916 |
| 1040 | Ga0495657_0028252 | 3300046675 | Bacteria | 3948 |
| 1041 | Ga0495657_0033935 | 3300046675 | Bacteria | 3548 |
| 1042 | Ga0495657_0155862 | 3300046675 | Bacteria | 1415 |
| 1043 | Ga0495599_0008017 | 3300046678 | Bacteria | 6412 |
| 1044 | Ga0495599_0025275 | 3300046678 | Bacteria | 3717 |
| 1045 | Ga0495599_0033357 | 3300046678 | Bacteria | 3235 |
| 1046 | Ga0495623_0002455 | 3300046679 | Bacteria | 12298 |
| 1047 | Ga0495646_0021079 | 3300046680 | Bacteria | 4119 |
| 1048 | Ga0495646_0048879 | 3300046680 | Bacteria | 2569 |
| 1049 | Ga0495646_0184058 | 3300046680 | Bacteria | 1145 |
| 1050 | Ga0495646_0249149 | 3300046680 | Bacteria | 952 |
| 1051 | Ga0495647_0018257 | 3300046681 | Bacteria | 2494 |
| 1052 | Ga0495647_0072246 | 3300046681 | Bacteria | 1383 |
| 1053 | Ga0495658_0000368 | 3300046683 | Bacteria | 25300 |
| 1054 | Ga0495658_0143321 | 3300046683 | Bacteria | 1463 |
| 1055 | Ga0495669_0011883 | 3300046684 | Bacteria | 3703 |
| 1056 | Ga0495669_0133912 | 3300046684 | Bacteria | 1168 |
| 1057 | Ga0495669_0207094 | 3300046684 | Bacteria | 938 |
| 1058 | Ga0495669_0215055 | 3300046684 | Bacteria | 920 |
| 1059 | Ga0495613_0049303 | 3300046689 | Bacteria | 3108 |
| 1060 | Ga0495613_0084351 | 3300046689 | Bacteria | 2307 |
| 1061 | Ga0495624_0003669 | 3300046690 | Bacteria | 11352 |
| 1062 | Ga0495624_0198199 | 3300046690 | Bacteria | 1220 |
| 1063 | Ga0495670_0000973 | 3300046691 | Bacteria | 13892 |
| 1064 | Ga0495670_0071841 | 3300046691 | Bacteria | 1752 |
| 1065 | Ga0495671_0074747 | 3300046692 | Bacteria | 1662 |
| 1066 | Ga0495649_0017227 | 3300046694 | Bacteria | 4080 |
| 1067 | Ga0495589_0195220 | 3300046794 | Bacteria | 957 |
| 1068 | Ga0495589_0290311 | 3300046794 | Bacteria | 759 |
| 1069 | Ga0495600_0004239 | 3300046809 | Bacteria | 8565 |
| 1070 | Ga0495600_0034813 | 3300046809 | Bacteria | 3270 |
| 1071 | Ga0495600_0166734 | 3300046809 | Bacteria | 1422 |
| 1072 | Ga0495660_0038089 | 3300046810 | Bacteria | 2675 |
| 1073 | Ga0495581_0000111 | 3300047315 | Bacteria | 34508 |
| 1074 | Ga0495581_0021235 | 3300047315 | Bacteria | 3765 |
| 1075 | Ga0495581_0396777 | 3300047315 | Bacteria | 805 |
| 1076 | Ga0495604_0014404 | 3300047317 | Bacteria | 6307 |
| 1077 | Ga0495604_0055322 | 3300047317 | Bacteria | 3059 |
| 1078 | Ga0495604_0083864 | 3300047317 | Bacteria | 2380 |
| 1079 | Ga0495636_0045401 | 3300047318 | Bacteria | 1831 |
| 1080 | Ga0495674_0002855 | 3300047319 | Bacteria | 16780 |
| 1081 | Ga0495674_0165657 | 3300047319 | Bacteria | 1847 |
| 1082 | Ga0495674_0327380 | 3300047319 | Bacteria | 1247 |
| 1083 | Ga0495674_0387919 | 3300047319 | Bacteria | 1129 |
| 1084 | Ga0495672_0072222 | 3300047320 | Bacteria | 1950 |
| 1085 | Ga0495676_0025260 | 3300047321 | Bacteria | 5132 |
| 1086 | Ga0495676_0028521 | 3300047321 | Bacteria | 4764 |
| 1087 | Ga0495676_0122511 | 3300047321 | Bacteria | 1889 |
| 1088 | Ga0495676_0223807 | 3300047321 | Bacteria | 1295 |
| 1089 | Ga0495680_0007580 | 3300047322 | Bacteria | 9924 |
| 1090 | Ga0495680_0066388 | 3300047322 | Bacteria | 2761 |
| 1091 | Ga0495680_0160969 | 3300047322 | Bacteria | 1630 |
| 1092 | Ga0495680_0161815 | 3300047322 | Bacteria | 1625 |
| 1093 | Ga0495683_0057209 | 3300047323 | Bacteria | 1938 |
| 1094 | Ga0495687_033969 | 3300047443 | Bacteria | 2309 |
| 1095 | Ga0495675_0007873 | 3300047444 | Bacteria | 6585 |
| 1096 | Ga0495675_0037173 | 3300047444 | Bacteria | 3101 |
| 1097 | Ga0495677_0036428 | 3300047445 | Bacteria | 1797 |
| 1098 | Ga0495677_0108327 | 3300047445 | Bacteria | 1055 |
| 1099 | Ga0495679_111116 | 3300047446 | Bacteria | 754 |
| 1100 | Ga0495673_0050133 | 3300047469 | Bacteria | 1834 |
| 1101 | Ga0495684_0109882 | 3300047471 | Bacteria | 2082 |
| 1102 | Ga0495686_0102707 | 3300047472 | Bacteria | 1722 |
| 1103 | Ga0495686_0123777 | 3300047472 | Bacteria | 1539 |
| 1104 | Ga0495686_0138490 | 3300047472 | Bacteria | 1438 |
| 1105 | Ga0495686_0188966 | 3300047472 | Bacteria | 1188 |
| 1106 | Ga0495686_0190567 | 3300047472 | Bacteria | 1182 |
| 1107 | Ga0495593_0000210 | 3300047673 | Bacteria | 30957 |
| 1108 | Ga0495593_0075182 | 3300047673 | Bacteria | 1752 |
| 1109 | Ga0495593_0137658 | 3300047673 | Bacteria | 1237 |
| 1110 | Ga0495602_0020857 | 3300048088 | Bacteria | 6466 |
| 1111 | Ga0495602_0054730 | 3300048088 | Bacteria | 3520 |
| 1112 | Ga0495602_0115385 | 3300048088 | Bacteria | 2172 |
| 1113 | Ga0495602_0739472 | 3300048088 | Bacteria | 665 |
| 1114 | Ga0495614_0037279 | 3300048089 | Bacteria | 2086 |
| 1115 | Ga0495614_0060546 | 3300048089 | Bacteria | 1627 |
| 1116 | Ga0495614_0266287 | 3300048089 | Bacteria | 787 |
| 1117 | Ga0495626_0028992 | 3300048091 | Bacteria | 2681 |
| 1118 | Ga0495626_0095109 | 3300048091 | Bacteria | 1305 |
| 1119 | Ga0496100_0076234 | 3300048903 | Bacteria | 2251 |
| 1120 | Ga0496100_0124181 | 3300048903 | Bacteria | 1810 |
| 1121 | Ga0496100_0224743 | 3300048903 | Bacteria | 1379 |
| 1122 | Ga0496100_0356432 | 3300048903 | Bacteria | 1106 |
| 1123 | Ga0496101_0002918 | 3300048904 | Bacteria | 10515 |
| 1124 | Ga0496101_0120579 | 3300048904 | Bacteria | 1982 |
| 1125 | Ga0496101_0133155 | 3300048904 | Bacteria | 1889 |
| 1126 | Ga0496101_0261270 | 3300048904 | Bacteria | 1350 |
| 1127 | Ga0496101_0326923 | 3300048904 | Bacteria | 1203 |
| 1128 | Ga0496101_0396415 | 3300048904 | Bacteria | 1087 |
| 1129 | Ga0496101_0466136 | 3300048904 | Bacteria | 997 |
| 1130 | Ga0496102_0003383 | 3300048905 | Bacteria | 13525 |
| 1131 | Ga0496102_0017307 | 3300048905 | Bacteria | 6312 |
| 1132 | Ga0496102_0041224 | 3300048905 | Bacteria | 4179 |
| 1133 | Ga0496102_0167313 | 3300048905 | Bacteria | 2069 |
| 1134 | Ga0496102_0176232 | 3300048905 | Bacteria | 2013 |
| 1135 | Ga0496102_0191001 | 3300048905 | Bacteria | 1930 |
| 1136 | Ga0496102_0841953 | 3300048905 | Bacteria | 839 |
| 1137 | Ga0496103_0005458 | 3300048906 | Bacteria | 7602 |
| 1138 | Ga0496103_0166305 | 3300048906 | Bacteria | 1415 |
| 1139 | Ga0496103_0619582 | 3300048906 | Bacteria | 689 |
| 1140 | Ga0496104_0023739 | 3300048907 | Bacteria | 5639 |
| 1141 | Ga0496104_0041340 | 3300048907 | Bacteria | 4323 |
| 1142 | Ga0496104_0042724 | 3300048907 | Bacteria | 4255 |
| 1143 | Ga0496104_0071924 | 3300048907 | Bacteria | 3288 |
| 1144 | Ga0496104_0132590 | 3300048907 | Bacteria | 2393 |
| 1145 | Ga0496104_0192450 | 3300048907 | Bacteria | 1952 |
| 1146 | Ga0496104_0369178 | 3300048907 | Bacteria | 1347 |
| 1147 | Ga0496104_0454445 | 3300048907 | Bacteria | 1193 |
| 1148 | Ga0496104_0813265 | 3300048907 | Bacteria | 840 |
| 1149 | Ga0496105_0053739 | 3300048908 | Bacteria | 3326 |
| 1150 | Ga0496105_0095918 | 3300048908 | Bacteria | 2449 |
| 1151 | Ga0496105_0121480 | 3300048908 | Bacteria | 2154 |
| 1152 | Ga0496105_0167066 | 3300048908 | Bacteria | 1805 |
| 1153 | Ga0496105_0182408 | 3300048908 | Bacteria | 1718 |
| 1154 | Ga0496105_0220905 | 3300048908 | Bacteria | 1542 |
| 1155 | Ga0496106_0014823 | 3300048909 | Bacteria | 5763 |
| 1156 | Ga0496106_0048165 | 3300048909 | Bacteria | 3209 |
| 1157 | Ga0496106_0071917 | 3300048909 | Bacteria | 2644 |
| 1158 | Ga0496106_0190337 | 3300048909 | Bacteria | 1631 |
| 1159 | Ga0496106_0350346 | 3300048909 | Bacteria | 1186 |
| 1160 | Ga0496106_0438872 | 3300048909 | Bacteria | 1049 |
| 1161 | Ga0496106_0518295 | 3300048909 | Bacteria | 957 |
| 1162 | Ga0496107_0010578 | 3300048910 | Bacteria | 6415 |
| 1163 | Ga0496107_0017668 | 3300048910 | Bacteria | 5017 |
| 1164 | Ga0496107_0022968 | 3300048910 | Bacteria | 4410 |
| 1165 | Ga0496107_0063122 | 3300048910 | Bacteria | 2684 |
| 1166 | Ga0496107_0094309 | 3300048910 | Bacteria | 2190 |
| 1167 | Ga0496107_0222687 | 3300048910 | Bacteria | 1404 |
| 1168 | Ga0496107_0615051 | 3300048910 | Bacteria | 802 |
| 1169 | Ga0496107_0655231 | 3300048910 | Bacteria | 774 |
| 1170 | Ga0496108_0000639 | 3300048911 | Bacteria | 27304 |
| 1171 | Ga0496108_0064133 | 3300048911 | Bacteria | 3094 |
| 1172 | Ga0496108_0145734 | 3300048911 | Bacteria | 2041 |
| 1173 | Ga0496108_0712118 | 3300048911 | Bacteria | 870 |
| 1174 | Ga0496109_0000619 | 3300048912 | Bacteria | 29616 |
| 1175 | Ga0496109_0064302 | 3300048912 | Bacteria | 3357 |
| 1176 | Ga0496109_0094558 | 3300048912 | Bacteria | 2766 |
| 1177 | Ga0496109_0139533 | 3300048912 | Bacteria | 2266 |
| 1178 | Ga0496109_0182600 | 3300048912 | Bacteria | 1971 |
| 1179 | Ga0496109_0409947 | 3300048912 | Bacteria | 1280 |
| 1180 | Ga0496110_0092579 | 3300048913 | Bacteria | 2705 |
| 1181 | Ga0496110_0118275 | 3300048913 | Bacteria | 2386 |
| 1182 | Ga0496110_0218478 | 3300048913 | Bacteria | 1733 |
| 1183 | Ga0496110_0229742 | 3300048913 | Bacteria | 1687 |
| 1184 | Ga0496110_0273038 | 3300048913 | Bacteria | 1539 |
| 1185 | Ga0496111_0038438 | 3300048914 | Bacteria | 3429 |
| 1186 | Ga0496111_0094006 | 3300048914 | Bacteria | 2198 |
| 1187 | Ga0496111_0122974 | 3300048914 | Bacteria | 1917 |
| 1188 | Ga0496111_0329601 | 3300048914 | Bacteria | 1130 |
| 1189 | Ga0496112_0002285 | 3300048915 | Bacteria | 15329 |
| 1190 | Ga0496112_0039764 | 3300048915 | Bacteria | 4597 |
| 1191 | Ga0496112_0098301 | 3300048915 | Bacteria | 2896 |
| 1192 | Ga0496112_0166061 | 3300048915 | Bacteria | 2173 |
| 1193 | Ga0496112_0358070 | 3300048915 | Bacteria | 1401 |
| 1194 | Ga0496112_0358525 | 3300048915 | Bacteria | 1400 |
| 1195 | Ga0496112_0374648 | 3300048915 | Bacteria | 1365 |
| 1196 | Ga0496112_0779421 | 3300048915 | Bacteria | 881 |
| 1197 | Ga0496112_1137952 | 3300048915 | Bacteria | 698 |
| 1198 | Ga0496113_0004176 | 3300048916 | Bacteria | 8823 |
| 1199 | Ga0496113_0057182 | 3300048916 | Bacteria | 2930 |
| 1200 | Ga0496113_0109068 | 3300048916 | Bacteria | 2152 |
| 1201 | Ga0496113_0134495 | 3300048916 | Bacteria | 1942 |
| 1202 | Ga0496113_0157317 | 3300048916 | Bacteria | 1795 |
| 1203 | Ga0496113_0943816 | 3300048916 | Bacteria | 681 |
| 1204 | Ga0496114_0017189 | 3300048917 | Bacteria | 5834 |
| 1205 | Ga0496114_0021593 | 3300048917 | Bacteria | 5239 |
| 1206 | Ga0496114_0024475 | 3300048917 | Bacteria | 4929 |
| 1207 | Ga0496114_0057328 | 3300048917 | Bacteria | 3252 |
| 1208 | Ga0496114_0329391 | 3300048917 | Bacteria | 1350 |
| 1209 | Ga0496114_0383389 | 3300048917 | Bacteria | 1244 |
| 1210 | Ga0496114_0713486 | 3300048917 | Bacteria | 879 |
| 1211 | Ga0496115_0027016 | 3300048918 | Bacteria | 4486 |
| 1212 | Ga0496115_0094296 | 3300048918 | Bacteria | 2449 |
| 1213 | Ga0496115_0168868 | 3300048918 | Bacteria | 1809 |
| 1214 | Ga0496115_0222783 | 3300048918 | Bacteria | 1556 |
| 1215 | Ga0496115_0381707 | 3300048918 | Bacteria | 1146 |
| 1216 | Ga0496115_0488960 | 3300048918 | Bacteria | 990 |
| 1217 | Ga0496115_0806872 | 3300048918 | Bacteria | 730 |
| 1218 | Ga0496116_0005187 | 3300048919 | Bacteria | 12224 |
| 1219 | Ga0496116_0035270 | 3300048919 | Bacteria | 3515 |
| 1220 | Ga0496116_0194417 | 3300048919 | Bacteria | 1070 |
| 1221 | Ga0496117_0021989 | 3300048920 | Bacteria | 5132 |
| 1222 | Ga0496117_0105060 | 3300048920 | Bacteria | 1776 |
| 1223 | Ga0496118_0033446 | 3300048921 | Bacteria | 4218 |
| 1224 | Ga0496118_0086842 | 3300048921 | Bacteria | 2172 |
| 1225 | Ga0496119_0102731 | 3300048922 | Bacteria | 1602 |
| 1226 | Ga0496120_0018181 | 3300048923 | Bacteria | 4538 |
| 1227 | Ga0496121_0009401 | 3300048924 | Bacteria | 11243 |
| 1228 | Ga0496121_0019336 | 3300048924 | Bacteria | 6814 |
| 1229 | Ga0496121_0053232 | 3300048924 | Bacteria | 3392 |
| 1230 | Ga0496121_0054751 | 3300048924 | Bacteria | 3330 |
| 1231 | Ga0496121_0060186 | 3300048924 | Bacteria | 3125 |
| 1232 | Ga0496121_0095978 | 3300048924 | Bacteria | 2302 |
| 1233 | Ga0496121_0195873 | 3300048924 | Bacteria | 1444 |
| 1234 | Ga0496121_0233781 | 3300048924 | Bacteria | 1285 |
| 1235 | Ga0496121_0268061 | 3300048924 | Bacteria | 1175 |
| 1236 | Ga0496121_0379696 | 3300048924 | Bacteria | 932 |
| 1237 | Ga0496122_0086985 | 3300048925 | Bacteria | 2149 |
| 1238 | Ga0496122_0117523 | 3300048925 | Bacteria | 1726 |
| 1239 | Ga0496122_0260599 | 3300048925 | Bacteria | 962 |
| 1240 | Ga0496123_0086053 | 3300048926 | Bacteria | 1887 |
| 1241 | Ga0496123_0099612 | 3300048926 | Bacteria | 1696 |
| 1242 | Ga0496123_0334777 | 3300048926 | Bacteria | 709 |
| 1243 | Ga0496124_0126298 | 3300048927 | Bacteria | 2037 |
| 1244 | Ga0496124_0176273 | 3300048927 | Bacteria | 1650 |
| 1245 | Ga0496124_0318679 | 3300048927 | Bacteria | 1114 |
| 1246 | Ga0496124_0423542 | 3300048927 | Bacteria | 916 |
| 1247 | Ga0496125_0000420 | 3300048928 | Bacteria | 78930 |
| 1248 | Ga0496125_0001294 | 3300048928 | Bacteria | 37111 |
| 1249 | Ga0496125_0138357 | 3300048928 | Bacteria | 1698 |
| 1250 | Ga0496125_0180840 | 3300048928 | Bacteria | 1405 |
| 1251 | Ga0496125_0182924 | 3300048928 | Bacteria | 1394 |
| 1252 | Ga0496125_0213707 | 3300048928 | Bacteria | 1250 |
| 1253 | Ga0496125_0237453 | 3300048928 | Bacteria | 1160 |
| 1254 | Ga0496126_0005768 | 3300048929 | Bacteria | 14002 |
| 1255 | Ga0496126_0006421 | 3300048929 | Bacteria | 13104 |
| 1256 | Ga0496126_0012916 | 3300048929 | Bacteria | 8528 |
| 1257 | Ga0496126_0069995 | 3300048929 | Bacteria | 3127 |
| 1258 | Ga0496126_0077290 | 3300048929 | Bacteria | 2951 |
| 1259 | Ga0496126_0152957 | 3300048929 | Bacteria | 1976 |
| 1260 | Ga0496126_0212172 | 3300048929 | Bacteria | 1629 |
| 1261 | Ga0496126_0232146 | 3300048929 | Bacteria | 1545 |
