metagRoot

F495758

General Info

Members	Datasets	Scaffolds	Average Seq Length
1808	794	3616	196

Family's Representative Sequence

Representative Sequence	3300048918\|Ga0496115_0672631\|Ga0496115_0672631_116_802
Length	228
Sequence	MAQPISTQAGMMTATPRQGRVASIIVWSAATSGALAVLGAAALWFHYGTAVFFEVIMLWAMGGLRTVTAPAAIGGPFQLTDQAGQAVTEQSLKGKPTLIFFGFTHCPDVCPTSLFEISEVLKAMGTDADKVNAWFVSVDPERDTAAAMKDYLSSFDPHLKGLTGEPQAVAKVISAYRVYARKVPLKDGDYTMDHTALIYLMDRDGNFVAPFNLKRTPEEAAKDLKRYL

Samples

	Sample ID	Description	Type	Environment
1	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
2	2209111006	Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1	Metagenome	Rhizosphere
3	3300000041	Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere	Metagenome	Rhizosphere
4	3300000042	Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young	Metagenome	Rhizosphere
5	3300000043	Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere	Metagenome	Rhizosphere
6	3300000044	Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old	Metagenome	Rhizosphere
7	3300000045	Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere	Metagenome	Rhizosphere
8	3300000652	Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA	Metagenome	Rhizosphere
9	3300001977	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5	Metagenome	Rhizosphere
10	3300001978	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6	Metagenome	Rhizosphere
11	3300001979	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6	Metagenome	Rhizosphere
12	3300001989	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5	Metagenome	Rhizosphere
13	3300001990	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3	Metagenome	Rhizosphere
14	3300002067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1	Metagenome	Rhizosphere
15	3300002070	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4	Metagenome	Rhizosphere
16	3300002075	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4	Metagenome	Rhizosphere
17	3300002076	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3	Metagenome	Rhizosphere
18	3300002239	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2	Metagenome	Rhizosphere
19	3300002244	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1	Metagenome	Rhizosphere
20	3300003203	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
21	3300003215	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF	Metagenome	Endosphere
22	3300003354	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS	Metagenome	Endosphere
23	3300003659	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1	Metagenome	Rhizosphere
24	3300003762	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2	Metagenome	Endosphere
25	3300003763	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2	Metagenome	Endosphere
26	3300003775	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2	Metagenome	Endosphere
27	3300003794	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2	Metagenome	Endosphere
28	3300004625	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2	Metagenome	Endosphere
29	3300005262	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3)	Metagenome	Endosphere
30	3300005276	Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v1	Metagenome	Rhizosphere
31	3300005277	Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2)	Metagenome	Rhizosphere
32	3300005289	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2)	Metagenome	Rhizosphere
33	3300005290	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3)	Metagenome	Rhizosphere
34	3300005293	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2)	Metagenome	Rhizosphere
35	3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Metagenome	Rhizosphere
36	3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Metagenome	Rhizosphere
37	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
38	3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Metagenome	Rhizosphere
39	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
40	3300005333	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG	Metagenome	Rhizosphere
41	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
42	3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Metagenome	Rhizosphere
43	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
44	3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Metagenome	Rhizosphere
45	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
46	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
47	3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Metagenome	Rhizosphere
48	3300005341	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG	Metagenome	Rhizosphere
49	3300005343	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG	Metagenome	Rhizosphere
50	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
51	3300005345	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG	Metagenome	Rhizosphere
52	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
53	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
54	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
55	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
56	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
57	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
58	3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Metagenome	Rhizosphere
59	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
60	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
61	3300005434	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG	Metagenome	Rhizosphere
62	3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Metagenome	Rhizosphere
63	3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Metagenome	Rhizosphere
64	3300005437	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG	Metagenome	Rhizosphere
65	3300005438	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG	Metagenome	Rhizosphere
66	3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Metagenome	Rhizosphere
67	3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Metagenome	Rhizosphere
68	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
69	3300005445	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG	Metagenome	Rhizosphere
70	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
71	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
72	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
73	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
74	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
75	3300005466	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG	Metagenome	Rhizosphere
76	3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Metagenome	Rhizosphere
77	3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Metagenome	Rhizosphere
78	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
79	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
80	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
81	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
82	3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Metagenome	Rhizosphere
83	3300005545	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG	Metagenome	Rhizosphere
84	3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Metagenome	Rhizosphere
85	3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Metagenome	Rhizosphere
86	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
87	3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Metagenome	Rhizosphere
88	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
89	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
90	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
91	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
92	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
93	3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Metagenome	Rhizosphere
94	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
95	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
96	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
97	3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Metagenome	Rhizosphere
98	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
99	3300005834	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2	Metagenome	Rhizosphere
100	3300005840	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2	Metagenome	Rhizosphere
101	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
102	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
103	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
104	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
105	3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
106	3300005981	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1	Metagenome	Rhizosphere
107	3300005983	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1	Metagenome	Rhizosphere
108	3300005985	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
109	3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Metagenome	Rhizosphere
110	3300006038	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Metagenome	Endosphere
111	3300006042	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3	Metagenome	Endosphere
112	3300006048	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3	Metagenome	Endosphere
113	3300006051	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Metagenome	Endosphere
114	3300006163	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG	Metagenome	Rhizosphere
115	3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Metagenome	Rhizosphere
116	3300006177	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2	Metagenome	Endosphere
117	3300006178	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2	Metagenome	Endosphere
118	3300006186	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4	Metagenome	Endosphere
119	3300006195	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1	Metagenome	Endosphere
120	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
121	3300006353	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5	Metagenome	Endosphere
122	3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Metagenome	Rhizosphere
123	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
124	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
125	3300006852	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Metagenome	Rhizosphere
126	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
127	3300006914	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5	Metagenome	Rhizosphere
128	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
129	3300006941	Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW	Metagenome	Nodule
130	3300006942	Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW	Metagenome	Nodule
131	3300007076	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Metagenome	Rhizosphere
132	3300007788	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2	Metagenome	Rhizosphere
133	3300009011	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG	Metagenome	Rhizosphere
134	3300009036	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG	Metagenome	Rhizosphere
135	3300009092	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG	Metagenome	Rhizosphere
136	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
137	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
138	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
139	3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Metagenome	Rhizosphere
140	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
141	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
142	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
143	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
144	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
145	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
146	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
147	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
148	3300010159	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3	Metagenome	Rhizosphere
149	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
150	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
151	3300012492	Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610	Metagenome	Rhizosphere
152	3300012507	Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610	Metagenome	Rhizosphere
153	3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Metagenome	Rhizosphere
154	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
155	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
156	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
157	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
158	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
159	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
160	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
161	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
162	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
163	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
164	3300014497	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG	Metagenome	Rhizosphere
165	3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Metagenome	Rhizosphere
166	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
167	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
168	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
169	3300020080	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
170	3300021320	Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3	Metagenome	Nodule
171	3300021321	Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1	Metagenome	Nodule
172	3300021324	Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4	Metagenome	Nodule
173	3300021327	Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2	Metagenome	Nodule
174	3300021361	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2	Metagenome	Rhizosphere
175	3300021377	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7	Metagenome	Unclassified
176	3300021384	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9	Metagenome	Unclassified
177	3300021388	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8	Metagenome	Unclassified
178	3300021441	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1	Metagenome	Rhizosphere
179	3300025230	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2)	Metagenome	Endosphere
180	3300025253	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
181	3300025254	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2)	Metagenome	Endosphere
182	3300025261	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2)	Metagenome	Endosphere
183	3300025272	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
184	3300025290	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2)	Metagenome	Rhizosphere
185	3300025295	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3)	Metagenome	Endosphere
186	3300025297	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2)	Metagenome	Endosphere
187	3300025299	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3)	Metagenome	Endosphere
188	3300025302	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2)	Metagenome	Endosphere
189	3300025304	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
190	3300025315	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2)	Metagenome	Rhizosphere
191	3300025321	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
192	3300025893	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
193	3300025898	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
194	3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
195	3300025900	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
196	3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2)	Metagenome	Rhizosphere
197	3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
198	3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2)	Metagenome	Rhizosphere
199	3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
200	3300025908	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
201	3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
202	3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
203	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
204	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
205	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
206	3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
207	3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
208	3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
209	3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
210	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
211	3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
212	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
213	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
214	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
215	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
216	3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
217	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
218	3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
219	3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
220	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
221	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
222	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
223	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
224	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
225	3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
226	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
227	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
228	3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
229	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
230	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
231	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
232	3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
233	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
234	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
235	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
236	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
237	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
238	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
239	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
240	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
241	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
242	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
243	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
244	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
245	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
246	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
247	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
248	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
249	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
250	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
251	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
252	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
253	3300027296	Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2)	Metagenome	Nodule
254	3300027357	Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2)	Metagenome	Nodule
255	3300027361	Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2)	Metagenome	Nodule
256	3300027363	Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2)	Metagenome	Nodule
257	3300027364	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2)	Metagenome	Rhizosphere
258	3300027617	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2)	Metagenome	Rhizosphere
259	3300027682	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2)	Metagenome	Rhizosphere
260	3300027717	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2)	Metagenome	Rhizosphere
261	3300027866	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2)	Metagenome	Endosphere
262	3300027907	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3)	Metagenome	Rhizosphere
263	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
264	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
265	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
266	3300028786	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM	Metagenome	Unclassified
267	3300028794	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM	Metagenome	Unclassified
268	3300031090	Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
269	3300031235	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG	Metagenome	Rhizosphere
270	3300031344	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG	Metagenome	Rhizosphere
271	3300031456	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM	Metagenome	Unclassified
272	3300031507	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM	Metagenome	Unclassified
273	3300031595	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG	Metagenome	Rhizosphere
274	3300031616	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM	Metagenome	Unclassified
275	3300031691	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA	Metagenome	Rhizosphere
276	3300031711	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG	Metagenome	Rhizosphere
277	3300031730	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM	Metagenome	Unclassified
278	3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Metagenome	Rhizosphere
279	3300031824	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2	Metagenome	Rhizosphere
280	3300031852	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3	Metagenome	Rhizosphere
281	3300031903	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1	Metagenome	Rhizosphere
282	3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Metagenome	Rhizosphere
283	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
284	3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Metagenome	Rhizosphere
285	3300032126	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2	Metagenome	Rhizosphere
286	3300033180	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM	Metagenome	Unclassified
287	3300033442	Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1	Metagenome	Nodule
288	3300034816	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3	Metagenome	Rhizosphere
289	3300034817	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1	Metagenome	Rhizosphere
290	3300034818	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3	Metagenome	Rhizosphere
291	3300034819	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1	Metagenome	Rhizosphere
292	3300034957	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2	Metagenome	Rhizosphere
293	3300035083	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17	Metagenome	Rhizosphere
294	3300035084	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1	Metagenome	Rhizosphere
295	3300035085	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2	Metagenome	Rhizosphere
296	3300035088	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4	Metagenome	Rhizosphere
297	3300035089	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2	Metagenome	Rhizosphere
298	3300035090	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2	Metagenome	Rhizosphere
299	3300035091	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4	Metagenome	Rhizosphere
300	3300035092	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11	Metagenome	Rhizosphere
301	3300035111	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11	Metagenome	Rhizosphere
302	3300035112	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16	Metagenome	Rhizosphere
303	3300035113	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12	Metagenome	Rhizosphere
304	3300035114	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3	Metagenome	Rhizosphere
305	3300035115	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11	Metagenome	Rhizosphere
306	3300035116	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3	Metagenome	Rhizosphere
307	3300035117	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1	Metagenome	Rhizosphere
308	3300035118	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2	Metagenome	Rhizosphere
309	3300035119	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4	Metagenome	Rhizosphere
310	3300035120	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5	Metagenome	Rhizosphere
311	3300035121	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3	Metagenome	Rhizosphere
312	3300035170	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1	Metagenome	Rhizosphere
313	3300035171	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4	Metagenome	Rhizosphere
314	3300035172	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3	Metagenome	Rhizosphere
315	3300035207	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16	Metagenome	Rhizosphere
316	3300035242	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11	Metagenome	Rhizosphere
317	3300035410	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12	Metagenome	Rhizosphere
318	3300035691	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4	Metagenome	Rhizosphere
319	3300035692	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11	Metagenome	Rhizosphere
320	3300035695	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19	Metagenome	Rhizosphere
321	3300035724	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1	Metagenome	Rhizosphere
322	3300035725	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8	Metagenome	Rhizosphere
323	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
324	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
325	3300037312	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2	Metagenome	Rhizosphere
326	3300037418	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3	Metagenome	Rhizosphere
327	3300037466	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1	Metagenome	Rhizosphere
328	3300037471	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11	Metagenome	Rhizosphere
329	3300037853	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2	Metagenome	Unclassified
330	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
331	3300039437	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2	Metagenome	Unclassified
332	3300039438	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2	Metagenome	Rhizosphere
333	3300039447	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2	Metagenome	Rhizosphere
334	3300039450	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2	Metagenome	Unclassified
335	3300041413	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839	Metagenome	Rhizosphere
336	3300041451	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG	Metagenome	Rhizoplane
337	3300041453	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG	Metagenome	Rhizoplane
338	3300041456	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG	Metagenome	Rhizoplane
339	3300041503	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG	Metagenome	Unclassified
340	3300042439	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363	Metagenome	Rhizosphere
341	3300042876	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED	Metagenome	Rhizosphere
342	3300044658	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R	Metagenome	Rhizosphere
343	3300044673	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED	Metagenome	Rhizosphere
344	3300044683	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R	Metagenome	Rhizosphere
345	3300044684	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R	Metagenome	Rhizosphere
346	3300044693	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R	Metagenome	Rhizosphere
347	3300044694	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R	Metagenome	Rhizosphere
348	3300044712	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED	Metagenome	Rhizosphere
349	3300044719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R	Metagenome	Rhizosphere
350	3300044735	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R	Metagenome	Rhizosphere
351	3300044842	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R	Metagenome	Rhizosphere
352	3300044901	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R	Metagenome	Rhizosphere
353	3300045049	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R	Metagenome	Rhizosphere
354	3300045051	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED	Metagenome	Rhizosphere
355	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
356	3300046452	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere	Metagenome	Rhizosphere
357	3300046454	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere	Metagenome	Rhizosphere
358	3300046455	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere	Metagenome	Rhizosphere
359	3300046457	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere	Metagenome	Rhizosphere
360	3300046459	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere	Metagenome	Rhizosphere
361	3300046460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere	Metagenome	Rhizosphere
362	3300046461	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere	Metagenome	Rhizosphere
363	3300046462	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere	Metagenome	Rhizosphere
364	3300046472	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere	Metagenome	Rhizosphere
365	3300046473	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere	Metagenome	Rhizosphere
366	3300046474	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere	Metagenome	Rhizosphere
367	3300046475	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere	Metagenome	Rhizosphere
368	3300046476	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere	Metagenome	Rhizosphere
369	3300046477	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere	Metagenome	Rhizosphere
370	3300046492	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere	Metagenome	Rhizosphere
371	3300046499	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere	Metagenome	Rhizosphere
372	3300046500	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere	Metagenome	Rhizosphere
373	3300046501	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere	Metagenome	Rhizosphere
374	3300046506	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere	Metagenome	Rhizosphere
375	3300046507	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere	Metagenome	Rhizosphere
376	3300046511	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere	Metagenome	Rhizosphere
377	3300046512	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere	Metagenome	Rhizosphere
378	3300046513	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere	Metagenome	Rhizosphere
379	3300046514	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere	Metagenome	Rhizosphere
380	3300046515	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere	Metagenome	Rhizosphere
381	3300046516	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere	Metagenome	Rhizosphere
382	3300046517	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere	Metagenome	Rhizosphere
383	3300046518	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere	Metagenome	Rhizosphere
384	3300046519	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere	Metagenome	Rhizosphere
385	3300046520	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere	Metagenome	Rhizosphere
386	3300046522	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere	Metagenome	Rhizosphere
387	3300046523	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere	Metagenome	Rhizosphere
388	3300046524	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere	Metagenome	Rhizosphere
389	3300046525	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere	Metagenome	Rhizosphere
390	3300046526	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere	Metagenome	Rhizosphere
391	3300046529	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere	Metagenome	Rhizosphere
392	3300046530	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere	Metagenome	Rhizosphere
393	3300046531	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere	Metagenome	Rhizosphere
394	3300046533	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere	Metagenome	Rhizosphere
395	3300046536	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere	Metagenome	Rhizosphere
396	3300046537	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere	Metagenome	Rhizosphere
397	3300046538	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere	Metagenome	Rhizosphere
398	3300046542	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere	Metagenome	Rhizosphere
399	3300046543	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere	Metagenome	Rhizosphere
400	3300046557	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere	Metagenome	Rhizosphere
401	3300046558	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere	Metagenome	Rhizosphere
402	3300046559	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere	Metagenome	Rhizosphere
403	3300046615	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere	Metagenome	Rhizosphere
404	3300046616	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere	Metagenome	Rhizosphere
405	3300046642	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere	Metagenome	Rhizosphere
406	3300046648	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere	Metagenome	Rhizosphere
407	3300046660	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere	Metagenome	Rhizosphere
408	3300046663	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere	Metagenome	Rhizosphere
409	3300046664	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere	Metagenome	Rhizosphere
410	3300046665	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere	Metagenome	Rhizosphere
411	3300046674	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere	Metagenome	Rhizosphere
412	3300046675	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere	Metagenome	Rhizosphere
413	3300046678	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere	Metagenome	Rhizosphere
414	3300046679	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere	Metagenome	Rhizosphere
415	3300046680	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere	Metagenome	Rhizosphere
416	3300046681	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere	Metagenome	Rhizosphere
417	3300046683	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere	Metagenome	Rhizosphere
418	3300046684	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere	Metagenome	Rhizosphere
419	3300046689	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere	Metagenome	Rhizosphere
420	3300046690	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere	Metagenome	Rhizosphere
421	3300046691	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere	Metagenome	Rhizosphere
422	3300046692	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere	Metagenome	Rhizosphere
423	3300046694	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere	Metagenome	Rhizosphere
424	3300046794	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere	Metagenome	Rhizosphere
425	3300046809	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere	Metagenome	Rhizosphere
426	3300046810	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere	Metagenome	Rhizosphere
427	3300047315	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere	Metagenome	Rhizosphere
428	3300047317	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere	Metagenome	Rhizosphere
429	3300047318	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere	Metagenome	Rhizosphere
430	3300047319	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere	Metagenome	Rhizosphere
431	3300047320	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere	Metagenome	Rhizosphere
432	3300047321	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere	Metagenome	Rhizosphere
433	3300047322	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere	Metagenome	Rhizosphere
434	3300047323	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere	Metagenome	Rhizosphere
435	3300047443	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere	Metagenome	Rhizosphere
436	3300047444	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere	Metagenome	Rhizosphere
437	3300047445	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere	Metagenome	Rhizosphere
438	3300047446	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere	Metagenome	Rhizosphere
439	3300047469	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere	Metagenome	Rhizosphere
440	3300047471	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere	Metagenome	Rhizosphere
441	3300047472	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere	Metagenome	Rhizosphere
442	3300047673	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere	Metagenome	Rhizosphere
443	3300048088	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere	Metagenome	Rhizosphere
444	3300048089	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere	Metagenome	Rhizosphere
445	3300048091	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere	Metagenome	Rhizosphere
446	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
447	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
448	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
449	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
450	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
451	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
452	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
453	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
454	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
455	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
456	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
457	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
458	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
459	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
460	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
461	3300048919	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled	Metagenome	Unclassified
462	3300048920	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15	Metagenome	Unclassified
463	3300048921	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15	Metagenome	Unclassified
464	3300048922	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15	Metagenome	Unclassified
465	3300048923	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15	Metagenome	Unclassified
466	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
467	3300048925	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled	Metagenome	Unclassified
468	3300048926	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled	Metagenome	Unclassified
469	3300048927	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15	Metagenome	Unclassified
470	3300048928	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15	Metagenome	Unclassified
471	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
472	3300049459	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere	Metagenome	Rhizosphere
473	3300049460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere	Metagenome	Rhizosphere
474	3300049568	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01	Metagenome	Rhizosphere
475	3300049569	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02	Metagenome	Rhizosphere
476	3300049570	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03	Metagenome	Rhizosphere
477	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
478	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
479	3300049573	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01	Metagenome	Rhizosphere
480	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
481	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
482	3300049576	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01	Metagenome	Rhizosphere
483	3300049578	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03	Metagenome	Rhizosphere
484	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
485	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
486	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
487	3300049582	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03	Metagenome	Rhizosphere
488	3300049583	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01	Metagenome	Rhizosphere
489	3300049584	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02	Metagenome	Rhizosphere
490	3300049585	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03	Metagenome	Rhizosphere
491	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
492	3300049587	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02	Metagenome	Rhizosphere
493	3300049588	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03	Metagenome	Rhizosphere
494	3300049589	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01	Metagenome	Rhizosphere
495	3300049590	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02	Metagenome	Rhizosphere
496	3300049592	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01	Metagenome	Rhizosphere
497	3300049593	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02	Metagenome	Rhizosphere
498	3300049705	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought	Metagenome	Rhizosphere
499	3300049741	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01	Metagenome	Rhizosphere
500	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
501	3300049743	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03	Metagenome	Rhizosphere
502	3300049744	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02	Metagenome	Rhizosphere
503	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
504	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
505	3300049824	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03	Metagenome	Rhizosphere
506	3300050489	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation	Metagenome	Endosphere
507	3300050490	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation	Metagenome	Endosphere
508	3300050491	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation	Metagenome	Endosphere
509	3300050492	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation	Metagenome	Endosphere
510	3300050493	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation	Metagenome	Endosphere
511	3300050494	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation	Metagenome	Endosphere
512	3300050495	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation	Metagenome	Endosphere
513	3300050496	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation	Metagenome	Endosphere
514	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
515	3300050509	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation	Metagenome	Rhizosphere
516	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
517	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
518	3300050513	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation	Metagenome	Rhizosphere
519	3300050515	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation	Metagenome	Rhizosphere
520	3300050516	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation	Metagenome	Endosphere
521	3300053077	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere	Metagenome	Rhizosphere
522	3300053078	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere	Metagenome	Rhizosphere
523	3300053084	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere	Metagenome	Rhizosphere
524	3300053085	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere	Metagenome	Rhizosphere
525	3300053086	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere	Metagenome	Endosphere
526	3300053087	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere	Metagenome	Endosphere
527	3300053088	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere	Metagenome	Endosphere
528	3300053090	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere	Metagenome	Endosphere
529	3300053091	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere	Metagenome	Endosphere
530	3300053093	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere	Metagenome	Endosphere
531	3300053094	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere	Metagenome	Endosphere
532	3300053096	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere	Metagenome	Endosphere
533	3300053098	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere	Metagenome	Endosphere
534	3300053102	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere	Metagenome	Endosphere
535	3300053103	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere	Metagenome	Endosphere
536	3300053104	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere	Metagenome	Endosphere
537	3300053105	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere	Metagenome	Endosphere
538	3300053108	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere	Metagenome	Endosphere
539	3300053109	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere	Metagenome	Endosphere
540	3300053111	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere	Metagenome	Endosphere
541	3300053116	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere	Metagenome	Endosphere
542	3300053117	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere	Metagenome	Endosphere
543	3300053118	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere	Metagenome	Endosphere
544	3300053119	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere	Metagenome	Endosphere
545	3300053121	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere	Metagenome	Endosphere
546	3300053122	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere	Metagenome	Endosphere
547	3300053123	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere	Metagenome	Endosphere
548	3300053124	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere	Metagenome	Endosphere
549	3300053125	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere	Metagenome	Endosphere
550	3300053128	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere	Metagenome	Endosphere
551	3300053130	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere	Metagenome	Endosphere
552	3300053131	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere	Metagenome	Endosphere
553	3300053133	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere	Metagenome	Endosphere
554	3300053134	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere	Metagenome	Endosphere
555	3300053136	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere	Metagenome	Endosphere
556	3300053138	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere	Metagenome	Endosphere
557	3300053139	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere	Metagenome	Endosphere
558	3300053142	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere	Metagenome	Endosphere
559	3300053147	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere	Metagenome	Endosphere
560	3300053148	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere	Metagenome	Endosphere
561	3300053151	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere	Metagenome	Endosphere
562	3300053153	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere	Metagenome	Endosphere
563	3300053154	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere	Metagenome	Endosphere
564	3300053155	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere	Metagenome	Endosphere
565	3300053156	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere	Metagenome	Endosphere
566	3300053157	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere	Metagenome	Endosphere
567	3300053158	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere	Metagenome	Endosphere
568	3300053161	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere	Metagenome	Endosphere
569	3300053162	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere	Metagenome	Endosphere
570	3300053177	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere	Metagenome	Endosphere
571	3300053178	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere	Metagenome	Endosphere
572	3300053722	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 endosphere	Metagenome	Endosphere
573	3300053730	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere	Metagenome	Endosphere
574	3300053731	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere	Metagenome	Endosphere
575	3300053737	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere	Metagenome	Endosphere
576	3300054114	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03	Metagenome	Rhizosphere
577	3300055283	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere	Metagenome	Endosphere
578	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere
579	3300061719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1	Metagenome	Rhizosphere
580	2507262055	Bradyrhizobium sp. WSM1417	Isolate	Nodule
581	2508501009	Bradyrhizobium sp. WSM471	Isolate	Nodule
582	2508501042	Bradyrhizobium sp. WSM1253	Isolate	Nodule
583	2508501128	Bradyrhizobium sp. ARR65	Isolate	Nodule
584	2511231028	Bradyrhizobium sp. YR681	Isolate	Rhizosphere
585	2513237092	Bradyrhizobium sp. WSM1743	Isolate	Nodule
586	2513237094	Bradyrhizobium sp. WSM3983	Isolate	Nodule
587	2513237095	Bradyrhizobium diazoefficiens USDA 122	Isolate	Nodule
588	2513237098	Bradyrhizobium elkanii WSM2783	Isolate	Nodule
589	2513237101	Bradyrhizobium murdochi WSM1741	Isolate	Nodule
590	2513237102	Bradyrhizobium japonicum USDA 135	Isolate	Nodule
591	2513237137	Bradyrhizobium elkanii USDA 94	Isolate	Nodule
592	2513237139	Bradyrhizobium ottawaense USDA 4	Isolate	Nodule
593	2513237141	Bradyrhizobium sp. TV2a.2	Isolate	Nodule
594	2513237161	Bradyrhizobium sp. WSM2793	Isolate	Nodule
595	2515154112	Bradyrhizobium sp. WSM4349	Isolate	Nodule
596	2517093001	Bradyrhizobium japonicum USDA 124	Isolate	Nodule
597	2524023205	Bradyrhizobium sp. Cp5.3	Isolate	Nodule
598	2524023210	Bradyrhizobium sp. Ai1a-2	Isolate	Nodule
599	2528768022	Bradyrhizobium japonicum USDA 123	Isolate	Nodule
600	2602042107	Bradyrhizobium sp. NFR13	Isolate	Rhizoplane
601	2617270735	Bradyrhizobium shewense ERR11	Isolate	Nodule
602	2617270741	Bradyrhizobium yuanmingense CCBAU 10071	Isolate	Nodule
603	2643221651	Afipia sp. Root123D2	Isolate	Unclassified
604	2721755755	Bradyrhizobium icense LMTR 13	Isolate	Nodule
605	2744054633	Bradyrhizobium neotropicale BR 10247	Isolate	Unclassified
606	2791355196	Bradyrhizobium sp. Y36	Isolate	Nodule
607	2791355199
608	2802429603	Bradyrhizobium ottawaense L2	Isolate	Nodule
609	2816332527	Bradyrhizobium diazoefficiens Y21	Isolate	Nodule
610	2824600985	Bradyrhizobium sp.HAMBI 2135	Isolate	Unclassified
611	2824609381	Bradyrhizobium sp. HAMBI 2134	Isolate	Unclassified
612	2824617872	Bradyrhizobium sp. HAMBI 2133	Isolate	Unclassified
613	2824626560	Bradyrhizobium sp. HAMBI 2149	Isolate	Unclassified
614	2824635225	Bradyrhizobium sp. HAMBI 2136	Isolate	Unclassified
615	2824644064	Bradyrhizobium sp. HAMBI 2137	Isolate	Unclassified
616	2824653114	Bradyrhizobium sp. HAMBI 2142	Isolate	Unclassified
617	2824661429	Bradyrhizobium sp. HAMBI 2115	Isolate	Unclassified
618	2824671348	Bradyrhizobium sp. HAMBI 2125	Isolate	Unclassified
619	2824679649	Bradyrhizobium sp.HAMBI 2116	Isolate	Unclassified
620	2824687955	Bradyrhizobium sp. HAMBI 2126	Isolate	Unclassified
621	2824696289	Bradyrhizobium sp. HAMBI 2127	Isolate	Unclassified
622	2824704595	Bradyrhizobium sp. HAMBI 2150	Isolate	Unclassified
623	2824714736	Bradyrhizobium sp. HAMBI 2151	Isolate	Unclassified
624	2824723954	Bradyrhizobium sp. HAMBI 2152	Isolate	Unclassified
625	2824732956	Bradyrhizobium sp. HAMBI 2153	Isolate	Unclassified
626	2824746037	Bradyrhizobium sp. HAMBI 2299	Isolate	Unclassified
627	2824753945	Bradyrhizobium sp. HAMBI 2128	Isolate	Unclassified
628	2824763712	Bradyrhizobium sp. HAMBI 2129	Isolate	Unclassified
629	2824773399	Bradyrhizobium sp. HAMBI 2130	Isolate	Unclassified
630	2838122688	Bradyrhizobium sp. CIR3A	Isolate	Nodule
631	2841941048	Bradyrhizobium sp. SBR1B	Isolate	Nodule
632	2841949485	Bradyrhizobium sp. ERR14	Isolate	Nodule
633	2841957949	Bradyrhizobium sp. CIR1	Isolate	Nodule
634	2841966195	Bradyrhizobium sp. CIR18	Isolate	Nodule
635	2841974524	Bradyrhizobium sp. CIR48	Isolate	Nodule
636	2841983080	Bradyrhizobium sp. IAR9	Isolate	Nodule
637	2842038055	Bradyrhizobium centrosematis SEMIA 424	Isolate	Nodule
638	2842045827	Bradyrhizobium centrosematis SEMIA 431	Isolate	Nodule
639	2844315083	Bradyrhizobium guangzhouense CCBAU 51670	Isolate	Unclassified
640	2847930680	Bradyrhizobium zhanjiangense CCBAU 51778	Isolate	Unclassified
641	2847939898	Bradyrhizobium ottawaense OO99	Isolate	Unclassified
642	2849076700	Bradyrhizobium symbiodeficiens 85S1MB	Isolate	Nodule
643	2857509624	Bradyrhizobium sp. R-73088	Isolate	Unclassified
644	2857524615	Tardiphaga sp. R-73074	Isolate	Unclassified
645	2874590934	Bradyrhizobium canariense UBMA181	Isolate	Nodule
646	2874604998	Bradyrhizobium sp. LMTR 3	Isolate	Nodule
647	2874612657	Bradyrhizobium forestalis INPA54B	Isolate	Nodule
648	2874620515	Bradyrhizobium nanningense CCBAU 53390	Isolate	Unclassified
649	2874628541	Bradyrhizobium betae Opo-243	Isolate	Unclassified
650	2874645413	Bradyrhizobium canariense UBMA122	Isolate	Nodule
651	2876761206	Bradyrhizobium centrolobii BR 10245	Isolate	Nodule
652	2876771140	Bradyrhizobium canariense UBMA192	Isolate	Nodule
653	2876808645	Bradyrhizobium algeriense RST89	Isolate	Unclassified
654	2876818435	Bradyrhizobium canariense UBMA195	Isolate	Nodule
655	2879074833	Bradyrhizobium canariense UBMA171	Isolate	Nodule
656	2879083081	Bradyrhizobium zhanjiangense CCBAU 51787	Isolate	Unclassified
657	2879099564	Bradyrhizobium japonicum UBMA197	Isolate	Nodule
658	2879110137	Bradyrhizobium algeriense RST91	Isolate	Nodule
659	2879127579	Bradyrhizobium canariense UBMA052	Isolate	Nodule
660	2879142872	Bradyrhizobium canariense UBMA061	Isolate	Nodule
661	2881364244	Bradyrhizobium sp. RP6	Isolate	Unclassified
662	2881665667	Bradyrhizobium vignae LMG 28791	Isolate	Unclassified
663	2885366525	Bradyrhizobium sp. LVM 105	Isolate	Unclassified
664	2885383462	Bradyrhizobium sp. Leo170	Isolate	Unclassified
665	2885409591	Bradyrhizobium sp. NAS80.1	Isolate	Unclassified
666	2888378607	Bradyrhizobium sp. LCT2	Isolate	Unclassified
667	2888388044	Bradyrhizobium cosmicum 58S1	Isolate	Unclassified
668	2888419890	Bradyrhizobium sp. 1(2017) 63S1MB	Isolate	Unclassified
669	2889033259	Bradyrhizobium sp. CCBAU 051011	Isolate	Unclassified
670	2893066018	Tardiphaga sp. P9-11	Isolate	Unclassified
671	2903727486	Bradyrhizobium guangzhouense CCBAU 53424	Isolate	Unclassified
672	2903768456	Bradyrhizobium sp. Leo121	Isolate	Unclassified
673	2904666416	Bradyrhizobium nanningense CCBAU 51757	Isolate	Unclassified
674	2904690495	Bradyrhizobium ivorense CI-1B	Isolate	Nodule
675	2904711408	Bradyrhizobium sp. USDA 3456	Isolate	Unclassified
676	2906602504	Bradyrhizobium guangzhouense CCBAU 53426	Isolate	Unclassified
677	2906626472	Bradyrhizobium hipponense aSej3	Isolate	Unclassified
678	2906635258	Bradyrhizobium sp. USDA 3458	Isolate	Unclassified
679	2906643746	Bradyrhizobium genosp. SA-3 Rp7b	Isolate	Unclassified
680	2906660503	Bradyrhizobium brasilense UFLA 03-321	Isolate	Unclassified
681	2908756301	Bradyrhizobium ivorense CI-41S	Isolate	Nodule
682	2908775508	Bradyrhizobium sp. SUTN9-2	Isolate	Unclassified
683	2919073203	Tardiphaga robiniae 1155	Isolate	Unclassified
684	2922361189	Bradyrhizobium australiense WSM 1791	Isolate	Nodule
685	2922368715
686	2922386360	Bradyrhizobium archetypum WSM 1744	Isolate	Nodule
687	2922393267	Bradyrhizobium sp. WBAH10	Isolate	Nodule
688	2929615660	Bradyrhizobium japonicum TXVA	Isolate	Nodule
689	2929624759	Bradyrhizobium japonicum TXEA	Isolate	Nodule
690	2932784394	Bradyrhizobium sp. S3.2.12	Isolate	Nodule
691	2932794094	Bradyrhizobium sp. S3.2.6	Isolate	Nodule
692	2932801729	Bradyrhizobium sp. S3.3.6	Isolate	Nodule
693	2932809354	Bradyrhizobium sp. S3.5.5	Isolate	Nodule
694	2932818245	Bradyrhizobium sp. S3.9.1	Isolate	Nodule
695	2932828146	Bradyrhizobium sp. S3.9.2	Isolate	Nodule
696	2933577622	Bradyrhizobium japonicum SEMIA 417	Isolate	Nodule
697	2935608549	Bradyrhizobium sp. RT6a	Isolate	Nodule
698	2935616580	Bradyrhizobium sp. RT7a	Isolate	Nodule
699	2935630451	Bradyrhizobium sp. I1.14.4	Isolate	Nodule
700	2935638405	Bradyrhizobium sp. JR19.8	Isolate	Nodule
701	2935648319	Bradyrhizobium sp. JR4.3	Isolate	Nodule
702	2935656913	Bradyrhizobium sp. JR5.3	Isolate	Nodule
703	2935665750	Bradyrhizobium sp. JR7.2	Isolate	Nodule
704	2935675223	Bradyrhizobium sp. LA2.1	Isolate	Nodule
705	2935684952	Bradyrhizobium sp. LA3.X	Isolate	Nodule
706	2935694250	Bradyrhizobium sp. LA6.1	Isolate	Nodule
707	2935703347	Bradyrhizobium sp. LA6.10	Isolate	Nodule
708	2935713505	Bradyrhizobium sp. LA6.12	Isolate	Nodule
709	2935722832	Bradyrhizobium sp. LA6.3	Isolate	Nodule
710	2935732158	Bradyrhizobium sp. LA6.4	Isolate	Nodule
711	2935741537	Bradyrhizobium sp. LA6.7	Isolate	Nodule
712	2935750917	Bradyrhizobium sp. LA6.8	Isolate	Nodule
713	2935760218	Bradyrhizobium sp. LA7.1	Isolate	Nodule
714	2935769743	Bradyrhizobium sp. LB12.1	Isolate	Nodule
715	2935777560	Bradyrhizobium sp. LB14.3	Isolate	Nodule
716	2935785616	Bradyrhizobium sp. LB5.2	Isolate	Nodule
717	2935793552	Bradyrhizobium sp. LB8.2	Isolate	Nodule
718	2935801545	Bradyrhizobium sp. RT10b	Isolate	Nodule
719	2935810662	Bradyrhizobium sp. RT3a	Isolate	Nodule
720	2935819856	Bradyrhizobium sp. RT3b	Isolate	Nodule
721	2935827899	Bradyrhizobium sp. RT4a	Isolate	Nodule
722	2935837841	Bradyrhizobium sp. RT4b	Isolate	Nodule
723	2935847175	Bradyrhizobium sp. RT5a	Isolate	Nodule
724	2935855204	Bradyrhizobium sp. RT7b	Isolate	Nodule
725	2935864058	Bradyrhizobium sp. RT9a	Isolate	Nodule
726	2935873716	Bradyrhizobium sp. RT9b	Isolate	Nodule
727	2935883170	Bradyrhizobium sp. S3.12.5	Isolate	Nodule
728	2935908558	Bradyrhizobium sp. F1.1.1	Isolate	Nodule
729	2935916978	Bradyrhizobium sp. F1.13.3	Isolate	Nodule
730	2935926038	Bradyrhizobium sp. F1.2.1	Isolate	Nodule
731	2935934488	Bradyrhizobium sp. F1.2.2	Isolate	Nodule
732	2935942939	Bradyrhizobium sp. F1.2.6	Isolate	Nodule
733	2935951376	Bradyrhizobium sp. F1.2.8	Isolate	Nodule
734	2935959822	Bradyrhizobium sp. F1.4.3	Isolate	Nodule
735	2935967501	Bradyrhizobium sp. F1.6.2	Isolate	Nodule
736	2935975950	Bradyrhizobium sp. GM2.2	Isolate	Nodule
737	2935984226	Bradyrhizobium sp. i1.15.2	Isolate	Nodule
738	2935992306	Bradyrhizobium sp. I1.7.5	Isolate	Nodule
739	2936002035	Bradyrhizobium sp. I1.8.5	Isolate	Nodule
740	2936011229	Bradyrhizobium sp. JR1.1	Isolate	Nodule
741	2936019824	Bradyrhizobium sp. JR1.5	Isolate	Nodule
742	2936028420	Bradyrhizobium sp. JR1.7	Isolate	Nodule
743	2936037263	Bradyrhizobium sp. JR18.2	Isolate	Nodule
744	2936046547	Bradyrhizobium sp. JR3.12	Isolate	Nodule
745	2936055302	Bradyrhizobium sp. JR4.1	Isolate	Nodule
746	2940556831	Bradyrhizobium sp. LA8.1	Isolate	Nodule
747	2941507105	Bradyrhizobium sp. i1.12.3	Isolate	Nodule
748	2941515067	Bradyrhizobium sp. i1.14.1	Isolate	Nodule
749	2941523033	Bradyrhizobium sp. i1.8.4	Isolate	Nodule
750	2941531003	Bradyrhizobium sp. LB11.1	Isolate	Nodule
751	2941538514	Bradyrhizobium sp. RT11b	Isolate	Nodule
752	3005483717	Bradyrhizobium agreste CNPSo 4010	Isolate	Unclassified
753	3005506211	Bradyrhizobium diazoefficiens SZCCT0449	Isolate	Unclassified
754	3005587118	Bradyrhizobium glycinis CNPSo 4016	Isolate	Unclassified
755	3005594810	Bradyrhizobium sp. CCBAU 53340	Isolate	Nodule
756	3005710791	Bradyrhizobium genosp. B BDV5040	Isolate	Unclassified
757	3005718088	Bradyrhizobium sp. CCBAU 53338	Isolate	Nodule
758	8006926726	Bradyrhizobium guangdongense SM32	Isolate	Unclassified
759	8006964411	Bradyrhizobium sp. sBnM-33	Isolate	Nodule
760	8006984368	Bradyrhizobium sp. SRL28	Isolate	Unclassified
761	8006994254	Bradyrhizobium sp. sGM-13	Isolate	Nodule
762	8016511872	Bradyrhizobium sp. S3.14.4	Isolate	Nodule
763	8016522445	Bradyrhizobium sp. LM6.9	Isolate	Nodule
764	8016530956	Bradyrhizobium sp. LM6.11	Isolate	Nodule
765	8016539877	Bradyrhizobium sp. LM6.10	Isolate	Nodule
766	8016548790	Bradyrhizobium sp. LM3.6	Isolate	Nodule
767	8016557553	Bradyrhizobium sp. LM3.4	Isolate	Nodule
768	8016566248	Bradyrhizobium sp. LM3.2	Isolate	Nodule
769	8016575299	Bradyrhizobium sp. LM2.9	Isolate	Nodule
770	8016583857	Bradyrhizobium sp. LM2.7	Isolate	Nodule
771	8016595262	Bradyrhizobium sp. LM2.3	Isolate	Nodule
772	8016603502	Bradyrhizobium sp. LB7.2	Isolate	Nodule
773	8016613128	Bradyrhizobium sp. LB7.1	Isolate	Nodule
774	8016622563	Bradyrhizobium sp. LB13.1	Isolate	Nodule
775	8016630954	Bradyrhizobium sp. F1.13.1	Isolate	Nodule
776	8017057580	Bradyrhizobium sp. S3.7.6	Isolate	Nodule
777	8019530166	Bradyrhizobium sp. LM4.3	Isolate	Nodule
778	8019538911	Bradyrhizobium sp. LB9.1b	Isolate	Nodule
779	8019547302	Bradyrhizobium sp. LB1.3	Isolate	Nodule
780	8019576017	Bradyrhizobium sp. i1.7.7	Isolate	Nodule
781	8019597564	Bradyrhizobium sp. i1.3.6	Isolate	Nodule
782	8019608314	Bradyrhizobium sp. i1.3.1	Isolate	Nodule
783	8019619141	Bradyrhizobium sp. GM7.3	Isolate	Nodule
784	8019629233	Bradyrhizobium sp. GM6.1	Isolate	Nodule
785	8019638758	Bradyrhizobium sp. GM5.1	Isolate	Nodule
786	8019648815	Bradyrhizobium sp. GM24.11	Isolate	Nodule
787	8019668869	Bradyrhizobium sp. GM2.4	Isolate	Nodule
788	8019678201	Bradyrhizobium sp. GM0.4	Isolate	Nodule
789	8019687851	Bradyrhizobium sp. F1.13.4	Isolate	Nodule
790	8055742211	Bradyrhizobium japonicum 5038	Isolate	Nodule
791	8056673599	Bradyrhizobium hereditatis WSM 1738	Isolate	Nodule
792	8056681323	Bradyrhizobium cenepequi CNPSo 4026	Isolate	Nodule
793	8056689827	Bradyrhizobium semiaridum WSM 1704	Isolate	Nodule
794	8056967851	Bradyrhizobium zhengyangense WYCCWR 12678	Isolate	Nodule

