F495759

General Info

Members Datasets Scaffolds Average Seq Length
1808 434 1808 191

Family's Representative Sequence

Representative Sequence 3300049824|Ga0501045_0266290|Ga0501045_0266290_20_703
Length 227
Sequence MGSAPFLFPAARTDPRSGRPPSITNDSMRGAIVPGHVEVTRERAWETLTRYTTSEALLRHALAVEASVRWYARRDGEDEERWGCAALLHDFDYEIHPTLDRHPQDGAPLLREEGYPEDLIETVLSHAEHLGLPRDTPLKRTLFACDELSGFIHACGLVRPTGVDGLTPKSVRKKLKQPSFAAGVHRDEVHAGAELLGLELDEHIANVIAALAPIAPELGLRTAADGG

Samples

Sample ID Description Type Environment
1 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
2 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
3 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
32 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
33 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
34 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
35 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
36 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
37 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
38 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
39 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
40 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
41 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
42 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
43 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
44 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
45 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
46 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
47 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
48 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
49 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
50 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
51 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
52 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
53 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
54 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
55 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
56 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
57 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
58 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
59 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
60 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
61 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
62 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
63 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
64 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
65 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
66 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
67 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
68 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
69 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
70 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
71 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
72 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
73 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
74 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
75 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
76 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
77 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
78 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
79 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
80 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
81 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
82 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
83 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
84 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
85 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
86 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
87 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
88 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
89 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
91 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
92 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
93 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
94 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
95 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
96 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
97 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
98 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
99 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
100 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
101 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
102 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
103 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
104 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
105 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
106 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
107 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
108 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
109 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