| 1262 | Ga0496126_0276065 | 3300048929 | Bacteria | 1393 |
| 1263 | Ga0496126_0345435 | 3300048929 | Bacteria | 1218 |
| 1264 | Ga0496126_0367747 | 3300048929 | Bacteria | 1173 |
| 1265 | Ga0495678_032930 | 3300049459 | Bacteria | 2144 |
| 1266 | Ga0495682_0011648 | 3300049460 | Bacteria | 3382 |
| 1267 | Ga0495682_0118445 | 3300049460 | Bacteria | 948 |
| 1268 | Ga0501031_0004523 | 3300049568 | Bacteria | 9010 |
| 1269 | Ga0501031_0008194 | 3300049568 | Bacteria | 6801 |
| 1270 | Ga0501031_0054472 | 3300049568 | Bacteria | 2606 |
| 1271 | Ga0501031_0055909 | 3300049568 | Bacteria | 2571 |
| 1272 | Ga0501031_0058562 | 3300049568 | Bacteria | 2510 |
| 1273 | Ga0501031_0062386 | 3300049568 | Bacteria | 2429 |
| 1274 | Ga0501031_0109056 | 3300049568 | Bacteria | 1808 |
| 1275 | Ga0501031_0209022 | 3300049568 | Bacteria | 1272 |
| 1276 | Ga0501032_0000172 | 3300049569 | Bacteria | 52773 |
| 1277 | Ga0501032_0004015 | 3300049569 | Bacteria | 11156 |
| 1278 | Ga0501032_0019595 | 3300049569 | Bacteria | 4729 |
| 1279 | Ga0501032_0030915 | 3300049569 | Bacteria | 3673 |
| 1280 | Ga0501032_0044825 | 3300049569 | Bacteria | 2992 |
| 1281 | Ga0501032_0173202 | 3300049569 | Bacteria | 1414 |
| 1282 | Ga0501032_0459267 | 3300049569 | Bacteria | 815 |
| 1283 | Ga0501033_0000866 | 3300049570 | Bacteria | 27653 |
| 1284 | Ga0501033_0001887 | 3300049570 | Bacteria | 18238 |
| 1285 | Ga0501033_0008787 | 3300049570 | Bacteria | 7807 |
| 1286 | Ga0501033_0052374 | 3300049570 | Bacteria | 3025 |
| 1287 | Ga0501033_0086379 | 3300049570 | Bacteria | 2296 |
| 1288 | Ga0501033_0148750 | 3300049570 | Bacteria | 1690 |
| 1289 | Ga0501033_0156287 | 3300049570 | Bacteria | 1643 |
| 1290 | Ga0501034_0000270 | 3300049571 | Bacteria | 94119 |
| 1291 | Ga0501034_0000676 | 3300049571 | Bacteria | 51758 |
| 1292 | Ga0501034_0003680 | 3300049571 | Bacteria | 17330 |
| 1293 | Ga0501034_0017445 | 3300049571 | Bacteria | 7361 |
| 1294 | Ga0501034_0042056 | 3300049571 | Bacteria | 4624 |
| 1295 | Ga0501034_0046005 | 3300049571 | Bacteria | 4409 |
| 1296 | Ga0501034_0077424 | 3300049571 | Bacteria | 3331 |
| 1297 | Ga0501034_0081044 | 3300049571 | Bacteria | 3249 |
| 1298 | Ga0501034_0195399 | 3300049571 | Bacteria | 1983 |
| 1299 | Ga0501034_0326110 | 3300049571 | Bacteria | 1467 |
| 1300 | Ga0501034_0393066 | 3300049571 | Bacteria | 1310 |
| 1301 | Ga0501034_0604510 | 3300049571 | Bacteria | 1002 |
| 1302 | Ga0501034_0634505 | 3300049571 | Bacteria | 971 |
| 1303 | Ga0501036_0000390 | 3300049572 | Bacteria | 30889 |
| 1304 | Ga0501036_0031129 | 3300049572 | Bacteria | 4508 |
| 1305 | Ga0501036_0044378 | 3300049572 | Bacteria | 3765 |
| 1306 | Ga0501036_0068188 | 3300049572 | Bacteria | 3010 |
| 1307 | Ga0501036_0071716 | 3300049572 | Bacteria | 2928 |
| 1308 | Ga0501036_0075280 | 3300049572 | Bacteria | 2855 |
| 1309 | Ga0501036_0131317 | 3300049572 | Bacteria | 2114 |
| 1310 | Ga0501036_0258670 | 3300049572 | Bacteria | 1458 |
| 1311 | Ga0501036_0365729 | 3300049572 | Bacteria | 1204 |
| 1312 | Ga0501037_0000755 | 3300049573 | Bacteria | 24430 |
| 1313 | Ga0501037_0000958 | 3300049573 | Bacteria | 21450 |
| 1314 | Ga0501037_0019397 | 3300049573 | Bacteria | 5016 |
| 1315 | Ga0501037_0023954 | 3300049573 | Bacteria | 4513 |
| 1316 | Ga0501037_0043886 | 3300049573 | Bacteria | 3286 |
| 1317 | Ga0501037_0057399 | 3300049573 | Bacteria | 2842 |
| 1318 | Ga0501037_0258632 | 3300049573 | Bacteria | 1216 |
| 1319 | Ga0501037_0281480 | 3300049573 | Bacteria | 1158 |
| 1320 | Ga0501037_0460680 | 3300049573 | Bacteria | 866 |
| 1321 | Ga0501038_0000089 | 3300049574 | Bacteria | 78009 |
| 1322 | Ga0501038_0024721 | 3300049574 | Bacteria | 5355 |
| 1323 | Ga0501038_0026409 | 3300049574 | Bacteria | 5172 |
| 1324 | Ga0501038_0047902 | 3300049574 | Bacteria | 3700 |
| 1325 | Ga0501038_0068998 | 3300049574 | Bacteria | 3004 |
| 1326 | Ga0501038_0092792 | 3300049574 | Bacteria | 2527 |
| 1327 | Ga0501038_0118989 | 3300049574 | Bacteria | 2180 |
| 1328 | Ga0501038_0181180 | 3300049574 | Bacteria | 1699 |
| 1329 | Ga0501038_0592458 | 3300049574 | Bacteria | 840 |
| 1330 | Ga0501039_0000114 | 3300049575 | Bacteria | 54651 |
| 1331 | Ga0501039_0005815 | 3300049575 | Bacteria | 9337 |
| 1332 | Ga0501039_0026996 | 3300049575 | Bacteria | 4414 |
| 1333 | Ga0501039_0154835 | 3300049575 | Bacteria | 1800 |
| 1334 | Ga0501039_0177021 | 3300049575 | Bacteria | 1677 |
| 1335 | Ga0501039_0389518 | 3300049575 | Bacteria | 1094 |
| 1336 | Ga0501039_0422170 | 3300049575 | Bacteria | 1047 |
| 1337 | Ga0501040_0033806 | 3300049576 | Bacteria | 3465 |
| 1338 | Ga0501042_0212028 | 3300049578 | Bacteria | 1397 |
| 1339 | Ga0501042_0376554 | 3300049578 | Bacteria | 1027 |
| 1340 | Ga0501043_0001086 | 3300049579 | Bacteria | 23917 |
| 1341 | Ga0501043_0004253 | 3300049579 | Bacteria | 11667 |
| 1342 | Ga0501043_0009335 | 3300049579 | Bacteria | 7707 |
| 1343 | Ga0501043_0009610 | 3300049579 | Bacteria | 7576 |
| 1344 | Ga0501043_0018279 | 3300049579 | Bacteria | 5496 |
| 1345 | Ga0501043_0254755 | 3300049579 | Bacteria | 1351 |
| 1346 | Ga0501043_0301353 | 3300049579 | Bacteria | 1224 |
| 1347 | Ga0501046_0006291 | 3300049580 | Bacteria | 10525 |
| 1348 | Ga0501046_0012856 | 3300049580 | Bacteria | 7120 |
| 1349 | Ga0501046_0030044 | 3300049580 | Bacteria | 4413 |
| 1350 | Ga0501046_0110364 | 3300049580 | Bacteria | 2102 |
| 1351 | Ga0501046_0344591 | 3300049580 | Bacteria | 1082 |
| 1352 | Ga0501047_0000594 | 3300049581 | Bacteria | 38494 |
| 1353 | Ga0501047_0052121 | 3300049581 | Bacteria | 3954 |
| 1354 | Ga0501047_0061369 | 3300049581 | Bacteria | 3627 |
| 1355 | Ga0501047_0133295 | 3300049581 | Bacteria | 2364 |
| 1356 | Ga0501047_0151819 | 3300049581 | Bacteria | 2192 |
| 1357 | Ga0501047_0336033 | 3300049581 | Bacteria | 1349 |
| 1358 | Ga0501047_0475446 | 3300049581 | Bacteria | 1077 |
| 1359 | Ga0501048_0042728 | 3300049582 | Bacteria | 3244 |
| 1360 | Ga0501048_0337176 | 3300049582 | Bacteria | 1075 |
| 1361 | Ga0501048_0355326 | 3300049582 | Bacteria | 1045 |
| 1362 | Ga0501067_0000445 | 3300049583 | Bacteria | 22645 |
| 1363 | Ga0501067_0028070 | 3300049583 | Bacteria | 3118 |
| 1364 | Ga0501067_0031977 | 3300049583 | Bacteria | 2919 |
| 1365 | Ga0501067_0108936 | 3300049583 | Bacteria | 1540 |
| 1366 | Ga0501067_0210294 | 3300049583 | Bacteria | 1083 |
| 1367 | Ga0501068_0004210 | 3300049584 | Bacteria | 7804 |
| 1368 | Ga0501068_0026560 | 3300049584 | Bacteria | 3412 |
| 1369 | Ga0501068_0036616 | 3300049584 | Bacteria | 2935 |
| 1370 | Ga0501068_0039358 | 3300049584 | Bacteria | 2834 |
| 1371 | Ga0501068_0104489 | 3300049584 | Bacteria | 1757 |
| 1372 | Ga0501069_0045261 | 3300049585 | Bacteria | 2438 |
| 1373 | Ga0501069_0139563 | 3300049585 | Bacteria | 1390 |
| 1374 | Ga0501070_0017073 | 3300049586 | Bacteria | 6091 |
| 1375 | Ga0501070_0095692 | 3300049586 | Bacteria | 2457 |
| 1376 | Ga0501070_0098200 | 3300049586 | Bacteria | 2422 |
| 1377 | Ga0501070_0144409 | 3300049586 | Bacteria | 1964 |
| 1378 | Ga0501070_0169638 | 3300049586 | Bacteria | 1798 |
| 1379 | Ga0501070_0238852 | 3300049586 | Bacteria | 1487 |
| 1380 | Ga0501071_0036958 | 3300049587 | Bacteria | 3485 |
| 1381 | Ga0501071_0061557 | 3300049587 | Bacteria | 2719 |
| 1382 | Ga0501071_0326770 | 3300049587 | Bacteria | 1165 |
| 1383 | Ga0501072_0001459 | 3300049588 | Bacteria | 17737 |
| 1384 | Ga0501072_0084143 | 3300049588 | Bacteria | 2522 |
| 1385 | Ga0501072_0328818 | 3300049588 | Bacteria | 1214 |
| 1386 | Ga0501072_0406023 | 3300049588 | Bacteria | 1080 |
| 1387 | Ga0501073_0000055 | 3300049589 | Bacteria | 71726 |
| 1388 | Ga0501073_0044654 | 3300049589 | Bacteria | 3123 |
| 1389 | Ga0501073_0057653 | 3300049589 | Bacteria | 2715 |
| 1390 | Ga0501073_0103031 | 3300049589 | Bacteria | 1981 |
| 1391 | Ga0501073_0112810 | 3300049589 | Bacteria | 1885 |
| 1392 | Ga0501073_0113981 | 3300049589 | Bacteria | 1874 |
| 1393 | Ga0501073_0251674 | 3300049589 | Bacteria | 1219 |
| 1394 | Ga0501074_0000492 | 3300049590 | Bacteria | 24146 |
| 1395 | Ga0501074_0007017 | 3300049590 | Bacteria | 8131 |
| 1396 | Ga0501074_0040558 | 3300049590 | Bacteria | 3371 |
| 1397 | Ga0501074_0072357 | 3300049590 | Bacteria | 2476 |
| 1398 | Ga0501074_0083946 | 3300049590 | Bacteria | 2283 |
| 1399 | Ga0501076_0012137 | 3300049592 | Bacteria | 6441 |
| 1400 | Ga0501076_0128644 | 3300049592 | Bacteria | 2053 |
| 1401 | Ga0501077_0024392 | 3300049593 | Bacteria | 3841 |
| 1402 | Ga0501077_0257873 | 3300049593 | Bacteria | 1109 |
| 1403 | Ga0501077_0294687 | 3300049593 | Bacteria | 1033 |
| 1404 | Ga0501225_0094635 | 3300049705 | Bacteria | 868 |
| 1405 | Ga0501079_0004436 | 3300049741 | Bacteria | 10395 |
| 1406 | Ga0501079_0076206 | 3300049741 | Bacteria | 2594 |
| 1407 | Ga0501080_0008079 | 3300049742 | Bacteria | 9533 |
| 1408 | Ga0501080_0022886 | 3300049742 | Bacteria | 5793 |
| 1409 | Ga0501080_0025902 | 3300049742 | Bacteria | 5449 |
| 1410 | Ga0501080_0060993 | 3300049742 | Bacteria | 3511 |
| 1411 | Ga0501080_0206292 | 3300049742 | Bacteria | 1802 |
| 1412 | Ga0501081_0013430 | 3300049743 | Bacteria | 5386 |
| 1413 | Ga0501081_0241742 | 3300049743 | Bacteria | 1316 |
| 1414 | Ga0501083_0000570 | 3300049744 | Bacteria | 23630 |
| 1415 | Ga0501083_0020711 | 3300049744 | Bacteria | 4572 |
| 1416 | Ga0501083_0089624 | 3300049744 | Bacteria | 2032 |
| 1417 | Ga0501083_0096362 | 3300049744 | Bacteria | 1952 |
| 1418 | Ga0501083_0112660 | 3300049744 | Bacteria | 1788 |
| 1419 | Ga0501083_0114872 | 3300049744 | Bacteria | 1768 |
| 1420 | Ga0501035_0000150 | 3300049822 | Bacteria | 85450 |
| 1421 | Ga0501035_0003778 | 3300049822 | Bacteria | 14432 |
| 1422 | Ga0501035_0022636 | 3300049822 | Bacteria | 5772 |
| 1423 | Ga0501035_0031779 | 3300049822 | Bacteria | 4808 |
| 1424 | Ga0501035_0045739 | 3300049822 | Bacteria | 3937 |
| 1425 | Ga0501035_0155236 | 3300049822 | Bacteria | 1984 |
| 1426 | Ga0501035_0496885 | 3300049822 | Bacteria | 1004 |
| 1427 | Ga0501035_0528287 | 3300049822 | Bacteria | 968 |
| 1428 | Ga0501035_0557433 | 3300049822 | Bacteria | 938 |
| 1429 | Ga0501044_0000546 | 3300049823 | Bacteria | 45906 |
| 1430 | Ga0501044_0006712 | 3300049823 | Bacteria | 12684 |
| 1431 | Ga0501044_0069407 | 3300049823 | Bacteria | 3587 |
| 1432 | Ga0501044_0077407 | 3300049823 | Bacteria | 3373 |
| 1433 | Ga0501044_0080620 | 3300049823 | Bacteria | 3296 |
| 1434 | Ga0501044_0106409 | 3300049823 | Bacteria | 2817 |
| 1435 | Ga0501044_0133952 | 3300049823 | Bacteria | 2470 |
| 1436 | Ga0501044_0179462 | 3300049823 | Bacteria | 2085 |
| 1437 | Ga0501044_0353527 | 3300049823 | Bacteria | 1388 |
| 1438 | Ga0501044_1012477 | 3300049823 | Bacteria | 702 |
| 1439 | Ga0501045_0003323 | 3300049824 | Bacteria | 11000 |
| 1440 | Ga0501045_0004352 | 3300049824 | Bacteria | 9762 |
| 1441 | Ga0501045_0140281 | 3300049824 | Bacteria | 1797 |
| 1442 | nmdc:mga03683_17434_c1 | 3300050489 | Bacteria | 2718 |
| 1443 | nmdc:mga03683_274518_c1 | 3300050489 | Bacteria | 787 |
| 1444 | nmdc:mga03n38_366961_c1 | 3300050490 | Bacteria | 786 |
| 1445 | nmdc:mga03n38_64360_c1 | 3300050490 | Bacteria | 1678 |
| 1446 | nmdc:mga00v17_11235_c1 | 3300050491 | Bacteria | 4918 |
| 1447 | nmdc:mga00v17_117908_c1 | 3300050491 | Bacteria | 1689 |
| 1448 | nmdc:mga00v17_12296_c1 | 3300050491 | Bacteria | 4722 |
| 1449 | nmdc:mga00v17_227117_c1 | 3300050491 | Bacteria | 1209 |
| 1450 | nmdc:mga00v17_261514_c1 | 3300050491 | Bacteria | 1123 |
| 1451 | nmdc:mga00v17_303901_c1 | 3300050491 | Bacteria | 1036 |
| 1452 | nmdc:mga00v17_456401_c1 | 3300050491 | Bacteria | 829 |
| 1453 | nmdc:mga0yw44_120803_c1 | 3300050492 | Bacteria | 1688 |
| 1454 | nmdc:mga0yw44_29347_c1 | 3300050492 | Bacteria | 3175 |
| 1455 | nmdc:mga0yw44_52049_c1 | 3300050492 | Bacteria | 2481 |
| 1456 | nmdc:mga0yw44_65999_c1 | 3300050492 | Bacteria | 2232 |
| 1457 | nmdc:mga0k408_213400_c1 | 3300050493 | Bacteria | 1152 |
| 1458 | nmdc:mga0k408_373167_c1 | 3300050493 | Bacteria | 850 |
| 1459 | nmdc:mga0k408_40371_c1 | 3300050493 | Bacteria | 2685 |
| 1460 | nmdc:mga0k408_90047_c1 | 3300050493 | Bacteria | 1802 |
| 1461 | nmdc:mga06z11_252133_c1 | 3300050494 | Bacteria | 1039 |
| 1462 | nmdc:mga06z11_260036_c1 | 3300050494 | Bacteria | 1024 |
| 1463 | nmdc:mga06z11_5217_c1 | 3300050494 | Bacteria | 5191 |
| 1464 | nmdc:mga06z11_59740_c1 | 3300050494 | Bacteria | 1982 |
| 1465 | nmdc:mga04h51_958_c1 | 3300050495 | Bacteria | 6657 |
| 1466 | nmdc:mga07m45_23113_c1 | 3300050496 | Bacteria | 1229 |
| 1467 | nmdc:mga07m45_342364_c1 | 3300050496 | Bacteria | 869 |
| 1468 | nmdc:mga07m45_395112_c1 | 3300050496 | Bacteria | 803 |
| 1469 | nmdc:mga07m45_401562_c1 | 3300050496 | Bacteria | 795 |
| 1470 | nmdc:mga07m45_8863_c1 | 3300050496 | Bacteria | 5192 |
| 1471 | nmdc:mga05p37_158567_c1 | 3300050507 | Bacteria | 2764 |
| 1472 | nmdc:mga05p37_247255_c1 | 3300050507 | Bacteria | 2141 |
| 1473 | nmdc:mga05p37_282843_c1 | 3300050507 | Bacteria | 1977 |
| 1474 | nmdc:mga0qj67_1096485_c1 | 3300050509 | Bacteria | 622 |
| 1475 | nmdc:mga0qj67_437711_c1 | 3300050509 | Bacteria | 1053 |
| 1476 | nmdc:mga08y16_102759_c1 | 3300050511 | Bacteria | 2976 |
| 1477 | nmdc:mga08y16_1197718_c1 | 3300050511 | Bacteria | 730 |
| 1478 | nmdc:mga08y16_127265_c1 | 3300050511 | Bacteria | 2650 |
| 1479 | nmdc:mga08y16_549433_c1 | 3300050511 | Bacteria | 1169 |
| 1480 | nmdc:mga0n895_109830_c1 | 3300050512 | Bacteria | 2773 |