Type Distribution

Type	Percentage (%)
Metagenomes	88.1
Metatranscriptomes	0.11
Isolates	11.79

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	10.62
Nodule	9.35
Rhizoplane	5.75
Rhizosphere	67.15
Stem	0
Stem Tuber	0
Unclassified	0

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	Ga0496115_0672631	3300048918	Bacteria	816
2	2214911863	2209111006	Bacteria	6897
3	ARcpr5oldR_c000133	3300000041	Bacteria	12591
4	ARSoilYngRDRAFT_c00291	3300000042	Bacteria	7340
5	ARcpr5yngRDRAFT_c000655	3300000043	Bacteria	4330
6	ARSoilOldRDRAFT_c000255	3300000044	Bacteria	7753
7	ARCol0oldRDRAFT_c00602	3300000045	Bacteria	3181
8	ARCol0yngRDRAFT_1000207	3300000652	Bacteria	9953
9	JGI24746J21847_1002330	3300001977	Bacteria	3035
10	JGI24747J21853_1001618	3300001978	Bacteria	1717
11	JGI24740J21852_10008161	3300001979	Bacteria	4197
12	JGI24739J22299_10002133	3300001989	Bacteria	7581
13	JGI24739J22299_10014522	3300001989	Bacteria	2865
14	JGI24737J22298_10006524	3300001990	Bacteria	3980
15	JGI24735J21928_10015500	3300002067	Bacteria	2377
16	JGI24750J21931_1000306	3300002070	Bacteria	8424
17	JGI24738J21930_10016858	3300002075	Bacteria	1539
18	JGI24738J21930_10035803	3300002075	Bacteria	1011
19	JGI24738J21930_10036983	3300002075	Bacteria	993
20	JGI24749J21850_1006556	3300002076	Bacteria	1621
21	JGI24034J26672_10000938	3300002239	Bacteria	3791
22	JGI24742J22300_10002042	3300002244	Bacteria	3221
23	JGI25406J46586_10031728	3300003203	Bacteria	1972
24	JGI25153J46596_10001604	3300003215	Bacteria	13406
25	JGI25153J46596_10002291	3300003215	Bacteria	11151
26	JGI25153J46596_10007925	3300003215	Bacteria	5150
27	JGI25153J46596_10008998	3300003215	Bacteria	4701
28	JGI25160J50197_1005286	3300003354	Bacteria	5401
29	JGI25160J50197_1014867	3300003354	Bacteria	2580
30	JGI25404J52841_10010453	3300003659	Bacteria	1995
31	JGI25404J52841_10021243	3300003659	Bacteria	1406
32	Ga0055542_1008419	3300003762	Bacteria	2022
33	Ga0055529_1005529	3300003763	Bacteria	1818
34	Ga0055524_1045134	3300003775	Bacteria	1064
35	Ga0055531_10005524	3300003794	Bacteria	7383
36	Ga0055531_10007473	3300003794	Bacteria	5954
37	Ga0055543_1002707	3300004625	Bacteria	5668
38	Ga0065165_1005568	3300005262	Bacteria	7001
39	Ga0065165_1005760	3300005262	Bacteria	6795
40	Ga0065717_1005363	3300005276	Bacteria	897
41	Ga0065716_1001632	3300005277	Bacteria	4804
42	Ga0065704_10006824	3300005289	Bacteria	3982
43	Ga0065712_10089599	3300005290	Bacteria	2462
44	Ga0065715_10008670	3300005293	Bacteria	2483
45	Ga0070658_10015577	3300005327	Bacteria	6080
46	Ga0070658_10036212	3300005327	Bacteria	3977
47	Ga0070676_10015450	3300005328	Bacteria	4212
48	Ga0070676_10052710	3300005328	Bacteria	2393
49	Ga0070676_10089122	3300005328	Bacteria	1887
50	Ga0070683_100014076	3300005329	Bacteria	6987
51	Ga0070683_100048868	3300005329	Bacteria	3911
52	Ga0070690_100009976	3300005330	Bacteria	5512
53	Ga0070690_100027758	3300005330	Bacteria	3501
54	Ga0070690_100066780	3300005330	Bacteria	2329
55	Ga0070690_100111027	3300005330	Bacteria	1829
56	Ga0070670_100415516	3300005331	Bacteria	1189
57	Ga0070670_100924178	3300005331	Bacteria	791
58	Ga0070677_10197425	3300005333	Bacteria	969
59	Ga0068869_100005362	3300005334	Bacteria	8057
60	Ga0068869_100317735	3300005334	Bacteria	1262
61	Ga0070666_10089682	3300005335	Bacteria	2111
62	Ga0070680_100090465	3300005336	Bacteria	2534
63	Ga0070680_100152353	3300005336	Bacteria	1941
64	Ga0070680_100848572	3300005336	Bacteria	787
65	Ga0070682_100697350	3300005337	Bacteria	814
66	Ga0068868_100035101	3300005338	Bacteria	3874
67	Ga0068868_100298087	3300005338	Bacteria	1369
68	Ga0068868_100562192	3300005338	Bacteria	1006
69	Ga0068868_100882916	3300005338	Bacteria	811
70	Ga0070660_100040041	3300005339	Bacteria	3564
71	Ga0070660_100167888	3300005339	Bacteria	1771
72	Ga0070660_100416169	3300005339	Bacteria	1112
73	Ga0070689_100040860	3300005340	Bacteria	3557
74	Ga0070689_100131274	3300005340	Bacteria	2009
75	Ga0070691_10087613	3300005341	Bacteria	1531
76	Ga0070687_100054857	3300005343	Bacteria	2078
77	Ga0070687_100357555	3300005343	Bacteria	944
78	Ga0070661_100088583	3300005344	Bacteria	2291
79	Ga0070661_100280880	3300005344	Bacteria	1291
80	Ga0070661_100347137	3300005344	Bacteria	1164
81	Ga0070692_10068790	3300005345	Bacteria	1882
82	Ga0070692_10104648	3300005345	Bacteria	1556
83	Ga0070668_100103090	3300005347	Bacteria	2263
84	Ga0070668_100184183	3300005347	Bacteria	1707
85	Ga0070668_100219502	3300005347	Bacteria	1567
86	Ga0070668_100237557	3300005347	Bacteria	1508
87	Ga0070668_100408606	3300005347	Bacteria	1160
88	Ga0070668_100946368	3300005347	Bacteria	772
89	Ga0070669_100009523	3300005353	Bacteria	6917
90	Ga0070669_100113283	3300005353	Bacteria	2060
91	Ga0070669_100280062	3300005353	Bacteria	1336
92	Ga0070675_100034164	3300005354	Bacteria	4126
93	Ga0070675_100785894	3300005354	Bacteria	870
94	Ga0070671_100018470	3300005355	Bacteria	5664
95	Ga0070671_100055481	3300005355	Bacteria	3296
96	Ga0070671_100116779	3300005355	Bacteria	2243
97	Ga0070671_100131073	3300005355	Bacteria	2112
98	Ga0070671_100348255	3300005355	Bacteria	1264
99	Ga0070671_101013859	3300005355	Bacteria	728
100	Ga0070674_100931401	3300005356	Bacteria	759
101	Ga0070673_100006016	3300005364	Bacteria	7853
102	Ga0070673_100018157	3300005364	Bacteria	5020
103	Ga0070688_100054184	3300005365	Bacteria	2511
104	Ga0070688_100090194	3300005365	Bacteria	2001
105	Ga0070688_100221599	3300005365	Bacteria	1333
106	Ga0070688_100435879	3300005365	Bacteria	977
107	Ga0070688_100677469	3300005365	Bacteria	796
108	Ga0070659_100099578	3300005366	Bacteria	2338
109	Ga0070659_100101942	3300005366	Bacteria	2310
110	Ga0070659_100207172	3300005366	Bacteria	1615
111	Ga0070659_100397832	3300005366	Bacteria	1162
112	Ga0070667_100039791	3300005367	Bacteria	3941
113	Ga0070667_100107058	3300005367	Bacteria	2420
114	Ga0070667_100163512	3300005367	Bacteria	1962
115	Ga0070667_100221243	3300005367	Bacteria	1685
116	Ga0070667_100913355	3300005367	Bacteria	818
117	Ga0070709_10008600	3300005434	Bacteria	5612
118	Ga0070709_10428499	3300005434	Bacteria	993
119	Ga0070709_10513607	3300005434	Bacteria	912
120	Ga0070714_100134185	3300005435	Bacteria	2215
121	Ga0070714_100227095	3300005435	Bacteria	1718
122	Ga0070714_100276899	3300005435	Bacteria	1558
123	Ga0070713_100052651	3300005436	Bacteria	3370
124	Ga0070713_100072884	3300005436	Bacteria	2906
125	Ga0070713_100089043	3300005436	Bacteria	2651
126	Ga0070713_100409266	3300005436	Bacteria	1268
127	Ga0070710_10092909	3300005437	Bacteria	1783
128	Ga0070710_10185989	3300005437	Bacteria	1304
129	Ga0070701_10121852	3300005438	Bacteria	1470
130	Ga0070701_10170190	3300005438	Bacteria	1268
131	Ga0070711_100087269	3300005439	Bacteria	2239
132	Ga0070711_100769677	3300005439	Bacteria	815
133	Ga0070705_100019679	3300005440	Bacteria	3557
134	Ga0070705_100165611	3300005440	Bacteria	1482
135	Ga0070705_100918351	3300005440	Bacteria	705
136	Ga0070700_100674932	3300005441	Bacteria	818
137	Ga0070708_100544521	3300005445	Bacteria	1095
138	Ga0070663_100002910	3300005455	Bacteria	9738
139	Ga0070663_100049267	3300005455	Bacteria	2990
140	Ga0070663_100051460	3300005455	Bacteria	2934
141	Ga0070663_100064014	3300005455	Bacteria	2657
142	Ga0070663_100146590	3300005455	Bacteria	1806
143	Ga0070663_100239861	3300005455	Bacteria	1430
144	Ga0070663_100449802	3300005455	Bacteria	1061
145	Ga0070663_100511551	3300005455	Bacteria	998
146	Ga0070678_100029230	3300005456	Bacteria	3771
147	Ga0070678_100123916	3300005456	Bacteria	2042
148	Ga0070678_100272630	3300005456	Bacteria	1428
149	Ga0070678_100281527	3300005456	Bacteria	1406
150	Ga0070678_100294563	3300005456	Bacteria	1377
151	Ga0070662_100594283	3300005457	Bacteria	930
152	Ga0070681_10040915	3300005458	Bacteria	4643
153	Ga0068867_100024117	3300005459	Bacteria	4359
154	Ga0068867_100266579	3300005459	Bacteria	1398
155	Ga0070685_10007220	3300005466	Bacteria	5678
156	Ga0070685_10377599	3300005466	Bacteria	976
157	Ga0070685_10528455	3300005466	Bacteria	839
158	Ga0070685_10658080	3300005466	Bacteria	760
159	Ga0070698_100900917	3300005471	Bacteria	830
160	Ga0070699_100387440	3300005518	Bacteria	1262
161	Ga0070679_100045216	3300005530	Bacteria	4388
162	Ga0070679_100870406	3300005530	Bacteria	844
163	Ga0070684_100041708	3300005535	Bacteria	3958
164	Ga0070684_100056864	3300005535	Bacteria	3415
165	Ga0070684_100427083	3300005535	Bacteria	1224
166	Ga0070684_100834814	3300005535	Bacteria	862
167	Ga0070684_100913162	3300005535	Bacteria	823
168	Ga0068853_100029132	3300005539	Bacteria	4651
169	Ga0068853_100037194	3300005539	Bacteria	4141
170	Ga0068853_100154051	3300005539	Bacteria	2070
171	Ga0068853_100176657	3300005539	Bacteria	1935
172	Ga0068853_100178589	3300005539	Bacteria	1924
173	Ga0068853_100216523	3300005539	Bacteria	1747
174	Ga0068853_100286910	3300005539	Bacteria	1518
175	Ga0070672_100074275	3300005543	Bacteria	2712
176	Ga0070672_101216951	3300005543	Bacteria	671
177	Ga0070686_100138899	3300005544	Bacteria	1689
178	Ga0070686_100140554	3300005544	Bacteria	1680
179	Ga0070695_100007606	3300005545	Bacteria	6419
180	Ga0070695_100143920	3300005545	Bacteria	1656
181	Ga0070696_100764698	3300005546	Bacteria	793
182	Ga0070693_100068169	3300005547	Bacteria	2088
183	Ga0070693_100150542	3300005547	Bacteria	1473
184	Ga0070693_100157753	3300005547	Bacteria	1443
185	Ga0070693_100454721	3300005547	Bacteria	899
186	Ga0070665_100028785	3300005548	Bacteria	5594
187	Ga0070665_100029858	3300005548	Bacteria	5486
188	Ga0070665_100116177	3300005548	Bacteria	2678
189	Ga0070665_100119192	3300005548	Bacteria	2641
190	Ga0070665_100218932	3300005548	Bacteria	1904
191	Ga0070665_100329012	3300005548	Bacteria	1532
192	Ga0070665_100427495	3300005548	Bacteria	1333
193	Ga0070665_100432315	3300005548	Bacteria	1325
194	Ga0070665_100501426	3300005548	Bacteria	1225
195	Ga0070704_100050220	3300005549	Bacteria	2930
196	Ga0070704_100306814	3300005549	Bacteria	1324
197	Ga0070704_100328155	3300005549	Bacteria	1284
198	Ga0068855_100043022	3300005563	Bacteria	5352
199	Ga0068855_100076846	3300005563	Bacteria	3874
200	Ga0068855_100082873	3300005563	Bacteria	3716
201	Ga0068855_100180572	3300005563	Bacteria	2386
202	Ga0068855_100745078	3300005563	Bacteria	1045
203	Ga0070664_100190239	3300005564	Bacteria	1828
204	Ga0070664_100231718	3300005564	Bacteria	1655
205	Ga0070664_100353167	3300005564	Bacteria	1338
206	Ga0070664_100934811	3300005564	Bacteria	814
207	Ga0068857_100003131	3300005577	Bacteria	13690
208	Ga0068857_100016900	3300005577	Bacteria	6393
209	Ga0068857_100048283	3300005577	Bacteria	3779
210	Ga0068857_100111718	3300005577	Bacteria	2457
211	Ga0068857_100633257	3300005577	Bacteria	1012
212	Ga0068854_100009446	3300005578	Bacteria	6297
213	Ga0068854_100025141	3300005578	Bacteria	4085
214	Ga0068854_100110432	3300005578	Bacteria	2073
215	Ga0068854_100211228	3300005578	Bacteria	1531
216	Ga0068856_100048827	3300005614	Bacteria	4171
217	Ga0068856_100052613	3300005614	Bacteria	4016
218	Ga0068856_100085326	3300005614	Bacteria	3136
219	Ga0068856_100174867	3300005614	Bacteria	2159
220	Ga0068856_100175839	3300005614	Bacteria	2153
221	Ga0068856_100559691	3300005614	Bacteria	1165
222	Ga0068856_100909849	3300005614	Bacteria	899
223	Ga0068856_101037630	3300005614	Bacteria	838
224	Ga0070702_100033101	3300005615	Bacteria	2840
225	Ga0068852_100050524	3300005616	Bacteria	3563
226	Ga0068852_100207146	3300005616	Bacteria	1858
227	Ga0068852_100223772	3300005616	Bacteria	1791
228	Ga0068852_100317394	3300005616	Bacteria	1512
229	Ga0068852_100426684	3300005616	Bacteria	1309
230	Ga0068852_100469452	3300005616	Bacteria	1249
231	Ga0068852_100614239	3300005616	Bacteria	1092
232	Ga0068859_100013930	3300005617	Bacteria	8068
233	Ga0068859_100087512	3300005617	Bacteria	3163
234	Ga0068859_100408141	3300005617	Bacteria	1454
235	Ga0068864_100000501	3300005618	Bacteria	33748
236	Ga0068864_100059311	3300005618	Bacteria	3310
237	Ga0068864_100107715	3300005618	Bacteria	2479
238	Ga0068864_100140430	3300005618	Bacteria	2178
239	Ga0068864_100594319	3300005618	Bacteria	1073
240	Ga0068864_101241109	3300005618	Bacteria	745
241	Ga0068866_10009096	3300005718	Bacteria	4210
242	Ga0068866_10081275	3300005718	Bacteria	1740
243	Ga0068866_10498061	3300005718	Bacteria	806
244	Ga0068861_100108219	3300005719	Bacteria	2223
245	Ga0068861_100137095	3300005719	Bacteria	1992
246	Ga0068861_100172566	3300005719	Bacteria	1793
247	Ga0068851_10001649	3300005834	Bacteria	9784
248	Ga0068851_10048827	3300005834	Bacteria	2145
249	Ga0068870_10017790	3300005840	Bacteria	3420
250	Ga0068870_10789204	3300005840	Bacteria	663
251	Ga0068863_100001487	3300005841	Bacteria	23230
252	Ga0068863_100114649	3300005841	Bacteria	2567
253	Ga0068863_100641427	3300005841	Bacteria	1053
254	Ga0068863_100880978	3300005841	Bacteria	895
255	Ga0068863_101239055	3300005841	Bacteria	752
256	Ga0068858_100008725	3300005842	Bacteria	9733
257	Ga0068858_100160649	3300005842	Bacteria	2116
258	Ga0068858_100205803	3300005842	Bacteria	1862
259	Ga0068858_100362857	3300005842	Bacteria	1388
260	Ga0068858_100568185	3300005842	Bacteria	1098
261	Ga0068858_100635724	3300005842	Bacteria	1036
262	Ga0068860_100087752	3300005843	Bacteria	2961
263	Ga0068860_100196348	3300005843	Bacteria	1954
264	Ga0068860_100495997	3300005843	Bacteria	1219
265	Ga0068860_100971666	3300005843	Bacteria	867
266	Ga0068860_101021522	3300005843	Bacteria	845
267	Ga0068862_100130981	3300005844	Bacteria	2218
268	Ga0068862_100194451	3300005844	Bacteria	1827
269	Ga0081455_10013105	3300005937	Bacteria	8218
270	Ga0081455_10028472	3300005937	Bacteria	5105
271	Ga0081455_10058469	3300005937	Bacteria	3262
272	Ga0081455_10062151	3300005937	Bacteria	3140
273	Ga0081455_10134396	3300005937	Bacteria	1930
274	Ga0081455_10448569	3300005937	Bacteria	882
275	Ga0081538_10001497	3300005981	Bacteria	23974
276	Ga0081538_10024144	3300005981	Bacteria	4339
277	Ga0081540_1001924	3300005983	Bacteria	17404
278	Ga0081540_1003483	3300005983	Bacteria	12420
279	Ga0081540_1003507	3300005983	Bacteria	12383
280	Ga0081540_1003700	3300005983	Bacteria	11979
281	Ga0081540_1005593	3300005983	Bacteria	9355
282	Ga0081540_1015557	3300005983	Bacteria	4812
283	Ga0081540_1020696	3300005983	Bacteria	3946
284	Ga0081540_1021821	3300005983	Bacteria	3798
285	Ga0081540_1028835	3300005983	Bacteria	3106
286	Ga0081540_1031643	3300005983	Bacteria	2904
287	Ga0081540_1120057	3300005983	Bacteria	1093
288	Ga0081539_10000902	3300005985	Bacteria	56412
289	Ga0081539_10027917	3300005985	Bacteria	3562
290	Ga0081539_10057458	3300005985	Bacteria	2153
291	Ga0081539_10064732	3300005985	Bacteria	1988
292	Ga0070717_10002469	3300006028	Bacteria	13054
293	Ga0070717_10009912	3300006028	Bacteria	7170
294	Ga0075365_10063057	3300006038	Bacteria	2481
295	Ga0075365_10086275	3300006038	Bacteria	2133
296	Ga0075365_10169763	3300006038	Bacteria	1522
297	Ga0075365_10307594	3300006038	Bacteria	1116
298	Ga0075365_10356903	3300006038	Bacteria	1030
299	Ga0075368_10001108	3300006042	Bacteria	8493
300	Ga0075368_10002847	3300006042	Bacteria	5710
301	Ga0075368_10054261	3300006042	Bacteria	1596
302	Ga0075368_10090766	3300006042	Bacteria	1249
303	Ga0075368_10175460	3300006042	Bacteria	902
304	Ga0075363_100000927	3300006048	Bacteria	10358
305	Ga0075363_100060388	3300006048	Bacteria	2041
306	Ga0075363_100061555	3300006048	Bacteria	2023
307	Ga0075363_100190898	3300006048	Bacteria	1168
308	Ga0075364_10008079	3300006051	Bacteria	6275
309	Ga0075364_10050941	3300006051	Bacteria	2703
310	Ga0075364_10292635	3300006051	Bacteria	1108
311	Ga0070715_10062008	3300006163	Bacteria	1644
312	Ga0070712_100172423	3300006175	Bacteria	1680
313	Ga0075362_10061018	3300006177	Bacteria	1705
314	Ga0075362_10102719	3300006177	Bacteria	1338
315	Ga0075362_10186107	3300006177	Bacteria	1007
316	Ga0075367_10004564	3300006178	Bacteria	6776
317	Ga0075367_10009741	3300006178	Bacteria	5031
318	Ga0075367_10036765	3300006178	Bacteria	2841
319	Ga0075367_10153038	3300006178	Bacteria	1432
320	Ga0075367_10187760	3300006178	Bacteria	1289
321	Ga0075367_10195404	3300006178	Bacteria	1263
322	Ga0075367_10196260	3300006178	Bacteria	1260
323	Ga0075369_10073524	3300006186	Bacteria	1507
324	Ga0075369_10097144	3300006186	Bacteria	1319
325	Ga0075369_10107742	3300006186	Bacteria	1254
326	Ga0075369_10147979	3300006186	Bacteria	1073
327	Ga0075366_10046923	3300006195	Bacteria	2560
328	Ga0075366_10050585	3300006195	Bacteria	2468
329	Ga0075366_10319496	3300006195	Bacteria	951
330	Ga0097621_100022827	3300006237	Bacteria	4861
331	Ga0097621_100515650	3300006237	Bacteria	1084
332	Ga0097621_100655409	3300006237	Bacteria	963
333	Ga0097621_101068740	3300006237	Bacteria	757
334	Ga0075370_10017300	3300006353	Bacteria	3894
335	Ga0075370_10041149	3300006353	Bacteria	2608
336	Ga0075370_10181981	3300006353	Bacteria	1237
337	Ga0075370_10274611	3300006353	Bacteria	1001
338	Ga0075370_10422841	3300006353	Bacteria	801
339	Ga0068871_100099573	3300006358	Bacteria	2433
340	Ga0068871_100481333	3300006358	Bacteria	1116
341	Ga0075428_100097833	3300006844	Bacteria	3199
342	Ga0075431_100092449	3300006847	Bacteria	3122
343	Ga0075431_100186659	3300006847	Bacteria	2126
344	Ga0075433_10269939	3300006852	Bacteria	1508
345	Ga0068865_100044064	3300006881	Bacteria	3052
346	Ga0068865_100110189	3300006881	Bacteria	2030
347	Ga0068865_100628337	3300006881	Bacteria	910
348	Ga0075436_100143930	3300006914	Bacteria	1676
349	Ga0097620_100013930	3300006931	Bacteria	8068
350	Ga0097620_100087516	3300006931	Bacteria	3163
351	Ga0097620_100408153	3300006931	Bacteria	1454
352	Ga0099825_1032185	3300006941	Bacteria	2152
353	Ga0099824_1009990	3300006942	Bacteria	11429
354	Ga0075435_100134829	3300007076	Bacteria	2067
355	Ga0075435_100179331	3300007076	Bacteria	1790
356	Ga0099795_10117307	3300007788	Bacteria	1061
357	Ga0105251_10093367	3300009011	Bacteria	1380
358	Ga0105244_10020920	3300009036	Bacteria	3625
359	Ga0105250_10026210	3300009092	Bacteria	2348
360	Ga0105240_10002869	3300009093	Bacteria	27260
361	Ga0105240_10005590	3300009093	Bacteria	18678
362	Ga0105240_10175899	3300009093	Bacteria	2530
363	Ga0105240_10203680	3300009093	Bacteria	2317
364	Ga0105240_10208525	3300009093	Bacteria	2285
365	Ga0105240_10481297	3300009093	Bacteria	1384
366	Ga0105240_11110202	3300009093	Bacteria	841
367	Ga0111539_10004905	3300009094	Bacteria	17416
368	Ga0111539_10094534	3300009094	Bacteria	3512
369	Ga0111539_10530111	3300009094	Bacteria	1372
370	Ga0111539_11271021	3300009094	Bacteria	854
371	Ga0105245_10013591	3300009098	Bacteria	7092
372	Ga0105245_10188048	3300009098	Bacteria	1976
373	Ga0105245_10270594	3300009098	Bacteria	1657
374	Ga0105245_10372016	3300009098	Bacteria	1421
375	Ga0105247_10033384	3300009101	Bacteria	3130
376	Ga0105247_10246097	3300009101	Bacteria	1220
377	Ga0105247_10782551	3300009101	Bacteria	726
378	Ga0114129_10128894	3300009147	Bacteria	3476
379	Ga0114129_10154066	3300009147	Bacteria	3144
380	Ga0114129_10234985	3300009147	Bacteria	2467
381	Ga0105243_10027119	3300009148	Bacteria	4388
382	Ga0105243_10259638	3300009148	Bacteria	1555
383	Ga0105243_10390440	3300009148	Bacteria	1290
384	Ga0105243_10552937	3300009148	Bacteria	1100
385	Ga0105241_10012442	3300009174	Bacteria	6237
386	Ga0105241_10031939	3300009174	Bacteria	3943
387	Ga0105241_10036477	3300009174	Bacteria	3700
388	Ga0105241_10051683	3300009174	Bacteria	3135
389	Ga0105241_10327541	3300009174	Bacteria	1323
390	Ga0105241_10478148	3300009174	Bacteria	1107
391	Ga0105241_10524537	3300009174	Bacteria	1060
392	Ga0105242_10036698	3300009176	Bacteria	3933
393	Ga0105248_10070776	3300009177	Bacteria	3917
394	Ga0105248_10100059	3300009177	Bacteria	3267
395	Ga0105248_10354898	3300009177	Bacteria	1651
396	Ga0105248_10398030	3300009177	Bacteria	1551
397	Ga0105237_10053520	3300009545	Bacteria	4048
398	Ga0105237_10141670	3300009545	Bacteria	2398
399	Ga0105237_10604311	3300009545	Bacteria	1104
400	Ga0105238_10003573	3300009551	Bacteria	15499
401	Ga0105238_10051142	3300009551	Bacteria	4156
402	Ga0105238_10202973	3300009551	Bacteria	1958
403	Ga0105238_10236890	3300009551	Bacteria	1802
404	Ga0105238_10294543	3300009551	Bacteria	1605
405	Ga0105238_10344350	3300009551	Bacteria	1479
406	Ga0105238_10745575	3300009551	Bacteria	993
407	Ga0105238_11302977	3300009551	Bacteria	752
408	Ga0105249_10137615	3300009553	Bacteria	2339
409	Ga0099796_10059076	3300010159	Bacteria	1353
410	Ga0099796_10088345	3300010159	Bacteria	1148
411	Ga0099796_10093277	3300010159	Bacteria	1122
412	Ga0105239_10077327	3300010375	Bacteria	3662
413	Ga0105239_10078453	3300010375	Bacteria	3634
414	Ga0105239_10155502	3300010375	Bacteria	2553
415	Ga0105239_10175241	3300010375	Bacteria	2398
416	Ga0105239_10193691	3300010375	Bacteria	2276
417	Ga0105239_10687272	3300010375	Bacteria	1170
418	Ga0105239_10729634	3300010375	Bacteria	1134
419	Ga0105239_10938440	3300010375	Bacteria	994
420	Ga0105239_11262763	3300010375	Bacteria	852
421	Ga0105246_10037876	3300011119	Bacteria	3238
422	Ga0105246_10041752	3300011119	Bacteria	3102
423	Ga0105246_10054890	3300011119	Bacteria	2747
424	Ga0105246_10148416	3300011119	Bacteria	1772
425	Ga0157335_1000327	3300012492	Bacteria	2093
426	Ga0157342_1001487	3300012507	Bacteria	1750
427	Ga0157373_10872817	3300013100	Bacteria	666
428	Ga0157371_10043766	3300013102	Bacteria	3188
429	Ga0157371_10060376	3300013102	Bacteria	2689
430	Ga0157371_10520451	3300013102	Bacteria	880
431	Ga0157370_10066426	3300013104	Bacteria	3411
432	Ga0157370_10329548	3300013104	Bacteria	1408
433	Ga0157370_11203856	3300013104	Bacteria	683
434	Ga0157369_11544308	3300013105	Bacteria	675