110 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
111 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
112 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
113 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
114 3300012480 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.yng.040610 Metagenome Rhizosphere
115 3300012495 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 Metagenome Rhizosphere
116 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
117 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
118 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
119 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
120 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
121 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
122 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
123 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
124 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
125 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
126 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
127 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
128 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
129 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
130 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
131 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
132 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
133 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
134 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
135 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
136 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
204 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
205 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
209 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
210 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
211 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
212 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
213 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
214 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
215 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
216 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
217 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
218 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
219 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
220 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
221 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
222 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
223 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
224 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
225 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
226 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
227 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
228 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
229 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
230 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
231 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
232 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
233 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
234 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
235 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
236 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
237 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
238 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
239 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
240 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
241 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
242 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
243 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
244 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
245 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
246 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
247 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
248 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
249 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
250 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
251 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
252 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
253 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
254 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
255 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
256 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
257 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
258 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
259 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
260 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
261 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
262 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
263 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
264 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
265 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
266 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
267 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
268 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
269 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
270 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
271 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
272 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
273 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
274 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
275 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
276 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
277 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
278 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
279 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
280 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
281 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
282 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
283 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
284 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
285 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
286 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
287 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
288 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
289 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
290 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
291 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
292 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
293 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
294 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
295 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
296 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
297 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
298 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
299 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
300 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
301 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
302 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
303 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
304 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
305 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
306 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
307 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
308 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
309 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
310 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
311 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
312 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
313 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
314 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
315 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
316 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
317 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
318 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
319 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
320 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
321 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
322 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
323 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
324 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
325 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
326 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
327 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
328 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
329 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
330 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
331 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
332 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
333 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
334 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
335 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
336 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
337 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
338 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
339 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
340 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
341 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
342 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
343 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
344 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
345 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
346 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
347 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
348 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
349 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
350 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
351 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
352 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
353 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