| 1481 | nmdc:mga0n895_507676_c1 | 3300050512 | Bacteria | 1214 |
| 1482 | nmdc:mga0rr50_1144197_c1 | 3300050513 | Bacteria | 662 |
| 1483 | nmdc:mga0rr50_174772_c1 | 3300050513 | Bacteria | 1752 |
| 1484 | nmdc:mga0a205_175143_c1 | 3300050515 | Bacteria | 2041 |
| 1485 | nmdc:mga0a205_321122_c1 | 3300050515 | Bacteria | 1419 |
| 1486 | nmdc:mga0sz30_12652_c2 | 3300050516 | Bacteria | 2237 |
| 1487 | nmdc:mga0sz30_30335_c1 | 3300050516 | Bacteria | 2234 |
| 1488 | nmdc:mga0sz30_41148_c1 | 3300050516 | Bacteria | 1943 |
| 1489 | nmdc:mga0sz30_43074_c1 | 3300050516 | Bacteria | 1900 |
| 1490 | Ga0495601_0009983 | 3300053077 | Bacteria | 5629 |
| 1491 | Ga0495601_0014707 | 3300053077 | Bacteria | 4720 |
| 1492 | Ga0495601_0064402 | 3300053077 | Bacteria | 2331 |
| 1493 | Ga0495601_0066963 | 3300053077 | Bacteria | 2287 |
| 1494 | Ga0495601_0515666 | 3300053077 | Bacteria | 771 |
| 1495 | Ga0495612_0143985 | 3300053078 | Bacteria | 1035 |
| 1496 | Ga0495612_0146357 | 3300053078 | Bacteria | 1026 |
| 1497 | Ga0495595_0000699 | 3300053084 | Bacteria | 12793 |
| 1498 | Ga0495595_0056996 | 3300053084 | Bacteria | 1822 |
| 1499 | Ga0495619_0003768 | 3300053085 | Bacteria | 9751 |
| 1500 | Ga0495619_0078651 | 3300053085 | Bacteria | 2217 |
| 1501 | Ga0495619_0081836 | 3300053085 | Bacteria | 2175 |
| 1502 | Ga0495619_0292737 | 3300053085 | Bacteria | 1128 |
| 1503 | Ga0495619_0315809 | 3300053085 | Bacteria | 1082 |
| 1504 | Ga0495619_0456719 | 3300053085 | Bacteria | 880 |
| 1505 | Ga0500578_0069357 | 3300053086 | Bacteria | 2247 |
| 1506 | Ga0500643_000278 | 3300053087 | Bacteria | 44354 |
| 1507 | Ga0500643_015999 | 3300053087 | Bacteria | 2557 |
| 1508 | Ga0500643_060511 | 3300053087 | Bacteria | 1064 |
| 1509 | Ga0500644_0095093 | 3300053088 | Bacteria | 1122 |
| 1510 | Ga0500644_0213157 | 3300053088 | Bacteria | 803 |
| 1511 | Ga0500646_0002189 | 3300053090 | Bacteria | 5099 |
| 1512 | Ga0500647_0108652 | 3300053091 | Bacteria | 1320 |
| 1513 | Ga0500651_0013046 | 3300053093 | Bacteria | 5049 |
| 1514 | Ga0500651_0216667 | 3300053093 | Bacteria | 1124 |
| 1515 | Ga0500566_0008990 | 3300053094 | Bacteria | 5910 |
| 1516 | Ga0500566_0018420 | 3300053094 | Bacteria | 4100 |
| 1517 | Ga0500566_0035829 | 3300053094 | Bacteria | 2882 |
| 1518 | Ga0500641_0032473 | 3300053096 | Bacteria | 2065 |
| 1519 | Ga0500641_0048221 | 3300053096 | Bacteria | 1744 |
| 1520 | Ga0500641_0151377 | 3300053096 | Bacteria | 1001 |
| 1521 | Ga0500650_0002801 | 3300053098 | Bacteria | 5874 |
| 1522 | Ga0500650_0086338 | 3300053098 | Bacteria | 1468 |
| 1523 | Ga0500554_001643 | 3300053102 | Bacteria | 4301 |
| 1524 | Ga0500555_002583 | 3300053103 | Bacteria | 5216 |
| 1525 | Ga0500556_0000005 | 3300053104 | Bacteria | 581135 |
| 1526 | Ga0500556_0052067 | 3300053104 | Bacteria | 1484 |
| 1527 | Ga0500557_000028 | 3300053105 | Bacteria | 78414 |
| 1528 | Ga0500562_009620 | 3300053108 | Bacteria | 2442 |
| 1529 | Ga0500562_011585 | 3300053108 | Bacteria | 2238 |
| 1530 | Ga0500569_025365 | 3300053109 | Bacteria | 1613 |
| 1531 | Ga0500572_066187 | 3300053111 | Bacteria | 1108 |
| 1532 | Ga0500572_141266 | 3300053111 | Bacteria | 784 |
| 1533 | Ga0500592_001026 | 3300053116 | Bacteria | 4557 |
| 1534 | Ga0500593_037159 | 3300053117 | Bacteria | 2182 |
| 1535 | Ga0500594_0041106 | 3300053118 | Bacteria | 1265 |
| 1536 | Ga0500595_001799 | 3300053119 | Bacteria | 11118 |
| 1537 | Ga0500595_001904 | 3300053119 | Bacteria | 10754 |
| 1538 | Ga0500595_032232 | 3300053119 | Bacteria | 1751 |
| 1539 | Ga0500595_078444 | 3300053119 | Bacteria | 970 |
| 1540 | Ga0500607_050084 | 3300053121 | Bacteria | 2227 |
| 1541 | Ga0500608_000378 | 3300053122 | Bacteria | 17203 |
| 1542 | Ga0500614_033240 | 3300053123 | Bacteria | 1273 |
| 1543 | Ga0500617_160280 | 3300053124 | Bacteria | 878 |
| 1544 | Ga0500618_007774 | 3300053125 | Bacteria | 3033 |
| 1545 | Ga0500626_186358 | 3300053128 | Bacteria | 831 |
| 1546 | Ga0500642_0000009 | 3300053130 | Bacteria | 286829 |
| 1547 | Ga0500642_0003513 | 3300053130 | Bacteria | 4752 |
| 1548 | Ga0500642_0203807 | 3300053130 | Bacteria | 920 |
| 1549 | Ga0500652_001958 | 3300053131 | Bacteria | 6202 |
| 1550 | Ga0500655_004688 | 3300053133 | Bacteria | 2458 |
| 1551 | Ga0500658_0063524 | 3300053134 | Bacteria | 1541 |
| 1552 | Ga0500658_0175435 | 3300053134 | Bacteria | 974 |
| 1553 | Ga0500559_0000705 | 3300053136 | Bacteria | 21916 |
| 1554 | Ga0500559_0020757 | 3300053136 | Bacteria | 2779 |
| 1555 | Ga0500559_0029661 | 3300053136 | Bacteria | 2344 |
| 1556 | Ga0500564_152355 | 3300053138 | Bacteria | 984 |
| 1557 | Ga0500568_0000477 | 3300053139 | Bacteria | 29630 |
| 1558 | Ga0500568_0091275 | 3300053139 | Bacteria | 1148 |
| 1559 | Ga0500577_0001565 | 3300053142 | Bacteria | 5847 |
| 1560 | Ga0500577_0177658 | 3300053142 | Bacteria | 912 |
| 1561 | Ga0500589_104484 | 3300053147 | Bacteria | 1225 |
| 1562 | Ga0500590_138998 | 3300053148 | Bacteria | 1113 |
| 1563 | Ga0500604_0000396 | 3300053151 | Bacteria | 11969 |
| 1564 | Ga0500616_0000118 | 3300053153 | Bacteria | 143496 |
| 1565 | Ga0500619_053498 | 3300053154 | Bacteria | 1312 |
| 1566 | Ga0500620_001010 | 3300053155 | Bacteria | 4944 |
| 1567 | Ga0500622_0022820 | 3300053156 | Bacteria | 3314 |
| 1568 | Ga0500622_0073129 | 3300053156 | Bacteria | 1729 |
| 1569 | Ga0500624_002509 | 3300053157 | Bacteria | 2481 |
| 1570 | Ga0500627_0001957 | 3300053158 | Bacteria | 5932 |
| 1571 | Ga0500634_0025228 | 3300053161 | Bacteria | 3236 |
| 1572 | Ga0500634_0178097 | 3300053161 | Bacteria | 960 |
| 1573 | Ga0500638_014397 | 3300053162 | Bacteria | 3606 |
| 1574 | Ga0500636_0000246 | 3300053177 | Bacteria | 29834 |
| 1575 | Ga0500636_0002208 | 3300053177 | Bacteria | 10771 |
| 1576 | Ga0500637_0000075 | 3300053178 | Bacteria | 35551 |
| 1577 | Ga0500637_0096449 | 3300053178 | Bacteria | 1714 |
| 1578 | Ga0500637_0098186 | 3300053178 | Bacteria | 1698 |
| 1579 | Ga0500649_035602 | 3300053722 | Bacteria | 2094 |
| 1580 | Ga0500645_003297 | 3300053730 | Bacteria | 6643 |
| 1581 | Ga0500645_040044 | 3300053730 | Bacteria | 1387 |
| 1582 | Ga0500645_094487 | 3300053730 | Bacteria | 846 |
| 1583 | Ga0500609_001977 | 3300053731 | Bacteria | 2957 |
| 1584 | Ga0500601_000529 | 3300053737 | Bacteria | 5720 |
| 1585 | Ga0501084_0001687 | 3300054114 | Bacteria | 17561 |
| 1586 | Ga0501084_0032214 | 3300054114 | Bacteria | 4384 |
| 1587 | Ga0501084_0074672 | 3300054114 | Bacteria | 2839 |
| 1588 | Ga0500661_000415 | 3300055283 | Bacteria | 7860 |
| 1589 | Ga0500661_003836 | 3300055283 | Bacteria | 2824 |
| 1590 | Ga0501082_0004787 | 3300060353 | Bacteria | 11800 |
| 1591 | Ga0501082_0039991 | 3300060353 | Bacteria | 4046 |
| 1592 | Ga0501082_0769537 | 3300060353 | Bacteria | 842 |
| 1593 | Ga0466962_0032496 | 3300061719 | Bacteria | 2499 |
| 1594 | 2507505714 | 2507262055 | Bacteria | 8048963 |
| 1595 | 2508539607 | 2508501009 | Bacteria | 7784016 |
| 1596 | 2508695978 | 2508501042 | Bacteria | 8719808 |
| 1597 | 2509150803 | 2508501128 | Bacteria | 8613869 |
| 1598 | 2511397028 | 2511231028 | Bacteria | 8046582 |
| 1599 | 2513626650 | 2513237092 | Bacteria | 8341956 |
| 1600 | 2513641788 | 2513237094 | Bacteria | 8789602 |
| 1601 | 2513648131 | 2513237095 | Bacteria | 8976980 |
| 1602 | 2513677968 | 2513237098 | Bacteria | 9902361 |
| 1603 | 2513694379 | 2513237101 | Bacteria | 7952346 |
| 1604 | 2513699186 | 2513237102 | Bacteria | 7703324 |
| 1605 | 2513857176 | 2513237137 | Bacteria | 9558895 |
| 1606 | 2513875688 | 2513237139 | Bacteria | 8737671 |
| 1607 | 2513889748 | 2513237141 | Bacteria | 8496279 |
| 1608 | 2514016354 | 2513237161 | Bacteria | 8871253 |
| 1609 | 2515624111 | 2515154112 | Bacteria | 8294334 |
| 1610 | 2517106990 | 2517093001 | Bacteria | 9002274 |
| 1611 | 2524435617 | 2524023205 | Bacteria | 8918781 |
| 1612 | 2524468327 | 2524023210 | Bacteria | 9029266 |
| 1613 | 2528850269 | 2528768022 | Bacteria | 10457665 |
| 1614 | 2603858104 | 2602042107 | Bacteria | 6226103 |
| 1615 | 2617352919 | 2617270735 | Bacteria | 9163226 |
| 1616 | 2617377133 | 2617270741 | Bacteria | 8201522 |
| 1617 | 2644290048 | 2643221651 | Bacteria | 4798932 |
| 1618 | 2723849103 | 2721755755 | Bacteria | 8322773 |
| 1619 | 2745079873 | 2744054633 | Bacteria | 8678936 |
| 1620 | 2793063235 | 2791355196 | Bacteria | 7323613 |
| 1621 | 2793082594 | |||
| 1622 | 2805919364 | 2802429603 | Bacteria | 8777136 |
| 1623 | 2818237153 | 2816332527 | Bacteria | 8933356 |
| 1624 | 2824608849 | 2824600985 | Bacteria | 8488197 |
| 1625 | 2824612773 | 2824609381 | Bacteria | 8672835 |
| 1626 | 2824625066 | 2824617872 | Bacteria | 8814715 |
| 1627 | 2824632517 | 2824626560 | Bacteria | 8813858 |
| 1628 | 2824643110 | 2824635225 | Bacteria | 8785348 |
| 1629 | 2824651431 | 2824644064 | Bacteria | 8743947 |
| 1630 | 2824661208 | 2824653114 | Bacteria | 8493680 |
| 1631 | 2824670687 | 2824661429 | Bacteria | 9877870 |
| 1632 | 2824674741 | 2824671348 | Bacteria | 8369588 |
| 1633 | 2824685441 | 2824679649 | Bacteria | 8248951 |
| 1634 | 2824692617 | 2824687955 | Bacteria | 8360029 |
| 1635 | 2824700944 | 2824696289 | Bacteria | 8335049 |
| 1636 | 2824712225 | 2824704595 | Bacteria | 9667483 |
| 1637 | 2824721485 | 2824714736 | Bacteria | 8717648 |
| 1638 | 2824731361 | 2824723954 | Bacteria | 8758240 |
| 1639 | 2824734111 | 2824732956 | Bacteria | 7810675 |
| 1640 | 2824749172 | 2824746037 | Bacteria | 7911610 |
| 1641 | 2824760651 | 2824753945 | Bacteria | 9787441 |
| 1642 | 2824773045 | 2824763712 | Bacteria | 9792355 |
| 1643 | 2824780138 | 2824773399 | Bacteria | 8360218 |
| 1644 | 2838130238 | 2838122688 | Bacteria | 8803140 |
| 1645 | 2841944319 | 2841941048 | Bacteria | 8688029 |
| 1646 | 2841954504 | 2841949485 | Bacteria | 8680857 |
| 1647 | 2841962931 | 2841957949 | Bacteria | 8652217 |
| 1648 | 2841969096 | 2841966195 | Bacteria | 8673214 |
| 1649 | 2841979870 | 2841974524 | Bacteria | 8931498 |
| 1650 | 2841990949 | 2841983080 | Bacteria | 8395090 |
| 1651 | 2842044026 | 2842038055 | Bacteria | 8002051 |
| 1652 | 2842051985 | 2842045827 | Bacteria | 8006841 |
| 1653 | 2844321675 | 2844315083 | Bacteria | 8138177 |
| 1654 | 2847939666 | 2847930680 | Bacteria | 9342022 |
| 1655 | 2847941615 | 2847939898 | Bacteria | 8606328 |
| 1656 | 2849082540 | 2849076700 | Bacteria | 7039503 |
| 1657 | 2857511442 | 2857509624 | Bacteria | 7472071 |
| 1658 | 2857527491 | 2857524615 | Bacteria | 6615449 |
| 1659 | 2874593166 | 2874590934 | Bacteria | 8299676 |
| 1660 | 2874606965 | 2874604998 | Bacteria | 7834745 |
| 1661 | 2874615582 | 2874612657 | Bacteria | 8252029 |
| 1662 | 2874624295 | 2874620515 | Bacteria | 8290088 |
| 1663 | 2874634064 | 2874628541 | Bacteria | 8630250 |
| 1664 | 2874645501 | 2874645413 | Bacteria | 8214782 |
| 1665 | 2876764530 | 2876761206 | Bacteria | 10111113 |
| 1666 | 2876773206 | 2876771140 | Bacteria | 8287509 |
| 1667 | 2876812509 | 2876808645 | Bacteria | 8824342 |
| 1668 | 2876820513 | 2876818435 | Bacteria | 8274608 |
| 1669 | 2879076848 | 2879074833 | Bacteria | 8279565 |
| 1670 | 2879090531 | 2879083081 | Bacteria | 8587928 |
| 1671 | 2879101868 | 2879099564 | Bacteria | 10442239 |
| 1672 | 2879115037 | 2879110137 | Bacteria | 8907982 |
| 1673 | 2879131035 | 2879127579 | Bacteria | 8294491 |
| 1674 | 2879150242 | 2879142872 | Bacteria | 8267021 |
| 1675 | 2881364961 | 2881364244 | Bacteria | 7710352 |
| 1676 | 2881672282 | 2881665667 | Bacteria | 8175609 |
| 1677 | 2885368135 | 2885366525 | Bacteria | 8326213 |
| 1678 | 2885384643 | 2885383462 | Bacteria | 9473874 |
| 1679 | 2885410934 | 2885409591 | Bacteria | 9235467 |
| 1680 | 2888380138 | 2888378607 | Bacteria | 9652610 |
| 1681 | 2888391152 | 2888388044 | Bacteria | 7304136 |
| 1682 | 2888420900 | 2888419890 | Bacteria | 7857137 |
| 1683 | 2889034940 | 2889033259 | Bacteria | 9099371 |
| 1684 | 2893066984 | 2893066018 | Bacteria | 6158120 |
| 1685 | 2903727750 | 2903727486 | Bacteria | 8281579 |
| 1686 | 2903773452 | 2903768456 | Bacteria | 9749579 |
| 1687 | 2904672366 | 2904666416 | Bacteria | 8226587 |
| 1688 | 2904695701 | 2904690495 | Bacteria | 9412302 |
| 1689 | 2904717945 | 2904711408 | Bacteria | 9771557 |
| 1690 | 2906602764 | 2906602504 | Bacteria | 8295279 |
| 1691 | 2906632430 | 2906626472 | Bacteria | 8826946 |
| 1692 | 2906639940 | 2906635258 | Bacteria | 8601019 |
| 1693 | 2906645070 | 2906643746 | Bacteria | 8722424 |
| 1694 | 2906666546 | 2906660503 | Bacteria | 8595048 |
| 1695 | 2908764211 | 2908756301 | Bacteria | 8864324 |
| 1696 | 2908783048 | 2908775508 | Bacteria | 8092255 |
| 1697 | 2919073341 | 2919073203 | Bacteria | 6531949 |
| 1698 | 2922364630 | 2922361189 | Bacteria | 7436256 |
| 1699 | 2922378491 | |||
| 1700 | 2922391896 | 2922386360 | Bacteria | 7017218 |
| 1701 | 2922400918 | 2922393267 | Bacteria | 8285685 |
| 1702 | 2929622421 | 2929615660 | Bacteria | 9193770 |
| 1703 | 2929631362 | 2929624759 | Bacteria | 9339455 |
| 1704 | 2932786221 | 2932784394 | Bacteria | 9704911 |
| 1705 | 2932794819 | 2932794094 | Bacteria | 7915132 |
| 1706 | 2932805389 | 2932801729 | Bacteria | 7987968 |
| 1707 | 2932812705 | 2932809354 | Bacteria | 9135765 |
| 1708 | 2932823067 | 2932818245 | Bacteria | 9955613 |
| 1709 | 2932829459 | 2932828146 | Bacteria | 9745859 |
| 1710 | 2933584499 | 2933577622 | Bacteria | 9116884 |