435	Ga0157374_10008247	3300013296	Bacteria	8898
436	Ga0157374_10046569	3300013296	Bacteria	4017
437	Ga0157374_10071735	3300013296	Bacteria	3266
438	Ga0157374_10136090	3300013296	Bacteria	2382
439	Ga0157378_10087734	3300013297	Bacteria	2822
440	Ga0157378_11532830	3300013297	Bacteria	711
441	Ga0157378_12031012	3300013297	Bacteria	625
442	Ga0163162_10025808	3300013306	Bacteria	5808
443	Ga0163162_10064631	3300013306	Bacteria	3704
444	Ga0163162_10660475	3300013306	Bacteria	1169
445	Ga0163162_10672659	3300013306	Bacteria	1158
446	Ga0163162_10802306	3300013306	Bacteria	1059
447	Ga0163162_11146949	3300013306	Bacteria	881
448	Ga0157372_10052804	3300013307	Bacteria	4527
449	Ga0157372_10799747	3300013307	Bacteria	1096
450	Ga0157375_10003919	3300013308	Bacteria	12910
451	Ga0157375_10122365	3300013308	Bacteria	2713
452	Ga0157375_10533056	3300013308	Bacteria	1337
453	Ga0157375_10687289	3300013308	Bacteria	1177
454	Ga0157375_11223191	3300013308	Bacteria	882
455	Ga0163163_10001518	3300014325	Bacteria	19614
456	Ga0163163_10006923	3300014325	Bacteria	9955
457	Ga0163163_10019540	3300014325	Bacteria	6363
458	Ga0163163_10174446	3300014325	Bacteria	2196
459	Ga0163163_10322527	3300014325	Bacteria	1598
460	Ga0163163_11327748	3300014325	Bacteria	781
461	Ga0157380_10393451	3300014326	Bacteria	1312
462	Ga0157380_10453269	3300014326	Bacteria	1232
463	Ga0182008_10418122	3300014497	Bacteria	723
464	Ga0157377_10047910	3300014745	Bacteria	2396
465	Ga0157377_10279935	3300014745	Bacteria	1093
466	Ga0157377_10302362	3300014745	Bacteria	1056
467	Ga0157379_10047563	3300014968	Bacteria	3827
468	Ga0157379_10162444	3300014968	Bacteria	2016
469	Ga0157379_10504128	3300014968	Bacteria	1122
470	Ga0157376_10034361	3300014969	Bacteria	4094
471	Ga0157376_10312044	3300014969	Bacteria	1492
472	Ga0157376_10813144	3300014969	Bacteria	948
473	Ga0163161_10035313	3300017792	Bacteria	3578
474	Ga0206350_10496500	3300020080	Bacteria	1010
475	Ga0214544_1000007	3300021320	Bacteria	379989
476	Ga0214542_1000007	3300021321	Bacteria	291816
477	Ga0214545_1000006	3300021324	Bacteria	291693
478	Ga0214543_1000009	3300021327	Bacteria	384302
479	Ga0213872_10024035	3300021361	Bacteria	2803
480	Ga0213872_10130788	3300021361	Bacteria	1106
481	Ga0213874_10060029	3300021377	Bacteria	1189
482	Ga0213876_10266907	3300021384	Bacteria	910
483	Ga0213875_10033755	3300021388	Bacteria	2418
484	Ga0213871_10000146	3300021441	Bacteria	7325
485	Ga0209563_101691	3300025230	Bacteria	5589
486	Ga0209677_101315	3300025253	Bacteria	10976
487	Ga0209148_1000645	3300025254	Bacteria	30288
488	Ga0209233_1001380	3300025261	Bacteria	9636
489	Ga0209233_1003243	3300025261	Bacteria	5767
490	Ga0209233_1037669	3300025261	Bacteria	1073
491	Ga0209455_1002521	3300025272	Bacteria	7020
492	Ga0207673_1001791	3300025290	Bacteria	2386
493	Ga0209564_1000384	3300025295	Bacteria	80490
494	Ga0209564_1009905	3300025295	Bacteria	4462
495	Ga0209758_1000015	3300025297	Bacteria	851943
496	Ga0209758_1000389	3300025297	Bacteria	75919
497	Ga0209758_1000716	3300025297	Bacteria	48984
498	Ga0209758_1001056	3300025297	Bacteria	36006
499	Ga0209758_1003447	3300025297	Bacteria	14374
500	Ga0209758_1010182	3300025297	Bacteria	5679
501	Ga0209758_1029178	3300025297	Bacteria	2313
502	Ga0209256_1008939	3300025299	Bacteria	4509
503	Ga0209256_1018664	3300025299	Bacteria	2241
504	Ga0209256_1059422	3300025299	Bacteria	895
505	Ga0207426_1000380	3300025302	Bacteria	76046
506	Ga0207426_1002496	3300025302	Bacteria	11628
507	Ga0207426_1012053	3300025302	Bacteria	3265
508	Ga0209257_1001378	3300025304	Bacteria	29161
509	Ga0207697_10002563	3300025315	Bacteria	9356
510	Ga0207697_10009251	3300025315	Bacteria	4262
511	Ga0207697_10059109	3300025315	Bacteria	1593
512	Ga0207697_10194223	3300025315	Bacteria	892
513	Ga0207656_10001912	3300025321	Bacteria	6929
514	Ga0207682_10002547	3300025893	Bacteria	8133
515	Ga0207682_10231886	3300025893	Bacteria	856
516	Ga0207692_10089754	3300025898	Bacteria	1664
517	Ga0207642_10103933	3300025899	Bacteria	1432
518	Ga0207642_10194177	3300025899	Bacteria	1116
519	Ga0207710_10044132	3300025900	Bacteria	1985
520	Ga0207688_10000420	3300025901	Bacteria	19959
521	Ga0207688_10017559	3300025901	Bacteria	3889
522	Ga0207688_10050406	3300025901	Bacteria	2330
523	Ga0207688_10050480	3300025901	Bacteria	2329
524	Ga0207688_10174879	3300025901	Bacteria	1278
525	Ga0207680_10490956	3300025903	Bacteria	874
526	Ga0207680_10511850	3300025903	Bacteria	855
527	Ga0207647_10001208	3300025904	Bacteria	19845
528	Ga0207647_10016448	3300025904	Bacteria	5049
529	Ga0207647_10079788	3300025904	Bacteria	1964
530	Ga0207645_10006423	3300025907	Bacteria	8438
531	Ga0207645_10100017	3300025907	Bacteria	1870
532	Ga0207645_10433108	3300025907	Bacteria	887
533	Ga0207643_10000085	3300025908	Bacteria	61372
534	Ga0207643_10032606	3300025908	Bacteria	2910
535	Ga0207705_10029513	3300025909	Bacteria	3909
536	Ga0207705_10371550	3300025909	Bacteria	1104
537	Ga0207705_10432624	3300025909	Bacteria	1019
538	Ga0207654_10016717	3300025911	Bacteria	3823
539	Ga0207654_10021104	3300025911	Bacteria	3460
540	Ga0207654_10030175	3300025911	Bacteria	2974
541	Ga0207654_10235208	3300025911	Bacteria	1222
542	Ga0207654_10346568	3300025911	Bacteria	1022
543	Ga0207654_10412185	3300025911	Bacteria	941
544	Ga0207707_10141145	3300025912	Bacteria	2106
545	Ga0207707_10345952	3300025912	Bacteria	1281
546	Ga0207695_10000065	3300025913	Bacteria	336949
547	Ga0207695_10000463	3300025913	Bacteria	88316
548	Ga0207695_10051076	3300025913	Bacteria	4344
549	Ga0207695_10066058	3300025913	Bacteria	3717
550	Ga0207695_11075822	3300025913	Bacteria	684
551	Ga0207671_10051470	3300025914	Bacteria	3052
552	Ga0207671_10662964	3300025914	Bacteria	831
553	Ga0207693_10024379	3300025915	Bacteria	4800
554	Ga0207693_10029000	3300025915	Bacteria	4374
555	Ga0207693_10092560	3300025915	Bacteria	2369
556	Ga0207693_10179546	3300025915	Bacteria	1665
557	Ga0207693_10298720	3300025915	Bacteria	1261
558	Ga0207663_10011980	3300025916	Bacteria	4673
559	Ga0207663_10028990	3300025916	Bacteria	3246
560	Ga0207663_10634833	3300025916	Bacteria	842
561	Ga0207660_10111408	3300025917	Bacteria	2060
562	Ga0207660_10413330	3300025917	Bacteria	1087
563	Ga0207662_10021760	3300025918	Bacteria	3668
564	Ga0207657_10031172	3300025919	Bacteria	4833
565	Ga0207657_10090739	3300025919	Bacteria	2550
566	Ga0207657_10163922	3300025919	Bacteria	1804
567	Ga0207649_10141082	3300025920	Bacteria	1649
568	Ga0207649_10220110	3300025920	Bacteria	1352
569	Ga0207649_10248428	3300025920	Bacteria	1280
570	Ga0207649_10443872	3300025920	Bacteria	978
571	Ga0207652_10156845	3300025921	Bacteria	2039
572	Ga0207652_10290508	3300025921	Bacteria	1475
573	Ga0207652_10328042	3300025921	Bacteria	1382
574	Ga0207652_11157539	3300025921	Bacteria	675
575	Ga0207681_10101564	3300025923	Bacteria	2075
576	Ga0207681_10223112	3300025923	Bacteria	1459
577	Ga0207681_10660236	3300025923	Bacteria	867
578	Ga0207694_10000234	3300025924	Bacteria	53453
579	Ga0207694_10060225	3300025924	Bacteria	2954
580	Ga0207694_10084867	3300025924	Bacteria	2491
581	Ga0207694_10428654	3300025924	Bacteria	1102
582	Ga0207650_10018107	3300025925	Bacteria	4939
583	Ga0207659_10007937	3300025926	Bacteria	6563
584	Ga0207659_10049744	3300025926	Bacteria	2974
585	Ga0207687_10007762	3300025927	Bacteria	7038
586	Ga0207687_10041286	3300025927	Bacteria	3167
587	Ga0207687_10144203	3300025927	Bacteria	1810
588	Ga0207687_10270049	3300025927	Bacteria	1359
589	Ga0207700_10007273	3300025928	Bacteria	6756
590	Ga0207700_10341530	3300025928	Bacteria	1302
591	Ga0207664_10071467	3300025929	Bacteria	2795
592	Ga0207664_10117460	3300025929	Bacteria	2221
593	Ga0207664_10905504	3300025929	Bacteria	792
594	Ga0207644_10024752	3300025931	Bacteria	4123
595	Ga0207644_10091140	3300025931	Bacteria	2272
596	Ga0207644_10295385	3300025931	Bacteria	1304
597	Ga0207644_10422523	3300025931	Bacteria	1092
598	Ga0207690_10041750	3300025932	Bacteria	3008
599	Ga0207690_10205636	3300025932	Bacteria	1498
600	Ga0207690_10252474	3300025932	Bacteria	1363
601	Ga0207690_10292065	3300025932	Bacteria	1273
602	Ga0207706_10088251	3300025933	Bacteria	2727
603	Ga0207706_10094123	3300025933	Bacteria	2635
604	Ga0207706_10134965	3300025933	Bacteria	2171
605	Ga0207686_10261568	3300025934	Bacteria	1269
606	Ga0207686_10327329	3300025934	Bacteria	1147
607	Ga0207709_10053693	3300025935	Bacteria	2481
608	Ga0207709_10370573	3300025935	Bacteria	1087
609	Ga0207709_10503279	3300025935	Bacteria	946
610	Ga0207670_10002363	3300025936	Bacteria	9882
611	Ga0207670_10102427	3300025936	Bacteria	2047
612	Ga0207670_10663123	3300025936	Bacteria	861
613	Ga0207670_11084032	3300025936	Bacteria	676
614	Ga0207669_10459115	3300025937	Bacteria	1011
615	Ga0207669_10912080	3300025937	Bacteria	734
616	Ga0207704_10124351	3300025938	Bacteria	1772
617	Ga0207704_10150475	3300025938	Bacteria	1641
618	Ga0207704_10395641	3300025938	Bacteria	1089
619	Ga0207704_10471429	3300025938	Bacteria	1006
620	Ga0207704_10747748	3300025938	Bacteria	813
621	Ga0207665_10066129	3300025939	Bacteria	2460
622	Ga0207691_10020632	3300025940	Bacteria	6229
623	Ga0207691_10050325	3300025940	Bacteria	3815
624	Ga0207691_10894046	3300025940	Bacteria	744
625	Ga0207691_11025331	3300025940	Bacteria	688
626	Ga0207711_10063221	3300025941	Bacteria	3195
627	Ga0207711_10116539	3300025941	Bacteria	2382
628	Ga0207711_10271550	3300025941	Bacteria	1560
629	Ga0207689_10301654	3300025942	Bacteria	1328
630	Ga0207689_10311360	3300025942	Bacteria	1306
631	Ga0207661_10044110	3300025944	Bacteria	3522
632	Ga0207661_10178147	3300025944	Bacteria	1855
633	Ga0207679_10632009	3300025945	Bacteria	967
634	Ga0207679_10866583	3300025945	Bacteria	825
635	Ga0207667_10026572	3300025949	Bacteria	6319
636	Ga0207667_10076155	3300025949	Bacteria	3482
637	Ga0207667_10138057	3300025949	Bacteria	2510
638	Ga0207667_10254262	3300025949	Bacteria	1797
639	Ga0207667_10884633	3300025949	Bacteria	886
640	Ga0207651_10002327	3300025960	Bacteria	9056
641	Ga0207651_10010959	3300025960	Bacteria	5049
642	Ga0207651_10532818	3300025960	Bacteria	1019
643	Ga0207712_10107821	3300025961	Bacteria	2083
644	Ga0207712_10263259	3300025961	Bacteria	1399
645	Ga0207712_10618796	3300025961	Bacteria	938
646	Ga0207668_10070733	3300025972	Bacteria	2489
647	Ga0207668_10170887	3300025972	Bacteria	1704
648	Ga0207668_10834618	3300025972	Bacteria	817
649	Ga0207668_11128067	3300025972	Bacteria	703
650	Ga0207640_10018424	3300025981	Bacteria	4104
651	Ga0207640_10022981	3300025981	Bacteria	3742
652	Ga0207658_10075608	3300025986	Bacteria	2563
653	Ga0207658_10126621	3300025986	Bacteria	2045
654	Ga0207658_10345610	3300025986	Bacteria	1294
655	Ga0207677_10089177	3300026023	Bacteria	2238
656	Ga0207677_10232838	3300026023	Bacteria	1485
657	Ga0207677_10252562	3300026023	Bacteria	1433
658	Ga0207703_10058879	3300026035	Bacteria	3137
659	Ga0207703_10062109	3300026035	Bacteria	3060
660	Ga0207703_10083826	3300026035	Bacteria	2664
661	Ga0207703_10392340	3300026035	Bacteria	1286
662	Ga0207703_10416304	3300026035	Bacteria	1249
663	Ga0207639_10029190	3300026041	Bacteria	4036
664	Ga0207639_10270426	3300026041	Bacteria	1490
665	Ga0207639_10295019	3300026041	Bacteria	1431
666	Ga0207639_10325906	3300026041	Bacteria	1365
667	Ga0207639_10684825	3300026041	Bacteria	950
668	Ga0207639_11407499	3300026041	Bacteria	654
669	Ga0207678_10005146	3300026067	Bacteria	11722
670	Ga0207678_10010843	3300026067	Bacteria	8008
671	Ga0207678_10013588	3300026067	Bacteria	7151
672	Ga0207678_10016226	3300026067	Bacteria	6537
673	Ga0207678_10057915	3300026067	Bacteria	3334
674	Ga0207678_10078637	3300026067	Bacteria	2824
675	Ga0207678_10096321	3300026067	Bacteria	2529
676	Ga0207678_10128205	3300026067	Bacteria	2164
677	Ga0207708_10121050	3300026075	Bacteria	2039
678	Ga0207702_10000098	3300026078	Bacteria	101326
679	Ga0207702_10023104	3300026078	Bacteria	5157
680	Ga0207702_10105618	3300026078	Bacteria	2494
681	Ga0207702_10488414	3300026078	Bacteria	1199
682	Ga0207702_10619569	3300026078	Bacteria	1063
683	Ga0207641_10084753	3300026088	Bacteria	2759
684	Ga0207641_10698471	3300026088	Bacteria	999
685	Ga0207641_11209277	3300026088	Bacteria	755
686	Ga0207641_11271659	3300026088	Bacteria	736
687	Ga0207648_10001362	3300026089	Bacteria	26996
688	Ga0207648_10016972	3300026089	Bacteria	6635
689	Ga0207648_10620474	3300026089	Bacteria	998
690	Ga0207676_10112306	3300026095	Bacteria	2282
691	Ga0207676_10119808	3300026095	Bacteria	2217
692	Ga0207676_10667316	3300026095	Bacteria	1005
693	Ga0207674_10006546	3300026116	Bacteria	13700
694	Ga0207674_10009002	3300026116	Bacteria	11471
695	Ga0207674_10010216	3300026116	Bacteria	10662
696	Ga0207674_10031549	3300026116	Bacteria	5565
697	Ga0207674_10082038	3300026116	Bacteria	3226
698	Ga0207675_100359610	3300026118	Bacteria	1428
699	Ga0207683_10004914	3300026121	Bacteria	11496
700	Ga0207683_10057619	3300026121	Bacteria	3410
701	Ga0207683_10112867	3300026121	Bacteria	2434
702	Ga0207683_10203433	3300026121	Bacteria	1800
703	Ga0207683_10291838	3300026121	Bacteria	1491
704	Ga0207683_10877124	3300026121	Bacteria	833
705	Ga0207683_11092839	3300026121	Bacteria	740
706	Ga0207683_11298497	3300026121	Bacteria	674
707	Ga0207698_10105252	3300026142	Bacteria	2350
708	Ga0207698_10192457	3300026142	Bacteria	1818
709	Ga0207698_10218966	3300026142	Bacteria	1719
710	Ga0207698_10327212	3300026142	Bacteria	1438
711	Ga0207698_10384510	3300026142	Bacteria	1336
712	Ga0207698_10476330	3300026142	Bacteria	1210
713	Ga0207698_10705566	3300026142	Bacteria	1004
714	Ga0207698_10717463	3300026142	Bacteria	996
715	Ga0209389_1000168	3300027296	Bacteria	52990
716	Ga0209389_1000180	3300027296	Bacteria	49331
717	Ga0209589_1000015	3300027357	Bacteria	225913
718	Ga0209589_1000570	3300027357	Bacteria	52985
719	Ga0209489_100015	3300027361	Bacteria	225913
720	Ga0209489_101190	3300027361	Bacteria	52985
721	Ga0209489_101411	3300027361	Bacteria	49331
722	Ga0209700_100025	3300027363	Bacteria	225913
723	Ga0209700_101443	3300027363	Bacteria	49345
724	Ga0209967_1015941	3300027364	Bacteria	1078
725	Ga0210002_1003502	3300027617	Bacteria	2313
726	Ga0209971_1034805	3300027682	Bacteria	1211
727	Ga0209998_10011152	3300027717	Bacteria	1860
728	Ga0209813_10169264	3300027866	Bacteria	793
729	Ga0207428_10000664	3300027907	Bacteria	40266
730	Ga0207428_10001593	3300027907	Bacteria	23627
731	Ga0207428_10349709	3300027907	Bacteria	1088
732	Ga0268266_10003266	3300028379	Bacteria	16328
733	Ga0268266_10046072	3300028379	Bacteria	3733
734	Ga0268266_10151210	3300028379	Bacteria	2092
735	Ga0268266_10165793	3300028379	Bacteria	2001
736	Ga0268266_10171356	3300028379	Bacteria	1970
737	Ga0268266_10210008	3300028379	Bacteria	1785
738	Ga0268266_10282367	3300028379	Bacteria	1544
739	Ga0268265_10128769	3300028380	Bacteria	2099
740	Ga0268265_10160149	3300028380	Bacteria	1910
741	Ga0268265_10385096	3300028380	Bacteria	1291
742	Ga0268264_10000049	3300028381	Bacteria	329992
743	Ga0268264_10511294	3300028381	Bacteria	1173
744	Ga0307517_10002508	3300028786	Bacteria	29345
745	Ga0307517_10138270	3300028786	Bacteria	1722
746	Ga0307517_10428677	3300028786	Bacteria	691
747	Ga0307515_10069558	3300028794	Bacteria	4808
748	Ga0307515_10113017	3300028794	Bacteria	3153
749	Ga0265760_10052578	3300031090	Bacteria	1228
750	Ga0265330_10081784	3300031235	Bacteria	1391
751	Ga0265316_10462372	3300031344	Bacteria	909
752	Ga0307513_10089886	3300031456	Bacteria	3134
753	Ga0307509_10120233	3300031507	Bacteria	2606
754	Ga0265313_10000510	3300031595	Bacteria	40838
755	Ga0265313_10031496	3300031595	Bacteria	2718
756	Ga0265313_10120675	3300031595	Bacteria	1144
757	Ga0307508_10000046	3300031616	Bacteria	139709
758	Ga0307508_10037024	3300031616	Bacteria	4390
759	Ga0316579_10043783	3300031691	Bacteria	2083
760	Ga0265314_10022525	3300031711	Bacteria	4825
761	Ga0265314_10151442	3300031711	Bacteria	1422
762	Ga0307516_10003810	3300031730	Bacteria	19133
763	Ga0307516_10264467	3300031730	Bacteria	1409
764	Ga0307405_10201212	3300031731	Bacteria	1447
765	Ga0307413_10048793	3300031824	Bacteria	2533
766	Ga0307410_10470799	3300031852	Bacteria	1029
767	Ga0307407_10256037	3300031903	Bacteria	1202
768	Ga0307409_101166958	3300031995	Bacteria	793
769	Ga0307416_100240771	3300032002	Bacteria	1753
770	Ga0307416_100416507	3300032002	Bacteria	1386
771	Ga0307416_100668905	3300032002	Bacteria	1125
772	Ga0307411_10236299	3300032005	Bacteria	1428
773	Ga0307411_10588884	3300032005	Bacteria	955
774	Ga0307415_100058305	3300032126	Bacteria	2658
775	Ga0307415_101136264	3300032126	Bacteria	733
776	Ga0307510_10003428	3300033180	Bacteria	18490
777	Ga0307510_10195732	3300033180	Bacteria	1563
778	Ga0315911_1000017	3300033442	Bacteria	161609
779	Ga0373930_0025262	3300034816	Bacteria	1191
780	Ga0373948_0002028	3300034817	Bacteria	2926
781	Ga0373950_0001366	3300034818	Bacteria	3168
782	Ga0373950_0029199	3300034818	Bacteria	1014
783	Ga0373958_0000682	3300034819	Bacteria	4305
784	Ga0373938_0000745	3300034957	Bacteria	5261
785	Ga0373938_0001870	3300034957	Bacteria	3366
786	Ga0373926_0010795	3300035083	Bacteria	3066
787	Ga0373928_0000048	3300035084	Bacteria	20964
788	Ga0373929_0000547	3300035085	Bacteria	7218
789	Ga0373940_0000927	3300035088	Bacteria	4957
790	Ga0373944_0020862	3300035089	Bacteria	1891
791	Ga0373944_0129215	3300035089	Bacteria	877
792	Ga0373949_0000821	3300035090	Bacteria	9896
793	Ga0373951_0007246	3300035091	Bacteria	2522
794	Ga0373952_0002299	3300035092	Bacteria	3445
795	Ga0373923_0010736	3300035111	Bacteria	3341
796	Ga0373923_0020082	3300035111	Bacteria	2592
797	Ga0373932_0001773	3300035112	Bacteria	5813
798	Ga0373932_0019787	3300035112	Bacteria	1758
799	Ga0373936_0020155	3300035113	Bacteria	2588
800	Ga0373936_0196083	3300035113	Bacteria	890
801	Ga0373939_0001868	3300035114	Bacteria	5032
802	Ga0373939_0014456	3300035114	Bacteria	2048
803	Ga0373941_0000452	3300035115	Bacteria	8177
804	Ga0373941_0000714	3300035115	Bacteria	6821
805	Ga0373941_0108990	3300035115	Bacteria	974
806	Ga0373945_0033172	3300035116	Bacteria	1834
807	Ga0373953_0010228	3300035117	Bacteria	3256
808	Ga0373954_0033716	3300035118	Bacteria	2369
809	Ga0373954_0109719	3300035118	Bacteria	1334
810	Ga0373956_0002568	3300035119	Bacteria	7375
811	Ga0373957_0023794	3300035120	Bacteria	2193
812	Ga0373960_0008309	3300035121	Bacteria	2484
813	Ga0373960_0117172	3300035121	Bacteria	880
814	Ga0373943_0012096	3300035170	Bacteria	3887
815	Ga0373943_0018472	3300035170	Bacteria	3204
816	Ga0373943_0023977	3300035170	Bacteria	2842
817	Ga0373946_0046780	3300035171	Bacteria	1794
818	Ga0373946_0249781	3300035171	Bacteria	865
819	Ga0373955_0004901	3300035172	Bacteria	5970
820	Ga0373955_0014739	3300035172	Bacteria	3812
821	Ga0373955_0042433	3300035172	Bacteria	2442
822	Ga0373942_0000844	3300035207	Bacteria	8415
823	Ga0373942_0002802	3300035207	Bacteria	4152
824	Ga0373962_0000546	3300035242	Bacteria	8445
825	Ga0373962_0003526	3300035242	Bacteria	3760
826	Ga0373924_0012982	3300035410	Bacteria	3123
827	Ga0373924_0022820	3300035410	Bacteria	2449
828	Ga0373931_0009546	3300035691	Bacteria	4640
829	Ga0373931_0047178	3300035691	Bacteria	2279
830	Ga0373931_0136358	3300035691	Bacteria	1417
831	Ga0373931_0214279	3300035691	Bacteria	1157
832	Ga0373935_0019978	3300035692	Bacteria	4088
833	Ga0373927_0000481	3300035695	Bacteria	30651
834	Ga0373927_0052809	3300035695	Bacteria	2628
835	Ga0373927_0089476	3300035695	Bacteria	1999
836	Ga0373927_0101160	3300035695	Bacteria	1874
837	Ga0373927_0125941	3300035695	Bacteria	1672
838	Ga0373933_0003495	3300035724	Bacteria	8748
839	Ga0373933_0040458	3300035724	Bacteria	2747
840	Ga0373947_0000441	3300035725	Bacteria	23573
841	Ga0373947_0574720	3300035725	Bacteria	768
842	Ga0373937_0030955	3300036401	Bacteria	4845
843	Ga0373937_0129490	3300036401	Bacteria	2356
844	Ga0373937_0195842	3300036401	Bacteria	1899
845	Ga0373937_0823972	3300036401	Bacteria	876
846	Ga0373925_0005350	3300037068	Bacteria	9577
847	Ga0373925_0018054	3300037068	Bacteria	5124
848	Ga0373925_0048343	3300037068	Bacteria	3169
849	Ga0373925_0313697	3300037068	Bacteria	1268
850	Ga0395899_0258995	3300037312	Bacteria	1191
851	Ga0395900_0000937	3300037418	Bacteria	38218
852	Ga0395900_0288371	3300037418	Bacteria	1631
853	Ga0395900_0355669	3300037418	Bacteria	1437
854	Ga0395898_0012937	3300037466	Bacteria	8607
855	Ga0395905_0003622	3300037471	Bacteria	16414
856	Ga0395905_0100877	3300037471	Bacteria	2710
857	Ga0395905_0107501	3300037471	Bacteria	2619
858	Ga0395905_0506056	3300037471	Bacteria	1108
859	Ga0436364_0666253	3300037853	Bacteria	5675
860	Ga0436364_1169764	3300037853	Bacteria	928
861	Ga0395901_0027708	3300038443	Bacteria	5825
862	Ga0436365_0332538	3300039437	Bacteria	1458
863	Ga0436360_0069163	3300039438	Bacteria	1323
864	Ga0436360_0794626	3300039438	Bacteria	2225
865	Ga0436361_0180263	3300039447	Bacteria	2601
866	Ga0436361_0354921	3300039447	Bacteria	1354
867	Ga0436361_0540936	3300039447	Bacteria	1468
868	Ga0436363_0376673	3300039450	Bacteria	6417
869	Ga0436363_1386220	3300039450	Bacteria	1331
870	Ga0439465_0006502	3300041413	Bacteria	3715
871	Ga0439465_0054106	3300041413	Bacteria	1320
872	Ga0451791_0027799	3300041451	Bacteria	1184
873	Ga0451797_0177233	3300041453	Bacteria	965
874	Ga0451795_0644648	3300041456	Bacteria	1225
875	Ga0451847_0937825	3300041503	Bacteria	871
876	Ga0439464_0035696	3300042439	Bacteria	1405
877	Ga0451577_0089386	3300042876	Bacteria	2749
878	Ga0466972_0000171	3300044658	Bacteria	50915
879	Ga0466972_0009381	3300044658	Bacteria	4918
880	Ga0466972_0099558	3300044658	Bacteria	1376