354 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
355 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
356 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
357 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
358 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
359 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
360 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
361 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
362 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
363 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
364 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
365 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
366 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
367 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
368 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
369 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
370 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
371 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
372 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
373 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
374 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
375 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
376 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
377 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
378 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
379 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
380 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
381 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
382 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
383 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
384 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
385 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
386 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
387 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
388 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
389 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
390 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
391 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
392 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
393 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
394 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
395 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
396 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
397 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
398 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
399 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
400 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
401 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
402 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
403 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
404 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
405 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
406 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
407 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
408 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
409 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
410 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
411 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
412 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
413 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
414 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
415 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
416 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
417 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
418 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
419 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
420 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
421 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
422 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
423 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
424 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
425 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
426 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
427 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
428 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
429 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
430 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
431 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
432 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
433 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
434 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.78
Metatranscriptomes 0.22
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.22
Nodule 0
Rhizoplane 9.46
Rhizosphere 89.05
Stem 0
Stem Tuber 0
Unclassified 0.28

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24743J22301_10016347 3300001991 Bacteria 1383
2 JGI24738J21930_10003707 3300002075 Bacteria 3820
3 JGI24738J21930_10037124 3300002075 Bacteria 991
4 JGI24744J21845_10004702 3300002077 Unclassified 2821