| 1711 | 2935614768 | 2935608549 | Bacteria | 8203142 |
| 1712 | 2935617891 | 2935616580 | Bacteria | 9032984 |
| 1713 | 2935632734 | 2935630451 | Bacteria | 8169952 |
| 1714 | 2935641625 | 2935638405 | Bacteria | 10015038 |
| 1715 | 2935649161 | 2935648319 | Bacteria | 8801166 |
| 1716 | 2935658067 | 2935656913 | Bacteria | 8965014 |
| 1717 | 2935669317 | 2935665750 | Bacteria | 9571747 |
| 1718 | 2935678087 | 2935675223 | Bacteria | 9928132 |
| 1719 | 2935693594 | 2935684952 | Bacteria | 9590419 |
| 1720 | 2935702914 | 2935694250 | Bacteria | 9291695 |
| 1721 | 2935707140 | 2935703347 | Bacteria | 10242284 |
| 1722 | 2935716958 | 2935713505 | Bacteria | 9608509 |
| 1723 | 2935730208 | 2935722832 | Bacteria | 9608746 |
| 1724 | 2935738397 | 2935732158 | Bacteria | 9706831 |
| 1725 | 2935750185 | 2935741537 | Bacteria | 9707219 |
| 1726 | 2935759779 | 2935750917 | Bacteria | 9590372 |
| 1727 | 2935764570 | 2935760218 | Bacteria | 9817913 |
| 1728 | 2935777099 | 2935769743 | Bacteria | 7878163 |
| 1729 | 2935777973 | 2935777560 | Bacteria | 8077691 |
| 1730 | 2935787177 | 2935785616 | Bacteria | 7962367 |
| 1731 | 2935796035 | 2935793552 | Bacteria | 8012592 |
| 1732 | 2935804479 | 2935801545 | Bacteria | 9301974 |
| 1733 | 2935819120 | 2935810662 | Bacteria | 9401221 |
| 1734 | 2935826192 | 2935819856 | Bacteria | 8261050 |
| 1735 | 2935831356 | 2935827899 | Bacteria | 10038562 |
| 1736 | 2935841965 | 2935837841 | Bacteria | 9454360 |
| 1737 | 2935853688 | 2935847175 | Bacteria | 8228321 |
| 1738 | 2935856610 | 2935855204 | Bacteria | 9035059 |
| 1739 | 2935870225 | 2935864058 | Bacteria | 9784707 |
| 1740 | 2935874450 | 2935873716 | Bacteria | 9632195 |
| 1741 | 2935887529 | 2935883170 | Bacteria | 7964738 |
| 1742 | 2935910910 | 2935908558 | Bacteria | 8568796 |
| 1743 | 2935922092 | 2935916978 | Bacteria | 9113783 |
| 1744 | 2935929771 | 2935926038 | Bacteria | 8601059 |
| 1745 | 2935937439 | 2935934488 | Bacteria | 8602579 |
| 1746 | 2935948162 | 2935942939 | Bacteria | 8599779 |
| 1747 | 2935957617 | 2935951376 | Bacteria | 8602333 |
| 1748 | 2935964271 | 2935959822 | Bacteria | 7869783 |
| 1749 | 2935971104 | 2935967501 | Bacteria | 8603075 |
| 1750 | 2935982303 | 2935975950 | Bacteria | 8347125 |
| 1751 | 2935985445 | 2935984226 | Bacteria | 8302647 |
| 1752 | 2935993911 | 2935992306 | Bacteria | 9802711 |
| 1753 | 2936005078 | 2936002035 | Bacteria | 9362176 |
| 1754 | 2936012286 | 2936011229 | Bacteria | 8801034 |
| 1755 | 2936020633 | 2936019824 | Bacteria | 8804134 |
| 1756 | 2936029579 | 2936028420 | Bacteria | 8965941 |
| 1757 | 2936045729 | 2936037263 | Bacteria | 9446081 |
| 1758 | 2936051956 | 2936046547 | Bacteria | 8903709 |
| 1759 | 2936056787 | 2936055302 | Bacteria | 8785755 |
| 1760 | 2940565767 | 2940556831 | Bacteria | 9590747 |
| 1761 | 2941508602 | 2941507105 | Bacteria | 8166816 |
| 1762 | 2941516432 | 2941515067 | Bacteria | 8166720 |
| 1763 | 2941524552 | 2941523033 | Bacteria | 8169134 |
| 1764 | 2941532236 | 2941531003 | Bacteria | 7653939 |
| 1765 | 2941547016 | 2941538514 | Bacteria | 9402094 |
| 1766 | 3005490535 | 3005483717 | Bacteria | 7877331 |
| 1767 | 3005509679 | 3005506211 | Bacteria | 6943378 |
| 1768 | 3005588908 | 3005587118 | Bacteria | 7794411 |
| 1769 | 3005602052 | 3005594810 | Bacteria | 8716512 |
| 1770 | 3005717784 | 3005710791 | Bacteria | 7622528 |
| 1771 | 3005724834 | 3005718088 | Bacteria | 8283608 |
| 1772 | 8006932430 | 8006926726 | Bacteria | 6749210 |
| 1773 | 8006971290 | 8006964411 | Bacteria | 8966052 |
| 1774 | 8006988582 | 8006984368 | Bacteria | 9651211 |
| 1775 | 8006995213 | 8006994254 | Bacteria | 8309700 |
| 1776 | 8016518776 | 8016511872 | Bacteria | 9921665 |
| 1777 | 8016526726 | 8016522445 | Bacteria | 8156687 |
| 1778 | 8016531813 | 8016530956 | Bacteria | 8155261 |
| 1779 | 8016545018 | 8016539877 | Bacteria | 8155419 |
| 1780 | 8016557059 | 8016548790 | Bacteria | 8155074 |
| 1781 | 8016565409 | 8016557553 | Bacteria | 8154380 |
| 1782 | 8016570093 | 8016566248 | Bacteria | 8158151 |
| 1783 | 8016582663 | 8016575299 | Bacteria | 8154085 |
| 1784 | 8016585664 | 8016583857 | Bacteria | 10421953 |
| 1785 | 8016603046 | 8016595262 | Bacteria | 8149947 |
| 1786 | 8016605947 | 8016603502 | Bacteria | 8731218 |
| 1787 | 8016617833 | 8016613128 | Bacteria | 8794220 |
| 1788 | 8016623741 | 8016622563 | Bacteria | 7999408 |
| 1789 | 8016635128 | 8016630954 | Bacteria | 9217207 |
| 1790 | 8017057903 | 8017057580 | Bacteria | 10023680 |
| 1791 | 8019531639 | 8019530166 | Bacteria | 8155624 |
| 1792 | 8019539896 | 8019538911 | Bacteria | 7872763 |
| 1793 | 8019550761 | 8019547302 | Bacteria | 7996444 |
| 1794 | 8019577821 | 8019576017 | Bacteria | 10049540 |
| 1795 | 8019605832 | 8019597564 | Bacteria | 10041141 |
| 1796 | 8019612701 | 8019608314 | Bacteria | 10042931 |
| 1797 | 8019623466 | 8019619141 | Bacteria | 9218857 |
| 1798 | 8019638677 | 8019629233 | Bacteria | 8687553 |
| 1799 | 8019641062 | 8019638758 | Bacteria | 9062356 |
| 1800 | 8019651922 | 8019648815 | Bacteria | 10014479 |
| 1801 | 8019676136 | 8019668869 | Bacteria | 8791617 |
| 1802 | 8019679847 | 8019678201 | Bacteria | 8863603 |
| 1803 | 8019695691 | 8019687851 | Bacteria | 8712826 |
| 1804 | 8055750872 | 8055742211 | Bacteria | 9226248 |
| 1805 | 8056679296 | 8056673599 | Bacteria | 7871253 |
| 1806 | 8056681387 | 8056681323 | Bacteria | 8472857 |
| 1807 | 8056694697 | 8056689827 | Bacteria | 6712655 |
| 1808 | 8056975555 | 8056967851 | Bacteria | 9038162 |
| 1809 | Ga0496115_0672631 | |||
| 1810 | 2214911863 | |||
| 1811 | ARcpr5oldR_c000133 | |||
| 1812 | ARSoilYngRDRAFT_c00291 | |||
| 1813 | ARcpr5yngRDRAFT_c000655 | |||
| 1814 | ARSoilOldRDRAFT_c000255 | |||
| 1815 | ARCol0oldRDRAFT_c00602 | |||
| 1816 | ARCol0yngRDRAFT_1000207 | |||
| 1817 | JGI24746J21847_1002330 | |||
| 1818 | JGI24747J21853_1001618 | |||
| 1819 | JGI24740J21852_10008161 | |||
| 1820 | JGI24739J22299_10002133 | |||
| 1821 | JGI24739J22299_10014522 | |||
| 1822 | JGI24737J22298_10006524 | |||
| 1823 | JGI24735J21928_10015500 | |||
| 1824 | JGI24750J21931_1000306 | |||
| 1825 | JGI24738J21930_10016858 | |||
| 1826 | JGI24738J21930_10035803 | |||
| 1827 | JGI24738J21930_10036983 | |||
| 1828 | JGI24749J21850_1006556 | |||
| 1829 | JGI24034J26672_10000938 | |||
| 1830 | JGI24742J22300_10002042 | |||
| 1831 | JGI25406J46586_10031728 | |||
| 1832 | JGI25153J46596_10001604 | |||
| 1833 | JGI25153J46596_10002291 | |||
| 1834 | JGI25153J46596_10007925 | |||
| 1835 | JGI25153J46596_10008998 | |||
| 1836 | JGI25160J50197_1005286 | |||
| 1837 | JGI25160J50197_1014867 | |||
| 1838 | JGI25404J52841_10010453 | |||
| 1839 | JGI25404J52841_10021243 | |||
| 1840 | Ga0055542_1008419 | |||
| 1841 | Ga0055529_1005529 | |||
| 1842 | Ga0055524_1045134 | |||
| 1843 | Ga0055531_10005524 | |||
| 1844 | Ga0055531_10007473 | |||
| 1845 | Ga0055543_1002707 | |||
| 1846 | Ga0065165_1005568 | |||
| 1847 | Ga0065165_1005760 | |||
| 1848 | Ga0065717_1005363 | |||
| 1849 | Ga0065716_1001632 | |||
| 1850 | Ga0065704_10006824 | |||
| 1851 | Ga0065712_10089599 | |||
| 1852 | Ga0065715_10008670 | |||
| 1853 | Ga0070658_10015577 | |||
| 1854 | Ga0070658_10036212 | |||
| 1855 | Ga0070676_10015450 | |||
| 1856 | Ga0070676_10052710 | |||
| 1857 | Ga0070676_10089122 | |||
| 1858 | Ga0070683_100014076 | |||
| 1859 | Ga0070683_100048868 | |||
| 1860 | Ga0070690_100009976 | |||
| 1861 | Ga0070690_100027758 | |||
| 1862 | Ga0070690_100066780 | |||
| 1863 | Ga0070690_100111027 | |||
| 1864 | Ga0070670_100415516 | |||
| 1865 | Ga0070670_100924178 | |||
| 1866 | Ga0070677_10197425 | |||
| 1867 | Ga0068869_100005362 | |||
| 1868 | Ga0068869_100317735 | |||
| 1869 | Ga0070666_10089682 | |||
| 1870 | Ga0070680_100090465 | |||
| 1871 | Ga0070680_100152353 | |||
| 1872 | Ga0070680_100848572 | |||
| 1873 | Ga0070682_100697350 | |||
| 1874 | Ga0068868_100035101 | |||
| 1875 | Ga0068868_100298087 | |||
| 1876 | Ga0068868_100562192 | |||
| 1877 | Ga0068868_100882916 | |||
| 1878 | Ga0070660_100040041 | |||
| 1879 | Ga0070660_100167888 | |||
| 1880 | Ga0070660_100416169 | |||
| 1881 | Ga0070689_100040860 | |||
| 1882 | Ga0070689_100131274 | |||
| 1883 | Ga0070691_10087613 | |||
| 1884 | Ga0070687_100054857 | |||
| 1885 | Ga0070687_100357555 | |||
| 1886 | Ga0070661_100088583 | |||
| 1887 | Ga0070661_100280880 | |||
| 1888 | Ga0070661_100347137 | |||
| 1889 | Ga0070692_10068790 | |||
| 1890 | Ga0070692_10104648 | |||
| 1891 | Ga0070668_100103090 | |||
| 1892 | Ga0070668_100184183 | |||
| 1893 | Ga0070668_100219502 | |||
| 1894 | Ga0070668_100237557 | |||
| 1895 | Ga0070668_100408606 | |||
| 1896 | Ga0070668_100946368 | |||
| 1897 | Ga0070669_100009523 | |||
| 1898 | Ga0070669_100113283 | |||
| 1899 | Ga0070669_100280062 | |||
| 1900 | Ga0070675_100034164 | |||
| 1901 | Ga0070675_100785894 | |||
| 1902 | Ga0070671_100018470 | |||
| 1903 | Ga0070671_100055481 | |||
| 1904 | Ga0070671_100116779 | |||
| 1905 | Ga0070671_100131073 | |||
| 1906 | Ga0070671_100348255 | |||
| 1907 | Ga0070671_101013859 | |||
| 1908 | Ga0070674_100931401 | |||
| 1909 | Ga0070673_100006016 | |||
| 1910 | Ga0070673_100018157 | |||
| 1911 | Ga0070688_100054184 | |||
| 1912 | Ga0070688_100090194 | |||
| 1913 | Ga0070688_100221599 | |||
| 1914 | Ga0070688_100435879 | |||
| 1915 | Ga0070688_100677469 | |||
| 1916 | Ga0070659_100099578 | |||
| 1917 | Ga0070659_100101942 | |||
| 1918 | Ga0070659_100207172 | |||
| 1919 | Ga0070659_100397832 | |||
| 1920 | Ga0070667_100039791 | |||
| 1921 | Ga0070667_100107058 | |||
| 1922 | Ga0070667_100163512 | |||
| 1923 | Ga0070667_100221243 | |||
| 1924 | Ga0070667_100913355 | |||
| 1925 | Ga0070709_10008600 | |||
| 1926 | Ga0070709_10428499 | |||
| 1927 | Ga0070709_10513607 | |||
| 1928 | Ga0070714_100134185 | |||
| 1929 | Ga0070714_100227095 | |||
| 1930 | Ga0070714_100276899 | |||
| 1931 | Ga0070713_100052651 | |||
| 1932 | Ga0070713_100072884 | |||
| 1933 | Ga0070713_100089043 | |||
| 1934 | Ga0070713_100409266 | |||
| 1935 | Ga0070710_10092909 | |||
| 1936 | Ga0070710_10185989 | |||
| 1937 | Ga0070701_10121852 | |||
| 1938 | Ga0070701_10170190 | |||
| 1939 | Ga0070711_100087269 | |||
| 1940 | Ga0070711_100769677 | |||
| 1941 | Ga0070705_100019679 | |||
| 1942 | Ga0070705_100165611 | |||
| 1943 | Ga0070705_100918351 | |||
| 1944 | Ga0070700_100674932 | |||
| 1945 | Ga0070708_100544521 | |||
| 1946 | Ga0070663_100002910 | |||
| 1947 | Ga0070663_100049267 | |||
| 1948 | Ga0070663_100051460 | |||
| 1949 | Ga0070663_100064014 | |||
| 1950 | Ga0070663_100146590 | |||
| 1951 | Ga0070663_100239861 | |||
| 1952 | Ga0070663_100449802 | |||
| 1953 | Ga0070663_100511551 | |||
| 1954 | Ga0070678_100029230 | |||
| 1955 | Ga0070678_100123916 | |||
| 1956 | Ga0070678_100272630 | |||
| 1957 | Ga0070678_100281527 | |||
| 1958 | Ga0070678_100294563 | |||
| 1959 | Ga0070662_100594283 | |||
| 1960 | Ga0070681_10040915 | |||
| 1961 | Ga0068867_100024117 | |||
| 1962 | Ga0068867_100266579 | |||
| 1963 | Ga0070685_10007220 | |||
| 1964 | Ga0070685_10377599 | |||
| 1965 | Ga0070685_10528455 | |||
| 1966 | Ga0070685_10658080 | |||
| 1967 | Ga0070698_100900917 | |||
| 1968 | Ga0070699_100387440 | |||
| 1969 | Ga0070679_100045216 | |||
| 1970 | Ga0070679_100870406 | |||
| 1971 | Ga0070684_100041708 | |||
| 1972 | Ga0070684_100056864 | |||
| 1973 | Ga0070684_100427083 | |||
| 1974 | Ga0070684_100834814 | |||
| 1975 | Ga0070684_100913162 | |||
| 1976 | Ga0068853_100029132 | |||
| 1977 | Ga0068853_100037194 | |||
| 1978 | Ga0068853_100154051 | |||
| 1979 | Ga0068853_100176657 | |||
| 1980 | Ga0068853_100178589 | |||
| 1981 | Ga0068853_100216523 | |||
| 1982 | Ga0068853_100286910 | |||
| 1983 | Ga0070672_100074275 | |||
| 1984 | Ga0070672_101216951 | |||
| 1985 | Ga0070686_100138899 | |||
| 1986 | Ga0070686_100140554 | |||
| 1987 | Ga0070695_100007606 | |||
| 1988 | Ga0070695_100143920 | |||
| 1989 | Ga0070696_100764698 | |||
| 1990 | Ga0070693_100068169 | |||
| 1991 | Ga0070693_100150542 | |||
| 1992 | Ga0070693_100157753 | |||
| 1993 | Ga0070693_100454721 | |||
| 1994 | Ga0070665_100028785 | |||
| 1995 | Ga0070665_100029858 | |||
| 1996 | Ga0070665_100116177 | |||
| 1997 | Ga0070665_100119192 | |||
| 1998 | Ga0070665_100218932 | |||
| 1999 | Ga0070665_100329012 | |||
| 2000 | Ga0070665_100427495 | |||
| 2001 | Ga0070665_100432315 | |||
| 2002 | Ga0070665_100501426 | |||
| 2003 | Ga0070704_100050220 | |||
| 2004 | Ga0070704_100306814 | |||
| 2005 | Ga0070704_100328155 | |||
| 2006 | Ga0068855_100043022 | |||
| 2007 | Ga0068855_100076846 | |||
| 2008 | Ga0068855_100082873 | |||
| 2009 | Ga0068855_100180572 | |||
| 2010 | Ga0068855_100745078 | |||
| 2011 | Ga0070664_100190239 | |||
| 2012 | Ga0070664_100231718 | |||
| 2013 | Ga0070664_100353167 | |||
| 2014 | Ga0070664_100934811 | |||
| 2015 | Ga0068857_100003131 | |||
| 2016 | Ga0068857_100016900 | |||
| 2017 | Ga0068857_100048283 | |||
| 2018 | Ga0068857_100111718 | |||
| 2019 | Ga0068857_100633257 | |||
| 2020 | Ga0068854_100009446 | |||
| 2021 | Ga0068854_100025141 | |||
| 2022 | Ga0068854_100110432 | |||
| 2023 | Ga0068854_100211228 | |||
| 2024 | Ga0068856_100048827 | |||
| 2025 | Ga0068856_100052613 | |||
| 2026 | Ga0068856_100085326 | |||
| 2027 | Ga0068856_100174867 | |||
| 2028 | Ga0068856_100175839 | |||
| 2029 | Ga0068856_100559691 | |||
| 2030 | Ga0068856_100909849 | |||
| 2031 | Ga0068856_101037630 | |||