881	Ga0453683_0138434	3300044673	Bacteria	1536
882	Ga0466965_0063765	3300044683	Bacteria	1844
883	Ga0466966_0000287	3300044684	Bacteria	33106
884	Ga0466966_0024099	3300044684	Bacteria	3984
885	Ga0466961_0000126	3300044693	Bacteria	51032
886	Ga0466963_0184624	3300044694	Bacteria	1456
887	Ga0453684_0101204	3300044712	Bacteria	3526
888	Ga0466971_0117504	3300044719	Bacteria	1230
889	Ga0466968_0002951	3300044735	Bacteria	6282
890	Ga0466968_0063072	3300044735	Bacteria	1602
891	Ga0466957_0554122	3300044842	Bacteria	801
892	Ga0466960_0011542	3300044901	Bacteria	3700
893	Ga0466960_0049122	3300044901	Bacteria	2030
894	Ga0466959_0003379	3300045049	Bacteria	10427
895	Ga0451576_0060155	3300045051	Bacteria	3963
896	Ga0466967_0203454	3300045976	Bacteria	1876
897	Ga0466967_0603392	3300045976	Bacteria	1083
898	Ga0495617_030202	3300046452	Bacteria	1822
899	Ga0495592_0038636	3300046454	Bacteria	3590
900	Ga0495592_0394284	3300046454	Bacteria	878
901	Ga0495603_0000066	3300046455	Bacteria	45635
902	Ga0495603_0027734	3300046455	Bacteria	3416
903	Ga0495603_0068782	3300046455	Bacteria	2083
904	Ga0495603_0086597	3300046455	Bacteria	1834
905	Ga0495603_0130881	3300046455	Bacteria	1461
906	Ga0495603_0237113	3300046455	Bacteria	1051
907	Ga0495590_0025134	3300046457	Bacteria	2095
908	Ga0495629_0006904	3300046459	Bacteria	8375
909	Ga0495629_0018144	3300046459	Bacteria	5040
910	Ga0495629_0105444	3300046459	Bacteria	1966
911	Ga0495638_0005913	3300046460	Bacteria	8988
912	Ga0495638_0067451	3300046460	Bacteria	2196
913	Ga0495641_0019238	3300046461	Bacteria	3500
914	Ga0495641_0107306	3300046461	Bacteria	1246
915	Ga0495641_0247308	3300046461	Bacteria	802
916	Ga0495651_0000667	3300046462	Bacteria	26661
917	Ga0495651_0049589	3300046462	Bacteria	3241
918	Ga0495651_0077600	3300046462	Bacteria	2514
919	Ga0495580_0001382	3300046472	Bacteria	21285
920	Ga0495580_0263001	3300046472	Bacteria	1180
921	Ga0495582_0000298	3300046473	Bacteria	27399
922	Ga0495582_0235013	3300046473	Bacteria	1050
923	Ga0495605_0032010	3300046474	Bacteria	2682
924	Ga0495605_0096196	3300046474	Bacteria	1366
925	Ga0495605_0144963	3300046474	Bacteria	1063
926	Ga0495605_0192831	3300046474	Bacteria	891
927	Ga0495639_0000282	3300046475	Bacteria	25018
928	Ga0495639_0054189	3300046475	Bacteria	1828
929	Ga0495662_0000058	3300046476	Bacteria	37987
930	Ga0495662_0233699	3300046476	Bacteria	906
931	Ga0495664_0001603	3300046477	Bacteria	12028
932	Ga0495664_0350670	3300046477	Bacteria	889
933	Ga0495585_0005925	3300046492	Bacteria	7648
934	Ga0495585_0087199	3300046492	Bacteria	1685
935	Ga0495585_0126109	3300046492	Bacteria	1350
936	Ga0495594_0000706	3300046499	Bacteria	17171
937	Ga0495594_0027151	3300046499	Bacteria	3083
938	Ga0495594_0074764	3300046499	Bacteria	1888
939	Ga0495596_0019026	3300046500	Bacteria	2825
940	Ga0495596_0052294	3300046500	Bacteria	1599
941	Ga0495607_0019906	3300046501	Bacteria	4252
942	Ga0495607_0074008	3300046501	Bacteria	1892
943	Ga0495607_0170774	3300046501	Bacteria	1098
944	Ga0495583_0077706	3300046506	Bacteria	1447
945	Ga0495583_0191809	3300046506	Bacteria	833
946	Ga0495606_0019769	3300046507	Bacteria	4992
947	Ga0495606_0051430	3300046507	Bacteria	2687
948	Ga0495606_0067970	3300046507	Bacteria	2255
949	Ga0495606_0198615	3300046507	Bacteria	1145
950	Ga0495608_0078741	3300046511	Bacteria	2143
951	Ga0495608_0127015	3300046511	Bacteria	1633
952	Ga0495610_0012760	3300046512	Bacteria	5030
953	Ga0495610_0089433	3300046512	Bacteria	1398
954	Ga0495610_0101939	3300046512	Bacteria	1284
955	Ga0495610_0140936	3300046512	Bacteria	1038
956	Ga0495616_0090402	3300046513	Bacteria	1450
957	Ga0495618_0033089	3300046514	Bacteria	3240
958	Ga0495618_0073141	3300046514	Bacteria	2182
959	Ga0495618_0481714	3300046514	Bacteria	750
960	Ga0495620_0107042	3300046515	Bacteria	1110
961	Ga0495620_0135135	3300046515	Bacteria	966
962	Ga0495628_0037494	3300046516	Bacteria	3886
963	Ga0495628_0066468	3300046516	Bacteria	2819
964	Ga0495630_0001425	3300046517	Bacteria	16552
965	Ga0495630_0017239	3300046517	Bacteria	5289
966	Ga0495630_0168514	3300046517	Bacteria	1668
967	Ga0495631_0004059	3300046518	Bacteria	7868
968	Ga0495631_0271736	3300046518	Bacteria	722
969	Ga0495632_0038495	3300046519	Bacteria	2421
970	Ga0495632_0180072	3300046519	Bacteria	968
971	Ga0495632_0271742	3300046519	Bacteria	756
972	Ga0495637_0055908	3300046520	Bacteria	1635
973	Ga0495637_0144166	3300046520	Bacteria	902
974	Ga0495637_0182295	3300046520	Bacteria	778
975	Ga0495643_0007902	3300046522	Bacteria	6793
976	Ga0495644_0004771	3300046523	Bacteria	5325
977	Ga0495644_0164387	3300046523	Bacteria	851
978	Ga0495648_0002045	3300046524	Bacteria	19136
979	Ga0495648_0014359	3300046524	Bacteria	5802
980	Ga0495648_0046198	3300046524	Bacteria	2701
981	Ga0495648_0098016	3300046524	Bacteria	1624
982	Ga0495648_0211530	3300046524	Bacteria	963
983	Ga0495648_0363328	3300046524	Bacteria	657
984	Ga0495663_0080918	3300046525	Bacteria	1046
985	Ga0495666_0036914	3300046526	Bacteria	2378
986	Ga0495666_0238691	3300046526	Bacteria	830
987	Ga0495652_0036110	3300046529	Bacteria	4298
988	Ga0495652_0237284	3300046529	Bacteria	1360
989	Ga0495654_0092505	3300046530	Bacteria	1401
990	Ga0495665_0000373	3300046531	Bacteria	22557
991	Ga0495640_0014709	3300046533	Bacteria	5911
992	Ga0495640_0028397	3300046533	Bacteria	4029
993	Ga0495587_0042572	3300046536	Bacteria	2708
994	Ga0495587_0045839	3300046536	Bacteria	2597
995	Ga0495587_0067629	3300046536	Bacteria	2082
996	Ga0495598_0012091	3300046537	Bacteria	2108
997	Ga0495609_0139272	3300046538	Bacteria	1036
998	Ga0495597_0027655	3300046542	Bacteria	2600
999	Ga0495597_0074178	3300046542	Bacteria	1461
1000	Ga0495645_0069970	3300046543	Bacteria	2533
1001	Ga0495622_0012697	3300046557	Bacteria	3905
1002	Ga0495622_0040321	3300046557	Bacteria	2173
1003	Ga0495622_0062057	3300046557	Bacteria	1730
1004	Ga0495622_0247552	3300046557	Bacteria	784
1005	Ga0495633_0005887	3300046558	Bacteria	7373
1006	Ga0495633_0158084	3300046558	Bacteria	1046
1007	Ga0495667_0007317	3300046559	Bacteria	7491
1008	Ga0495667_0016052	3300046559	Bacteria	5061
1009	Ga0495667_0021985	3300046559	Bacteria	4300
1010	Ga0495667_0023536	3300046559	Bacteria	4150
1011	Ga0495667_0073041	3300046559	Bacteria	2235
1012	Ga0495656_0000705	3300046615	Bacteria	10789
1013	Ga0495656_0011792	3300046615	Bacteria	3212
1014	Ga0495656_0030526	3300046615	Bacteria	2179
1015	Ga0495656_0087987	3300046615	Bacteria	1415
1016	Ga0495668_0024474	3300046616	Bacteria	3434
1017	Ga0495668_0120327	3300046616	Bacteria	1436
1018	Ga0495668_0197662	3300046616	Bacteria	1101
1019	Ga0495668_0239637	3300046616	Bacteria	993
1020	Ga0495634_0000502	3300046642	Bacteria	38371
1021	Ga0495634_0251229	3300046642	Bacteria	1082
1022	Ga0495611_0005467	3300046648	Bacteria	5426
1023	Ga0495611_0126082	3300046648	Bacteria	1194
1024	Ga0495611_0261026	3300046648	Bacteria	802
1025	Ga0495625_0220532	3300046660	Bacteria	1243
1026	Ga0495625_0255677	3300046660	Bacteria	1135
1027	Ga0495625_0344122	3300046660	Bacteria	944
1028	Ga0495625_0462677	3300046660	Bacteria	781
1029	Ga0495635_0000178	3300046663	Bacteria	40063
1030	Ga0495635_0053042	3300046663	Bacteria	2794
1031	Ga0495635_0161792	3300046663	Bacteria	1523
1032	Ga0495659_0014518	3300046664	Bacteria	2579
1033	Ga0495659_0147917	3300046664	Bacteria	941
1034	Ga0495661_0076948	3300046665	Bacteria	1934
1035	Ga0495661_0159078	3300046665	Bacteria	1214
1036	Ga0495661_0295958	3300046665	Bacteria	811
1037	Ga0495588_0002644	3300046674	Bacteria	7677
1038	Ga0495588_0011343	3300046674	Bacteria	4178
1039	Ga0495588_0063410	3300046674	Bacteria	1916
1040	Ga0495657_0028252	3300046675	Bacteria	3948
1041	Ga0495657_0033935	3300046675	Bacteria	3548
1042	Ga0495657_0155862	3300046675	Bacteria	1415
1043	Ga0495599_0008017	3300046678	Bacteria	6412
1044	Ga0495599_0025275	3300046678	Bacteria	3717
1045	Ga0495599_0033357	3300046678	Bacteria	3235
1046	Ga0495623_0002455	3300046679	Bacteria	12298
1047	Ga0495646_0021079	3300046680	Bacteria	4119
1048	Ga0495646_0048879	3300046680	Bacteria	2569
1049	Ga0495646_0184058	3300046680	Bacteria	1145
1050	Ga0495646_0249149	3300046680	Bacteria	952
1051	Ga0495647_0018257	3300046681	Bacteria	2494
1052	Ga0495647_0072246	3300046681	Bacteria	1383
1053	Ga0495658_0000368	3300046683	Bacteria	25300
1054	Ga0495658_0143321	3300046683	Bacteria	1463
1055	Ga0495669_0011883	3300046684	Bacteria	3703
1056	Ga0495669_0133912	3300046684	Bacteria	1168
1057	Ga0495669_0207094	3300046684	Bacteria	938
1058	Ga0495669_0215055	3300046684	Bacteria	920
1059	Ga0495613_0049303	3300046689	Bacteria	3108
1060	Ga0495613_0084351	3300046689	Bacteria	2307
1061	Ga0495624_0003669	3300046690	Bacteria	11352
1062	Ga0495624_0198199	3300046690	Bacteria	1220
1063	Ga0495670_0000973	3300046691	Bacteria	13892
1064	Ga0495670_0071841	3300046691	Bacteria	1752
1065	Ga0495671_0074747	3300046692	Bacteria	1662
1066	Ga0495649_0017227	3300046694	Bacteria	4080
1067	Ga0495589_0195220	3300046794	Bacteria	957
1068	Ga0495589_0290311	3300046794	Bacteria	759
1069	Ga0495600_0004239	3300046809	Bacteria	8565
1070	Ga0495600_0034813	3300046809	Bacteria	3270
1071	Ga0495600_0166734	3300046809	Bacteria	1422
1072	Ga0495660_0038089	3300046810	Bacteria	2675
1073	Ga0495581_0000111	3300047315	Bacteria	34508
1074	Ga0495581_0021235	3300047315	Bacteria	3765
1075	Ga0495581_0396777	3300047315	Bacteria	805
1076	Ga0495604_0014404	3300047317	Bacteria	6307
1077	Ga0495604_0055322	3300047317	Bacteria	3059
1078	Ga0495604_0083864	3300047317	Bacteria	2380
1079	Ga0495636_0045401	3300047318	Bacteria	1831
1080	Ga0495674_0002855	3300047319	Bacteria	16780
1081	Ga0495674_0165657	3300047319	Bacteria	1847
1082	Ga0495674_0327380	3300047319	Bacteria	1247
1083	Ga0495674_0387919	3300047319	Bacteria	1129
1084	Ga0495672_0072222	3300047320	Bacteria	1950
1085	Ga0495676_0025260	3300047321	Bacteria	5132
1086	Ga0495676_0028521	3300047321	Bacteria	4764
1087	Ga0495676_0122511	3300047321	Bacteria	1889
1088	Ga0495676_0223807	3300047321	Bacteria	1295
1089	Ga0495680_0007580	3300047322	Bacteria	9924
1090	Ga0495680_0066388	3300047322	Bacteria	2761
1091	Ga0495680_0160969	3300047322	Bacteria	1630
1092	Ga0495680_0161815	3300047322	Bacteria	1625
1093	Ga0495683_0057209	3300047323	Bacteria	1938
1094	Ga0495687_033969	3300047443	Bacteria	2309
1095	Ga0495675_0007873	3300047444	Bacteria	6585
1096	Ga0495675_0037173	3300047444	Bacteria	3101
1097	Ga0495677_0036428	3300047445	Bacteria	1797
1098	Ga0495677_0108327	3300047445	Bacteria	1055
1099	Ga0495679_111116	3300047446	Bacteria	754
1100	Ga0495673_0050133	3300047469	Bacteria	1834
1101	Ga0495684_0109882	3300047471	Bacteria	2082
1102	Ga0495686_0102707	3300047472	Bacteria	1722
1103	Ga0495686_0123777	3300047472	Bacteria	1539
1104	Ga0495686_0138490	3300047472	Bacteria	1438
1105	Ga0495686_0188966	3300047472	Bacteria	1188
1106	Ga0495686_0190567	3300047472	Bacteria	1182
1107	Ga0495593_0000210	3300047673	Bacteria	30957
1108	Ga0495593_0075182	3300047673	Bacteria	1752
1109	Ga0495593_0137658	3300047673	Bacteria	1237
1110	Ga0495602_0020857	3300048088	Bacteria	6466
1111	Ga0495602_0054730	3300048088	Bacteria	3520
1112	Ga0495602_0115385	3300048088	Bacteria	2172
1113	Ga0495602_0739472	3300048088	Bacteria	665
1114	Ga0495614_0037279	3300048089	Bacteria	2086
1115	Ga0495614_0060546	3300048089	Bacteria	1627
1116	Ga0495614_0266287	3300048089	Bacteria	787
1117	Ga0495626_0028992	3300048091	Bacteria	2681
1118	Ga0495626_0095109	3300048091	Bacteria	1305
1119	Ga0496100_0076234	3300048903	Bacteria	2251
1120	Ga0496100_0124181	3300048903	Bacteria	1810
1121	Ga0496100_0224743	3300048903	Bacteria	1379
1122	Ga0496100_0356432	3300048903	Bacteria	1106
1123	Ga0496101_0002918	3300048904	Bacteria	10515
1124	Ga0496101_0120579	3300048904	Bacteria	1982
1125	Ga0496101_0133155	3300048904	Bacteria	1889
1126	Ga0496101_0261270	3300048904	Bacteria	1350
1127	Ga0496101_0326923	3300048904	Bacteria	1203
1128	Ga0496101_0396415	3300048904	Bacteria	1087
1129	Ga0496101_0466136	3300048904	Bacteria	997
1130	Ga0496102_0003383	3300048905	Bacteria	13525
1131	Ga0496102_0017307	3300048905	Bacteria	6312
1132	Ga0496102_0041224	3300048905	Bacteria	4179
1133	Ga0496102_0167313	3300048905	Bacteria	2069
1134	Ga0496102_0176232	3300048905	Bacteria	2013
1135	Ga0496102_0191001	3300048905	Bacteria	1930
1136	Ga0496102_0841953	3300048905	Bacteria	839
1137	Ga0496103_0005458	3300048906	Bacteria	7602
1138	Ga0496103_0166305	3300048906	Bacteria	1415
1139	Ga0496103_0619582	3300048906	Bacteria	689
1140	Ga0496104_0023739	3300048907	Bacteria	5639
1141	Ga0496104_0041340	3300048907	Bacteria	4323
1142	Ga0496104_0042724	3300048907	Bacteria	4255
1143	Ga0496104_0071924	3300048907	Bacteria	3288
1144	Ga0496104_0132590	3300048907	Bacteria	2393
1145	Ga0496104_0192450	3300048907	Bacteria	1952
1146	Ga0496104_0369178	3300048907	Bacteria	1347
1147	Ga0496104_0454445	3300048907	Bacteria	1193
1148	Ga0496104_0813265	3300048907	Bacteria	840
1149	Ga0496105_0053739	3300048908	Bacteria	3326
1150	Ga0496105_0095918	3300048908	Bacteria	2449
1151	Ga0496105_0121480	3300048908	Bacteria	2154
1152	Ga0496105_0167066	3300048908	Bacteria	1805
1153	Ga0496105_0182408	3300048908	Bacteria	1718
1154	Ga0496105_0220905	3300048908	Bacteria	1542
1155	Ga0496106_0014823	3300048909	Bacteria	5763
1156	Ga0496106_0048165	3300048909	Bacteria	3209
1157	Ga0496106_0071917	3300048909	Bacteria	2644
1158	Ga0496106_0190337	3300048909	Bacteria	1631
1159	Ga0496106_0350346	3300048909	Bacteria	1186
1160	Ga0496106_0438872	3300048909	Bacteria	1049
1161	Ga0496106_0518295	3300048909	Bacteria	957
1162	Ga0496107_0010578	3300048910	Bacteria	6415
1163	Ga0496107_0017668	3300048910	Bacteria	5017
1164	Ga0496107_0022968	3300048910	Bacteria	4410
1165	Ga0496107_0063122	3300048910	Bacteria	2684
1166	Ga0496107_0094309	3300048910	Bacteria	2190
1167	Ga0496107_0222687	3300048910	Bacteria	1404
1168	Ga0496107_0615051	3300048910	Bacteria	802
1169	Ga0496107_0655231	3300048910	Bacteria	774
1170	Ga0496108_0000639	3300048911	Bacteria	27304
1171	Ga0496108_0064133	3300048911	Bacteria	3094
1172	Ga0496108_0145734	3300048911	Bacteria	2041
1173	Ga0496108_0712118	3300048911	Bacteria	870
1174	Ga0496109_0000619	3300048912	Bacteria	29616
1175	Ga0496109_0064302	3300048912	Bacteria	3357
1176	Ga0496109_0094558	3300048912	Bacteria	2766
1177	Ga0496109_0139533	3300048912	Bacteria	2266
1178	Ga0496109_0182600	3300048912	Bacteria	1971
1179	Ga0496109_0409947	3300048912	Bacteria	1280
1180	Ga0496110_0092579	3300048913	Bacteria	2705
1181	Ga0496110_0118275	3300048913	Bacteria	2386
1182	Ga0496110_0218478	3300048913	Bacteria	1733
1183	Ga0496110_0229742	3300048913	Bacteria	1687
1184	Ga0496110_0273038	3300048913	Bacteria	1539
1185	Ga0496111_0038438	3300048914	Bacteria	3429
1186	Ga0496111_0094006	3300048914	Bacteria	2198
1187	Ga0496111_0122974	3300048914	Bacteria	1917
1188	Ga0496111_0329601	3300048914	Bacteria	1130
1189	Ga0496112_0002285	3300048915	Bacteria	15329
1190	Ga0496112_0039764	3300048915	Bacteria	4597
1191	Ga0496112_0098301	3300048915	Bacteria	2896
1192	Ga0496112_0166061	3300048915	Bacteria	2173
1193	Ga0496112_0358070	3300048915	Bacteria	1401
1194	Ga0496112_0358525	3300048915	Bacteria	1400
1195	Ga0496112_0374648	3300048915	Bacteria	1365
1196	Ga0496112_0779421	3300048915	Bacteria	881
1197	Ga0496112_1137952	3300048915	Bacteria	698
1198	Ga0496113_0004176	3300048916	Bacteria	8823
1199	Ga0496113_0057182	3300048916	Bacteria	2930
1200	Ga0496113_0109068	3300048916	Bacteria	2152
1201	Ga0496113_0134495	3300048916	Bacteria	1942
1202	Ga0496113_0157317	3300048916	Bacteria	1795
1203	Ga0496113_0943816	3300048916	Bacteria	681
1204	Ga0496114_0017189	3300048917	Bacteria	5834
1205	Ga0496114_0021593	3300048917	Bacteria	5239
1206	Ga0496114_0024475	3300048917	Bacteria	4929
1207	Ga0496114_0057328	3300048917	Bacteria	3252
1208	Ga0496114_0329391	3300048917	Bacteria	1350
1209	Ga0496114_0383389	3300048917	Bacteria	1244
1210	Ga0496114_0713486	3300048917	Bacteria	879
1211	Ga0496115_0027016	3300048918	Bacteria	4486
1212	Ga0496115_0094296	3300048918	Bacteria	2449
1213	Ga0496115_0168868	3300048918	Bacteria	1809
1214	Ga0496115_0222783	3300048918	Bacteria	1556
1215	Ga0496115_0381707	3300048918	Bacteria	1146
1216	Ga0496115_0488960	3300048918	Bacteria	990
1217	Ga0496115_0806872	3300048918	Bacteria	730
1218	Ga0496116_0005187	3300048919	Bacteria	12224
1219	Ga0496116_0035270	3300048919	Bacteria	3515
1220	Ga0496116_0194417	3300048919	Bacteria	1070
1221	Ga0496117_0021989	3300048920	Bacteria	5132
1222	Ga0496117_0105060	3300048920	Bacteria	1776
1223	Ga0496118_0033446	3300048921	Bacteria	4218
1224	Ga0496118_0086842	3300048921	Bacteria	2172
1225	Ga0496119_0102731	3300048922	Bacteria	1602
1226	Ga0496120_0018181	3300048923	Bacteria	4538
1227	Ga0496121_0009401	3300048924	Bacteria	11243
1228	Ga0496121_0019336	3300048924	Bacteria	6814
1229	Ga0496121_0053232	3300048924	Bacteria	3392
1230	Ga0496121_0054751	3300048924	Bacteria	3330
1231	Ga0496121_0060186	3300048924	Bacteria	3125
1232	Ga0496121_0095978	3300048924	Bacteria	2302
1233	Ga0496121_0195873	3300048924	Bacteria	1444
1234	Ga0496121_0233781	3300048924	Bacteria	1285
1235	Ga0496121_0268061	3300048924	Bacteria	1175
1236	Ga0496121_0379696	3300048924	Bacteria	932
1237	Ga0496122_0086985	3300048925	Bacteria	2149
1238	Ga0496122_0117523	3300048925	Bacteria	1726
1239	Ga0496122_0260599	3300048925	Bacteria	962
1240	Ga0496123_0086053	3300048926	Bacteria	1887
1241	Ga0496123_0099612	3300048926	Bacteria	1696
1242	Ga0496123_0334777	3300048926	Bacteria	709
1243	Ga0496124_0126298	3300048927	Bacteria	2037
1244	Ga0496124_0176273	3300048927	Bacteria	1650
1245	Ga0496124_0318679	3300048927	Bacteria	1114
1246	Ga0496124_0423542	3300048927	Bacteria	916
1247	Ga0496125_0000420	3300048928	Bacteria	78930
1248	Ga0496125_0001294	3300048928	Bacteria	37111
1249	Ga0496125_0138357	3300048928	Bacteria	1698
1250	Ga0496125_0180840	3300048928	Bacteria	1405
1251	Ga0496125_0182924	3300048928	Bacteria	1394
1252	Ga0496125_0213707	3300048928	Bacteria	1250
1253	Ga0496125_0237453	3300048928	Bacteria	1160
1254	Ga0496126_0005768	3300048929	Bacteria	14002
1255	Ga0496126_0006421	3300048929	Bacteria	13104
1256	Ga0496126_0012916	3300048929	Bacteria	8528
1257	Ga0496126_0069995	3300048929	Bacteria	3127
1258	Ga0496126_0077290	3300048929	Bacteria	2951
1259	Ga0496126_0152957	3300048929	Bacteria	1976
1260	Ga0496126_0212172	3300048929	Bacteria	1629
1261	Ga0496126_0232146	3300048929	Bacteria	1545
1262	Ga0496126_0276065	3300048929	Bacteria	1393
1263	Ga0496126_0345435	3300048929	Bacteria	1218
1264	Ga0496126_0367747	3300048929	Bacteria	1173
1265	Ga0495678_032930	3300049459	Bacteria	2144
1266	Ga0495682_0011648	3300049460	Bacteria	3382
1267	Ga0495682_0118445	3300049460	Bacteria	948
1268	Ga0501031_0004523	3300049568	Bacteria	9010
1269	Ga0501031_0008194	3300049568	Bacteria	6801
1270	Ga0501031_0054472	3300049568	Bacteria	2606
1271	Ga0501031_0055909	3300049568	Bacteria	2571
1272	Ga0501031_0058562	3300049568	Bacteria	2510
1273	Ga0501031_0062386	3300049568	Bacteria	2429
1274	Ga0501031_0109056	3300049568	Bacteria	1808
1275	Ga0501031_0209022	3300049568	Bacteria	1272
1276	Ga0501032_0000172	3300049569	Bacteria	52773
1277	Ga0501032_0004015	3300049569	Bacteria	11156
1278	Ga0501032_0019595	3300049569	Bacteria	4729
1279	Ga0501032_0030915	3300049569	Bacteria	3673
1280	Ga0501032_0044825	3300049569	Bacteria	2992
1281	Ga0501032_0173202	3300049569	Bacteria	1414
1282	Ga0501032_0459267	3300049569	Bacteria	815
1283	Ga0501033_0000866	3300049570	Bacteria	27653
1284	Ga0501033_0001887	3300049570	Bacteria	18238
1285	Ga0501033_0008787	3300049570	Bacteria	7807
1286	Ga0501033_0052374	3300049570	Bacteria	3025
1287	Ga0501033_0086379	3300049570	Bacteria	2296
1288	Ga0501033_0148750	3300049570	Bacteria	1690
1289	Ga0501033_0156287	3300049570	Bacteria	1643
1290	Ga0501034_0000270	3300049571	Bacteria	94119
1291	Ga0501034_0000676	3300049571	Bacteria	51758
1292	Ga0501034_0003680	3300049571	Bacteria	17330
1293	Ga0501034_0017445	3300049571	Bacteria	7361
1294	Ga0501034_0042056	3300049571	Bacteria	4624
1295	Ga0501034_0046005	3300049571	Bacteria	4409
1296	Ga0501034_0077424	3300049571	Bacteria	3331
1297	Ga0501034_0081044	3300049571	Bacteria	3249
1298	Ga0501034_0195399	3300049571	Bacteria	1983
1299	Ga0501034_0326110	3300049571	Bacteria	1467
1300	Ga0501034_0393066	3300049571	Bacteria	1310
1301	Ga0501034_0604510	3300049571	Bacteria	1002
1302	Ga0501034_0634505	3300049571	Bacteria	971
1303	Ga0501036_0000390	3300049572	Bacteria	30889
1304	Ga0501036_0031129	3300049572	Bacteria	4508
1305	Ga0501036_0044378	3300049572	Bacteria	3765
1306	Ga0501036_0068188	3300049572	Bacteria	3010
1307	Ga0501036_0071716	3300049572	Bacteria	2928
1308	Ga0501036_0075280	3300049572	Bacteria	2855
1309	Ga0501036_0131317	3300049572	Bacteria	2114
1310	Ga0501036_0258670	3300049572	Bacteria	1458
1311	Ga0501036_0365729	3300049572	Bacteria	1204
1312	Ga0501037_0000755	3300049573	Bacteria	24430
1313	Ga0501037_0000958	3300049573	Bacteria	21450
1314	Ga0501037_0019397	3300049573	Bacteria	5016
1315	Ga0501037_0023954	3300049573	Bacteria	4513
1316	Ga0501037_0043886	3300049573	Bacteria	3286
1317	Ga0501037_0057399	3300049573	Bacteria	2842
1318	Ga0501037_0258632	3300049573	Bacteria	1216
1319	Ga0501037_0281480	3300049573	Bacteria	1158
1320	Ga0501037_0460680	3300049573	Bacteria	866
1321	Ga0501038_0000089	3300049574	Bacteria	78009
1322	Ga0501038_0024721	3300049574	Bacteria	5355
1323	Ga0501038_0026409	3300049574	Bacteria	5172
1324	Ga0501038_0047902	3300049574	Bacteria	3700
1325	Ga0501038_0068998	3300049574	Bacteria	3004
1326	Ga0501038_0092792	3300049574	Bacteria	2527