5 JGI25406J46586_10025659 3300003203 Bacteria 2285
6 JGI25407J50210_10001246 3300003373 Bacteria 5687
7 JGI25407J50210_10016413 3300003373 Bacteria 1918
8 JGI25407J50210_10063487 3300003373 Bacteria 926
9 Ga0070658_10036847 3300005327 Bacteria 3942
10 Ga0070658_10118369 3300005327 Bacteria 2199
11 Ga0070658_10278074 3300005327 Bacteria 1424
12 Ga0070658_10308321 3300005327 Bacteria 1350
13 Ga0070658_10318066 3300005327 Bacteria 1329
14 Ga0070676_10160695 3300005328 Bacteria 1446
15 Ga0070676_10522178 3300005328 Unclassified 846
16 Ga0070683_100012761 3300005329 Bacteria 7308
17 Ga0070683_100075320 3300005329 Bacteria 3153
18 Ga0070683_100120725 3300005329 Bacteria 2476
19 Ga0070683_100159278 3300005329 Unclassified 2141
20 Ga0070683_100204943 3300005329 Unclassified 1873
21 Ga0070683_100531542 3300005329 Bacteria 1124
22 Ga0070683_100676112 3300005329 Bacteria 988
23 Ga0070683_101052195 3300005329 Bacteria 781
24 Ga0070690_100147041 3300005330 Bacteria 1604
25 Ga0070690_100280341 3300005330 Bacteria 1189
26 Ga0070670_100002961 3300005331 Bacteria 14061
27 Ga0070670_100041998 3300005331 Bacteria 3930
28 Ga0070670_100424567 3300005331 Bacteria 1175
29 Ga0068869_100284567 3300005334 Bacteria 1330
30 Ga0068869_100400471 3300005334 Bacteria 1129
31 Ga0068869_100461885 3300005334 Bacteria 1054
32 Ga0070666_10113528 3300005335 Bacteria 1875
33 Ga0070680_100041373 3300005336 Bacteria 3736
34 Ga0070680_100073220 3300005336 Unclassified 2817
35 Ga0070680_100073747 3300005336 Bacteria 2807
36 Ga0070680_100118439 3300005336 Bacteria 2209
37 Ga0070680_100127018 3300005336 Bacteria 2131
38 Ga0070680_100838072 3300005336 Unclassified 793
39 Ga0070682_100001712 3300005337 Bacteria 12197
40 Ga0070682_100108645 3300005337 Bacteria 1845
41 Ga0070682_100549185 3300005337 Bacteria 904
42 Ga0068868_100013592 3300005338 Bacteria 5977
43 Ga0068868_100073439 3300005338 Bacteria 2732
44 Ga0068868_100621077 3300005338 Bacteria 959
45 Ga0070660_100001690 3300005339 Bacteria 15140
46 Ga0070660_100172033 3300005339 Bacteria 1750
47 Ga0070660_100187162 3300005339 Bacteria 1676
48 Ga0070660_100386357 3300005339 Unclassified 1156
49 Ga0070689_100007496 3300005340 Bacteria 7636
50 Ga0070689_100014920 3300005340 Bacteria 5654
51 Ga0070689_101038300 3300005340 Bacteria 731
52 Ga0070691_10000781 3300005341 Bacteria 12645
53 Ga0070687_100069376 3300005343 Bacteria 1887
54 Ga0070687_100093269 3300005343 Bacteria 1670
55 Ga0070661_100261024 3300005344 Unclassified 1339
56 Ga0070661_100281374 3300005344 Bacteria 1290
57 Ga0070661_100306793 3300005344 Bacteria 1237
58 Ga0070661_101369313 3300005344 Bacteria 595
59 Ga0070692_10110453 3300005345 Unclassified 1520
60 Ga0070692_10296676 3300005345 Bacteria 985
61 Ga0070668_100123839 3300005347 Bacteria 2069
62 Ga0070668_100163660 3300005347 Bacteria 1807
63 Ga0070668_100165355 3300005347 Bacteria 1797
64 Ga0070669_100227242 3300005353 Bacteria 1477
65 Ga0070675_100013253 3300005354 Bacteria 6478
66 Ga0070675_100047731 3300005354 Bacteria 3509
67 Ga0070675_100350783 3300005354 Bacteria 1308
68 Ga0070671_100165482 3300005355 Bacteria 1870
69 Ga0070671_100353449 3300005355 Bacteria 1254
70 Ga0070674_100002662 3300005356 Bacteria 9894
71 Ga0070674_100005767 3300005356 Bacteria 7185
72 Ga0070674_100008638 3300005356 Bacteria 6072
73 Ga0070674_100019808 3300005356 Bacteria 4282
74 Ga0070674_100157022 3300005356 Unclassified 1722
75 Ga0070673_100001958 3300005364 Bacteria 12419
76 Ga0070673_100018928 3300005364 Bacteria 4935
77 Ga0070673_100042159 3300005364 Bacteria 3517
78 Ga0070673_100908902 3300005364 Bacteria 817
79 Ga0070673_100972307 3300005364 Bacteria 789
80 Ga0070688_100006185 3300005365 Bacteria 6372
81 Ga0070659_100006531 3300005366 Bacteria 8420
82 Ga0070659_100008477 3300005366 Bacteria 7511
83 Ga0070659_100018433 3300005366 Bacteria 5268
84 Ga0070659_100073515 3300005366 Bacteria 2721
85 Ga0070659_100085982 3300005366 Bacteria 2516
86 Ga0070659_100088259 3300005366 Bacteria 2483
87 Ga0070659_100147056 3300005366 Unclassified 1920
88 Ga0070659_100239674 3300005366 Unclassified 1500
89 Ga0070659_100935867 3300005366 Bacteria 759
90 Ga0070667_100003011 3300005367 Bacteria 14476
91 Ga0070703_10026156 3300005406 Unclassified 1734
92 Ga0070714_100021504 3300005435 Bacteria 5279
93 Ga0070714_100064384 3300005435 Bacteria 3155
94 Ga0070714_100202224 3300005435 Bacteria 1818
95 Ga0070714_100368773 3300005435 Bacteria 1351
96 Ga0070714_101186382 3300005435 Bacteria 745
97 Ga0070713_101563380 3300005436 Bacteria 640
98 Ga0070710_10016437 3300005437 Bacteria 3766
99 Ga0070701_10001717 3300005438 Bacteria 8233
100 Ga0070701_10005023 3300005438 Bacteria 5424
101 Ga0070701_10008511 3300005438 Bacteria 4442
102 Ga0070701_10081364 3300005438 Bacteria 1754
103 Ga0070711_100057522 3300005439 Bacteria 2693
104 Ga0070711_100085617 3300005439 Bacteria 2258
105 Ga0070711_100182298 3300005439 Bacteria 1608
106 Ga0070700_100018616 3300005441 Bacteria 3995
107 Ga0070700_100090432 3300005441 Bacteria 1996
108 Ga0070700_100480089 3300005441 Bacteria 952
109 Ga0070700_100789415 3300005441 Bacteria 764