| 2032 | Ga0070702_100033101 | |||
| 2033 | Ga0068852_100050524 | |||
| 2034 | Ga0068852_100207146 | |||
| 2035 | Ga0068852_100223772 | |||
| 2036 | Ga0068852_100317394 | |||
| 2037 | Ga0068852_100426684 | |||
| 2038 | Ga0068852_100469452 | |||
| 2039 | Ga0068852_100614239 | |||
| 2040 | Ga0068859_100013930 | |||
| 2041 | Ga0068859_100087512 | |||
| 2042 | Ga0068859_100408141 | |||
| 2043 | Ga0068864_100000501 | |||
| 2044 | Ga0068864_100059311 | |||
| 2045 | Ga0068864_100107715 | |||
| 2046 | Ga0068864_100140430 | |||
| 2047 | Ga0068864_100594319 | |||
| 2048 | Ga0068864_101241109 | |||
| 2049 | Ga0068866_10009096 | |||
| 2050 | Ga0068866_10081275 | |||
| 2051 | Ga0068866_10498061 | |||
| 2052 | Ga0068861_100108219 | |||
| 2053 | Ga0068861_100137095 | |||
| 2054 | Ga0068861_100172566 | |||
| 2055 | Ga0068851_10001649 | |||
| 2056 | Ga0068851_10048827 | |||
| 2057 | Ga0068870_10017790 | |||
| 2058 | Ga0068870_10789204 | |||
| 2059 | Ga0068863_100001487 | |||
| 2060 | Ga0068863_100114649 | |||
| 2061 | Ga0068863_100641427 | |||
| 2062 | Ga0068863_100880978 | |||
| 2063 | Ga0068863_101239055 | |||
| 2064 | Ga0068858_100008725 | |||
| 2065 | Ga0068858_100160649 | |||
| 2066 | Ga0068858_100205803 | |||
| 2067 | Ga0068858_100362857 | |||
| 2068 | Ga0068858_100568185 | |||
| 2069 | Ga0068858_100635724 | |||
| 2070 | Ga0068860_100087752 | |||
| 2071 | Ga0068860_100196348 | |||
| 2072 | Ga0068860_100495997 | |||
| 2073 | Ga0068860_100971666 | |||
| 2074 | Ga0068860_101021522 | |||
| 2075 | Ga0068862_100130981 | |||
| 2076 | Ga0068862_100194451 | |||
| 2077 | Ga0081455_10013105 | |||
| 2078 | Ga0081455_10028472 | |||
| 2079 | Ga0081455_10058469 | |||
| 2080 | Ga0081455_10062151 | |||
| 2081 | Ga0081455_10134396 | |||
| 2082 | Ga0081455_10448569 | |||
| 2083 | Ga0081538_10001497 | |||
| 2084 | Ga0081538_10024144 | |||
| 2085 | Ga0081540_1001924 | |||
| 2086 | Ga0081540_1003483 | |||
| 2087 | Ga0081540_1003507 | |||
| 2088 | Ga0081540_1003700 | |||
| 2089 | Ga0081540_1005593 | |||
| 2090 | Ga0081540_1015557 | |||
| 2091 | Ga0081540_1020696 | |||
| 2092 | Ga0081540_1021821 | |||
| 2093 | Ga0081540_1028835 | |||
| 2094 | Ga0081540_1031643 | |||
| 2095 | Ga0081540_1120057 | |||
| 2096 | Ga0081539_10000902 | |||
| 2097 | Ga0081539_10027917 | |||
| 2098 | Ga0081539_10057458 | |||
| 2099 | Ga0081539_10064732 | |||
| 2100 | Ga0070717_10002469 | |||
| 2101 | Ga0070717_10009912 | |||
| 2102 | Ga0075365_10063057 | |||
| 2103 | Ga0075365_10086275 | |||
| 2104 | Ga0075365_10169763 | |||
| 2105 | Ga0075365_10307594 | |||
| 2106 | Ga0075365_10356903 | |||
| 2107 | Ga0075368_10001108 | |||
| 2108 | Ga0075368_10002847 | |||
| 2109 | Ga0075368_10054261 | |||
| 2110 | Ga0075368_10090766 | |||
| 2111 | Ga0075368_10175460 | |||
| 2112 | Ga0075363_100000927 | |||
| 2113 | Ga0075363_100060388 | |||
| 2114 | Ga0075363_100061555 | |||
| 2115 | Ga0075363_100190898 | |||
| 2116 | Ga0075364_10008079 | |||
| 2117 | Ga0075364_10050941 | |||
| 2118 | Ga0075364_10292635 | |||
| 2119 | Ga0070715_10062008 | |||
| 2120 | Ga0070712_100172423 | |||
| 2121 | Ga0075362_10061018 | |||
| 2122 | Ga0075362_10102719 | |||
| 2123 | Ga0075362_10186107 | |||
| 2124 | Ga0075367_10004564 | |||
| 2125 | Ga0075367_10009741 | |||
| 2126 | Ga0075367_10036765 | |||
| 2127 | Ga0075367_10153038 | |||
| 2128 | Ga0075367_10187760 | |||
| 2129 | Ga0075367_10195404 | |||
| 2130 | Ga0075367_10196260 | |||
| 2131 | Ga0075369_10073524 | |||
| 2132 | Ga0075369_10097144 | |||
| 2133 | Ga0075369_10107742 | |||
| 2134 | Ga0075369_10147979 | |||
| 2135 | Ga0075366_10046923 | |||
| 2136 | Ga0075366_10050585 | |||
| 2137 | Ga0075366_10319496 | |||
| 2138 | Ga0097621_100022827 | |||
| 2139 | Ga0097621_100515650 | |||
| 2140 | Ga0097621_100655409 | |||
| 2141 | Ga0097621_101068740 | |||
| 2142 | Ga0075370_10017300 | |||
| 2143 | Ga0075370_10041149 | |||
| 2144 | Ga0075370_10181981 | |||
| 2145 | Ga0075370_10274611 | |||
| 2146 | Ga0075370_10422841 | |||
| 2147 | Ga0068871_100099573 | |||
| 2148 | Ga0068871_100481333 | |||
| 2149 | Ga0075428_100097833 | |||
| 2150 | Ga0075431_100092449 | |||
| 2151 | Ga0075431_100186659 | |||
| 2152 | Ga0075433_10269939 | |||
| 2153 | Ga0068865_100044064 | |||
| 2154 | Ga0068865_100110189 | |||
| 2155 | Ga0068865_100628337 | |||
| 2156 | Ga0075436_100143930 | |||
| 2157 | Ga0097620_100013930 | |||
| 2158 | Ga0097620_100087516 | |||
| 2159 | Ga0097620_100408153 | |||
| 2160 | Ga0099825_1032185 | |||
| 2161 | Ga0099824_1009990 | |||
| 2162 | Ga0075435_100134829 | |||
| 2163 | Ga0075435_100179331 | |||
| 2164 | Ga0099795_10117307 | |||
| 2165 | Ga0105251_10093367 | |||
| 2166 | Ga0105244_10020920 | |||
| 2167 | Ga0105250_10026210 | |||
| 2168 | Ga0105240_10002869 | |||
| 2169 | Ga0105240_10005590 | |||
| 2170 | Ga0105240_10175899 | |||
| 2171 | Ga0105240_10203680 | |||
| 2172 | Ga0105240_10208525 | |||
| 2173 | Ga0105240_10481297 | |||
| 2174 | Ga0105240_11110202 | |||
| 2175 | Ga0111539_10004905 | |||
| 2176 | Ga0111539_10094534 | |||
| 2177 | Ga0111539_10530111 | |||
| 2178 | Ga0111539_11271021 | |||
| 2179 | Ga0105245_10013591 | |||
| 2180 | Ga0105245_10188048 | |||
| 2181 | Ga0105245_10270594 | |||
| 2182 | Ga0105245_10372016 | |||
| 2183 | Ga0105247_10033384 | |||
| 2184 | Ga0105247_10246097 | |||
| 2185 | Ga0105247_10782551 | |||
| 2186 | Ga0114129_10128894 | |||
| 2187 | Ga0114129_10154066 | |||
| 2188 | Ga0114129_10234985 | |||
| 2189 | Ga0105243_10027119 | |||
| 2190 | Ga0105243_10259638 | |||
| 2191 | Ga0105243_10390440 | |||
| 2192 | Ga0105243_10552937 | |||
| 2193 | Ga0105241_10012442 | |||
| 2194 | Ga0105241_10031939 | |||
| 2195 | Ga0105241_10036477 | |||
| 2196 | Ga0105241_10051683 | |||
| 2197 | Ga0105241_10327541 | |||
| 2198 | Ga0105241_10478148 | |||
| 2199 | Ga0105241_10524537 | |||
| 2200 | Ga0105242_10036698 | |||
| 2201 | Ga0105248_10070776 | |||
| 2202 | Ga0105248_10100059 | |||
| 2203 | Ga0105248_10354898 | |||
| 2204 | Ga0105248_10398030 | |||
| 2205 | Ga0105237_10053520 | |||
| 2206 | Ga0105237_10141670 | |||
| 2207 | Ga0105237_10604311 | |||
| 2208 | Ga0105238_10003573 | |||
| 2209 | Ga0105238_10051142 | |||
| 2210 | Ga0105238_10202973 | |||
| 2211 | Ga0105238_10236890 | |||
| 2212 | Ga0105238_10294543 | |||
| 2213 | Ga0105238_10344350 | |||
| 2214 | Ga0105238_10745575 | |||
| 2215 | Ga0105238_11302977 | |||
| 2216 | Ga0105249_10137615 | |||
| 2217 | Ga0099796_10059076 | |||
| 2218 | Ga0099796_10088345 | |||
| 2219 | Ga0099796_10093277 | |||
| 2220 | Ga0105239_10077327 | |||
| 2221 | Ga0105239_10078453 | |||
| 2222 | Ga0105239_10155502 | |||
| 2223 | Ga0105239_10175241 | |||
| 2224 | Ga0105239_10193691 | |||
| 2225 | Ga0105239_10687272 | |||
| 2226 | Ga0105239_10729634 | |||
| 2227 | Ga0105239_10938440 | |||
| 2228 | Ga0105239_11262763 | |||
| 2229 | Ga0105246_10037876 | |||
| 2230 | Ga0105246_10041752 | |||
| 2231 | Ga0105246_10054890 | |||
| 2232 | Ga0105246_10148416 | |||
| 2233 | Ga0157335_1000327 | |||
| 2234 | Ga0157342_1001487 | |||
| 2235 | Ga0157373_10872817 | |||
| 2236 | Ga0157371_10043766 | |||
| 2237 | Ga0157371_10060376 | |||
| 2238 | Ga0157371_10520451 | |||
| 2239 | Ga0157370_10066426 | |||
| 2240 | Ga0157370_10329548 | |||
| 2241 | Ga0157370_11203856 | |||
| 2242 | Ga0157369_11544308 | |||
| 2243 | Ga0157374_10008247 | |||
| 2244 | Ga0157374_10046569 | |||
| 2245 | Ga0157374_10071735 | |||
| 2246 | Ga0157374_10136090 | |||
| 2247 | Ga0157378_10087734 | |||
| 2248 | Ga0157378_11532830 | |||
| 2249 | Ga0157378_12031012 | |||
| 2250 | Ga0163162_10025808 | |||
| 2251 | Ga0163162_10064631 | |||
| 2252 | Ga0163162_10660475 | |||
| 2253 | Ga0163162_10672659 | |||
| 2254 | Ga0163162_10802306 | |||
| 2255 | Ga0163162_11146949 | |||
| 2256 | Ga0157372_10052804 | |||
| 2257 | Ga0157372_10799747 | |||
| 2258 | Ga0157375_10003919 | |||
| 2259 | Ga0157375_10122365 | |||
| 2260 | Ga0157375_10533056 | |||
| 2261 | Ga0157375_10687289 | |||
| 2262 | Ga0157375_11223191 | |||
| 2263 | Ga0163163_10001518 | |||
| 2264 | Ga0163163_10006923 | |||
| 2265 | Ga0163163_10019540 | |||
| 2266 | Ga0163163_10174446 | |||
| 2267 | Ga0163163_10322527 | |||
| 2268 | Ga0163163_11327748 | |||
| 2269 | Ga0157380_10393451 | |||
| 2270 | Ga0157380_10453269 | |||
| 2271 | Ga0182008_10418122 | |||
| 2272 | Ga0157377_10047910 | |||
| 2273 | Ga0157377_10279935 | |||
| 2274 | Ga0157377_10302362 | |||
| 2275 | Ga0157379_10047563 | |||
| 2276 | Ga0157379_10162444 | |||
| 2277 | Ga0157379_10504128 | |||
| 2278 | Ga0157376_10034361 | |||
| 2279 | Ga0157376_10312044 | |||
| 2280 | Ga0157376_10813144 | |||
| 2281 | Ga0163161_10035313 | |||
| 2282 | Ga0206350_10496500 | |||
| 2283 | Ga0214544_1000007 | |||
| 2284 | Ga0214542_1000007 | |||
| 2285 | Ga0214545_1000006 | |||
| 2286 | Ga0214543_1000009 | |||
| 2287 | Ga0213872_10024035 | |||
| 2288 | Ga0213872_10130788 | |||
| 2289 | Ga0213874_10060029 | |||
| 2290 | Ga0213876_10266907 | |||
| 2291 | Ga0213875_10033755 | |||
| 2292 | Ga0213871_10000146 | |||
| 2293 | Ga0209563_101691 | |||
| 2294 | Ga0209677_101315 | |||
| 2295 | Ga0209148_1000645 | |||
| 2296 | Ga0209233_1001380 | |||
| 2297 | Ga0209233_1003243 | |||
| 2298 | Ga0209233_1037669 | |||
| 2299 | Ga0209455_1002521 | |||
| 2300 | Ga0207673_1001791 | |||
| 2301 | Ga0209564_1000384 | |||
| 2302 | Ga0209564_1009905 | |||
| 2303 | Ga0209758_1000015 | |||
| 2304 | Ga0209758_1000389 | |||
| 2305 | Ga0209758_1000716 | |||
| 2306 | Ga0209758_1001056 | |||
| 2307 | Ga0209758_1003447 | |||
| 2308 | Ga0209758_1010182 | |||
| 2309 | Ga0209758_1029178 | |||
| 2310 | Ga0209256_1008939 | |||
| 2311 | Ga0209256_1018664 | |||
| 2312 | Ga0209256_1059422 | |||
| 2313 | Ga0207426_1000380 | |||
| 2314 | Ga0207426_1002496 | |||
| 2315 | Ga0207426_1012053 | |||
| 2316 | Ga0209257_1001378 | |||
| 2317 | Ga0207697_10002563 | |||
| 2318 | Ga0207697_10009251 | |||
| 2319 | Ga0207697_10059109 | |||
| 2320 | Ga0207697_10194223 | |||
| 2321 | Ga0207656_10001912 | |||
| 2322 | Ga0207682_10002547 | |||
| 2323 | Ga0207682_10231886 | |||
| 2324 | Ga0207692_10089754 | |||
| 2325 | Ga0207642_10103933 | |||
| 2326 | Ga0207642_10194177 | |||
| 2327 | Ga0207710_10044132 | |||
| 2328 | Ga0207688_10000420 | |||
| 2329 | Ga0207688_10017559 | |||
| 2330 | Ga0207688_10050406 | |||
| 2331 | Ga0207688_10050480 | |||
| 2332 | Ga0207688_10174879 | |||
| 2333 | Ga0207680_10490956 | |||
| 2334 | Ga0207680_10511850 | |||
| 2335 | Ga0207647_10001208 | |||
| 2336 | Ga0207647_10016448 | |||
| 2337 | Ga0207647_10079788 | |||
| 2338 | Ga0207645_10006423 | |||
| 2339 | Ga0207645_10100017 | |||
| 2340 | Ga0207645_10433108 | |||
| 2341 | Ga0207643_10000085 | |||
| 2342 | Ga0207643_10032606 | |||
| 2343 | Ga0207705_10029513 | |||
| 2344 | Ga0207705_10371550 | |||
| 2345 | Ga0207705_10432624 | |||
| 2346 | Ga0207654_10016717 | |||
| 2347 | Ga0207654_10021104 | |||
| 2348 | Ga0207654_10030175 | |||
| 2349 | Ga0207654_10235208 | |||
| 2350 | Ga0207654_10346568 | |||
| 2351 | Ga0207654_10412185 | |||
| 2352 | Ga0207707_10141145 | |||
| 2353 | Ga0207707_10345952 | |||
| 2354 | Ga0207695_10000065 | |||
| 2355 | Ga0207695_10000463 | |||
| 2356 | Ga0207695_10051076 | |||
| 2357 | Ga0207695_10066058 | |||
| 2358 | Ga0207695_11075822 | |||
| 2359 | Ga0207671_10051470 | |||
| 2360 | Ga0207671_10662964 | |||
| 2361 | Ga0207693_10024379 | |||
| 2362 | Ga0207693_10029000 | |||
| 2363 | Ga0207693_10092560 | |||
| 2364 | Ga0207693_10179546 | |||
| 2365 | Ga0207693_10298720 | |||
| 2366 | Ga0207663_10011980 | |||
| 2367 | Ga0207663_10028990 | |||
| 2368 | Ga0207663_10634833 | |||
| 2369 | Ga0207660_10111408 | |||
| 2370 | Ga0207660_10413330 | |||
| 2371 | Ga0207662_10021760 | |||
| 2372 | Ga0207657_10031172 | |||
| 2373 | Ga0207657_10090739 | |||
| 2374 | Ga0207657_10163922 | |||
| 2375 | Ga0207649_10141082 | |||
| 2376 | Ga0207649_10220110 | |||
| 2377 | Ga0207649_10248428 | |||
| 2378 | Ga0207649_10443872 | |||
| 2379 | Ga0207652_10156845 | |||
| 2380 | Ga0207652_10290508 | |||
| 2381 | Ga0207652_10328042 | |||
| 2382 | Ga0207652_11157539 | |||
| 2383 | Ga0207681_10101564 | |||
| 2384 | Ga0207681_10223112 | |||
| 2385 | Ga0207681_10660236 | |||
| 2386 | Ga0207694_10000234 | |||
| 2387 | Ga0207694_10060225 | |||
| 2388 | Ga0207694_10084867 | |||
| 2389 | Ga0207694_10428654 | |||
| 2390 | Ga0207650_10018107 | |||
| 2391 | Ga0207659_10007937 | |||
| 2392 | Ga0207659_10049744 | |||
| 2393 | Ga0207687_10007762 | |||
| 2394 | Ga0207687_10041286 | |||
| 2395 | Ga0207687_10144203 | |||
| 2396 | Ga0207687_10270049 | |||
| 2397 | Ga0207700_10007273 | |||
| 2398 | Ga0207700_10341530 | |||
| 2399 | Ga0207664_10071467 | |||
| 2400 | Ga0207664_10117460 | |||
| 2401 | Ga0207664_10905504 | |||
| 2402 | Ga0207644_10024752 | |||
| 2403 | Ga0207644_10091140 | |||
| 2404 | Ga0207644_10295385 | |||
| 2405 | Ga0207644_10422523 | |||
| 2406 | Ga0207690_10041750 | |||
| 2407 | Ga0207690_10205636 | |||
| 2408 | Ga0207690_10252474 | |||
| 2409 | Ga0207690_10292065 | |||
| 2410 | Ga0207706_10088251 | |||
| 2411 | Ga0207706_10094123 | |||
| 2412 | Ga0207706_10134965 | |||
| 2413 | Ga0207686_10261568 | |||
| 2414 | Ga0207686_10327329 | |||
| 2415 | Ga0207709_10053693 | |||
| 2416 | Ga0207709_10370573 | |||
| 2417 | Ga0207709_10503279 | |||
| 2418 | Ga0207670_10002363 | |||
| 2419 | Ga0207670_10102427 | |||
| 2420 | Ga0207670_10663123 | |||
| 2421 | Ga0207670_11084032 | |||
| 2422 | Ga0207669_10459115 | |||