1327	Ga0501038_0118989	3300049574	Bacteria	2180
1328	Ga0501038_0181180	3300049574	Bacteria	1699
1329	Ga0501038_0592458	3300049574	Bacteria	840
1330	Ga0501039_0000114	3300049575	Bacteria	54651
1331	Ga0501039_0005815	3300049575	Bacteria	9337
1332	Ga0501039_0026996	3300049575	Bacteria	4414
1333	Ga0501039_0154835	3300049575	Bacteria	1800
1334	Ga0501039_0177021	3300049575	Bacteria	1677
1335	Ga0501039_0389518	3300049575	Bacteria	1094
1336	Ga0501039_0422170	3300049575	Bacteria	1047
1337	Ga0501040_0033806	3300049576	Bacteria	3465
1338	Ga0501042_0212028	3300049578	Bacteria	1397
1339	Ga0501042_0376554	3300049578	Bacteria	1027
1340	Ga0501043_0001086	3300049579	Bacteria	23917
1341	Ga0501043_0004253	3300049579	Bacteria	11667
1342	Ga0501043_0009335	3300049579	Bacteria	7707
1343	Ga0501043_0009610	3300049579	Bacteria	7576
1344	Ga0501043_0018279	3300049579	Bacteria	5496
1345	Ga0501043_0254755	3300049579	Bacteria	1351
1346	Ga0501043_0301353	3300049579	Bacteria	1224
1347	Ga0501046_0006291	3300049580	Bacteria	10525
1348	Ga0501046_0012856	3300049580	Bacteria	7120
1349	Ga0501046_0030044	3300049580	Bacteria	4413
1350	Ga0501046_0110364	3300049580	Bacteria	2102
1351	Ga0501046_0344591	3300049580	Bacteria	1082
1352	Ga0501047_0000594	3300049581	Bacteria	38494
1353	Ga0501047_0052121	3300049581	Bacteria	3954
1354	Ga0501047_0061369	3300049581	Bacteria	3627
1355	Ga0501047_0133295	3300049581	Bacteria	2364
1356	Ga0501047_0151819	3300049581	Bacteria	2192
1357	Ga0501047_0336033	3300049581	Bacteria	1349
1358	Ga0501047_0475446	3300049581	Bacteria	1077
1359	Ga0501048_0042728	3300049582	Bacteria	3244
1360	Ga0501048_0337176	3300049582	Bacteria	1075
1361	Ga0501048_0355326	3300049582	Bacteria	1045
1362	Ga0501067_0000445	3300049583	Bacteria	22645
1363	Ga0501067_0028070	3300049583	Bacteria	3118
1364	Ga0501067_0031977	3300049583	Bacteria	2919
1365	Ga0501067_0108936	3300049583	Bacteria	1540
1366	Ga0501067_0210294	3300049583	Bacteria	1083
1367	Ga0501068_0004210	3300049584	Bacteria	7804
1368	Ga0501068_0026560	3300049584	Bacteria	3412
1369	Ga0501068_0036616	3300049584	Bacteria	2935
1370	Ga0501068_0039358	3300049584	Bacteria	2834
1371	Ga0501068_0104489	3300049584	Bacteria	1757
1372	Ga0501069_0045261	3300049585	Bacteria	2438
1373	Ga0501069_0139563	3300049585	Bacteria	1390
1374	Ga0501070_0017073	3300049586	Bacteria	6091
1375	Ga0501070_0095692	3300049586	Bacteria	2457
1376	Ga0501070_0098200	3300049586	Bacteria	2422
1377	Ga0501070_0144409	3300049586	Bacteria	1964
1378	Ga0501070_0169638	3300049586	Bacteria	1798
1379	Ga0501070_0238852	3300049586	Bacteria	1487
1380	Ga0501071_0036958	3300049587	Bacteria	3485
1381	Ga0501071_0061557	3300049587	Bacteria	2719
1382	Ga0501071_0326770	3300049587	Bacteria	1165
1383	Ga0501072_0001459	3300049588	Bacteria	17737
1384	Ga0501072_0084143	3300049588	Bacteria	2522
1385	Ga0501072_0328818	3300049588	Bacteria	1214
1386	Ga0501072_0406023	3300049588	Bacteria	1080
1387	Ga0501073_0000055	3300049589	Bacteria	71726
1388	Ga0501073_0044654	3300049589	Bacteria	3123
1389	Ga0501073_0057653	3300049589	Bacteria	2715
1390	Ga0501073_0103031	3300049589	Bacteria	1981
1391	Ga0501073_0112810	3300049589	Bacteria	1885
1392	Ga0501073_0113981	3300049589	Bacteria	1874
1393	Ga0501073_0251674	3300049589	Bacteria	1219
1394	Ga0501074_0000492	3300049590	Bacteria	24146
1395	Ga0501074_0007017	3300049590	Bacteria	8131
1396	Ga0501074_0040558	3300049590	Bacteria	3371
1397	Ga0501074_0072357	3300049590	Bacteria	2476
1398	Ga0501074_0083946	3300049590	Bacteria	2283
1399	Ga0501076_0012137	3300049592	Bacteria	6441
1400	Ga0501076_0128644	3300049592	Bacteria	2053
1401	Ga0501077_0024392	3300049593	Bacteria	3841
1402	Ga0501077_0257873	3300049593	Bacteria	1109
1403	Ga0501077_0294687	3300049593	Bacteria	1033
1404	Ga0501225_0094635	3300049705	Bacteria	868
1405	Ga0501079_0004436	3300049741	Bacteria	10395
1406	Ga0501079_0076206	3300049741	Bacteria	2594
1407	Ga0501080_0008079	3300049742	Bacteria	9533
1408	Ga0501080_0022886	3300049742	Bacteria	5793
1409	Ga0501080_0025902	3300049742	Bacteria	5449
1410	Ga0501080_0060993	3300049742	Bacteria	3511
1411	Ga0501080_0206292	3300049742	Bacteria	1802
1412	Ga0501081_0013430	3300049743	Bacteria	5386
1413	Ga0501081_0241742	3300049743	Bacteria	1316
1414	Ga0501083_0000570	3300049744	Bacteria	23630
1415	Ga0501083_0020711	3300049744	Bacteria	4572
1416	Ga0501083_0089624	3300049744	Bacteria	2032
1417	Ga0501083_0096362	3300049744	Bacteria	1952
1418	Ga0501083_0112660	3300049744	Bacteria	1788
1419	Ga0501083_0114872	3300049744	Bacteria	1768
1420	Ga0501035_0000150	3300049822	Bacteria	85450
1421	Ga0501035_0003778	3300049822	Bacteria	14432
1422	Ga0501035_0022636	3300049822	Bacteria	5772
1423	Ga0501035_0031779	3300049822	Bacteria	4808
1424	Ga0501035_0045739	3300049822	Bacteria	3937
1425	Ga0501035_0155236	3300049822	Bacteria	1984
1426	Ga0501035_0496885	3300049822	Bacteria	1004
1427	Ga0501035_0528287	3300049822	Bacteria	968
1428	Ga0501035_0557433	3300049822	Bacteria	938
1429	Ga0501044_0000546	3300049823	Bacteria	45906
1430	Ga0501044_0006712	3300049823	Bacteria	12684
1431	Ga0501044_0069407	3300049823	Bacteria	3587
1432	Ga0501044_0077407	3300049823	Bacteria	3373
1433	Ga0501044_0080620	3300049823	Bacteria	3296
1434	Ga0501044_0106409	3300049823	Bacteria	2817
1435	Ga0501044_0133952	3300049823	Bacteria	2470
1436	Ga0501044_0179462	3300049823	Bacteria	2085
1437	Ga0501044_0353527	3300049823	Bacteria	1388
1438	Ga0501044_1012477	3300049823	Bacteria	702
1439	Ga0501045_0003323	3300049824	Bacteria	11000
1440	Ga0501045_0004352	3300049824	Bacteria	9762
1441	Ga0501045_0140281	3300049824	Bacteria	1797
1442	nmdc:mga03683_17434_c1	3300050489	Bacteria	2718
1443	nmdc:mga03683_274518_c1	3300050489	Bacteria	787
1444	nmdc:mga03n38_366961_c1	3300050490	Bacteria	786
1445	nmdc:mga03n38_64360_c1	3300050490	Bacteria	1678
1446	nmdc:mga00v17_11235_c1	3300050491	Bacteria	4918
1447	nmdc:mga00v17_117908_c1	3300050491	Bacteria	1689
1448	nmdc:mga00v17_12296_c1	3300050491	Bacteria	4722
1449	nmdc:mga00v17_227117_c1	3300050491	Bacteria	1209
1450	nmdc:mga00v17_261514_c1	3300050491	Bacteria	1123
1451	nmdc:mga00v17_303901_c1	3300050491	Bacteria	1036
1452	nmdc:mga00v17_456401_c1	3300050491	Bacteria	829
1453	nmdc:mga0yw44_120803_c1	3300050492	Bacteria	1688
1454	nmdc:mga0yw44_29347_c1	3300050492	Bacteria	3175
1455	nmdc:mga0yw44_52049_c1	3300050492	Bacteria	2481
1456	nmdc:mga0yw44_65999_c1	3300050492	Bacteria	2232
1457	nmdc:mga0k408_213400_c1	3300050493	Bacteria	1152
1458	nmdc:mga0k408_373167_c1	3300050493	Bacteria	850
1459	nmdc:mga0k408_40371_c1	3300050493	Bacteria	2685
1460	nmdc:mga0k408_90047_c1	3300050493	Bacteria	1802
1461	nmdc:mga06z11_252133_c1	3300050494	Bacteria	1039
1462	nmdc:mga06z11_260036_c1	3300050494	Bacteria	1024
1463	nmdc:mga06z11_5217_c1	3300050494	Bacteria	5191
1464	nmdc:mga06z11_59740_c1	3300050494	Bacteria	1982
1465	nmdc:mga04h51_958_c1	3300050495	Bacteria	6657
1466	nmdc:mga07m45_23113_c1	3300050496	Bacteria	1229
1467	nmdc:mga07m45_342364_c1	3300050496	Bacteria	869
1468	nmdc:mga07m45_395112_c1	3300050496	Bacteria	803
1469	nmdc:mga07m45_401562_c1	3300050496	Bacteria	795
1470	nmdc:mga07m45_8863_c1	3300050496	Bacteria	5192
1471	nmdc:mga05p37_158567_c1	3300050507	Bacteria	2764
1472	nmdc:mga05p37_247255_c1	3300050507	Bacteria	2141
1473	nmdc:mga05p37_282843_c1	3300050507	Bacteria	1977
1474	nmdc:mga0qj67_1096485_c1	3300050509	Bacteria	622
1475	nmdc:mga0qj67_437711_c1	3300050509	Bacteria	1053
1476	nmdc:mga08y16_102759_c1	3300050511	Bacteria	2976
1477	nmdc:mga08y16_1197718_c1	3300050511	Bacteria	730
1478	nmdc:mga08y16_127265_c1	3300050511	Bacteria	2650
1479	nmdc:mga08y16_549433_c1	3300050511	Bacteria	1169
1480	nmdc:mga0n895_109830_c1	3300050512	Bacteria	2773
1481	nmdc:mga0n895_507676_c1	3300050512	Bacteria	1214
1482	nmdc:mga0rr50_1144197_c1	3300050513	Bacteria	662
1483	nmdc:mga0rr50_174772_c1	3300050513	Bacteria	1752
1484	nmdc:mga0a205_175143_c1	3300050515	Bacteria	2041
1485	nmdc:mga0a205_321122_c1	3300050515	Bacteria	1419
1486	nmdc:mga0sz30_12652_c2	3300050516	Bacteria	2237
1487	nmdc:mga0sz30_30335_c1	3300050516	Bacteria	2234
1488	nmdc:mga0sz30_41148_c1	3300050516	Bacteria	1943
1489	nmdc:mga0sz30_43074_c1	3300050516	Bacteria	1900
1490	Ga0495601_0009983	3300053077	Bacteria	5629
1491	Ga0495601_0014707	3300053077	Bacteria	4720
1492	Ga0495601_0064402	3300053077	Bacteria	2331
1493	Ga0495601_0066963	3300053077	Bacteria	2287
1494	Ga0495601_0515666	3300053077	Bacteria	771
1495	Ga0495612_0143985	3300053078	Bacteria	1035
1496	Ga0495612_0146357	3300053078	Bacteria	1026
1497	Ga0495595_0000699	3300053084	Bacteria	12793
1498	Ga0495595_0056996	3300053084	Bacteria	1822
1499	Ga0495619_0003768	3300053085	Bacteria	9751
1500	Ga0495619_0078651	3300053085	Bacteria	2217
1501	Ga0495619_0081836	3300053085	Bacteria	2175
1502	Ga0495619_0292737	3300053085	Bacteria	1128
1503	Ga0495619_0315809	3300053085	Bacteria	1082
1504	Ga0495619_0456719	3300053085	Bacteria	880
1505	Ga0500578_0069357	3300053086	Bacteria	2247
1506	Ga0500643_000278	3300053087	Bacteria	44354
1507	Ga0500643_015999	3300053087	Bacteria	2557
1508	Ga0500643_060511	3300053087	Bacteria	1064
1509	Ga0500644_0095093	3300053088	Bacteria	1122
1510	Ga0500644_0213157	3300053088	Bacteria	803
1511	Ga0500646_0002189	3300053090	Bacteria	5099
1512	Ga0500647_0108652	3300053091	Bacteria	1320
1513	Ga0500651_0013046	3300053093	Bacteria	5049
1514	Ga0500651_0216667	3300053093	Bacteria	1124
1515	Ga0500566_0008990	3300053094	Bacteria	5910
1516	Ga0500566_0018420	3300053094	Bacteria	4100
1517	Ga0500566_0035829	3300053094	Bacteria	2882
1518	Ga0500641_0032473	3300053096	Bacteria	2065
1519	Ga0500641_0048221	3300053096	Bacteria	1744
1520	Ga0500641_0151377	3300053096	Bacteria	1001
1521	Ga0500650_0002801	3300053098	Bacteria	5874
1522	Ga0500650_0086338	3300053098	Bacteria	1468
1523	Ga0500554_001643	3300053102	Bacteria	4301
1524	Ga0500555_002583	3300053103	Bacteria	5216
1525	Ga0500556_0000005	3300053104	Bacteria	581135
1526	Ga0500556_0052067	3300053104	Bacteria	1484
1527	Ga0500557_000028	3300053105	Bacteria	78414
1528	Ga0500562_009620	3300053108	Bacteria	2442
1529	Ga0500562_011585	3300053108	Bacteria	2238
1530	Ga0500569_025365	3300053109	Bacteria	1613
1531	Ga0500572_066187	3300053111	Bacteria	1108
1532	Ga0500572_141266	3300053111	Bacteria	784
1533	Ga0500592_001026	3300053116	Bacteria	4557
1534	Ga0500593_037159	3300053117	Bacteria	2182
1535	Ga0500594_0041106	3300053118	Bacteria	1265
1536	Ga0500595_001799	3300053119	Bacteria	11118
1537	Ga0500595_001904	3300053119	Bacteria	10754
1538	Ga0500595_032232	3300053119	Bacteria	1751
1539	Ga0500595_078444	3300053119	Bacteria	970
1540	Ga0500607_050084	3300053121	Bacteria	2227
1541	Ga0500608_000378	3300053122	Bacteria	17203
1542	Ga0500614_033240	3300053123	Bacteria	1273
1543	Ga0500617_160280	3300053124	Bacteria	878
1544	Ga0500618_007774	3300053125	Bacteria	3033
1545	Ga0500626_186358	3300053128	Bacteria	831
1546	Ga0500642_0000009	3300053130	Bacteria	286829
1547	Ga0500642_0003513	3300053130	Bacteria	4752
1548	Ga0500642_0203807	3300053130	Bacteria	920
1549	Ga0500652_001958	3300053131	Bacteria	6202
1550	Ga0500655_004688	3300053133	Bacteria	2458
1551	Ga0500658_0063524	3300053134	Bacteria	1541
1552	Ga0500658_0175435	3300053134	Bacteria	974
1553	Ga0500559_0000705	3300053136	Bacteria	21916
1554	Ga0500559_0020757	3300053136	Bacteria	2779
1555	Ga0500559_0029661	3300053136	Bacteria	2344
1556	Ga0500564_152355	3300053138	Bacteria	984
1557	Ga0500568_0000477	3300053139	Bacteria	29630
1558	Ga0500568_0091275	3300053139	Bacteria	1148
1559	Ga0500577_0001565	3300053142	Bacteria	5847
1560	Ga0500577_0177658	3300053142	Bacteria	912
1561	Ga0500589_104484	3300053147	Bacteria	1225
1562	Ga0500590_138998	3300053148	Bacteria	1113
1563	Ga0500604_0000396	3300053151	Bacteria	11969
1564	Ga0500616_0000118	3300053153	Bacteria	143496
1565	Ga0500619_053498	3300053154	Bacteria	1312
1566	Ga0500620_001010	3300053155	Bacteria	4944
1567	Ga0500622_0022820	3300053156	Bacteria	3314
1568	Ga0500622_0073129	3300053156	Bacteria	1729
1569	Ga0500624_002509	3300053157	Bacteria	2481
1570	Ga0500627_0001957	3300053158	Bacteria	5932
1571	Ga0500634_0025228	3300053161	Bacteria	3236
1572	Ga0500634_0178097	3300053161	Bacteria	960
1573	Ga0500638_014397	3300053162	Bacteria	3606
1574	Ga0500636_0000246	3300053177	Bacteria	29834
1575	Ga0500636_0002208	3300053177	Bacteria	10771
1576	Ga0500637_0000075	3300053178	Bacteria	35551
1577	Ga0500637_0096449	3300053178	Bacteria	1714
1578	Ga0500637_0098186	3300053178	Bacteria	1698
1579	Ga0500649_035602	3300053722	Bacteria	2094
1580	Ga0500645_003297	3300053730	Bacteria	6643
1581	Ga0500645_040044	3300053730	Bacteria	1387
1582	Ga0500645_094487	3300053730	Bacteria	846
1583	Ga0500609_001977	3300053731	Bacteria	2957
1584	Ga0500601_000529	3300053737	Bacteria	5720
1585	Ga0501084_0001687	3300054114	Bacteria	17561
1586	Ga0501084_0032214	3300054114	Bacteria	4384
1587	Ga0501084_0074672	3300054114	Bacteria	2839
1588	Ga0500661_000415	3300055283	Bacteria	7860
1589	Ga0500661_003836	3300055283	Bacteria	2824
1590	Ga0501082_0004787	3300060353	Bacteria	11800
1591	Ga0501082_0039991	3300060353	Bacteria	4046
1592	Ga0501082_0769537	3300060353	Bacteria	842
1593	Ga0466962_0032496	3300061719	Bacteria	2499
1594	2507505714	2507262055	Bacteria	8048963
1595	2508539607	2508501009	Bacteria	7784016
1596	2508695978	2508501042	Bacteria	8719808
1597	2509150803	2508501128	Bacteria	8613869
1598	2511397028	2511231028	Bacteria	8046582
1599	2513626650	2513237092	Bacteria	8341956
1600	2513641788	2513237094	Bacteria	8789602
1601	2513648131	2513237095	Bacteria	8976980
1602	2513677968	2513237098	Bacteria	9902361
1603	2513694379	2513237101	Bacteria	7952346
1604	2513699186	2513237102	Bacteria	7703324
1605	2513857176	2513237137	Bacteria	9558895
1606	2513875688	2513237139	Bacteria	8737671
1607	2513889748	2513237141	Bacteria	8496279
1608	2514016354	2513237161	Bacteria	8871253
1609	2515624111	2515154112	Bacteria	8294334
1610	2517106990	2517093001	Bacteria	9002274
1611	2524435617	2524023205	Bacteria	8918781
1612	2524468327	2524023210	Bacteria	9029266
1613	2528850269	2528768022	Bacteria	10457665
1614	2603858104	2602042107	Bacteria	6226103
1615	2617352919	2617270735	Bacteria	9163226
1616	2617377133	2617270741	Bacteria	8201522
1617	2644290048	2643221651	Bacteria	4798932
1618	2723849103	2721755755	Bacteria	8322773
1619	2745079873	2744054633	Bacteria	8678936
1620	2793063235	2791355196	Bacteria	7323613
1621	2793082594
1622	2805919364	2802429603	Bacteria	8777136
1623	2818237153	2816332527	Bacteria	8933356
1624	2824608849	2824600985	Bacteria	8488197
1625	2824612773	2824609381	Bacteria	8672835
1626	2824625066	2824617872	Bacteria	8814715
1627	2824632517	2824626560	Bacteria	8813858
1628	2824643110	2824635225	Bacteria	8785348
1629	2824651431	2824644064	Bacteria	8743947
1630	2824661208	2824653114	Bacteria	8493680
1631	2824670687	2824661429	Bacteria	9877870
1632	2824674741	2824671348	Bacteria	8369588
1633	2824685441	2824679649	Bacteria	8248951
1634	2824692617	2824687955	Bacteria	8360029
1635	2824700944	2824696289	Bacteria	8335049
1636	2824712225	2824704595	Bacteria	9667483
1637	2824721485	2824714736	Bacteria	8717648
1638	2824731361	2824723954	Bacteria	8758240
1639	2824734111	2824732956	Bacteria	7810675
1640	2824749172	2824746037	Bacteria	7911610
1641	2824760651	2824753945	Bacteria	9787441
1642	2824773045	2824763712	Bacteria	9792355
1643	2824780138	2824773399	Bacteria	8360218
1644	2838130238	2838122688	Bacteria	8803140
1645	2841944319	2841941048	Bacteria	8688029
1646	2841954504	2841949485	Bacteria	8680857
1647	2841962931	2841957949	Bacteria	8652217
1648	2841969096	2841966195	Bacteria	8673214
1649	2841979870	2841974524	Bacteria	8931498
1650	2841990949	2841983080	Bacteria	8395090
1651	2842044026	2842038055	Bacteria	8002051
1652	2842051985	2842045827	Bacteria	8006841
1653	2844321675	2844315083	Bacteria	8138177
1654	2847939666	2847930680	Bacteria	9342022
1655	2847941615	2847939898	Bacteria	8606328
1656	2849082540	2849076700	Bacteria	7039503
1657	2857511442	2857509624	Bacteria	7472071
1658	2857527491	2857524615	Bacteria	6615449
1659	2874593166	2874590934	Bacteria	8299676
1660	2874606965	2874604998	Bacteria	7834745
1661	2874615582	2874612657	Bacteria	8252029
1662	2874624295	2874620515	Bacteria	8290088
1663	2874634064	2874628541	Bacteria	8630250
1664	2874645501	2874645413	Bacteria	8214782
1665	2876764530	2876761206	Bacteria	10111113
1666	2876773206	2876771140	Bacteria	8287509
1667	2876812509	2876808645	Bacteria	8824342
1668	2876820513	2876818435	Bacteria	8274608
1669	2879076848	2879074833	Bacteria	8279565
1670	2879090531	2879083081	Bacteria	8587928
1671	2879101868	2879099564	Bacteria	10442239
1672	2879115037	2879110137	Bacteria	8907982
1673	2879131035	2879127579	Bacteria	8294491
1674	2879150242	2879142872	Bacteria	8267021
1675	2881364961	2881364244	Bacteria	7710352
1676	2881672282	2881665667	Bacteria	8175609
1677	2885368135	2885366525	Bacteria	8326213
1678	2885384643	2885383462	Bacteria	9473874
1679	2885410934	2885409591	Bacteria	9235467
1680	2888380138	2888378607	Bacteria	9652610
1681	2888391152	2888388044	Bacteria	7304136
1682	2888420900	2888419890	Bacteria	7857137
1683	2889034940	2889033259	Bacteria	9099371
1684	2893066984	2893066018	Bacteria	6158120
1685	2903727750	2903727486	Bacteria	8281579
1686	2903773452	2903768456	Bacteria	9749579
1687	2904672366	2904666416	Bacteria	8226587
1688	2904695701	2904690495	Bacteria	9412302
1689	2904717945	2904711408	Bacteria	9771557
1690	2906602764	2906602504	Bacteria	8295279
1691	2906632430	2906626472	Bacteria	8826946
1692	2906639940	2906635258	Bacteria	8601019
1693	2906645070	2906643746	Bacteria	8722424
1694	2906666546	2906660503	Bacteria	8595048
1695	2908764211	2908756301	Bacteria	8864324
1696	2908783048	2908775508	Bacteria	8092255
1697	2919073341	2919073203	Bacteria	6531949
1698	2922364630	2922361189	Bacteria	7436256
1699	2922378491
1700	2922391896	2922386360	Bacteria	7017218
1701	2922400918	2922393267	Bacteria	8285685
1702	2929622421	2929615660	Bacteria	9193770
1703	2929631362	2929624759	Bacteria	9339455
1704	2932786221	2932784394	Bacteria	9704911
1705	2932794819	2932794094	Bacteria	7915132
1706	2932805389	2932801729	Bacteria	7987968
1707	2932812705	2932809354	Bacteria	9135765
1708	2932823067	2932818245	Bacteria	9955613
1709	2932829459	2932828146	Bacteria	9745859
1710	2933584499	2933577622	Bacteria	9116884
1711	2935614768	2935608549	Bacteria	8203142
1712	2935617891	2935616580	Bacteria	9032984
1713	2935632734	2935630451	Bacteria	8169952
1714	2935641625	2935638405	Bacteria	10015038
1715	2935649161	2935648319	Bacteria	8801166
1716	2935658067	2935656913	Bacteria	8965014
1717	2935669317	2935665750	Bacteria	9571747
1718	2935678087	2935675223	Bacteria	9928132
1719	2935693594	2935684952	Bacteria	9590419
1720	2935702914	2935694250	Bacteria	9291695
1721	2935707140	2935703347	Bacteria	10242284
1722	2935716958	2935713505	Bacteria	9608509
1723	2935730208	2935722832	Bacteria	9608746
1724	2935738397	2935732158	Bacteria	9706831
1725	2935750185	2935741537	Bacteria	9707219
1726	2935759779	2935750917	Bacteria	9590372
1727	2935764570	2935760218	Bacteria	9817913
1728	2935777099	2935769743	Bacteria	7878163
1729	2935777973	2935777560	Bacteria	8077691
1730	2935787177	2935785616	Bacteria	7962367
1731	2935796035	2935793552	Bacteria	8012592
1732	2935804479	2935801545	Bacteria	9301974
1733	2935819120	2935810662	Bacteria	9401221
1734	2935826192	2935819856	Bacteria	8261050
1735	2935831356	2935827899	Bacteria	10038562
1736	2935841965	2935837841	Bacteria	9454360
1737	2935853688	2935847175	Bacteria	8228321
1738	2935856610	2935855204	Bacteria	9035059
1739	2935870225	2935864058	Bacteria	9784707
1740	2935874450	2935873716	Bacteria	9632195
1741	2935887529	2935883170	Bacteria	7964738
1742	2935910910	2935908558	Bacteria	8568796
1743	2935922092	2935916978	Bacteria	9113783
1744	2935929771	2935926038	Bacteria	8601059
1745	2935937439	2935934488	Bacteria	8602579
1746	2935948162	2935942939	Bacteria	8599779
1747	2935957617	2935951376	Bacteria	8602333
1748	2935964271	2935959822	Bacteria	7869783
1749	2935971104	2935967501	Bacteria	8603075
1750	2935982303	2935975950	Bacteria	8347125
1751	2935985445	2935984226	Bacteria	8302647
1752	2935993911	2935992306	Bacteria	9802711
1753	2936005078	2936002035	Bacteria	9362176
1754	2936012286	2936011229	Bacteria	8801034
1755	2936020633	2936019824	Bacteria	8804134
1756	2936029579	2936028420	Bacteria	8965941
1757	2936045729	2936037263	Bacteria	9446081
1758	2936051956	2936046547	Bacteria	8903709
1759	2936056787	2936055302	Bacteria	8785755
1760	2940565767	2940556831	Bacteria	9590747
1761	2941508602	2941507105	Bacteria	8166816
1762	2941516432	2941515067	Bacteria	8166720
1763	2941524552	2941523033	Bacteria	8169134
1764	2941532236	2941531003	Bacteria	7653939
1765	2941547016	2941538514	Bacteria	9402094
1766	3005490535	3005483717	Bacteria	7877331
1767	3005509679	3005506211	Bacteria	6943378
1768	3005588908	3005587118	Bacteria	7794411
1769	3005602052	3005594810	Bacteria	8716512
1770	3005717784	3005710791	Bacteria	7622528
1771	3005724834	3005718088	Bacteria	8283608
1772	8006932430	8006926726	Bacteria	6749210
1773	8006971290	8006964411	Bacteria	8966052
1774	8006988582	8006984368	Bacteria	9651211
1775	8006995213	8006994254	Bacteria	8309700
1776	8016518776	8016511872	Bacteria	9921665
1777	8016526726	8016522445	Bacteria	8156687
1778	8016531813	8016530956	Bacteria	8155261
1779	8016545018	8016539877	Bacteria	8155419
1780	8016557059	8016548790	Bacteria	8155074
1781	8016565409	8016557553	Bacteria	8154380