110 Ga0070700_100791574 3300005441 Unclassified 763
111 Ga0070694_100048280 3300005444 Bacteria 2864
112 Ga0070708_100028302 3300005445 Bacteria 4822
113 Ga0070663_100056361 3300005455 Bacteria 2815
114 Ga0070663_100291009 3300005455 Bacteria 1304
115 Ga0070678_100008915 3300005456 Bacteria 6040
116 Ga0070678_100059160 3300005456 Bacteria 2815
117 Ga0070678_100068605 3300005456 Bacteria 2644
118 Ga0070678_100240757 3300005456 Bacteria 1513
119 Ga0070678_100274520 3300005456 Bacteria 1423
120 Ga0070678_100333546 3300005456 Bacteria 1299
121 Ga0070678_100630451 3300005456 Bacteria 960
122 Ga0070662_100077590 3300005457 Bacteria 2465
123 Ga0070662_100179861 3300005457 Unclassified 1667
124 Ga0070662_100449040 3300005457 Bacteria 1070
125 Ga0070681_10001213 3300005458 Bacteria 22417
126 Ga0070681_10073162 3300005458 Bacteria 3389
127 Ga0070681_10110050 3300005458 Bacteria 2695
128 Ga0068867_100001791 3300005459 Bacteria 14941
129 Ga0068867_100158103 3300005459 Bacteria 1785
130 Ga0068867_100421869 3300005459 Unclassified 1130
131 Ga0070685_10001703 3300005466 Bacteria 11556
132 Ga0070685_10009536 3300005466 Bacteria 5020
133 Ga0070685_10287638 3300005466 Bacteria 1103
134 Ga0070706_100107531 3300005467 Bacteria 2595
135 Ga0070707_100003768 3300005468 Bacteria 14293
136 Ga0070707_100287779 3300005468 Bacteria 1597
137 Ga0070707_100294819 3300005468 Bacteria 1576
138 Ga0070707_100655076 3300005468 Bacteria 1013
139 Ga0070698_100037325 3300005471 Bacteria 5010
140 Ga0070698_100073650 3300005471 Bacteria 3421
141 Ga0070698_100131064 3300005471 Bacteria 2463
142 Ga0070698_100437505 3300005471 Bacteria 1243
143 Ga0070699_100069022 3300005518 Bacteria 3071
144 Ga0070699_100107013 3300005518 Bacteria 2453
145 Ga0070699_100425954 3300005518 Bacteria 1202
146 Ga0070679_100001403 3300005530 Bacteria 21260
147 Ga0070679_100021038 3300005530 Bacteria 6366
148 Ga0070679_100028543 3300005530 Bacteria 5502
149 Ga0070679_100037238 3300005530 Bacteria 4831
150 Ga0070679_100168855 3300005530 Bacteria 2160
151 Ga0070679_101213028 3300005530 Unclassified 700
152 Ga0070684_100007800 3300005535 Bacteria 8349
153 Ga0070684_100023347 3300005535 Bacteria 5171
154 Ga0070684_100025817 3300005535 Bacteria 4942
155 Ga0070684_100169179 3300005535 Bacteria 1985
156 Ga0070684_100229000 3300005535 Bacteria 1697
157 Ga0070684_101256167 3300005535 Bacteria 697
158 Ga0068853_100035480 3300005539 Bacteria 4236
159 Ga0068853_100418787 3300005539 Bacteria 1256
160 Ga0070672_100019493 3300005543 Bacteria 4924
161 Ga0070672_100099257 3300005543 Bacteria 2360
162 Ga0070672_100178976 3300005543 Bacteria 1766
163 Ga0070672_100219230 3300005543 Bacteria 1595
164 Ga0070686_100022046 3300005544 Bacteria 3791
165 Ga0070686_100145091 3300005544 Bacteria 1656
166 Ga0070696_100015057 3300005546 Bacteria 5192
167 Ga0070696_100271437 3300005546 Unclassified 1290
168 Ga0070696_100273307 3300005546 Bacteria 1285
169 Ga0070696_100612957 3300005546 Bacteria 879
170 Ga0070693_100004902 3300005547 Bacteria 6386
171 Ga0070693_100027797 3300005547 Bacteria 3069
172 Ga0070693_100066727 3300005547 Bacteria 2106
173 Ga0070693_100079315 3300005547 Bacteria 1953
174 Ga0070693_100239756 3300005547 Bacteria 1197
175 Ga0070693_100241737 3300005547 Bacteria 1193
176 Ga0070665_100012505 3300005548 Bacteria 8552
177 Ga0070665_100018342 3300005548 Bacteria 7014
178 Ga0070665_100048975 3300005548 Bacteria 4241
179 Ga0070704_100017045 3300005549 Unclassified 4608
180 Ga0070704_100052532 3300005549 Unclassified 2875
181 Ga0070704_100315098 3300005549 Bacteria 1308
182 Ga0070704_100616549 3300005549 Bacteria 955
183 Ga0068855_100015442 3300005563 Bacteria 9192
184 Ga0068855_100071334 3300005563 Bacteria 4039
185 Ga0068855_100229095 3300005563 Bacteria 2082
186 Ga0068855_100233339 3300005563 Bacteria 2059
187 Ga0068855_100285623 3300005563 Bacteria 1831
188 Ga0068855_100628542 3300005563 Bacteria 1155
189 Ga0070664_100005843 3300005564 Bacteria 9926
190 Ga0068857_100020406 3300005577 Bacteria 5827
191 Ga0068857_100180528 3300005577 Unclassified 1921
192 Ga0068857_100242098 3300005577 Bacteria 1652
193 Ga0068857_101131231 3300005577 Unclassified 757
194 Ga0068854_100022013 3300005578 Bacteria 4334
195 Ga0068854_100390097 3300005578 Bacteria 1149
196 Ga0068854_100916797 3300005578 Bacteria 771
197 Ga0068856_100016313 3300005614 Bacteria 7189
198 Ga0068856_100124921 3300005614 Bacteria 2576
199 Ga0068856_100129229 3300005614 Bacteria 2530
200 Ga0068856_100363965 3300005614 Unclassified 1465
201 Ga0068856_100388328 3300005614 Bacteria 1415
202 Ga0068856_100846384 3300005614 Bacteria 934
203 Ga0068856_100957705 3300005614 Bacteria 874
204 Ga0070702_100009253 3300005615 Unclassified 4814
205 Ga0070702_100077139 3300005615 Bacteria 1985
206 Ga0070702_100091164 3300005615 Bacteria 1849
207 Ga0070702_100391278 3300005615 Bacteria 991
208 Ga0068852_100002371 3300005616 Bacteria 12983
209 Ga0068852_100242155 3300005616 Unclassified 1724
210 Ga0068852_100811760 3300005616 Unclassified 950
211 Ga0068859_100170337 3300005617 Unclassified 2258
212 Ga0068859_100181417 3300005617 Bacteria 2188