| 2423 | Ga0207669_10912080 | |||
| 2424 | Ga0207704_10124351 | |||
| 2425 | Ga0207704_10150475 | |||
| 2426 | Ga0207704_10395641 | |||
| 2427 | Ga0207704_10471429 | |||
| 2428 | Ga0207704_10747748 | |||
| 2429 | Ga0207665_10066129 | |||
| 2430 | Ga0207691_10020632 | |||
| 2431 | Ga0207691_10050325 | |||
| 2432 | Ga0207691_10894046 | |||
| 2433 | Ga0207691_11025331 | |||
| 2434 | Ga0207711_10063221 | |||
| 2435 | Ga0207711_10116539 | |||
| 2436 | Ga0207711_10271550 | |||
| 2437 | Ga0207689_10301654 | |||
| 2438 | Ga0207689_10311360 | |||
| 2439 | Ga0207661_10044110 | |||
| 2440 | Ga0207661_10178147 | |||
| 2441 | Ga0207679_10632009 | |||
| 2442 | Ga0207679_10866583 | |||
| 2443 | Ga0207667_10026572 | |||
| 2444 | Ga0207667_10076155 | |||
| 2445 | Ga0207667_10138057 | |||
| 2446 | Ga0207667_10254262 | |||
| 2447 | Ga0207667_10884633 | |||
| 2448 | Ga0207651_10002327 | |||
| 2449 | Ga0207651_10010959 | |||
| 2450 | Ga0207651_10532818 | |||
| 2451 | Ga0207712_10107821 | |||
| 2452 | Ga0207712_10263259 | |||
| 2453 | Ga0207712_10618796 | |||
| 2454 | Ga0207668_10070733 | |||
| 2455 | Ga0207668_10170887 | |||
| 2456 | Ga0207668_10834618 | |||
| 2457 | Ga0207668_11128067 | |||
| 2458 | Ga0207640_10018424 | |||
| 2459 | Ga0207640_10022981 | |||
| 2460 | Ga0207658_10075608 | |||
| 2461 | Ga0207658_10126621 | |||
| 2462 | Ga0207658_10345610 | |||
| 2463 | Ga0207677_10089177 | |||
| 2464 | Ga0207677_10232838 | |||
| 2465 | Ga0207677_10252562 | |||
| 2466 | Ga0207703_10058879 | |||
| 2467 | Ga0207703_10062109 | |||
| 2468 | Ga0207703_10083826 | |||
| 2469 | Ga0207703_10392340 | |||
| 2470 | Ga0207703_10416304 | |||
| 2471 | Ga0207639_10029190 | |||
| 2472 | Ga0207639_10270426 | |||
| 2473 | Ga0207639_10295019 | |||
| 2474 | Ga0207639_10325906 | |||
| 2475 | Ga0207639_10684825 | |||
| 2476 | Ga0207639_11407499 | |||
| 2477 | Ga0207678_10005146 | |||
| 2478 | Ga0207678_10010843 | |||
| 2479 | Ga0207678_10013588 | |||
| 2480 | Ga0207678_10016226 | |||
| 2481 | Ga0207678_10057915 | |||
| 2482 | Ga0207678_10078637 | |||
| 2483 | Ga0207678_10096321 | |||
| 2484 | Ga0207678_10128205 | |||
| 2485 | Ga0207708_10121050 | |||
| 2486 | Ga0207702_10000098 | |||
| 2487 | Ga0207702_10023104 | |||
| 2488 | Ga0207702_10105618 | |||
| 2489 | Ga0207702_10488414 | |||
| 2490 | Ga0207702_10619569 | |||
| 2491 | Ga0207641_10084753 | |||
| 2492 | Ga0207641_10698471 | |||
| 2493 | Ga0207641_11209277 | |||
| 2494 | Ga0207641_11271659 | |||
| 2495 | Ga0207648_10001362 | |||
| 2496 | Ga0207648_10016972 | |||
| 2497 | Ga0207648_10620474 | |||
| 2498 | Ga0207676_10112306 | |||
| 2499 | Ga0207676_10119808 | |||
| 2500 | Ga0207676_10667316 | |||
| 2501 | Ga0207674_10006546 | |||
| 2502 | Ga0207674_10009002 | |||
| 2503 | Ga0207674_10010216 | |||
| 2504 | Ga0207674_10031549 | |||
| 2505 | Ga0207674_10082038 | |||
| 2506 | Ga0207675_100359610 | |||
| 2507 | Ga0207683_10004914 | |||
| 2508 | Ga0207683_10057619 | |||
| 2509 | Ga0207683_10112867 | |||
| 2510 | Ga0207683_10203433 | |||
| 2511 | Ga0207683_10291838 | |||
| 2512 | Ga0207683_10877124 | |||
| 2513 | Ga0207683_11092839 | |||
| 2514 | Ga0207683_11298497 | |||
| 2515 | Ga0207698_10105252 | |||
| 2516 | Ga0207698_10192457 | |||
| 2517 | Ga0207698_10218966 | |||
| 2518 | Ga0207698_10327212 | |||
| 2519 | Ga0207698_10384510 | |||
| 2520 | Ga0207698_10476330 | |||
| 2521 | Ga0207698_10705566 | |||
| 2522 | Ga0207698_10717463 | |||
| 2523 | Ga0209389_1000168 | |||
| 2524 | Ga0209389_1000180 | |||
| 2525 | Ga0209589_1000015 | |||
| 2526 | Ga0209589_1000570 | |||
| 2527 | Ga0209489_100015 | |||
| 2528 | Ga0209489_101190 | |||
| 2529 | Ga0209489_101411 | |||
| 2530 | Ga0209700_100025 | |||
| 2531 | Ga0209700_101443 | |||
| 2532 | Ga0209967_1015941 | |||
| 2533 | Ga0210002_1003502 | |||
| 2534 | Ga0209971_1034805 | |||
| 2535 | Ga0209998_10011152 | |||
| 2536 | Ga0209813_10169264 | |||
| 2537 | Ga0207428_10000664 | |||
| 2538 | Ga0207428_10001593 | |||
| 2539 | Ga0207428_10349709 | |||
| 2540 | Ga0268266_10003266 | |||
| 2541 | Ga0268266_10046072 | |||
| 2542 | Ga0268266_10151210 | |||
| 2543 | Ga0268266_10165793 | |||
| 2544 | Ga0268266_10171356 | |||
| 2545 | Ga0268266_10210008 | |||
| 2546 | Ga0268266_10282367 | |||
| 2547 | Ga0268265_10128769 | |||
| 2548 | Ga0268265_10160149 | |||
| 2549 | Ga0268265_10385096 | |||
| 2550 | Ga0268264_10000049 | |||
| 2551 | Ga0268264_10511294 | |||
| 2552 | Ga0307517_10002508 | |||
| 2553 | Ga0307517_10138270 | |||
| 2554 | Ga0307517_10428677 | |||
| 2555 | Ga0307515_10069558 | |||
| 2556 | Ga0307515_10113017 | |||
| 2557 | Ga0265760_10052578 | |||
| 2558 | Ga0265330_10081784 | |||
| 2559 | Ga0265316_10462372 | |||
| 2560 | Ga0307513_10089886 | |||
| 2561 | Ga0307509_10120233 | |||
| 2562 | Ga0265313_10000510 | |||
| 2563 | Ga0265313_10031496 | |||
| 2564 | Ga0265313_10120675 | |||
| 2565 | Ga0307508_10000046 | |||
| 2566 | Ga0307508_10037024 | |||
| 2567 | Ga0316579_10043783 | |||
| 2568 | Ga0265314_10022525 | |||
| 2569 | Ga0265314_10151442 | |||
| 2570 | Ga0307516_10003810 | |||
| 2571 | Ga0307516_10264467 | |||
| 2572 | Ga0307405_10201212 | |||
| 2573 | Ga0307413_10048793 | |||
| 2574 | Ga0307410_10470799 | |||
| 2575 | Ga0307407_10256037 | |||
| 2576 | Ga0307409_101166958 | |||
| 2577 | Ga0307416_100240771 | |||
| 2578 | Ga0307416_100416507 | |||
| 2579 | Ga0307416_100668905 | |||
| 2580 | Ga0307411_10236299 | |||
| 2581 | Ga0307411_10588884 | |||
| 2582 | Ga0307415_100058305 | |||
| 2583 | Ga0307415_101136264 | |||
| 2584 | Ga0307510_10003428 | |||
| 2585 | Ga0307510_10195732 | |||
| 2586 | Ga0315911_1000017 | |||
| 2587 | Ga0373930_0025262 | |||
| 2588 | Ga0373948_0002028 | |||
| 2589 | Ga0373950_0001366 | |||
| 2590 | Ga0373950_0029199 | |||
| 2591 | Ga0373958_0000682 | |||
| 2592 | Ga0373938_0000745 | |||
| 2593 | Ga0373938_0001870 | |||
| 2594 | Ga0373926_0010795 | |||
| 2595 | Ga0373928_0000048 | |||
| 2596 | Ga0373929_0000547 | |||
| 2597 | Ga0373940_0000927 | |||
| 2598 | Ga0373944_0020862 | |||
| 2599 | Ga0373944_0129215 | |||
| 2600 | Ga0373949_0000821 | |||
| 2601 | Ga0373951_0007246 | |||
| 2602 | Ga0373952_0002299 | |||
| 2603 | Ga0373923_0010736 | |||
| 2604 | Ga0373923_0020082 | |||
| 2605 | Ga0373932_0001773 | |||
| 2606 | Ga0373932_0019787 | |||
| 2607 | Ga0373936_0020155 | |||
| 2608 | Ga0373936_0196083 | |||
| 2609 | Ga0373939_0001868 | |||
| 2610 | Ga0373939_0014456 | |||
| 2611 | Ga0373941_0000452 | |||
| 2612 | Ga0373941_0000714 | |||
| 2613 | Ga0373941_0108990 | |||
| 2614 | Ga0373945_0033172 | |||
| 2615 | Ga0373953_0010228 | |||
| 2616 | Ga0373954_0033716 | |||
| 2617 | Ga0373954_0109719 | |||
| 2618 | Ga0373956_0002568 | |||
| 2619 | Ga0373957_0023794 | |||
| 2620 | Ga0373960_0008309 | |||
| 2621 | Ga0373960_0117172 | |||
| 2622 | Ga0373943_0012096 | |||
| 2623 | Ga0373943_0018472 | |||
| 2624 | Ga0373943_0023977 | |||
| 2625 | Ga0373946_0046780 | |||
| 2626 | Ga0373946_0249781 | |||
| 2627 | Ga0373955_0004901 | |||
| 2628 | Ga0373955_0014739 | |||
| 2629 | Ga0373955_0042433 | |||
| 2630 | Ga0373942_0000844 | |||
| 2631 | Ga0373942_0002802 | |||
| 2632 | Ga0373962_0000546 | |||
| 2633 | Ga0373962_0003526 | |||
| 2634 | Ga0373924_0012982 | |||
| 2635 | Ga0373924_0022820 | |||
| 2636 | Ga0373931_0009546 | |||
| 2637 | Ga0373931_0047178 | |||
| 2638 | Ga0373931_0136358 | |||
| 2639 | Ga0373931_0214279 | |||
| 2640 | Ga0373935_0019978 | |||
| 2641 | Ga0373927_0000481 | |||
| 2642 | Ga0373927_0052809 | |||
| 2643 | Ga0373927_0089476 | |||
| 2644 | Ga0373927_0101160 | |||
| 2645 | Ga0373927_0125941 | |||
| 2646 | Ga0373933_0003495 | |||
| 2647 | Ga0373933_0040458 | |||
| 2648 | Ga0373947_0000441 | |||
| 2649 | Ga0373947_0574720 | |||
| 2650 | Ga0373937_0030955 | |||
| 2651 | Ga0373937_0129490 | |||
| 2652 | Ga0373937_0195842 | |||
| 2653 | Ga0373937_0823972 | |||
| 2654 | Ga0373925_0005350 | |||
| 2655 | Ga0373925_0018054 | |||
| 2656 | Ga0373925_0048343 | |||
| 2657 | Ga0373925_0313697 | |||
| 2658 | Ga0395899_0258995 | |||
| 2659 | Ga0395900_0000937 | |||
| 2660 | Ga0395900_0288371 | |||
| 2661 | Ga0395900_0355669 | |||
| 2662 | Ga0395898_0012937 | |||
| 2663 | Ga0395905_0003622 | |||
| 2664 | Ga0395905_0100877 | |||
| 2665 | Ga0395905_0107501 | |||
| 2666 | Ga0395905_0506056 | |||
| 2667 | Ga0436364_0666253 | |||
| 2668 | Ga0436364_1169764 | |||
| 2669 | Ga0395901_0027708 | |||
| 2670 | Ga0436365_0332538 | |||
| 2671 | Ga0436360_0069163 | |||
| 2672 | Ga0436360_0794626 | |||
| 2673 | Ga0436361_0180263 | |||
| 2674 | Ga0436361_0354921 | |||
| 2675 | Ga0436361_0540936 | |||
| 2676 | Ga0436363_0376673 | |||
| 2677 | Ga0436363_1386220 | |||
| 2678 | Ga0439465_0006502 | |||
| 2679 | Ga0439465_0054106 | |||
| 2680 | Ga0451791_0027799 | |||
| 2681 | Ga0451797_0177233 | |||
| 2682 | Ga0451795_0644648 | |||
| 2683 | Ga0451847_0937825 | |||
| 2684 | Ga0439464_0035696 | |||
| 2685 | Ga0451577_0089386 | |||
| 2686 | Ga0466972_0000171 | |||
| 2687 | Ga0466972_0009381 | |||
| 2688 | Ga0466972_0099558 | |||
| 2689 | Ga0453683_0138434 | |||
| 2690 | Ga0466965_0063765 | |||
| 2691 | Ga0466966_0000287 | |||
| 2692 | Ga0466966_0024099 | |||
| 2693 | Ga0466961_0000126 | |||
| 2694 | Ga0466963_0184624 | |||
| 2695 | Ga0453684_0101204 | |||
| 2696 | Ga0466971_0117504 | |||
| 2697 | Ga0466968_0002951 | |||
| 2698 | Ga0466968_0063072 | |||
| 2699 | Ga0466957_0554122 | |||
| 2700 | Ga0466960_0011542 | |||
| 2701 | Ga0466960_0049122 | |||
| 2702 | Ga0466959_0003379 | |||
| 2703 | Ga0451576_0060155 | |||
| 2704 | Ga0466967_0203454 | |||
| 2705 | Ga0466967_0603392 | |||
| 2706 | Ga0495617_030202 | |||
| 2707 | Ga0495592_0038636 | |||
| 2708 | Ga0495592_0394284 | |||
| 2709 | Ga0495603_0000066 | |||
| 2710 | Ga0495603_0027734 | |||
| 2711 | Ga0495603_0068782 | |||
| 2712 | Ga0495603_0086597 | |||
| 2713 | Ga0495603_0130881 | |||
| 2714 | Ga0495603_0237113 | |||
| 2715 | Ga0495590_0025134 | |||
| 2716 | Ga0495629_0006904 | |||
| 2717 | Ga0495629_0018144 | |||
| 2718 | Ga0495629_0105444 | |||
| 2719 | Ga0495638_0005913 | |||
| 2720 | Ga0495638_0067451 | |||
| 2721 | Ga0495641_0019238 | |||
| 2722 | Ga0495641_0107306 | |||
| 2723 | Ga0495641_0247308 | |||
| 2724 | Ga0495651_0000667 | |||
| 2725 | Ga0495651_0049589 | |||
| 2726 | Ga0495651_0077600 | |||
| 2727 | Ga0495580_0001382 | |||
| 2728 | Ga0495580_0263001 | |||
| 2729 | Ga0495582_0000298 | |||
| 2730 | Ga0495582_0235013 | |||
| 2731 | Ga0495605_0032010 | |||
| 2732 | Ga0495605_0096196 | |||
| 2733 | Ga0495605_0144963 | |||
| 2734 | Ga0495605_0192831 | |||
| 2735 | Ga0495639_0000282 | |||
| 2736 | Ga0495639_0054189 | |||
| 2737 | Ga0495662_0000058 | |||
| 2738 | Ga0495662_0233699 | |||
| 2739 | Ga0495664_0001603 | |||
| 2740 | Ga0495664_0350670 | |||
| 2741 | Ga0495585_0005925 | |||
| 2742 | Ga0495585_0087199 | |||
| 2743 | Ga0495585_0126109 | |||
| 2744 | Ga0495594_0000706 | |||
| 2745 | Ga0495594_0027151 | |||
| 2746 | Ga0495594_0074764 | |||
| 2747 | Ga0495596_0019026 | |||
| 2748 | Ga0495596_0052294 | |||
| 2749 | Ga0495607_0019906 | |||
| 2750 | Ga0495607_0074008 | |||
| 2751 | Ga0495607_0170774 | |||
| 2752 | Ga0495583_0077706 | |||
| 2753 | Ga0495583_0191809 | |||
| 2754 | Ga0495606_0019769 | |||
| 2755 | Ga0495606_0051430 | |||
| 2756 | Ga0495606_0067970 | |||
| 2757 | Ga0495606_0198615 | |||
| 2758 | Ga0495608_0078741 | |||
| 2759 | Ga0495608_0127015 | |||
| 2760 | Ga0495610_0012760 | |||
| 2761 | Ga0495610_0089433 | |||
| 2762 | Ga0495610_0101939 | |||
| 2763 | Ga0495610_0140936 | |||
| 2764 | Ga0495616_0090402 | |||
| 2765 | Ga0495618_0033089 | |||
| 2766 | Ga0495618_0073141 | |||
| 2767 | Ga0495618_0481714 | |||
| 2768 | Ga0495620_0107042 | |||
| 2769 | Ga0495620_0135135 | |||
| 2770 | Ga0495628_0037494 | |||
| 2771 | Ga0495628_0066468 | |||
| 2772 | Ga0495630_0001425 | |||
| 2773 | Ga0495630_0017239 | |||
| 2774 | Ga0495630_0168514 | |||
| 2775 | Ga0495631_0004059 | |||
| 2776 | Ga0495631_0271736 | |||
| 2777 | Ga0495632_0038495 | |||
| 2778 | Ga0495632_0180072 | |||
| 2779 | Ga0495632_0271742 | |||
| 2780 | Ga0495637_0055908 | |||
| 2781 | Ga0495637_0144166 | |||
| 2782 | Ga0495637_0182295 | |||
| 2783 | Ga0495643_0007902 | |||
| 2784 | Ga0495644_0004771 | |||
| 2785 | Ga0495644_0164387 | |||
| 2786 | Ga0495648_0002045 | |||
| 2787 | Ga0495648_0014359 | |||
| 2788 | Ga0495648_0046198 | |||
| 2789 | Ga0495648_0098016 | |||
| 2790 | Ga0495648_0211530 | |||
| 2791 | Ga0495648_0363328 | |||
| 2792 | Ga0495663_0080918 | |||
| 2793 | Ga0495666_0036914 | |||
| 2794 | Ga0495666_0238691 | |||
| 2795 | Ga0495652_0036110 | |||
| 2796 | Ga0495652_0237284 | |||
| 2797 | Ga0495654_0092505 | |||
| 2798 | Ga0495665_0000373 | |||
| 2799 | Ga0495640_0014709 | |||
| 2800 | Ga0495640_0028397 | |||
| 2801 | Ga0495587_0042572 | |||
| 2802 | Ga0495587_0045839 | |||
| 2803 | Ga0495587_0067629 | |||
| 2804 | Ga0495598_0012091 | |||
| 2805 | Ga0495609_0139272 | |||
| 2806 | Ga0495597_0027655 | |||
| 2807 | Ga0495597_0074178 | |||
| 2808 | Ga0495645_0069970 | |||
| 2809 | Ga0495622_0012697 | |||
| 2810 | Ga0495622_0040321 | |||
| 2811 | Ga0495622_0062057 | |||
| 2812 | Ga0495622_0247552 | |||
| 2813 | Ga0495633_0005887 | |||
| 2814 | Ga0495633_0158084 | |||
| 2815 | Ga0495667_0007317 | |||
| 2816 | Ga0495667_0016052 | |||
| 2817 | Ga0495667_0021985 | |||
| 2818 | Ga0495667_0023536 | |||
| 2819 | Ga0495667_0073041 | |||
| 2820 | Ga0495656_0000705 | |||
| 2821 | Ga0495656_0011792 | |||