1782	8016570093	8016566248	Bacteria	8158151
1783	8016582663	8016575299	Bacteria	8154085
1784	8016585664	8016583857	Bacteria	10421953
1785	8016603046	8016595262	Bacteria	8149947
1786	8016605947	8016603502	Bacteria	8731218
1787	8016617833	8016613128	Bacteria	8794220
1788	8016623741	8016622563	Bacteria	7999408
1789	8016635128	8016630954	Bacteria	9217207
1790	8017057903	8017057580	Bacteria	10023680
1791	8019531639	8019530166	Bacteria	8155624
1792	8019539896	8019538911	Bacteria	7872763
1793	8019550761	8019547302	Bacteria	7996444
1794	8019577821	8019576017	Bacteria	10049540
1795	8019605832	8019597564	Bacteria	10041141
1796	8019612701	8019608314	Bacteria	10042931
1797	8019623466	8019619141	Bacteria	9218857
1798	8019638677	8019629233	Bacteria	8687553
1799	8019641062	8019638758	Bacteria	9062356
1800	8019651922	8019648815	Bacteria	10014479
1801	8019676136	8019668869	Bacteria	8791617
1802	8019679847	8019678201	Bacteria	8863603
1803	8019695691	8019687851	Bacteria	8712826
1804	8055750872	8055742211	Bacteria	9226248
1805	8056679296	8056673599	Bacteria	7871253
1806	8056681387	8056681323	Bacteria	8472857
1807	8056694697	8056689827	Bacteria	6712655
1808	8056975555	8056967851	Bacteria	9038162
1809	Ga0496115_0672631
1810	2214911863
1811	ARcpr5oldR_c000133
1812	ARSoilYngRDRAFT_c00291
1813	ARcpr5yngRDRAFT_c000655
1814	ARSoilOldRDRAFT_c000255
1815	ARCol0oldRDRAFT_c00602
1816	ARCol0yngRDRAFT_1000207
1817	JGI24746J21847_1002330
1818	JGI24747J21853_1001618
1819	JGI24740J21852_10008161
1820	JGI24739J22299_10002133
1821	JGI24739J22299_10014522
1822	JGI24737J22298_10006524
1823	JGI24735J21928_10015500
1824	JGI24750J21931_1000306
1825	JGI24738J21930_10016858
1826	JGI24738J21930_10035803
1827	JGI24738J21930_10036983
1828	JGI24749J21850_1006556
1829	JGI24034J26672_10000938
1830	JGI24742J22300_10002042
1831	JGI25406J46586_10031728
1832	JGI25153J46596_10001604
1833	JGI25153J46596_10002291
1834	JGI25153J46596_10007925
1835	JGI25153J46596_10008998
1836	JGI25160J50197_1005286
1837	JGI25160J50197_1014867
1838	JGI25404J52841_10010453
1839	JGI25404J52841_10021243
1840	Ga0055542_1008419
1841	Ga0055529_1005529
1842	Ga0055524_1045134
1843	Ga0055531_10005524
1844	Ga0055531_10007473
1845	Ga0055543_1002707
1846	Ga0065165_1005568
1847	Ga0065165_1005760
1848	Ga0065717_1005363
1849	Ga0065716_1001632
1850	Ga0065704_10006824
1851	Ga0065712_10089599
1852	Ga0065715_10008670
1853	Ga0070658_10015577
1854	Ga0070658_10036212
1855	Ga0070676_10015450
1856	Ga0070676_10052710
1857	Ga0070676_10089122
1858	Ga0070683_100014076
1859	Ga0070683_100048868
1860	Ga0070690_100009976
1861	Ga0070690_100027758
1862	Ga0070690_100066780
1863	Ga0070690_100111027
1864	Ga0070670_100415516
1865	Ga0070670_100924178
1866	Ga0070677_10197425
1867	Ga0068869_100005362
1868	Ga0068869_100317735
1869	Ga0070666_10089682
1870	Ga0070680_100090465
1871	Ga0070680_100152353
1872	Ga0070680_100848572
1873	Ga0070682_100697350
1874	Ga0068868_100035101
1875	Ga0068868_100298087
1876	Ga0068868_100562192
1877	Ga0068868_100882916
1878	Ga0070660_100040041
1879	Ga0070660_100167888
1880	Ga0070660_100416169
1881	Ga0070689_100040860
1882	Ga0070689_100131274
1883	Ga0070691_10087613
1884	Ga0070687_100054857
1885	Ga0070687_100357555
1886	Ga0070661_100088583
1887	Ga0070661_100280880
1888	Ga0070661_100347137
1889	Ga0070692_10068790
1890	Ga0070692_10104648
1891	Ga0070668_100103090
1892	Ga0070668_100184183
1893	Ga0070668_100219502
1894	Ga0070668_100237557
1895	Ga0070668_100408606
1896	Ga0070668_100946368
1897	Ga0070669_100009523
1898	Ga0070669_100113283
1899	Ga0070669_100280062
1900	Ga0070675_100034164
1901	Ga0070675_100785894
1902	Ga0070671_100018470
1903	Ga0070671_100055481
1904	Ga0070671_100116779
1905	Ga0070671_100131073
1906	Ga0070671_100348255
1907	Ga0070671_101013859
1908	Ga0070674_100931401
1909	Ga0070673_100006016
1910	Ga0070673_100018157
1911	Ga0070688_100054184
1912	Ga0070688_100090194
1913	Ga0070688_100221599
1914	Ga0070688_100435879
1915	Ga0070688_100677469
1916	Ga0070659_100099578
1917	Ga0070659_100101942
1918	Ga0070659_100207172
1919	Ga0070659_100397832
1920	Ga0070667_100039791
1921	Ga0070667_100107058
1922	Ga0070667_100163512
1923	Ga0070667_100221243
1924	Ga0070667_100913355
1925	Ga0070709_10008600
1926	Ga0070709_10428499
1927	Ga0070709_10513607
1928	Ga0070714_100134185
1929	Ga0070714_100227095
1930	Ga0070714_100276899
1931	Ga0070713_100052651
1932	Ga0070713_100072884
1933	Ga0070713_100089043
1934	Ga0070713_100409266
1935	Ga0070710_10092909
1936	Ga0070710_10185989
1937	Ga0070701_10121852
1938	Ga0070701_10170190
1939	Ga0070711_100087269
1940	Ga0070711_100769677
1941	Ga0070705_100019679
1942	Ga0070705_100165611
1943	Ga0070705_100918351
1944	Ga0070700_100674932
1945	Ga0070708_100544521
1946	Ga0070663_100002910
1947	Ga0070663_100049267
1948	Ga0070663_100051460
1949	Ga0070663_100064014
1950	Ga0070663_100146590
1951	Ga0070663_100239861
1952	Ga0070663_100449802
1953	Ga0070663_100511551
1954	Ga0070678_100029230
1955	Ga0070678_100123916
1956	Ga0070678_100272630
1957	Ga0070678_100281527
1958	Ga0070678_100294563
1959	Ga0070662_100594283
1960	Ga0070681_10040915
1961	Ga0068867_100024117
1962	Ga0068867_100266579
1963	Ga0070685_10007220
1964	Ga0070685_10377599
1965	Ga0070685_10528455
1966	Ga0070685_10658080
1967	Ga0070698_100900917
1968	Ga0070699_100387440
1969	Ga0070679_100045216
1970	Ga0070679_100870406
1971	Ga0070684_100041708
1972	Ga0070684_100056864
1973	Ga0070684_100427083
1974	Ga0070684_100834814
1975	Ga0070684_100913162
1976	Ga0068853_100029132
1977	Ga0068853_100037194
1978	Ga0068853_100154051
1979	Ga0068853_100176657
1980	Ga0068853_100178589
1981	Ga0068853_100216523
1982	Ga0068853_100286910
1983	Ga0070672_100074275
1984	Ga0070672_101216951
1985	Ga0070686_100138899
1986	Ga0070686_100140554
1987	Ga0070695_100007606
1988	Ga0070695_100143920
1989	Ga0070696_100764698
1990	Ga0070693_100068169
1991	Ga0070693_100150542
1992	Ga0070693_100157753
1993	Ga0070693_100454721
1994	Ga0070665_100028785
1995	Ga0070665_100029858
1996	Ga0070665_100116177
1997	Ga0070665_100119192
1998	Ga0070665_100218932
1999	Ga0070665_100329012
2000	Ga0070665_100427495
2001	Ga0070665_100432315
2002	Ga0070665_100501426
2003	Ga0070704_100050220
2004	Ga0070704_100306814
2005	Ga0070704_100328155
2006	Ga0068855_100043022
2007	Ga0068855_100076846
2008	Ga0068855_100082873
2009	Ga0068855_100180572
2010	Ga0068855_100745078
2011	Ga0070664_100190239
2012	Ga0070664_100231718
2013	Ga0070664_100353167
2014	Ga0070664_100934811
2015	Ga0068857_100003131
2016	Ga0068857_100016900
2017	Ga0068857_100048283
2018	Ga0068857_100111718
2019	Ga0068857_100633257
2020	Ga0068854_100009446
2021	Ga0068854_100025141
2022	Ga0068854_100110432
2023	Ga0068854_100211228
2024	Ga0068856_100048827
2025	Ga0068856_100052613
2026	Ga0068856_100085326
2027	Ga0068856_100174867
2028	Ga0068856_100175839
2029	Ga0068856_100559691
2030	Ga0068856_100909849
2031	Ga0068856_101037630
2032	Ga0070702_100033101
2033	Ga0068852_100050524
2034	Ga0068852_100207146
2035	Ga0068852_100223772
2036	Ga0068852_100317394
2037	Ga0068852_100426684
2038	Ga0068852_100469452
2039	Ga0068852_100614239
2040	Ga0068859_100013930
2041	Ga0068859_100087512
2042	Ga0068859_100408141
2043	Ga0068864_100000501
2044	Ga0068864_100059311
2045	Ga0068864_100107715
2046	Ga0068864_100140430
2047	Ga0068864_100594319
2048	Ga0068864_101241109
2049	Ga0068866_10009096
2050	Ga0068866_10081275
2051	Ga0068866_10498061
2052	Ga0068861_100108219
2053	Ga0068861_100137095
2054	Ga0068861_100172566
2055	Ga0068851_10001649
2056	Ga0068851_10048827
2057	Ga0068870_10017790
2058	Ga0068870_10789204
2059	Ga0068863_100001487
2060	Ga0068863_100114649
2061	Ga0068863_100641427
2062	Ga0068863_100880978
2063	Ga0068863_101239055
2064	Ga0068858_100008725
2065	Ga0068858_100160649
2066	Ga0068858_100205803
2067	Ga0068858_100362857
2068	Ga0068858_100568185
2069	Ga0068858_100635724
2070	Ga0068860_100087752
2071	Ga0068860_100196348
2072	Ga0068860_100495997
2073	Ga0068860_100971666
2074	Ga0068860_101021522
2075	Ga0068862_100130981
2076	Ga0068862_100194451
2077	Ga0081455_10013105
2078	Ga0081455_10028472
2079	Ga0081455_10058469
2080	Ga0081455_10062151
2081	Ga0081455_10134396
2082	Ga0081455_10448569
2083	Ga0081538_10001497
2084	Ga0081538_10024144
2085	Ga0081540_1001924
2086	Ga0081540_1003483
2087	Ga0081540_1003507
2088	Ga0081540_1003700
2089	Ga0081540_1005593
2090	Ga0081540_1015557
2091	Ga0081540_1020696
2092	Ga0081540_1021821
2093	Ga0081540_1028835
2094	Ga0081540_1031643
2095	Ga0081540_1120057
2096	Ga0081539_10000902
2097	Ga0081539_10027917
2098	Ga0081539_10057458
2099	Ga0081539_10064732
2100	Ga0070717_10002469
2101	Ga0070717_10009912
2102	Ga0075365_10063057
2103	Ga0075365_10086275
2104	Ga0075365_10169763
2105	Ga0075365_10307594
2106	Ga0075365_10356903
2107	Ga0075368_10001108
2108	Ga0075368_10002847
2109	Ga0075368_10054261
2110	Ga0075368_10090766
2111	Ga0075368_10175460
2112	Ga0075363_100000927
2113	Ga0075363_100060388
2114	Ga0075363_100061555
2115	Ga0075363_100190898
2116	Ga0075364_10008079
2117	Ga0075364_10050941
2118	Ga0075364_10292635
2119	Ga0070715_10062008
2120	Ga0070712_100172423
2121	Ga0075362_10061018
2122	Ga0075362_10102719
2123	Ga0075362_10186107
2124	Ga0075367_10004564
2125	Ga0075367_10009741
2126	Ga0075367_10036765
2127	Ga0075367_10153038
2128	Ga0075367_10187760
2129	Ga0075367_10195404
2130	Ga0075367_10196260
2131	Ga0075369_10073524
2132	Ga0075369_10097144
2133	Ga0075369_10107742
2134	Ga0075369_10147979
2135	Ga0075366_10046923
2136	Ga0075366_10050585
2137	Ga0075366_10319496
2138	Ga0097621_100022827
2139	Ga0097621_100515650
2140	Ga0097621_100655409
2141	Ga0097621_101068740
2142	Ga0075370_10017300
2143	Ga0075370_10041149
2144	Ga0075370_10181981
2145	Ga0075370_10274611
2146	Ga0075370_10422841
2147	Ga0068871_100099573
2148	Ga0068871_100481333
2149	Ga0075428_100097833
2150	Ga0075431_100092449
2151	Ga0075431_100186659
2152	Ga0075433_10269939
2153	Ga0068865_100044064
2154	Ga0068865_100110189
2155	Ga0068865_100628337
2156	Ga0075436_100143930
2157	Ga0097620_100013930
2158	Ga0097620_100087516
2159	Ga0097620_100408153
2160	Ga0099825_1032185
2161	Ga0099824_1009990
2162	Ga0075435_100134829
2163	Ga0075435_100179331
2164	Ga0099795_10117307
2165	Ga0105251_10093367
2166	Ga0105244_10020920
2167	Ga0105250_10026210
2168	Ga0105240_10002869
2169	Ga0105240_10005590
2170	Ga0105240_10175899
2171	Ga0105240_10203680
2172	Ga0105240_10208525
2173	Ga0105240_10481297
2174	Ga0105240_11110202
2175	Ga0111539_10004905
2176	Ga0111539_10094534
2177	Ga0111539_10530111
2178	Ga0111539_11271021
2179	Ga0105245_10013591
2180	Ga0105245_10188048
2181	Ga0105245_10270594
2182	Ga0105245_10372016
2183	Ga0105247_10033384
2184	Ga0105247_10246097
2185	Ga0105247_10782551
2186	Ga0114129_10128894
2187	Ga0114129_10154066
2188	Ga0114129_10234985
2189	Ga0105243_10027119
2190	Ga0105243_10259638
2191	Ga0105243_10390440
2192	Ga0105243_10552937
2193	Ga0105241_10012442
2194	Ga0105241_10031939
2195	Ga0105241_10036477
2196	Ga0105241_10051683
2197	Ga0105241_10327541
2198	Ga0105241_10478148
2199	Ga0105241_10524537
2200	Ga0105242_10036698
2201	Ga0105248_10070776
2202	Ga0105248_10100059
2203	Ga0105248_10354898
2204	Ga0105248_10398030
2205	Ga0105237_10053520
2206	Ga0105237_10141670
2207	Ga0105237_10604311
2208	Ga0105238_10003573
2209	Ga0105238_10051142
2210	Ga0105238_10202973
2211	Ga0105238_10236890
2212	Ga0105238_10294543
2213	Ga0105238_10344350
2214	Ga0105238_10745575
2215	Ga0105238_11302977
2216	Ga0105249_10137615
2217	Ga0099796_10059076
2218	Ga0099796_10088345
2219	Ga0099796_10093277
2220	Ga0105239_10077327
2221	Ga0105239_10078453
2222	Ga0105239_10155502
2223	Ga0105239_10175241
2224	Ga0105239_10193691
2225	Ga0105239_10687272
2226	Ga0105239_10729634
2227	Ga0105239_10938440
2228	Ga0105239_11262763
2229	Ga0105246_10037876
2230	Ga0105246_10041752
2231	Ga0105246_10054890
2232	Ga0105246_10148416
2233	Ga0157335_1000327
2234	Ga0157342_1001487
2235	Ga0157373_10872817
2236	Ga0157371_10043766
2237	Ga0157371_10060376
2238	Ga0157371_10520451
2239	Ga0157370_10066426
2240	Ga0157370_10329548
2241	Ga0157370_11203856
2242	Ga0157369_11544308
2243	Ga0157374_10008247
2244	Ga0157374_10046569
2245	Ga0157374_10071735
2246	Ga0157374_10136090
2247	Ga0157378_10087734
2248	Ga0157378_11532830
2249	Ga0157378_12031012
2250	Ga0163162_10025808
2251	Ga0163162_10064631
2252	Ga0163162_10660475
2253	Ga0163162_10672659
2254	Ga0163162_10802306
2255	Ga0163162_11146949
2256	Ga0157372_10052804
2257	Ga0157372_10799747
2258	Ga0157375_10003919
2259	Ga0157375_10122365
2260	Ga0157375_10533056
2261	Ga0157375_10687289
2262	Ga0157375_11223191
2263	Ga0163163_10001518
2264	Ga0163163_10006923
2265	Ga0163163_10019540
2266	Ga0163163_10174446
2267	Ga0163163_10322527
2268	Ga0163163_11327748
2269	Ga0157380_10393451
2270	Ga0157380_10453269
2271	Ga0182008_10418122
2272	Ga0157377_10047910
2273	Ga0157377_10279935
2274	Ga0157377_10302362
2275	Ga0157379_10047563
2276	Ga0157379_10162444
2277	Ga0157379_10504128
2278	Ga0157376_10034361
2279	Ga0157376_10312044
2280	Ga0157376_10813144
2281	Ga0163161_10035313
2282	Ga0206350_10496500
2283	Ga0214544_1000007
2284	Ga0214542_1000007
2285	Ga0214545_1000006
2286	Ga0214543_1000009
2287	Ga0213872_10024035
2288	Ga0213872_10130788
2289	Ga0213874_10060029
2290	Ga0213876_10266907
2291	Ga0213875_10033755
2292	Ga0213871_10000146
2293	Ga0209563_101691
2294	Ga0209677_101315
2295	Ga0209148_1000645
2296	Ga0209233_1001380
2297	Ga0209233_1003243
2298	Ga0209233_1037669
2299	Ga0209455_1002521
2300	Ga0207673_1001791
2301	Ga0209564_1000384
2302	Ga0209564_1009905
2303	Ga0209758_1000015
2304	Ga0209758_1000389
2305	Ga0209758_1000716
2306	Ga0209758_1001056
2307	Ga0209758_1003447
2308	Ga0209758_1010182
2309	Ga0209758_1029178
2310	Ga0209256_1008939
2311	Ga0209256_1018664
2312	Ga0209256_1059422
2313	Ga0207426_1000380
2314	Ga0207426_1002496
2315	Ga0207426_1012053
2316	Ga0209257_1001378
2317	Ga0207697_10002563
2318	Ga0207697_10009251
2319	Ga0207697_10059109
2320	Ga0207697_10194223
2321	Ga0207656_10001912
2322	Ga0207682_10002547
2323	Ga0207682_10231886
2324	Ga0207692_10089754
2325	Ga0207642_10103933
2326	Ga0207642_10194177
2327	Ga0207710_10044132
2328	Ga0207688_10000420
2329	Ga0207688_10017559
2330	Ga0207688_10050406
2331	Ga0207688_10050480
2332	Ga0207688_10174879
2333	Ga0207680_10490956
2334	Ga0207680_10511850
2335	Ga0207647_10001208
2336	Ga0207647_10016448
2337	Ga0207647_10079788
2338	Ga0207645_10006423
2339	Ga0207645_10100017
2340	Ga0207645_10433108
2341	Ga0207643_10000085
2342	Ga0207643_10032606
2343	Ga0207705_10029513
2344	Ga0207705_10371550
2345	Ga0207705_10432624
2346	Ga0207654_10016717
2347	Ga0207654_10021104
2348	Ga0207654_10030175
2349	Ga0207654_10235208
2350	Ga0207654_10346568
2351	Ga0207654_10412185
2352	Ga0207707_10141145
2353	Ga0207707_10345952
2354	Ga0207695_10000065
2355	Ga0207695_10000463
2356	Ga0207695_10051076
2357	Ga0207695_10066058
2358	Ga0207695_11075822
2359	Ga0207671_10051470
2360	Ga0207671_10662964
2361	Ga0207693_10024379
2362	Ga0207693_10029000
2363	Ga0207693_10092560
2364	Ga0207693_10179546
2365	Ga0207693_10298720
2366	Ga0207663_10011980
2367	Ga0207663_10028990
2368	Ga0207663_10634833
2369	Ga0207660_10111408
2370	Ga0207660_10413330
2371	Ga0207662_10021760
2372	Ga0207657_10031172
2373	Ga0207657_10090739
2374	Ga0207657_10163922
2375	Ga0207649_10141082
2376	Ga0207649_10220110
2377	Ga0207649_10248428
2378	Ga0207649_10443872
2379	Ga0207652_10156845
2380	Ga0207652_10290508
2381	Ga0207652_10328042
2382	Ga0207652_11157539
2383	Ga0207681_10101564
2384	Ga0207681_10223112
2385	Ga0207681_10660236
2386	Ga0207694_10000234
2387	Ga0207694_10060225
2388	Ga0207694_10084867
2389	Ga0207694_10428654
2390	Ga0207650_10018107
2391	Ga0207659_10007937
2392	Ga0207659_10049744
2393	Ga0207687_10007762
2394	Ga0207687_10041286
2395	Ga0207687_10144203
2396	Ga0207687_10270049
2397	Ga0207700_10007273
2398	Ga0207700_10341530
2399	Ga0207664_10071467
2400	Ga0207664_10117460
2401	Ga0207664_10905504
2402	Ga0207644_10024752
2403	Ga0207644_10091140
2404	Ga0207644_10295385
2405	Ga0207644_10422523
2406	Ga0207690_10041750
2407	Ga0207690_10205636
2408	Ga0207690_10252474
2409	Ga0207690_10292065
2410	Ga0207706_10088251
2411	Ga0207706_10094123
2412	Ga0207706_10134965
2413	Ga0207686_10261568
2414	Ga0207686_10327329
2415	Ga0207709_10053693
2416	Ga0207709_10370573
2417	Ga0207709_10503279
2418	Ga0207670_10002363
2419	Ga0207670_10102427
2420	Ga0207670_10663123
2421	Ga0207670_11084032
2422	Ga0207669_10459115
2423	Ga0207669_10912080
2424	Ga0207704_10124351
2425	Ga0207704_10150475
2426	Ga0207704_10395641
2427	Ga0207704_10471429
2428	Ga0207704_10747748
2429	Ga0207665_10066129
2430	Ga0207691_10020632
2431	Ga0207691_10050325
2432	Ga0207691_10894046
2433	Ga0207691_11025331
2434	Ga0207711_10063221
2435	Ga0207711_10116539
2436	Ga0207711_10271550
2437	Ga0207689_10301654
2438	Ga0207689_10311360
2439	Ga0207661_10044110
2440	Ga0207661_10178147
2441	Ga0207679_10632009
2442	Ga0207679_10866583
2443	Ga0207667_10026572
2444	Ga0207667_10076155
2445	Ga0207667_10138057
2446	Ga0207667_10254262
2447	Ga0207667_10884633
2448	Ga0207651_10002327
2449	Ga0207651_10010959
2450	Ga0207651_10532818
2451	Ga0207712_10107821
2452	Ga0207712_10263259
2453	Ga0207712_10618796
2454	Ga0207668_10070733
2455	Ga0207668_10170887
2456	Ga0207668_10834618
2457	Ga0207668_11128067
2458	Ga0207640_10018424
2459	Ga0207640_10022981
2460	Ga0207658_10075608
2461	Ga0207658_10126621
2462	Ga0207658_10345610
2463	Ga0207677_10089177
2464	Ga0207677_10232838
2465	Ga0207677_10252562
2466	Ga0207703_10058879
2467	Ga0207703_10062109
2468	Ga0207703_10083826
2469	Ga0207703_10392340
2470	Ga0207703_10416304
2471	Ga0207639_10029190
2472	Ga0207639_10270426
2473	Ga0207639_10295019
2474	Ga0207639_10325906
2475	Ga0207639_10684825
2476	Ga0207639_11407499
2477	Ga0207678_10005146
2478	Ga0207678_10010843
2479	Ga0207678_10013588
2480	Ga0207678_10016226
2481	Ga0207678_10057915
2482	Ga0207678_10078637
2483	Ga0207678_10096321
2484	Ga0207678_10128205
2485	Ga0207708_10121050
2486	Ga0207702_10000098
2487	Ga0207702_10023104
2488	Ga0207702_10105618
2489	Ga0207702_10488414
2490	Ga0207702_10619569
2491	Ga0207641_10084753
2492	Ga0207641_10698471
2493	Ga0207641_11209277
2494	Ga0207641_11271659
2495	Ga0207648_10001362
2496	Ga0207648_10016972
2497	Ga0207648_10620474
2498	Ga0207676_10112306
2499	Ga0207676_10119808
2500	Ga0207676_10667316
2501	Ga0207674_10006546
2502	Ga0207674_10009002
2503	Ga0207674_10010216
2504	Ga0207674_10031549
2505	Ga0207674_10082038
2506	Ga0207675_100359610
2507	Ga0207683_10004914
2508	Ga0207683_10057619
2509	Ga0207683_10112867
2510	Ga0207683_10203433
2511	Ga0207683_10291838
2512	Ga0207683_10877124
2513	Ga0207683_11092839
2514	Ga0207683_11298497
2515	Ga0207698_10105252
2516	Ga0207698_10192457
2517	Ga0207698_10218966
2518	Ga0207698_10327212
2519	Ga0207698_10384510
2520	Ga0207698_10476330
2521	Ga0207698_10705566
2522	Ga0207698_10717463
2523	Ga0209389_1000168
2524	Ga0209389_1000180
2525	Ga0209589_1000015
2526	Ga0209589_1000570
2527	Ga0209489_100015
2528	Ga0209489_101190
2529	Ga0209489_101411
2530	Ga0209700_100025
2531	Ga0209700_101443
2532	Ga0209967_1015941
2533	Ga0210002_1003502
2534	Ga0209971_1034805
2535	Ga0209998_10011152
2536	Ga0209813_10169264
2537	Ga0207428_10000664
2538	Ga0207428_10001593
2539	Ga0207428_10349709
2540	Ga0268266_10003266
2541	Ga0268266_10046072
2542	Ga0268266_10151210
2543	Ga0268266_10165793
2544	Ga0268266_10171356
2545	Ga0268266_10210008
2546	Ga0268266_10282367
2547	Ga0268265_10128769
2548	Ga0268265_10160149
2549	Ga0268265_10385096
2550	Ga0268264_10000049
2551	Ga0268264_10511294
2552	Ga0307517_10002508
2553	Ga0307517_10138270
2554	Ga0307517_10428677
2555	Ga0307515_10069558
2556	Ga0307515_10113017
2557	Ga0265760_10052578
2558	Ga0265330_10081784
2559	Ga0265316_10462372
2560	Ga0307513_10089886
2561	Ga0307509_10120233
2562	Ga0265313_10000510
2563	Ga0265313_10031496
2564	Ga0265313_10120675
2565	Ga0307508_10000046
2566	Ga0307508_10037024
2567	Ga0316579_10043783
2568	Ga0265314_10022525
2569	Ga0265314_10151442
2570	Ga0307516_10003810
2571	Ga0307516_10264467
2572	Ga0307405_10201212
2573	Ga0307413_10048793
2574	Ga0307410_10470799
2575	Ga0307407_10256037
2576	Ga0307409_101166958
2577	Ga0307416_100240771
2578	Ga0307416_100416507
2579	Ga0307416_100668905
2580	Ga0307411_10236299
2581	Ga0307411_10588884
2582	Ga0307415_100058305
2583	Ga0307415_101136264
2584	Ga0307510_10003428
2585	Ga0307510_10195732
2586	Ga0315911_1000017
2587	Ga0373930_0025262
2588	Ga0373948_0002028
2589	Ga0373950_0001366
2590	Ga0373950_0029199
2591	Ga0373958_0000682
2592	Ga0373938_0000745
2593	Ga0373938_0001870
2594	Ga0373926_0010795
2595	Ga0373928_0000048
2596	Ga0373929_0000547
2597	Ga0373940_0000927
2598	Ga0373944_0020862
2599	Ga0373944_0129215
2600	Ga0373949_0000821
2601	Ga0373951_0007246
2602	Ga0373952_0002299
2603	Ga0373923_0010736
2604	Ga0373923_0020082
2605	Ga0373932_0001773
2606	Ga0373932_0019787
2607	Ga0373936_0020155
2608	Ga0373936_0196083
2609	Ga0373939_0001868
2610	Ga0373939_0014456
2611	Ga0373941_0000452
2612	Ga0373941_0000714
2613	Ga0373941_0108990
2614	Ga0373945_0033172
2615	Ga0373953_0010228
2616	Ga0373954_0033716
2617	Ga0373954_0109719
2618	Ga0373956_0002568
2619	Ga0373957_0023794
2620	Ga0373960_0008309
2621	Ga0373960_0117172
2622	Ga0373943_0012096
2623	Ga0373943_0018472
2624	Ga0373943_0023977
2625	Ga0373946_0046780
2626	Ga0373946_0249781
2627	Ga0373955_0004901
2628	Ga0373955_0014739
2629	Ga0373955_0042433
2630	Ga0373942_0000844
2631	Ga0373942_0002802
2632	Ga0373962_0000546
2633	Ga0373962_0003526
2634	Ga0373924_0012982
2635	Ga0373924_0022820