213 Ga0068859_100628170 3300005617 Bacteria 1166
214 Ga0068864_100056903 3300005618 Unclassified 3378
215 Ga0068864_100060948 3300005618 Bacteria 3267
216 Ga0068864_100173434 3300005618 Bacteria 1968
217 Ga0068866_10001672 3300005718 Bacteria 9348
218 Ga0068866_10014836 3300005718 Bacteria 3449
219 Ga0068866_10304239 3300005718 Bacteria 997
220 Ga0068861_100246496 3300005719 Bacteria 1522
221 Ga0068861_100445172 3300005719 Bacteria 1160
222 Ga0068861_101466080 3300005719 Bacteria 668
223 Ga0068851_10020613 3300005834 Bacteria 3193
224 Ga0068851_10596996 3300005834 Bacteria 672
225 Ga0068870_10000685 3300005840 Bacteria 12965
226 Ga0068870_10019676 3300005840 Bacteria 3277
227 Ga0068870_10054016 3300005840 Unclassified 2135
228 Ga0068870_10191577 3300005840 Bacteria 1234
229 Ga0068863_100073888 3300005841 Bacteria 3225
230 Ga0068863_100847150 3300005841 Unclassified 913
231 Ga0068858_100190991 3300005842 Bacteria 1935
232 Ga0068858_100345761 3300005842 Bacteria 1424
233 Ga0068860_100018472 3300005843 Bacteria 6781
234 Ga0068860_100073222 3300005843 Bacteria 3257
235 Ga0068862_100200168 3300005844 Unclassified 1800
236 Ga0068862_100618459 3300005844 Bacteria 1042
237 Ga0081455_10003417 3300005937 Bacteria 18253
238 Ga0081455_10012226 3300005937 Bacteria 8570
239 Ga0081455_10018021 3300005937 Bacteria 6743
240 Ga0081455_10026678 3300005937 Bacteria 5306
241 Ga0081455_10037679 3300005937 Bacteria 4290
242 Ga0081455_10045388 3300005937 Bacteria 3823
243 Ga0081455_10056972 3300005937 Bacteria 3315
244 Ga0081455_10116605 3300005937 Bacteria 2112
245 Ga0081538_10000136 3300005981 Bacteria 76141
246 Ga0081538_10000286 3300005981 Bacteria 57937
247 Ga0081538_10000303 3300005981 Bacteria 56689
248 Ga0081538_10001394 3300005981 Bacteria 24783
249 Ga0081538_10002571 3300005981 Bacteria 17618
250 Ga0081538_10005639 3300005981 Bacteria 11226
251 Ga0081538_10010466 3300005981 Bacteria 7607
252 Ga0081538_10048536 3300005981 Bacteria 2587
253 Ga0081538_10130305 3300005981 Bacteria 1184
254 Ga0081539_10001263 3300005985 Bacteria 44753
255 Ga0081539_10001773 3300005985 Bacteria 34339
256 Ga0081539_10003477 3300005985 Bacteria 19242
257 Ga0070717_10002029 3300006028 Bacteria 14175
258 Ga0070717_10007911 3300006028 Bacteria 7917
259 Ga0075365_10024308 3300006038 Bacteria 3820
260 Ga0075365_10054270 3300006038 Bacteria 2657
261 Ga0075363_100027800 3300006048 Bacteria 2904
262 Ga0075364_10037199 3300006051 Bacteria 3150
263 Ga0075364_10101944 3300006051 Unclassified 1911
264 Ga0075364_10556400 3300006051 Bacteria 784
265 Ga0075432_10000733 3300006058 Bacteria 10147
266 Ga0075432_10016947 3300006058 Bacteria 2487
267 Ga0070715_10233959 3300006163 Unclassified 952
268 Ga0070716_100348765 3300006173 Bacteria 1047
269 Ga0070712_100055179 3300006175 Bacteria 2781
270 Ga0070712_100073707 3300006175 Bacteria 2450
271 Ga0070712_100096628 3300006175 Bacteria 2175
272 Ga0070712_100213720 3300006175 Bacteria 1522
273 Ga0070712_100637167 3300006175 Bacteria 905
274 Ga0070712_100826663 3300006175 Unclassified 796
275 Ga0075367_10158500 3300006178 Bacteria 1407
276 Ga0075366_10189756 3300006195 Bacteria 1249
277 Ga0097621_100036335 3300006237 Bacteria 3942
278 Ga0097621_100073901 3300006237 Bacteria 2823
279 Ga0097621_100167183 3300006237 Bacteria 1894
280 Ga0068871_100119864 3300006358 Bacteria 2221
281 Ga0068871_100353738 3300006358 Bacteria 1300
282 Ga0068871_100437394 3300006358 Bacteria 1170
283 Ga0068871_100599820 3300006358 Bacteria 1001
284 Ga0075428_100000369 3300006844 Bacteria 44666
285 Ga0075428_100009861 3300006844 Bacteria 10614
286 Ga0075428_100034263 3300006844 Bacteria 5602
287 Ga0075428_100275608 3300006844 Bacteria 1810
288 Ga0075430_100159353 3300006846 Bacteria 1879
289 Ga0075431_100019487 3300006847 Bacteria 6916
290 Ga0075431_100019830 3300006847 Bacteria 6865
291 Ga0075431_100175495 3300006847 Bacteria 2201
292 Ga0075431_100269105 3300006847 Bacteria 1727
293 Ga0075433_10047244 3300006852 Bacteria 3744
294 Ga0075433_10085433 3300006852 Unclassified 2786
295 Ga0075433_10376458 3300006852 Bacteria 1254
296 Ga0075433_10453765 3300006852 Bacteria 1130
297 Ga0075434_100070341 3300006871 Unclassified 3490
298 Ga0075434_100091009 3300006871 Bacteria 3052
299 Ga0075434_100181463 3300006871 Bacteria 2125
300 Ga0075434_100896576 3300006871 Bacteria 902
301 Ga0075429_100098233 3300006880 Bacteria 2555
302 Ga0075429_100806673 3300006880 Bacteria 822
303 Ga0068865_100001919 3300006881 Bacteria 12226
304 Ga0068865_100018740 3300006881 Bacteria 4471
305 Ga0068865_100027165 3300006881 Bacteria 3777
306 Ga0068865_100215762 3300006881 Bacteria 1498
307 Ga0068865_100766466 3300006881 Bacteria 830
308 Ga0068865_101055927 3300006881 Bacteria 714
309 Ga0097620_100170344 3300006931 Unclassified 2258
310 Ga0097620_100181427 3300006931 Bacteria 2188
311 Ga0097620_100628163 3300006931 Bacteria 1166
312 Ga0075435_100477263 3300007076 Unclassified 1077
313 Ga0105240_10479184 3300009093 Bacteria 1387
314 Ga0105240_10583101 3300009093 Bacteria 1233
315 Ga0105240_10827561 3300009093 Bacteria 1001
316 Ga0111539_10006960 3300009094 Bacteria 14514