| 2822 | Ga0495656_0030526 | |||
| 2823 | Ga0495656_0087987 | |||
| 2824 | Ga0495668_0024474 | |||
| 2825 | Ga0495668_0120327 | |||
| 2826 | Ga0495668_0197662 | |||
| 2827 | Ga0495668_0239637 | |||
| 2828 | Ga0495634_0000502 | |||
| 2829 | Ga0495634_0251229 | |||
| 2830 | Ga0495611_0005467 | |||
| 2831 | Ga0495611_0126082 | |||
| 2832 | Ga0495611_0261026 | |||
| 2833 | Ga0495625_0220532 | |||
| 2834 | Ga0495625_0255677 | |||
| 2835 | Ga0495625_0344122 | |||
| 2836 | Ga0495625_0462677 | |||
| 2837 | Ga0495635_0000178 | |||
| 2838 | Ga0495635_0053042 | |||
| 2839 | Ga0495635_0161792 | |||
| 2840 | Ga0495659_0014518 | |||
| 2841 | Ga0495659_0147917 | |||
| 2842 | Ga0495661_0076948 | |||
| 2843 | Ga0495661_0159078 | |||
| 2844 | Ga0495661_0295958 | |||
| 2845 | Ga0495588_0002644 | |||
| 2846 | Ga0495588_0011343 | |||
| 2847 | Ga0495588_0063410 | |||
| 2848 | Ga0495657_0028252 | |||
| 2849 | Ga0495657_0033935 | |||
| 2850 | Ga0495657_0155862 | |||
| 2851 | Ga0495599_0008017 | |||
| 2852 | Ga0495599_0025275 | |||
| 2853 | Ga0495599_0033357 | |||
| 2854 | Ga0495623_0002455 | |||
| 2855 | Ga0495646_0021079 | |||
| 2856 | Ga0495646_0048879 | |||
| 2857 | Ga0495646_0184058 | |||
| 2858 | Ga0495646_0249149 | |||
| 2859 | Ga0495647_0018257 | |||
| 2860 | Ga0495647_0072246 | |||
| 2861 | Ga0495658_0000368 | |||
| 2862 | Ga0495658_0143321 | |||
| 2863 | Ga0495669_0011883 | |||
| 2864 | Ga0495669_0133912 | |||
| 2865 | Ga0495669_0207094 | |||
| 2866 | Ga0495669_0215055 | |||
| 2867 | Ga0495613_0049303 | |||
| 2868 | Ga0495613_0084351 | |||
| 2869 | Ga0495624_0003669 | |||
| 2870 | Ga0495624_0198199 | |||
| 2871 | Ga0495670_0000973 | |||
| 2872 | Ga0495670_0071841 | |||
| 2873 | Ga0495671_0074747 | |||
| 2874 | Ga0495649_0017227 | |||
| 2875 | Ga0495589_0195220 | |||
| 2876 | Ga0495589_0290311 | |||
| 2877 | Ga0495600_0004239 | |||
| 2878 | Ga0495600_0034813 | |||
| 2879 | Ga0495600_0166734 | |||
| 2880 | Ga0495660_0038089 | |||
| 2881 | Ga0495581_0000111 | |||
| 2882 | Ga0495581_0021235 | |||
| 2883 | Ga0495581_0396777 | |||
| 2884 | Ga0495604_0014404 | |||
| 2885 | Ga0495604_0055322 | |||
| 2886 | Ga0495604_0083864 | |||
| 2887 | Ga0495636_0045401 | |||
| 2888 | Ga0495674_0002855 | |||
| 2889 | Ga0495674_0165657 | |||
| 2890 | Ga0495674_0327380 | |||
| 2891 | Ga0495674_0387919 | |||
| 2892 | Ga0495672_0072222 | |||
| 2893 | Ga0495676_0025260 | |||
| 2894 | Ga0495676_0028521 | |||
| 2895 | Ga0495676_0122511 | |||
| 2896 | Ga0495676_0223807 | |||
| 2897 | Ga0495680_0007580 | |||
| 2898 | Ga0495680_0066388 | |||
| 2899 | Ga0495680_0160969 | |||
| 2900 | Ga0495680_0161815 | |||
| 2901 | Ga0495683_0057209 | |||
| 2902 | Ga0495687_033969 | |||
| 2903 | Ga0495675_0007873 | |||
| 2904 | Ga0495675_0037173 | |||
| 2905 | Ga0495677_0036428 | |||
| 2906 | Ga0495677_0108327 | |||
| 2907 | Ga0495679_111116 | |||
| 2908 | Ga0495673_0050133 | |||
| 2909 | Ga0495684_0109882 | |||
| 2910 | Ga0495686_0102707 | |||
| 2911 | Ga0495686_0123777 | |||
| 2912 | Ga0495686_0138490 | |||
| 2913 | Ga0495686_0188966 | |||
| 2914 | Ga0495686_0190567 | |||
| 2915 | Ga0495593_0000210 | |||
| 2916 | Ga0495593_0075182 | |||
| 2917 | Ga0495593_0137658 | |||
| 2918 | Ga0495602_0020857 | |||
| 2919 | Ga0495602_0054730 | |||
| 2920 | Ga0495602_0115385 | |||
| 2921 | Ga0495602_0739472 | |||
| 2922 | Ga0495614_0037279 | |||
| 2923 | Ga0495614_0060546 | |||
| 2924 | Ga0495614_0266287 | |||
| 2925 | Ga0495626_0028992 | |||
| 2926 | Ga0495626_0095109 | |||
| 2927 | Ga0496100_0076234 | |||
| 2928 | Ga0496100_0124181 | |||
| 2929 | Ga0496100_0224743 | |||
| 2930 | Ga0496100_0356432 | |||
| 2931 | Ga0496101_0002918 | |||
| 2932 | Ga0496101_0120579 | |||
| 2933 | Ga0496101_0133155 | |||
| 2934 | Ga0496101_0261270 | |||
| 2935 | Ga0496101_0326923 | |||
| 2936 | Ga0496101_0396415 | |||
| 2937 | Ga0496101_0466136 | |||
| 2938 | Ga0496102_0003383 | |||
| 2939 | Ga0496102_0017307 | |||
| 2940 | Ga0496102_0041224 | |||
| 2941 | Ga0496102_0167313 | |||
| 2942 | Ga0496102_0176232 | |||
| 2943 | Ga0496102_0191001 | |||
| 2944 | Ga0496102_0841953 | |||
| 2945 | Ga0496103_0005458 | |||
| 2946 | Ga0496103_0166305 | |||
| 2947 | Ga0496103_0619582 | |||
| 2948 | Ga0496104_0023739 | |||
| 2949 | Ga0496104_0041340 | |||
| 2950 | Ga0496104_0042724 | |||
| 2951 | Ga0496104_0071924 | |||
| 2952 | Ga0496104_0132590 | |||
| 2953 | Ga0496104_0192450 | |||
| 2954 | Ga0496104_0369178 | |||
| 2955 | Ga0496104_0454445 | |||
| 2956 | Ga0496104_0813265 | |||
| 2957 | Ga0496105_0053739 | |||
| 2958 | Ga0496105_0095918 | |||
| 2959 | Ga0496105_0121480 | |||
| 2960 | Ga0496105_0167066 | |||
| 2961 | Ga0496105_0182408 | |||
| 2962 | Ga0496105_0220905 | |||
| 2963 | Ga0496106_0014823 | |||
| 2964 | Ga0496106_0048165 | |||
| 2965 | Ga0496106_0071917 | |||
| 2966 | Ga0496106_0190337 | |||
| 2967 | Ga0496106_0350346 | |||
| 2968 | Ga0496106_0438872 | |||
| 2969 | Ga0496106_0518295 | |||
| 2970 | Ga0496107_0010578 | |||
| 2971 | Ga0496107_0017668 | |||
| 2972 | Ga0496107_0022968 | |||
| 2973 | Ga0496107_0063122 | |||
| 2974 | Ga0496107_0094309 | |||
| 2975 | Ga0496107_0222687 | |||
| 2976 | Ga0496107_0615051 | |||
| 2977 | Ga0496107_0655231 | |||
| 2978 | Ga0496108_0000639 | |||
| 2979 | Ga0496108_0064133 | |||
| 2980 | Ga0496108_0145734 | |||
| 2981 | Ga0496108_0712118 | |||
| 2982 | Ga0496109_0000619 | |||
| 2983 | Ga0496109_0064302 | |||
| 2984 | Ga0496109_0094558 | |||
| 2985 | Ga0496109_0139533 | |||
| 2986 | Ga0496109_0182600 | |||
| 2987 | Ga0496109_0409947 | |||
| 2988 | Ga0496110_0092579 | |||
| 2989 | Ga0496110_0118275 | |||
| 2990 | Ga0496110_0218478 | |||
| 2991 | Ga0496110_0229742 | |||
| 2992 | Ga0496110_0273038 | |||
| 2993 | Ga0496111_0038438 | |||
| 2994 | Ga0496111_0094006 | |||
| 2995 | Ga0496111_0122974 | |||
| 2996 | Ga0496111_0329601 | |||
| 2997 | Ga0496112_0002285 | |||
| 2998 | Ga0496112_0039764 | |||
| 2999 | Ga0496112_0098301 | |||
| 3000 | Ga0496112_0166061 | |||
| 3001 | Ga0496112_0358070 | |||
| 3002 | Ga0496112_0358525 | |||
| 3003 | Ga0496112_0374648 | |||
| 3004 | Ga0496112_0779421 | |||
| 3005 | Ga0496112_1137952 | |||
| 3006 | Ga0496113_0004176 | |||
| 3007 | Ga0496113_0057182 | |||
| 3008 | Ga0496113_0109068 | |||
| 3009 | Ga0496113_0134495 | |||
| 3010 | Ga0496113_0157317 | |||
| 3011 | Ga0496113_0943816 | |||
| 3012 | Ga0496114_0017189 | |||
| 3013 | Ga0496114_0021593 | |||
| 3014 | Ga0496114_0024475 | |||
| 3015 | Ga0496114_0057328 | |||
| 3016 | Ga0496114_0329391 | |||
| 3017 | Ga0496114_0383389 | |||
| 3018 | Ga0496114_0713486 | |||
| 3019 | Ga0496115_0027016 | |||
| 3020 | Ga0496115_0094296 | |||
| 3021 | Ga0496115_0168868 | |||
| 3022 | Ga0496115_0222783 | |||
| 3023 | Ga0496115_0381707 | |||
| 3024 | Ga0496115_0488960 | |||
| 3025 | Ga0496115_0806872 | |||
| 3026 | Ga0496116_0005187 | |||
| 3027 | Ga0496116_0035270 | |||
| 3028 | Ga0496116_0194417 | |||
| 3029 | Ga0496117_0021989 | |||
| 3030 | Ga0496117_0105060 | |||
| 3031 | Ga0496118_0033446 | |||
| 3032 | Ga0496118_0086842 | |||
| 3033 | Ga0496119_0102731 | |||
| 3034 | Ga0496120_0018181 | |||
| 3035 | Ga0496121_0009401 | |||
| 3036 | Ga0496121_0019336 | |||
| 3037 | Ga0496121_0053232 | |||
| 3038 | Ga0496121_0054751 | |||
| 3039 | Ga0496121_0060186 | |||
| 3040 | Ga0496121_0095978 | |||
| 3041 | Ga0496121_0195873 | |||
| 3042 | Ga0496121_0233781 | |||
| 3043 | Ga0496121_0268061 | |||
| 3044 | Ga0496121_0379696 | |||
| 3045 | Ga0496122_0086985 | |||
| 3046 | Ga0496122_0117523 | |||
| 3047 | Ga0496122_0260599 | |||
| 3048 | Ga0496123_0086053 | |||
| 3049 | Ga0496123_0099612 | |||
| 3050 | Ga0496123_0334777 | |||
| 3051 | Ga0496124_0126298 | |||
| 3052 | Ga0496124_0176273 | |||
| 3053 | Ga0496124_0318679 | |||
| 3054 | Ga0496124_0423542 | |||
| 3055 | Ga0496125_0000420 | |||
| 3056 | Ga0496125_0001294 | |||
| 3057 | Ga0496125_0138357 | |||
| 3058 | Ga0496125_0180840 | |||
| 3059 | Ga0496125_0182924 | |||
| 3060 | Ga0496125_0213707 | |||
| 3061 | Ga0496125_0237453 | |||
| 3062 | Ga0496126_0005768 | |||
| 3063 | Ga0496126_0006421 | |||
| 3064 | Ga0496126_0012916 | |||
| 3065 | Ga0496126_0069995 | |||
| 3066 | Ga0496126_0077290 | |||
| 3067 | Ga0496126_0152957 | |||
| 3068 | Ga0496126_0212172 | |||
| 3069 | Ga0496126_0232146 | |||
| 3070 | Ga0496126_0276065 | |||
| 3071 | Ga0496126_0345435 | |||
| 3072 | Ga0496126_0367747 | |||
| 3073 | Ga0495678_032930 | |||
| 3074 | Ga0495682_0011648 | |||
| 3075 | Ga0495682_0118445 | |||
| 3076 | Ga0501031_0004523 | |||
| 3077 | Ga0501031_0008194 | |||
| 3078 | Ga0501031_0054472 | |||
| 3079 | Ga0501031_0055909 | |||
| 3080 | Ga0501031_0058562 | |||
| 3081 | Ga0501031_0062386 | |||
| 3082 | Ga0501031_0109056 | |||
| 3083 | Ga0501031_0209022 | |||
| 3084 | Ga0501032_0000172 | |||
| 3085 | Ga0501032_0004015 | |||
| 3086 | Ga0501032_0019595 | |||
| 3087 | Ga0501032_0030915 | |||
| 3088 | Ga0501032_0044825 | |||
| 3089 | Ga0501032_0173202 | |||
| 3090 | Ga0501032_0459267 | |||
| 3091 | Ga0501033_0000866 | |||
| 3092 | Ga0501033_0001887 | |||
| 3093 | Ga0501033_0008787 | |||
| 3094 | Ga0501033_0052374 | |||
| 3095 | Ga0501033_0086379 | |||
| 3096 | Ga0501033_0148750 | |||
| 3097 | Ga0501033_0156287 | |||
| 3098 | Ga0501034_0000270 | |||
| 3099 | Ga0501034_0000676 | |||
| 3100 | Ga0501034_0003680 | |||
| 3101 | Ga0501034_0017445 | |||
| 3102 | Ga0501034_0042056 | |||
| 3103 | Ga0501034_0046005 | |||
| 3104 | Ga0501034_0077424 | |||
| 3105 | Ga0501034_0081044 | |||
| 3106 | Ga0501034_0195399 | |||
| 3107 | Ga0501034_0326110 | |||
| 3108 | Ga0501034_0393066 | |||
| 3109 | Ga0501034_0604510 | |||
| 3110 | Ga0501034_0634505 | |||
| 3111 | Ga0501036_0000390 | |||
| 3112 | Ga0501036_0031129 | |||
| 3113 | Ga0501036_0044378 | |||
| 3114 | Ga0501036_0068188 | |||
| 3115 | Ga0501036_0071716 | |||
| 3116 | Ga0501036_0075280 | |||
| 3117 | Ga0501036_0131317 | |||
| 3118 | Ga0501036_0258670 | |||
| 3119 | Ga0501036_0365729 | |||
| 3120 | Ga0501037_0000755 | |||
| 3121 | Ga0501037_0000958 | |||
| 3122 | Ga0501037_0019397 | |||
| 3123 | Ga0501037_0023954 | |||
| 3124 | Ga0501037_0043886 | |||
| 3125 | Ga0501037_0057399 | |||
| 3126 | Ga0501037_0258632 | |||
| 3127 | Ga0501037_0281480 | |||
| 3128 | Ga0501037_0460680 | |||
| 3129 | Ga0501038_0000089 | |||
| 3130 | Ga0501038_0024721 | |||
| 3131 | Ga0501038_0026409 | |||
| 3132 | Ga0501038_0047902 | |||
| 3133 | Ga0501038_0068998 | |||
| 3134 | Ga0501038_0092792 | |||
| 3135 | Ga0501038_0118989 | |||
| 3136 | Ga0501038_0181180 | |||
| 3137 | Ga0501038_0592458 | |||
| 3138 | Ga0501039_0000114 | |||
| 3139 | Ga0501039_0005815 | |||
| 3140 | Ga0501039_0026996 | |||
| 3141 | Ga0501039_0154835 | |||
| 3142 | Ga0501039_0177021 | |||
| 3143 | Ga0501039_0389518 | |||
| 3144 | Ga0501039_0422170 | |||
| 3145 | Ga0501040_0033806 | |||
| 3146 | Ga0501042_0212028 | |||
| 3147 | Ga0501042_0376554 | |||
| 3148 | Ga0501043_0001086 | |||
| 3149 | Ga0501043_0004253 | |||
| 3150 | Ga0501043_0009335 | |||
| 3151 | Ga0501043_0009610 | |||
| 3152 | Ga0501043_0018279 | |||
| 3153 | Ga0501043_0254755 | |||
| 3154 | Ga0501043_0301353 | |||
| 3155 | Ga0501046_0006291 | |||
| 3156 | Ga0501046_0012856 | |||
| 3157 | Ga0501046_0030044 | |||
| 3158 | Ga0501046_0110364 | |||
| 3159 | Ga0501046_0344591 | |||
| 3160 | Ga0501047_0000594 | |||
| 3161 | Ga0501047_0052121 | |||
| 3162 | Ga0501047_0061369 | |||
| 3163 | Ga0501047_0133295 | |||
| 3164 | Ga0501047_0151819 | |||
| 3165 | Ga0501047_0336033 | |||
| 3166 | Ga0501047_0475446 | |||
| 3167 | Ga0501048_0042728 | |||
| 3168 | Ga0501048_0337176 | |||
| 3169 | Ga0501048_0355326 | |||
| 3170 | Ga0501067_0000445 | |||
| 3171 | Ga0501067_0028070 | |||
| 3172 | Ga0501067_0031977 | |||
| 3173 | Ga0501067_0108936 | |||
| 3174 | Ga0501067_0210294 | |||
| 3175 | Ga0501068_0004210 | |||
| 3176 | Ga0501068_0026560 | |||
| 3177 | Ga0501068_0036616 | |||
| 3178 | Ga0501068_0039358 | |||
| 3179 | Ga0501068_0104489 | |||
| 3180 | Ga0501069_0045261 | |||
| 3181 | Ga0501069_0139563 | |||
| 3182 | Ga0501070_0017073 | |||
| 3183 | Ga0501070_0095692 | |||
| 3184 | Ga0501070_0098200 | |||
| 3185 | Ga0501070_0144409 | |||
| 3186 | Ga0501070_0169638 | |||
| 3187 | Ga0501070_0238852 | |||
| 3188 | Ga0501071_0036958 | |||
| 3189 | Ga0501071_0061557 | |||
| 3190 | Ga0501071_0326770 | |||
| 3191 | Ga0501072_0001459 | |||
| 3192 | Ga0501072_0084143 | |||
| 3193 | Ga0501072_0328818 | |||
| 3194 | Ga0501072_0406023 | |||
| 3195 | Ga0501073_0000055 | |||
| 3196 | Ga0501073_0044654 | |||
| 3197 | Ga0501073_0057653 | |||
| 3198 | Ga0501073_0103031 | |||
| 3199 | Ga0501073_0112810 | |||
| 3200 | Ga0501073_0113981 | |||
| 3201 | Ga0501073_0251674 | |||
| 3202 | Ga0501074_0000492 | |||
| 3203 | Ga0501074_0007017 | |||
| 3204 | Ga0501074_0040558 | |||
| 3205 | Ga0501074_0072357 | |||
| 3206 | Ga0501074_0083946 | |||
| 3207 | Ga0501076_0012137 | |||
| 3208 | Ga0501076_0128644 | |||
| 3209 | Ga0501077_0024392 | |||
| 3210 | Ga0501077_0257873 | |||
| 3211 | Ga0501077_0294687 | |||
| 3212 | Ga0501225_0094635 | |||
| 3213 | Ga0501079_0004436 | |||
| 3214 | Ga0501079_0076206 | |||
| 3215 | Ga0501080_0008079 | |||
| 3216 | Ga0501080_0022886 | |||
| 3217 | Ga0501080_0025902 | |||
| 3218 | Ga0501080_0060993 | |||
| 3219 | Ga0501080_0206292 | |||
| 3220 | Ga0501081_0013430 | |||
| 3221 | Ga0501081_0241742 | |||
| 3222 | Ga0501083_0000570 | |||
| 3223 | Ga0501083_0020711 | |||
| 3224 | Ga0501083_0089624 | |||
| 3225 | Ga0501083_0096362 | |||