2636	Ga0373931_0009546
2637	Ga0373931_0047178
2638	Ga0373931_0136358
2639	Ga0373931_0214279
2640	Ga0373935_0019978
2641	Ga0373927_0000481
2642	Ga0373927_0052809
2643	Ga0373927_0089476
2644	Ga0373927_0101160
2645	Ga0373927_0125941
2646	Ga0373933_0003495
2647	Ga0373933_0040458
2648	Ga0373947_0000441
2649	Ga0373947_0574720
2650	Ga0373937_0030955
2651	Ga0373937_0129490
2652	Ga0373937_0195842
2653	Ga0373937_0823972
2654	Ga0373925_0005350
2655	Ga0373925_0018054
2656	Ga0373925_0048343
2657	Ga0373925_0313697
2658	Ga0395899_0258995
2659	Ga0395900_0000937
2660	Ga0395900_0288371
2661	Ga0395900_0355669
2662	Ga0395898_0012937
2663	Ga0395905_0003622
2664	Ga0395905_0100877
2665	Ga0395905_0107501
2666	Ga0395905_0506056
2667	Ga0436364_0666253
2668	Ga0436364_1169764
2669	Ga0395901_0027708
2670	Ga0436365_0332538
2671	Ga0436360_0069163
2672	Ga0436360_0794626
2673	Ga0436361_0180263
2674	Ga0436361_0354921
2675	Ga0436361_0540936
2676	Ga0436363_0376673
2677	Ga0436363_1386220
2678	Ga0439465_0006502
2679	Ga0439465_0054106
2680	Ga0451791_0027799
2681	Ga0451797_0177233
2682	Ga0451795_0644648
2683	Ga0451847_0937825
2684	Ga0439464_0035696
2685	Ga0451577_0089386
2686	Ga0466972_0000171
2687	Ga0466972_0009381
2688	Ga0466972_0099558
2689	Ga0453683_0138434
2690	Ga0466965_0063765
2691	Ga0466966_0000287
2692	Ga0466966_0024099
2693	Ga0466961_0000126
2694	Ga0466963_0184624
2695	Ga0453684_0101204
2696	Ga0466971_0117504
2697	Ga0466968_0002951
2698	Ga0466968_0063072
2699	Ga0466957_0554122
2700	Ga0466960_0011542
2701	Ga0466960_0049122
2702	Ga0466959_0003379
2703	Ga0451576_0060155
2704	Ga0466967_0203454
2705	Ga0466967_0603392
2706	Ga0495617_030202
2707	Ga0495592_0038636
2708	Ga0495592_0394284
2709	Ga0495603_0000066
2710	Ga0495603_0027734
2711	Ga0495603_0068782
2712	Ga0495603_0086597
2713	Ga0495603_0130881
2714	Ga0495603_0237113
2715	Ga0495590_0025134
2716	Ga0495629_0006904
2717	Ga0495629_0018144
2718	Ga0495629_0105444
2719	Ga0495638_0005913
2720	Ga0495638_0067451
2721	Ga0495641_0019238
2722	Ga0495641_0107306
2723	Ga0495641_0247308
2724	Ga0495651_0000667
2725	Ga0495651_0049589
2726	Ga0495651_0077600
2727	Ga0495580_0001382
2728	Ga0495580_0263001
2729	Ga0495582_0000298
2730	Ga0495582_0235013
2731	Ga0495605_0032010
2732	Ga0495605_0096196
2733	Ga0495605_0144963
2734	Ga0495605_0192831
2735	Ga0495639_0000282
2736	Ga0495639_0054189
2737	Ga0495662_0000058
2738	Ga0495662_0233699
2739	Ga0495664_0001603
2740	Ga0495664_0350670
2741	Ga0495585_0005925
2742	Ga0495585_0087199
2743	Ga0495585_0126109
2744	Ga0495594_0000706
2745	Ga0495594_0027151
2746	Ga0495594_0074764
2747	Ga0495596_0019026
2748	Ga0495596_0052294
2749	Ga0495607_0019906
2750	Ga0495607_0074008
2751	Ga0495607_0170774
2752	Ga0495583_0077706
2753	Ga0495583_0191809
2754	Ga0495606_0019769
2755	Ga0495606_0051430
2756	Ga0495606_0067970
2757	Ga0495606_0198615
2758	Ga0495608_0078741
2759	Ga0495608_0127015
2760	Ga0495610_0012760
2761	Ga0495610_0089433
2762	Ga0495610_0101939
2763	Ga0495610_0140936
2764	Ga0495616_0090402
2765	Ga0495618_0033089
2766	Ga0495618_0073141
2767	Ga0495618_0481714
2768	Ga0495620_0107042
2769	Ga0495620_0135135
2770	Ga0495628_0037494
2771	Ga0495628_0066468
2772	Ga0495630_0001425
2773	Ga0495630_0017239
2774	Ga0495630_0168514
2775	Ga0495631_0004059
2776	Ga0495631_0271736
2777	Ga0495632_0038495
2778	Ga0495632_0180072
2779	Ga0495632_0271742
2780	Ga0495637_0055908
2781	Ga0495637_0144166
2782	Ga0495637_0182295
2783	Ga0495643_0007902
2784	Ga0495644_0004771
2785	Ga0495644_0164387
2786	Ga0495648_0002045
2787	Ga0495648_0014359
2788	Ga0495648_0046198
2789	Ga0495648_0098016
2790	Ga0495648_0211530
2791	Ga0495648_0363328
2792	Ga0495663_0080918
2793	Ga0495666_0036914
2794	Ga0495666_0238691
2795	Ga0495652_0036110
2796	Ga0495652_0237284
2797	Ga0495654_0092505
2798	Ga0495665_0000373
2799	Ga0495640_0014709
2800	Ga0495640_0028397
2801	Ga0495587_0042572
2802	Ga0495587_0045839
2803	Ga0495587_0067629
2804	Ga0495598_0012091
2805	Ga0495609_0139272
2806	Ga0495597_0027655
2807	Ga0495597_0074178
2808	Ga0495645_0069970
2809	Ga0495622_0012697
2810	Ga0495622_0040321
2811	Ga0495622_0062057
2812	Ga0495622_0247552
2813	Ga0495633_0005887
2814	Ga0495633_0158084
2815	Ga0495667_0007317
2816	Ga0495667_0016052
2817	Ga0495667_0021985
2818	Ga0495667_0023536
2819	Ga0495667_0073041
2820	Ga0495656_0000705
2821	Ga0495656_0011792
2822	Ga0495656_0030526
2823	Ga0495656_0087987
2824	Ga0495668_0024474
2825	Ga0495668_0120327
2826	Ga0495668_0197662
2827	Ga0495668_0239637
2828	Ga0495634_0000502
2829	Ga0495634_0251229
2830	Ga0495611_0005467
2831	Ga0495611_0126082
2832	Ga0495611_0261026
2833	Ga0495625_0220532
2834	Ga0495625_0255677
2835	Ga0495625_0344122
2836	Ga0495625_0462677
2837	Ga0495635_0000178
2838	Ga0495635_0053042
2839	Ga0495635_0161792
2840	Ga0495659_0014518
2841	Ga0495659_0147917
2842	Ga0495661_0076948
2843	Ga0495661_0159078
2844	Ga0495661_0295958
2845	Ga0495588_0002644
2846	Ga0495588_0011343
2847	Ga0495588_0063410
2848	Ga0495657_0028252
2849	Ga0495657_0033935
2850	Ga0495657_0155862
2851	Ga0495599_0008017
2852	Ga0495599_0025275
2853	Ga0495599_0033357
2854	Ga0495623_0002455
2855	Ga0495646_0021079
2856	Ga0495646_0048879
2857	Ga0495646_0184058
2858	Ga0495646_0249149
2859	Ga0495647_0018257
2860	Ga0495647_0072246
2861	Ga0495658_0000368
2862	Ga0495658_0143321
2863	Ga0495669_0011883
2864	Ga0495669_0133912
2865	Ga0495669_0207094
2866	Ga0495669_0215055
2867	Ga0495613_0049303
2868	Ga0495613_0084351
2869	Ga0495624_0003669
2870	Ga0495624_0198199
2871	Ga0495670_0000973
2872	Ga0495670_0071841
2873	Ga0495671_0074747
2874	Ga0495649_0017227
2875	Ga0495589_0195220
2876	Ga0495589_0290311
2877	Ga0495600_0004239
2878	Ga0495600_0034813
2879	Ga0495600_0166734
2880	Ga0495660_0038089
2881	Ga0495581_0000111
2882	Ga0495581_0021235
2883	Ga0495581_0396777
2884	Ga0495604_0014404
2885	Ga0495604_0055322
2886	Ga0495604_0083864
2887	Ga0495636_0045401
2888	Ga0495674_0002855
2889	Ga0495674_0165657
2890	Ga0495674_0327380
2891	Ga0495674_0387919
2892	Ga0495672_0072222
2893	Ga0495676_0025260
2894	Ga0495676_0028521
2895	Ga0495676_0122511
2896	Ga0495676_0223807
2897	Ga0495680_0007580
2898	Ga0495680_0066388
2899	Ga0495680_0160969
2900	Ga0495680_0161815
2901	Ga0495683_0057209
2902	Ga0495687_033969
2903	Ga0495675_0007873
2904	Ga0495675_0037173
2905	Ga0495677_0036428
2906	Ga0495677_0108327
2907	Ga0495679_111116
2908	Ga0495673_0050133
2909	Ga0495684_0109882
2910	Ga0495686_0102707
2911	Ga0495686_0123777
2912	Ga0495686_0138490
2913	Ga0495686_0188966
2914	Ga0495686_0190567
2915	Ga0495593_0000210
2916	Ga0495593_0075182
2917	Ga0495593_0137658
2918	Ga0495602_0020857
2919	Ga0495602_0054730
2920	Ga0495602_0115385
2921	Ga0495602_0739472
2922	Ga0495614_0037279
2923	Ga0495614_0060546
2924	Ga0495614_0266287
2925	Ga0495626_0028992
2926	Ga0495626_0095109
2927	Ga0496100_0076234
2928	Ga0496100_0124181
2929	Ga0496100_0224743
2930	Ga0496100_0356432
2931	Ga0496101_0002918
2932	Ga0496101_0120579
2933	Ga0496101_0133155
2934	Ga0496101_0261270
2935	Ga0496101_0326923
2936	Ga0496101_0396415
2937	Ga0496101_0466136
2938	Ga0496102_0003383
2939	Ga0496102_0017307
2940	Ga0496102_0041224
2941	Ga0496102_0167313
2942	Ga0496102_0176232
2943	Ga0496102_0191001
2944	Ga0496102_0841953
2945	Ga0496103_0005458
2946	Ga0496103_0166305
2947	Ga0496103_0619582
2948	Ga0496104_0023739
2949	Ga0496104_0041340
2950	Ga0496104_0042724
2951	Ga0496104_0071924
2952	Ga0496104_0132590
2953	Ga0496104_0192450
2954	Ga0496104_0369178
2955	Ga0496104_0454445
2956	Ga0496104_0813265
2957	Ga0496105_0053739
2958	Ga0496105_0095918
2959	Ga0496105_0121480
2960	Ga0496105_0167066
2961	Ga0496105_0182408
2962	Ga0496105_0220905
2963	Ga0496106_0014823
2964	Ga0496106_0048165
2965	Ga0496106_0071917
2966	Ga0496106_0190337
2967	Ga0496106_0350346
2968	Ga0496106_0438872
2969	Ga0496106_0518295
2970	Ga0496107_0010578
2971	Ga0496107_0017668
2972	Ga0496107_0022968
2973	Ga0496107_0063122
2974	Ga0496107_0094309
2975	Ga0496107_0222687
2976	Ga0496107_0615051
2977	Ga0496107_0655231
2978	Ga0496108_0000639
2979	Ga0496108_0064133
2980	Ga0496108_0145734
2981	Ga0496108_0712118
2982	Ga0496109_0000619
2983	Ga0496109_0064302
2984	Ga0496109_0094558
2985	Ga0496109_0139533
2986	Ga0496109_0182600
2987	Ga0496109_0409947
2988	Ga0496110_0092579
2989	Ga0496110_0118275
2990	Ga0496110_0218478
2991	Ga0496110_0229742
2992	Ga0496110_0273038
2993	Ga0496111_0038438
2994	Ga0496111_0094006
2995	Ga0496111_0122974
2996	Ga0496111_0329601
2997	Ga0496112_0002285
2998	Ga0496112_0039764
2999	Ga0496112_0098301
3000	Ga0496112_0166061
3001	Ga0496112_0358070
3002	Ga0496112_0358525
3003	Ga0496112_0374648
3004	Ga0496112_0779421
3005	Ga0496112_1137952
3006	Ga0496113_0004176
3007	Ga0496113_0057182
3008	Ga0496113_0109068
3009	Ga0496113_0134495
3010	Ga0496113_0157317
3011	Ga0496113_0943816
3012	Ga0496114_0017189
3013	Ga0496114_0021593
3014	Ga0496114_0024475
3015	Ga0496114_0057328
3016	Ga0496114_0329391
3017	Ga0496114_0383389
3018	Ga0496114_0713486
3019	Ga0496115_0027016
3020	Ga0496115_0094296
3021	Ga0496115_0168868
3022	Ga0496115_0222783
3023	Ga0496115_0381707
3024	Ga0496115_0488960
3025	Ga0496115_0806872
3026	Ga0496116_0005187
3027	Ga0496116_0035270
3028	Ga0496116_0194417
3029	Ga0496117_0021989
3030	Ga0496117_0105060
3031	Ga0496118_0033446
3032	Ga0496118_0086842
3033	Ga0496119_0102731
3034	Ga0496120_0018181
3035	Ga0496121_0009401
3036	Ga0496121_0019336
3037	Ga0496121_0053232
3038	Ga0496121_0054751
3039	Ga0496121_0060186
3040	Ga0496121_0095978
3041	Ga0496121_0195873
3042	Ga0496121_0233781
3043	Ga0496121_0268061
3044	Ga0496121_0379696
3045	Ga0496122_0086985
3046	Ga0496122_0117523
3047	Ga0496122_0260599
3048	Ga0496123_0086053
3049	Ga0496123_0099612
3050	Ga0496123_0334777
3051	Ga0496124_0126298
3052	Ga0496124_0176273
3053	Ga0496124_0318679
3054	Ga0496124_0423542
3055	Ga0496125_0000420
3056	Ga0496125_0001294
3057	Ga0496125_0138357
3058	Ga0496125_0180840
3059	Ga0496125_0182924
3060	Ga0496125_0213707
3061	Ga0496125_0237453
3062	Ga0496126_0005768
3063	Ga0496126_0006421
3064	Ga0496126_0012916
3065	Ga0496126_0069995
3066	Ga0496126_0077290
3067	Ga0496126_0152957
3068	Ga0496126_0212172
3069	Ga0496126_0232146
3070	Ga0496126_0276065
3071	Ga0496126_0345435
3072	Ga0496126_0367747
3073	Ga0495678_032930
3074	Ga0495682_0011648
3075	Ga0495682_0118445
3076	Ga0501031_0004523
3077	Ga0501031_0008194
3078	Ga0501031_0054472
3079	Ga0501031_0055909
3080	Ga0501031_0058562
3081	Ga0501031_0062386
3082	Ga0501031_0109056
3083	Ga0501031_0209022
3084	Ga0501032_0000172
3085	Ga0501032_0004015
3086	Ga0501032_0019595
3087	Ga0501032_0030915
3088	Ga0501032_0044825
3089	Ga0501032_0173202
3090	Ga0501032_0459267
3091	Ga0501033_0000866
3092	Ga0501033_0001887
3093	Ga0501033_0008787
3094	Ga0501033_0052374
3095	Ga0501033_0086379
3096	Ga0501033_0148750
3097	Ga0501033_0156287
3098	Ga0501034_0000270
3099	Ga0501034_0000676
3100	Ga0501034_0003680
3101	Ga0501034_0017445
3102	Ga0501034_0042056
3103	Ga0501034_0046005
3104	Ga0501034_0077424
3105	Ga0501034_0081044
3106	Ga0501034_0195399
3107	Ga0501034_0326110
3108	Ga0501034_0393066
3109	Ga0501034_0604510
3110	Ga0501034_0634505
3111	Ga0501036_0000390
3112	Ga0501036_0031129
3113	Ga0501036_0044378
3114	Ga0501036_0068188
3115	Ga0501036_0071716
3116	Ga0501036_0075280
3117	Ga0501036_0131317
3118	Ga0501036_0258670
3119	Ga0501036_0365729
3120	Ga0501037_0000755
3121	Ga0501037_0000958
3122	Ga0501037_0019397
3123	Ga0501037_0023954
3124	Ga0501037_0043886
3125	Ga0501037_0057399
3126	Ga0501037_0258632
3127	Ga0501037_0281480
3128	Ga0501037_0460680
3129	Ga0501038_0000089
3130	Ga0501038_0024721
3131	Ga0501038_0026409
3132	Ga0501038_0047902
3133	Ga0501038_0068998
3134	Ga0501038_0092792
3135	Ga0501038_0118989
3136	Ga0501038_0181180
3137	Ga0501038_0592458
3138	Ga0501039_0000114
3139	Ga0501039_0005815
3140	Ga0501039_0026996
3141	Ga0501039_0154835
3142	Ga0501039_0177021
3143	Ga0501039_0389518
3144	Ga0501039_0422170
3145	Ga0501040_0033806
3146	Ga0501042_0212028
3147	Ga0501042_0376554
3148	Ga0501043_0001086
3149	Ga0501043_0004253
3150	Ga0501043_0009335
3151	Ga0501043_0009610
3152	Ga0501043_0018279
3153	Ga0501043_0254755
3154	Ga0501043_0301353
3155	Ga0501046_0006291
3156	Ga0501046_0012856
3157	Ga0501046_0030044
3158	Ga0501046_0110364
3159	Ga0501046_0344591
3160	Ga0501047_0000594
3161	Ga0501047_0052121
3162	Ga0501047_0061369
3163	Ga0501047_0133295
3164	Ga0501047_0151819
3165	Ga0501047_0336033
3166	Ga0501047_0475446
3167	Ga0501048_0042728
3168	Ga0501048_0337176
3169	Ga0501048_0355326
3170	Ga0501067_0000445
3171	Ga0501067_0028070
3172	Ga0501067_0031977
3173	Ga0501067_0108936
3174	Ga0501067_0210294
3175	Ga0501068_0004210
3176	Ga0501068_0026560
3177	Ga0501068_0036616
3178	Ga0501068_0039358
3179	Ga0501068_0104489
3180	Ga0501069_0045261
3181	Ga0501069_0139563
3182	Ga0501070_0017073
3183	Ga0501070_0095692
3184	Ga0501070_0098200
3185	Ga0501070_0144409
3186	Ga0501070_0169638
3187	Ga0501070_0238852
3188	Ga0501071_0036958
3189	Ga0501071_0061557
3190	Ga0501071_0326770
3191	Ga0501072_0001459
3192	Ga0501072_0084143
3193	Ga0501072_0328818
3194	Ga0501072_0406023
3195	Ga0501073_0000055
3196	Ga0501073_0044654
3197	Ga0501073_0057653
3198	Ga0501073_0103031
3199	Ga0501073_0112810
3200	Ga0501073_0113981
3201	Ga0501073_0251674
3202	Ga0501074_0000492
3203	Ga0501074_0007017
3204	Ga0501074_0040558
3205	Ga0501074_0072357
3206	Ga0501074_0083946
3207	Ga0501076_0012137
3208	Ga0501076_0128644
3209	Ga0501077_0024392
3210	Ga0501077_0257873
3211	Ga0501077_0294687
3212	Ga0501225_0094635
3213	Ga0501079_0004436
3214	Ga0501079_0076206
3215	Ga0501080_0008079
3216	Ga0501080_0022886
3217	Ga0501080_0025902
3218	Ga0501080_0060993
3219	Ga0501080_0206292
3220	Ga0501081_0013430
3221	Ga0501081_0241742
3222	Ga0501083_0000570
3223	Ga0501083_0020711
3224	Ga0501083_0089624
3225	Ga0501083_0096362
3226	Ga0501083_0112660
3227	Ga0501083_0114872
3228	Ga0501035_0000150
3229	Ga0501035_0003778
3230	Ga0501035_0022636
3231	Ga0501035_0031779
3232	Ga0501035_0045739
3233	Ga0501035_0155236
3234	Ga0501035_0496885
3235	Ga0501035_0528287
3236	Ga0501035_0557433
3237	Ga0501044_0000546
3238	Ga0501044_0006712
3239	Ga0501044_0069407
3240	Ga0501044_0077407
3241	Ga0501044_0080620
3242	Ga0501044_0106409
3243	Ga0501044_0133952
3244	Ga0501044_0179462
3245	Ga0501044_0353527
3246	Ga0501044_1012477
3247	Ga0501045_0003323
3248	Ga0501045_0004352
3249	Ga0501045_0140281
3250	nmdc:mga03683_17434_c1
3251	nmdc:mga03683_274518_c1
3252	nmdc:mga03n38_366961_c1
3253	nmdc:mga03n38_64360_c1
3254	nmdc:mga00v17_11235_c1
3255	nmdc:mga00v17_117908_c1
3256	nmdc:mga00v17_12296_c1
3257	nmdc:mga00v17_227117_c1
3258	nmdc:mga00v17_261514_c1
3259	nmdc:mga00v17_303901_c1
3260	nmdc:mga00v17_456401_c1
3261	nmdc:mga0yw44_120803_c1
3262	nmdc:mga0yw44_29347_c1
3263	nmdc:mga0yw44_52049_c1
3264	nmdc:mga0yw44_65999_c1
3265	nmdc:mga0k408_213400_c1
3266	nmdc:mga0k408_373167_c1
3267	nmdc:mga0k408_40371_c1
3268	nmdc:mga0k408_90047_c1
3269	nmdc:mga06z11_252133_c1
3270	nmdc:mga06z11_260036_c1
3271	nmdc:mga06z11_5217_c1
3272	nmdc:mga06z11_59740_c1
3273	nmdc:mga04h51_958_c1
3274	nmdc:mga07m45_23113_c1
3275	nmdc:mga07m45_342364_c1
3276	nmdc:mga07m45_395112_c1
3277	nmdc:mga07m45_401562_c1
3278	nmdc:mga07m45_8863_c1
3279	nmdc:mga05p37_158567_c1
3280	nmdc:mga05p37_247255_c1
3281	nmdc:mga05p37_282843_c1
3282	nmdc:mga0qj67_1096485_c1
3283	nmdc:mga0qj67_437711_c1
3284	nmdc:mga08y16_102759_c1
3285	nmdc:mga08y16_1197718_c1
3286	nmdc:mga08y16_127265_c1
3287	nmdc:mga08y16_549433_c1
3288	nmdc:mga0n895_109830_c1
3289	nmdc:mga0n895_507676_c1
3290	nmdc:mga0rr50_1144197_c1
3291	nmdc:mga0rr50_174772_c1
3292	nmdc:mga0a205_175143_c1
3293	nmdc:mga0a205_321122_c1
3294	nmdc:mga0sz30_12652_c2
3295	nmdc:mga0sz30_30335_c1
3296	nmdc:mga0sz30_41148_c1
3297	nmdc:mga0sz30_43074_c1
3298	Ga0495601_0009983
3299	Ga0495601_0014707
3300	Ga0495601_0064402
3301	Ga0495601_0066963
3302	Ga0495601_0515666
3303	Ga0495612_0143985
3304	Ga0495612_0146357
3305	Ga0495595_0000699
3306	Ga0495595_0056996
3307	Ga0495619_0003768
3308	Ga0495619_0078651
3309	Ga0495619_0081836
3310	Ga0495619_0292737
3311	Ga0495619_0315809
3312	Ga0495619_0456719
3313	Ga0500578_0069357
3314	Ga0500643_000278
3315	Ga0500643_015999
3316	Ga0500643_060511
3317	Ga0500644_0095093
3318	Ga0500644_0213157
3319	Ga0500646_0002189
3320	Ga0500647_0108652
3321	Ga0500651_0013046
3322	Ga0500651_0216667
3323	Ga0500566_0008990
3324	Ga0500566_0018420
3325	Ga0500566_0035829
3326	Ga0500641_0032473
3327	Ga0500641_0048221
3328	Ga0500641_0151377
3329	Ga0500650_0002801
3330	Ga0500650_0086338
3331	Ga0500554_001643
3332	Ga0500555_002583
3333	Ga0500556_0000005
3334	Ga0500556_0052067
3335	Ga0500557_000028
3336	Ga0500562_009620
3337	Ga0500562_011585
3338	Ga0500569_025365
3339	Ga0500572_066187
3340	Ga0500572_141266
3341	Ga0500592_001026
3342	Ga0500593_037159
3343	Ga0500594_0041106
3344	Ga0500595_001799
3345	Ga0500595_001904
3346	Ga0500595_032232
3347	Ga0500595_078444
3348	Ga0500607_050084
3349	Ga0500608_000378
3350	Ga0500614_033240
3351	Ga0500617_160280
3352	Ga0500618_007774
3353	Ga0500626_186358
3354	Ga0500642_0000009
3355	Ga0500642_0003513
3356	Ga0500642_0203807
3357	Ga0500652_001958
3358	Ga0500655_004688
3359	Ga0500658_0063524
3360	Ga0500658_0175435
3361	Ga0500559_0000705
3362	Ga0500559_0020757
3363	Ga0500559_0029661
3364	Ga0500564_152355
3365	Ga0500568_0000477
3366	Ga0500568_0091275
3367	Ga0500577_0001565
3368	Ga0500577_0177658
3369	Ga0500589_104484
3370	Ga0500590_138998
3371	Ga0500604_0000396
3372	Ga0500616_0000118
3373	Ga0500619_053498
3374	Ga0500620_001010
3375	Ga0500622_0022820
3376	Ga0500622_0073129
3377	Ga0500624_002509
3378	Ga0500627_0001957
3379	Ga0500634_0025228
3380	Ga0500634_0178097
3381	Ga0500638_014397
3382	Ga0500636_0000246
3383	Ga0500636_0002208
3384	Ga0500637_0000075
3385	Ga0500637_0096449
3386	Ga0500637_0098186
3387	Ga0500649_035602
3388	Ga0500645_003297
3389	Ga0500645_040044
3390	Ga0500645_094487
3391	Ga0500609_001977
3392	Ga0500601_000529
3393	Ga0501084_0001687
3394	Ga0501084_0032214
3395	Ga0501084_0074672
3396	Ga0500661_000415
3397	Ga0500661_003836
3398	Ga0501082_0004787
3399	Ga0501082_0039991
3400	Ga0501082_0769537
3401	Ga0466962_0032496
3402	2507505714
3403	2508539607
3404	2508695978
3405	2509150803
3406	2511397028
3407	2513626650
3408	2513641788
3409	2513648131
3410	2513677968
3411	2513694379
3412	2513699186
3413	2513857176
3414	2513875688
3415	2513889748
3416	2514016354
3417	2515624111
3418	2517106990
3419	2524435617
3420	2524468327
3421	2528850269
3422	2603858104
3423	2617352919
3424	2617377133
3425	2644290048
3426	2723849103
3427	2745079873
3428	2793063235
3429	2793082594
3430	2805919364
3431	2818237153
3432	2824608849
3433	2824612773
3434	2824625066
3435	2824632517
3436	2824643110
3437	2824651431
3438	2824661208
3439	2824670687
3440	2824674741
3441	2824685441
3442	2824692617
3443	2824700944
3444	2824712225
3445	2824721485
3446	2824731361
3447	2824734111
3448	2824749172
3449	2824760651
3450	2824773045
3451	2824780138
3452	2838130238
3453	2841944319
3454	2841954504
3455	2841962931
3456	2841969096
3457	2841979870
3458	2841990949
3459	2842044026
3460	2842051985
3461	2844321675
3462	2847939666
3463	2847941615
3464	2849082540
3465	2857511442
3466	2857527491
3467	2874593166
3468	2874606965
3469	2874615582
3470	2874624295
3471	2874634064
3472	2874645501
3473	2876764530
3474	2876773206
3475	2876812509
3476	2876820513
3477	2879076848
3478	2879090531
3479	2879101868
3480	2879115037
3481	2879131035
3482	2879150242
3483	2881364961
3484	2881672282
3485	2885368135
3486	2885384643
3487	2885410934
3488	2888380138
3489	2888391152
3490	2888420900
3491	2889034940
3492	2893066984
3493	2903727750
3494	2903773452
3495	2904672366
3496	2904695701
3497	2904717945
3498	2906602764
3499	2906632430
3500	2906639940
3501	2906645070
3502	2906666546
3503	2908764211
3504	2908783048
3505	2919073341
3506	2922364630
3507	2922378491
3508	2922391896
3509	2922400918
3510	2929622421
3511	2929631362
3512	2932786221
3513	2932794819
3514	2932805389
3515	2932812705
3516	2932823067
3517	2932829459
3518	2933584499
3519	2935614768
3520	2935617891
3521	2935632734
3522	2935641625
3523	2935649161
3524	2935658067
3525	2935669317
3526	2935678087
3527	2935693594
3528	2935702914
3529	2935707140
3530	2935716958
3531	2935730208
3532	2935738397
3533	2935750185
3534	2935759779
3535	2935764570
3536	2935777099
3537	2935777973
3538	2935787177
3539	2935796035
3540	2935804479
3541	2935819120
3542	2935826192
3543	2935831356
3544	2935841965
3545	2935853688
3546	2935856610
3547	2935870225
3548	2935874450
3549	2935887529
3550	2935910910
3551	2935922092
3552	2935929771
3553	2935937439
3554	2935948162
3555	2935957617
3556	2935964271
3557	2935971104
3558	2935982303
3559	2935985445
3560	2935993911
3561	2936005078
3562	2936012286
3563	2936020633
3564	2936029579
3565	2936045729
3566	2936051956
3567	2936056787
3568	2940565767
3569	2941508602
3570	2941516432
3571	2941524552
3572	2941532236
3573	2941547016
3574	3005490535
3575	3005509679
3576	3005588908
3577	3005602052
3578	3005717784
3579	3005724834
3580	8006932430
3581	8006971290
3582	8006988582
3583	8006995213
3584	8016518776
3585	8016526726
3586	8016531813
3587	8016545018
3588	8016557059
3589	8016565409
3590	8016570093
3591	8016582663
3592	8016585664
3593	8016603046
3594	8016605947
3595	8016617833
3596	8016623741
3597	8016635128
3598	8017057903
3599	8019531639
3600	8019539896
3601	8019550761
3602	8019577821
3603	8019605832
3604	8019612701
3605	8019623466
3606	8019638677
3607	8019641062
3608	8019651922
3609	8019676136
3610	8019679847
3611	8019695691
3612	8055750872
3613	8056679296
3614	8056681387
3615	8056694697
3616	8056975555