| 3226 | Ga0501083_0112660 | |||
| 3227 | Ga0501083_0114872 | |||
| 3228 | Ga0501035_0000150 | |||
| 3229 | Ga0501035_0003778 | |||
| 3230 | Ga0501035_0022636 | |||
| 3231 | Ga0501035_0031779 | |||
| 3232 | Ga0501035_0045739 | |||
| 3233 | Ga0501035_0155236 | |||
| 3234 | Ga0501035_0496885 | |||
| 3235 | Ga0501035_0528287 | |||
| 3236 | Ga0501035_0557433 | |||
| 3237 | Ga0501044_0000546 | |||
| 3238 | Ga0501044_0006712 | |||
| 3239 | Ga0501044_0069407 | |||
| 3240 | Ga0501044_0077407 | |||
| 3241 | Ga0501044_0080620 | |||
| 3242 | Ga0501044_0106409 | |||
| 3243 | Ga0501044_0133952 | |||
| 3244 | Ga0501044_0179462 | |||
| 3245 | Ga0501044_0353527 | |||
| 3246 | Ga0501044_1012477 | |||
| 3247 | Ga0501045_0003323 | |||
| 3248 | Ga0501045_0004352 | |||
| 3249 | Ga0501045_0140281 | |||
| 3250 | nmdc:mga03683_17434_c1 | |||
| 3251 | nmdc:mga03683_274518_c1 | |||
| 3252 | nmdc:mga03n38_366961_c1 | |||
| 3253 | nmdc:mga03n38_64360_c1 | |||
| 3254 | nmdc:mga00v17_11235_c1 | |||
| 3255 | nmdc:mga00v17_117908_c1 | |||
| 3256 | nmdc:mga00v17_12296_c1 | |||
| 3257 | nmdc:mga00v17_227117_c1 | |||
| 3258 | nmdc:mga00v17_261514_c1 | |||
| 3259 | nmdc:mga00v17_303901_c1 | |||
| 3260 | nmdc:mga00v17_456401_c1 | |||
| 3261 | nmdc:mga0yw44_120803_c1 | |||
| 3262 | nmdc:mga0yw44_29347_c1 | |||
| 3263 | nmdc:mga0yw44_52049_c1 | |||
| 3264 | nmdc:mga0yw44_65999_c1 | |||
| 3265 | nmdc:mga0k408_213400_c1 | |||
| 3266 | nmdc:mga0k408_373167_c1 | |||
| 3267 | nmdc:mga0k408_40371_c1 | |||
| 3268 | nmdc:mga0k408_90047_c1 | |||
| 3269 | nmdc:mga06z11_252133_c1 | |||
| 3270 | nmdc:mga06z11_260036_c1 | |||
| 3271 | nmdc:mga06z11_5217_c1 | |||
| 3272 | nmdc:mga06z11_59740_c1 | |||
| 3273 | nmdc:mga04h51_958_c1 | |||
| 3274 | nmdc:mga07m45_23113_c1 | |||
| 3275 | nmdc:mga07m45_342364_c1 | |||
| 3276 | nmdc:mga07m45_395112_c1 | |||
| 3277 | nmdc:mga07m45_401562_c1 | |||
| 3278 | nmdc:mga07m45_8863_c1 | |||
| 3279 | nmdc:mga05p37_158567_c1 | |||
| 3280 | nmdc:mga05p37_247255_c1 | |||
| 3281 | nmdc:mga05p37_282843_c1 | |||
| 3282 | nmdc:mga0qj67_1096485_c1 | |||
| 3283 | nmdc:mga0qj67_437711_c1 | |||
| 3284 | nmdc:mga08y16_102759_c1 | |||
| 3285 | nmdc:mga08y16_1197718_c1 | |||
| 3286 | nmdc:mga08y16_127265_c1 | |||
| 3287 | nmdc:mga08y16_549433_c1 | |||
| 3288 | nmdc:mga0n895_109830_c1 | |||
| 3289 | nmdc:mga0n895_507676_c1 | |||
| 3290 | nmdc:mga0rr50_1144197_c1 | |||
| 3291 | nmdc:mga0rr50_174772_c1 | |||
| 3292 | nmdc:mga0a205_175143_c1 | |||
| 3293 | nmdc:mga0a205_321122_c1 | |||
| 3294 | nmdc:mga0sz30_12652_c2 | |||
| 3295 | nmdc:mga0sz30_30335_c1 | |||
| 3296 | nmdc:mga0sz30_41148_c1 | |||
| 3297 | nmdc:mga0sz30_43074_c1 | |||
| 3298 | Ga0495601_0009983 | |||
| 3299 | Ga0495601_0014707 | |||
| 3300 | Ga0495601_0064402 | |||
| 3301 | Ga0495601_0066963 | |||
| 3302 | Ga0495601_0515666 | |||
| 3303 | Ga0495612_0143985 | |||
| 3304 | Ga0495612_0146357 | |||
| 3305 | Ga0495595_0000699 | |||
| 3306 | Ga0495595_0056996 | |||
| 3307 | Ga0495619_0003768 | |||
| 3308 | Ga0495619_0078651 | |||
| 3309 | Ga0495619_0081836 | |||
| 3310 | Ga0495619_0292737 | |||
| 3311 | Ga0495619_0315809 | |||
| 3312 | Ga0495619_0456719 | |||
| 3313 | Ga0500578_0069357 | |||
| 3314 | Ga0500643_000278 | |||
| 3315 | Ga0500643_015999 | |||
| 3316 | Ga0500643_060511 | |||
| 3317 | Ga0500644_0095093 | |||
| 3318 | Ga0500644_0213157 | |||
| 3319 | Ga0500646_0002189 | |||
| 3320 | Ga0500647_0108652 | |||
| 3321 | Ga0500651_0013046 | |||
| 3322 | Ga0500651_0216667 | |||
| 3323 | Ga0500566_0008990 | |||
| 3324 | Ga0500566_0018420 | |||
| 3325 | Ga0500566_0035829 | |||
| 3326 | Ga0500641_0032473 | |||
| 3327 | Ga0500641_0048221 | |||
| 3328 | Ga0500641_0151377 | |||
| 3329 | Ga0500650_0002801 | |||
| 3330 | Ga0500650_0086338 | |||
| 3331 | Ga0500554_001643 | |||
| 3332 | Ga0500555_002583 | |||
| 3333 | Ga0500556_0000005 | |||
| 3334 | Ga0500556_0052067 | |||
| 3335 | Ga0500557_000028 | |||
| 3336 | Ga0500562_009620 | |||
| 3337 | Ga0500562_011585 | |||
| 3338 | Ga0500569_025365 | |||
| 3339 | Ga0500572_066187 | |||
| 3340 | Ga0500572_141266 | |||
| 3341 | Ga0500592_001026 | |||
| 3342 | Ga0500593_037159 | |||
| 3343 | Ga0500594_0041106 | |||
| 3344 | Ga0500595_001799 | |||
| 3345 | Ga0500595_001904 | |||
| 3346 | Ga0500595_032232 | |||
| 3347 | Ga0500595_078444 | |||
| 3348 | Ga0500607_050084 | |||
| 3349 | Ga0500608_000378 | |||
| 3350 | Ga0500614_033240 | |||
| 3351 | Ga0500617_160280 | |||
| 3352 | Ga0500618_007774 | |||
| 3353 | Ga0500626_186358 | |||
| 3354 | Ga0500642_0000009 | |||
| 3355 | Ga0500642_0003513 | |||
| 3356 | Ga0500642_0203807 | |||
| 3357 | Ga0500652_001958 | |||
| 3358 | Ga0500655_004688 | |||
| 3359 | Ga0500658_0063524 | |||
| 3360 | Ga0500658_0175435 | |||
| 3361 | Ga0500559_0000705 | |||
| 3362 | Ga0500559_0020757 | |||
| 3363 | Ga0500559_0029661 | |||
| 3364 | Ga0500564_152355 | |||
| 3365 | Ga0500568_0000477 | |||
| 3366 | Ga0500568_0091275 | |||
| 3367 | Ga0500577_0001565 | |||
| 3368 | Ga0500577_0177658 | |||
| 3369 | Ga0500589_104484 | |||
| 3370 | Ga0500590_138998 | |||
| 3371 | Ga0500604_0000396 | |||
| 3372 | Ga0500616_0000118 | |||
| 3373 | Ga0500619_053498 | |||
| 3374 | Ga0500620_001010 | |||
| 3375 | Ga0500622_0022820 | |||
| 3376 | Ga0500622_0073129 | |||
| 3377 | Ga0500624_002509 | |||
| 3378 | Ga0500627_0001957 | |||
| 3379 | Ga0500634_0025228 | |||
| 3380 | Ga0500634_0178097 | |||
| 3381 | Ga0500638_014397 | |||
| 3382 | Ga0500636_0000246 | |||
| 3383 | Ga0500636_0002208 | |||
| 3384 | Ga0500637_0000075 | |||
| 3385 | Ga0500637_0096449 | |||
| 3386 | Ga0500637_0098186 | |||
| 3387 | Ga0500649_035602 | |||
| 3388 | Ga0500645_003297 | |||
| 3389 | Ga0500645_040044 | |||
| 3390 | Ga0500645_094487 | |||
| 3391 | Ga0500609_001977 | |||
| 3392 | Ga0500601_000529 | |||
| 3393 | Ga0501084_0001687 | |||
| 3394 | Ga0501084_0032214 | |||
| 3395 | Ga0501084_0074672 | |||
| 3396 | Ga0500661_000415 | |||
| 3397 | Ga0500661_003836 | |||
| 3398 | Ga0501082_0004787 | |||
| 3399 | Ga0501082_0039991 | |||
| 3400 | Ga0501082_0769537 | |||
| 3401 | Ga0466962_0032496 | |||
| 3402 | 2507505714 | |||
| 3403 | 2508539607 | |||
| 3404 | 2508695978 | |||
| 3405 | 2509150803 | |||
| 3406 | 2511397028 | |||
| 3407 | 2513626650 | |||
| 3408 | 2513641788 | |||
| 3409 | 2513648131 | |||
| 3410 | 2513677968 | |||
| 3411 | 2513694379 | |||
| 3412 | 2513699186 | |||
| 3413 | 2513857176 | |||
| 3414 | 2513875688 | |||
| 3415 | 2513889748 | |||
| 3416 | 2514016354 | |||
| 3417 | 2515624111 | |||
| 3418 | 2517106990 | |||
| 3419 | 2524435617 | |||
| 3420 | 2524468327 | |||
| 3421 | 2528850269 | |||
| 3422 | 2603858104 | |||
| 3423 | 2617352919 | |||
| 3424 | 2617377133 | |||
| 3425 | 2644290048 | |||
| 3426 | 2723849103 | |||
| 3427 | 2745079873 | |||
| 3428 | 2793063235 | |||
| 3429 | 2793082594 | |||
| 3430 | 2805919364 | |||
| 3431 | 2818237153 | |||
| 3432 | 2824608849 | |||
| 3433 | 2824612773 | |||
| 3434 | 2824625066 | |||
| 3435 | 2824632517 | |||
| 3436 | 2824643110 | |||
| 3437 | 2824651431 | |||
| 3438 | 2824661208 | |||
| 3439 | 2824670687 | |||
| 3440 | 2824674741 | |||
| 3441 | 2824685441 | |||
| 3442 | 2824692617 | |||
| 3443 | 2824700944 | |||
| 3444 | 2824712225 | |||
| 3445 | 2824721485 | |||
| 3446 | 2824731361 | |||
| 3447 | 2824734111 | |||
| 3448 | 2824749172 | |||
| 3449 | 2824760651 | |||
| 3450 | 2824773045 | |||
| 3451 | 2824780138 | |||
| 3452 | 2838130238 | |||
| 3453 | 2841944319 | |||
| 3454 | 2841954504 | |||
| 3455 | 2841962931 | |||
| 3456 | 2841969096 | |||
| 3457 | 2841979870 | |||
| 3458 | 2841990949 | |||
| 3459 | 2842044026 | |||
| 3460 | 2842051985 | |||
| 3461 | 2844321675 | |||
| 3462 | 2847939666 | |||
| 3463 | 2847941615 | |||
| 3464 | 2849082540 | |||
| 3465 | 2857511442 | |||
| 3466 | 2857527491 | |||
| 3467 | 2874593166 | |||
| 3468 | 2874606965 | |||
| 3469 | 2874615582 | |||
| 3470 | 2874624295 | |||
| 3471 | 2874634064 | |||
| 3472 | 2874645501 | |||
| 3473 | 2876764530 | |||
| 3474 | 2876773206 | |||
| 3475 | 2876812509 | |||
| 3476 | 2876820513 | |||
| 3477 | 2879076848 | |||
| 3478 | 2879090531 | |||
| 3479 | 2879101868 | |||
| 3480 | 2879115037 | |||
| 3481 | 2879131035 | |||
| 3482 | 2879150242 | |||
| 3483 | 2881364961 | |||
| 3484 | 2881672282 | |||
| 3485 | 2885368135 | |||
| 3486 | 2885384643 | |||
| 3487 | 2885410934 | |||
| 3488 | 2888380138 | |||
| 3489 | 2888391152 | |||
| 3490 | 2888420900 | |||
| 3491 | 2889034940 | |||
| 3492 | 2893066984 | |||
| 3493 | 2903727750 | |||
| 3494 | 2903773452 | |||
| 3495 | 2904672366 | |||
| 3496 | 2904695701 | |||
| 3497 | 2904717945 | |||
| 3498 | 2906602764 | |||
| 3499 | 2906632430 | |||
| 3500 | 2906639940 | |||
| 3501 | 2906645070 | |||
| 3502 | 2906666546 | |||
| 3503 | 2908764211 | |||
| 3504 | 2908783048 | |||
| 3505 | 2919073341 | |||
| 3506 | 2922364630 | |||
| 3507 | 2922378491 | |||
| 3508 | 2922391896 | |||
| 3509 | 2922400918 | |||
| 3510 | 2929622421 | |||
| 3511 | 2929631362 | |||
| 3512 | 2932786221 | |||
| 3513 | 2932794819 | |||
| 3514 | 2932805389 | |||
| 3515 | 2932812705 | |||
| 3516 | 2932823067 | |||
| 3517 | 2932829459 | |||
| 3518 | 2933584499 | |||
| 3519 | 2935614768 | |||
| 3520 | 2935617891 | |||
| 3521 | 2935632734 | |||
| 3522 | 2935641625 | |||
| 3523 | 2935649161 | |||
| 3524 | 2935658067 | |||
| 3525 | 2935669317 | |||
| 3526 | 2935678087 | |||
| 3527 | 2935693594 | |||
| 3528 | 2935702914 | |||
| 3529 | 2935707140 | |||
| 3530 | 2935716958 | |||
| 3531 | 2935730208 | |||
| 3532 | 2935738397 | |||
| 3533 | 2935750185 | |||
| 3534 | 2935759779 | |||
| 3535 | 2935764570 | |||
| 3536 | 2935777099 | |||
| 3537 | 2935777973 | |||
| 3538 | 2935787177 | |||
| 3539 | 2935796035 | |||
| 3540 | 2935804479 | |||
| 3541 | 2935819120 | |||
| 3542 | 2935826192 | |||
| 3543 | 2935831356 | |||
| 3544 | 2935841965 | |||
| 3545 | 2935853688 | |||
| 3546 | 2935856610 | |||
| 3547 | 2935870225 | |||
| 3548 | 2935874450 | |||
| 3549 | 2935887529 | |||
| 3550 | 2935910910 | |||
| 3551 | 2935922092 | |||
| 3552 | 2935929771 | |||
| 3553 | 2935937439 | |||
| 3554 | 2935948162 | |||
| 3555 | 2935957617 | |||
| 3556 | 2935964271 | |||
| 3557 | 2935971104 | |||
| 3558 | 2935982303 | |||
| 3559 | 2935985445 | |||
| 3560 | 2935993911 | |||
| 3561 | 2936005078 | |||
| 3562 | 2936012286 | |||
| 3563 | 2936020633 | |||
| 3564 | 2936029579 | |||
| 3565 | 2936045729 | |||
| 3566 | 2936051956 | |||
| 3567 | 2936056787 | |||
| 3568 | 2940565767 | |||
| 3569 | 2941508602 | |||
| 3570 | 2941516432 | |||
| 3571 | 2941524552 | |||
| 3572 | 2941532236 | |||
| 3573 | 2941547016 | |||
| 3574 | 3005490535 | |||
| 3575 | 3005509679 | |||
| 3576 | 3005588908 | |||
| 3577 | 3005602052 | |||
| 3578 | 3005717784 | |||
| 3579 | 3005724834 | |||
| 3580 | 8006932430 | |||
| 3581 | 8006971290 | |||
| 3582 | 8006988582 | |||
| 3583 | 8006995213 | |||
| 3584 | 8016518776 | |||
| 3585 | 8016526726 | |||
| 3586 | 8016531813 | |||
| 3587 | 8016545018 | |||
| 3588 | 8016557059 | |||
| 3589 | 8016565409 | |||
| 3590 | 8016570093 | |||
| 3591 | 8016582663 | |||
| 3592 | 8016585664 | |||
| 3593 | 8016603046 | |||
| 3594 | 8016605947 | |||
| 3595 | 8016617833 | |||
| 3596 | 8016623741 | |||
| 3597 | 8016635128 | |||
| 3598 | 8017057903 | |||
| 3599 | 8019531639 | |||
| 3600 | 8019539896 | |||
| 3601 | 8019550761 | |||
| 3602 | 8019577821 | |||
| 3603 | 8019605832 | |||
| 3604 | 8019612701 | |||
| 3605 | 8019623466 | |||
| 3606 | 8019638677 | |||
| 3607 | 8019641062 | |||
| 3608 | 8019651922 | |||
| 3609 | 8019676136 | |||
| 3610 | 8019679847 | |||
| 3611 | 8019695691 | |||
| 3612 | 8055750872 | |||
| 3613 | 8056679296 | |||
| 3614 | 8056681387 | |||
| 3615 | 8056694697 | |||
| 3616 | 8056975555 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4wbr-assembly1.cif.gz_D | structure of bradyrhizobium japonicum scoi with copper bound | 0.985 | 42 | 198 |
| 4wbr-assembly1.cif.gz_D | structure of bradyrhizobium japonicum scoi with copper bound | 0.9788 | 42 | 198 |
| 4txo-assembly4.cif.gz_H | crystal structure of the mixed disulfide complex of thioredoxin-like tlpas(c110s) and copper chaperone scois(c74s) | 0.9713 | 42 | 198 |
| 4txo-assembly4.cif.gz_H | crystal structure of the mixed disulfide complex of thioredoxin-like tlpas(c110s) and copper chaperone scois(c74s) | 0.9651 | 42 | 198 |
| 4txo-assembly1.cif.gz_D | crystal structure of the mixed disulfide complex of thioredoxin-like tlpas(c110s) and copper chaperone scois(c74s) | 0.9557 | 42 | 198 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4txoH00 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9713 | 42 | 198 | 3.40.30.10 |
| 4txoH00 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9651 | 42 | 198 | 3.40.30.10 |
| af_Q54TT7_154_312_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9337 | 44 | 196 | 3.40.30.10 |
| af_P38072_102_285_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9078 | 42 | 195 | 3.40.30.10 |
| af_K7MTL0_161_316_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9069 | 59 | 197 | 3.40.30.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A519Y4N8-F1-model_v4 | deleted | 0.9746 | 49 | 198 |
|
| AF-A0A519Y4N8-F1-model_v4 | deleted | 0.9683 | 49 | 198 |
|
| AF-A5H8G9-F1-model_v4 | Major surface protein 5 | 0.9642 | 45 | 136 |
GO:0046872
|
| AF-A0A6I1K3T2-F1-model_v4 | Electron transporter SCO1/SenC | 0.964 | 33 | 198 |
GO:0046872
|
| AF-B0UHN5-F1-model_v4 | deleted | 0.958 | 42 | 196 |
|