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02630

SCO1-SenC

SCO1/SenC

74

207

0.99 PF00578

AhpC-TSA

AhpC/TSA family

70

221

0.88 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
4wbr-assembly1.cif.gz_D	structure of bradyrhizobium japonicum scoi with copper bound	0.985	42	198
4wbr-assembly1.cif.gz_D	structure of bradyrhizobium japonicum scoi with copper bound	0.9788	42	198
4txo-assembly4.cif.gz_H	crystal structure of the mixed disulfide complex of thioredoxin-like tlpas(c110s) and copper chaperone scois(c74s)	0.9713	42	198
4txo-assembly4.cif.gz_H	crystal structure of the mixed disulfide complex of thioredoxin-like tlpas(c110s) and copper chaperone scois(c74s)	0.9651	42	198
4txo-assembly1.cif.gz_D	crystal structure of the mixed disulfide complex of thioredoxin-like tlpas(c110s) and copper chaperone scois(c74s)	0.9557	42	198

ID	Description	Score	Start	End	Superfamily
4txoH00	Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin	0.9713	42	198	3.40.30.10
4txoH00	Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin	0.9651	42	198	3.40.30.10
af_Q54TT7_154_312_3.40.30.10	Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin	0.9337	44	196	3.40.30.10
af_P38072_102_285_3.40.30.10	Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin	0.9078	42	195	3.40.30.10
af_K7MTL0_161_316_3.40.30.10	Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin	0.9069	59	197	3.40.30.10

ID	Description	Score	Start	End	GO Terms
AF-A0A519Y4N8-F1-model_v4	deleted	0.9746	49	198
AF-A0A519Y4N8-F1-model_v4	deleted	0.9683	49	198
AF-A5H8G9-F1-model_v4	Major surface protein 5	0.9642	45	136	GO:0046872
AF-A0A6I1K3T2-F1-model_v4	Electron transporter SCO1/SenC	0.964	33	198	GO:0046872
AF-B0UHN5-F1-model_v4	deleted	0.958	42	196

F495758

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF02630

SCO1-SenC

SCO1/SenC

74

207

0.99

PF00578

AhpC-TSA

AhpC/TSA family

70

221

0.88

Structural Annotation

Top 5 Hits

Map