317 Ga0111539_10055878 3300009094 Bacteria 4693
318 Ga0111539_10168122 3300009094 Bacteria 2563
319 Ga0111539_10199030 3300009094 Bacteria 2336
320 Ga0111539_10439319 3300009094 Bacteria 1519
321 Ga0111539_10909786 3300009094 Bacteria 1023
322 Ga0111539_11006395 3300009094 Bacteria 969
323 Ga0105245_10002363 3300009098 Bacteria 17055
324 Ga0105245_10025153 3300009098 Bacteria 5235
325 Ga0105245_10156503 3300009098 Bacteria 2158
326 Ga0105245_10166146 3300009098 Bacteria 2098
327 Ga0105245_10248883 3300009098 Bacteria 1726
328 Ga0105245_10348765 3300009098 Bacteria 1466
329 Ga0105245_10366369 3300009098 Bacteria 1431
330 Ga0105245_10621054 3300009098 Bacteria 1109
331 Ga0105245_10758224 3300009098 Bacteria 1007
332 Ga0105247_10092852 3300009101 Bacteria 1918
333 Ga0114129_10007795 3300009147 Bacteria 15234
334 Ga0114129_10013910 3300009147 Bacteria 11464
335 Ga0114129_10029482 3300009147 Bacteria 7773
336 Ga0114129_10029648 3300009147 Bacteria 7749
337 Ga0114129_10069567 3300009147 Bacteria 4906
338 Ga0114129_10094167 3300009147 Bacteria 4149
339 Ga0114129_10135140 3300009147 Bacteria 3384
340 Ga0114129_10192615 3300009147 Bacteria 2767
341 Ga0114129_10718974 3300009147 Bacteria 1282
342 Ga0105243_10002852 3300009148 Bacteria 14323
343 Ga0105243_10004018 3300009148 Bacteria 11716
344 Ga0105243_10018298 3300009148 Bacteria 5305
345 Ga0105243_10045839 3300009148 Bacteria 3437
346 Ga0105243_10171898 3300009148 Bacteria 1878
347 Ga0105243_10207030 3300009148 Bacteria 1724
348 Ga0105243_11134418 3300009148 Bacteria 792
349 Ga0105243_11139448 3300009148 Bacteria 790
350 Ga0105241_10154909 3300009174 Bacteria 1878
351 Ga0105241_10367742 3300009174 Bacteria 1253
352 Ga0105242_10003918 3300009176 Bacteria 11569
353 Ga0105242_10034315 3300009176 Bacteria 4067
354 Ga0105242_10324597 3300009176 Bacteria 1413
355 Ga0105242_10332892 3300009176 Unclassified 1397
356 Ga0105242_10352962 3300009176 Unclassified 1359
357 Ga0105242_10388772 3300009176 Bacteria 1299
358 Ga0105242_10518025 3300009176 Bacteria 1137
359 Ga0105248_10013646 3300009177 Bacteria 8943
360 Ga0105248_10023640 3300009177 Bacteria 6828
361 Ga0105248_10056409 3300009177 Bacteria 4407
362 Ga0105248_10070230 3300009177 Bacteria 3933
363 Ga0105248_10139691 3300009177 Unclassified 2733
364 Ga0105248_10151006 3300009177 Bacteria 2621
365 Ga0105248_10214872 3300009177 Bacteria 2166
366 Ga0105237_10189263 3300009545 Unclassified 2058
367 Ga0105237_10228283 3300009545 Bacteria 1862
368 Ga0105237_10241255 3300009545 Bacteria 1808
369 Ga0105237_11304743 3300009545 Bacteria 732
370 Ga0105238_10226868 3300009551 Unclassified 1845
371 Ga0105238_10690342 3300009551 Bacteria 1033
372 Ga0105238_11775024 3300009551 Bacteria 649
373 Ga0105249_10036159 3300009553 Unclassified 4480
374 Ga0105249_10242218 3300009553 Bacteria 1783
375 Ga0105249_10543357 3300009553 Bacteria 1212
376 Ga0105249_10738350 3300009553 Bacteria 1046
377 Ga0105249_10861173 3300009553 Bacteria 972
378 Ga0105249_10878109 3300009553 Bacteria 963
379 Ga0105249_10948732 3300009553 Bacteria 928
380 Ga0105249_11575946 3300009553 Bacteria 729
381 Ga0105239_10003594 3300010375 Bacteria 18939
382 Ga0105239_10057682 3300010375 Bacteria 4259
383 Ga0105239_10132134 3300010375 Bacteria 2777
384 Ga0105239_10231951 3300010375 Bacteria 2071
385 Ga0105239_10284608 3300010375 Bacteria 1861
386 Ga0105239_10657540 3300010375 Bacteria 1197
387 Ga0105239_11872141 3300010375 Unclassified 696
388 Ga0105246_10059133 3300011119 Bacteria 2658
389 Ga0105246_10086227 3300011119 Bacteria 2250
390 Ga0105246_10175537 3300011119 Bacteria 1645
391 Ga0105246_10711687 3300011119 Bacteria 881
392 Ga0157346_1007217 3300012480 Bacteria 737
393 Ga0157323_1011177 3300012495 Bacteria 719
394 Ga0157338_1008147 3300012515 Bacteria 1009
395 Ga0157373_10039976 3300013100 Bacteria 3356
396 Ga0157373_10338621 3300013100 Bacteria 1072
397 Ga0157371_10003237 3300013102 Bacteria 14944
398 Ga0157370_10016374 3300013104 Bacteria 7505
399 Ga0157370_10077949 3300013104 Unclassified 3121
400 Ga0157370_10134105 3300013104 Bacteria 2309
401 Ga0157369_10002394 3300013105 Bacteria 22528
402 Ga0157369_10003170 3300013105 Bacteria 19626
403 Ga0157369_10082328 3300013105 Bacteria 3443
404 Ga0157369_10162654 3300013105 Bacteria 2355
405 Ga0157369_10267171 3300013105 Bacteria 1783
406 Ga0157374_10002922 3300013296 Bacteria 14319
407 Ga0157374_10064373 3300013296 Bacteria 3440
408 Ga0157374_10435291 3300013296 Bacteria 1311
409 Ga0157378_10009605 3300013297 Bacteria 8423
410 Ga0157378_10125043 3300013297 Bacteria 2375
411 Ga0157378_10204936 3300013297 Bacteria 1867
412 Ga0157378_11167955 3300013297 Bacteria 808
413 Ga0163162_10012972 3300013306 Bacteria 8132
414 Ga0163162_10244349 3300013306 Bacteria 1926
415 Ga0163162_10842564 3300013306 Viruses 1032
416 Ga0157372_10044755 3300013307 Bacteria 4906
417 Ga0157372_10138023 3300013307 Bacteria 2809
418 Ga0157372_10171621 3300013307 Bacteria 2509
419 Ga0157372_10482658 3300013307 Bacteria 1445
420 Ga0157372_11302351 3300013307 Unclassified 838
421 Ga0157375_10010091 3300013308 Bacteria 8303
422 Ga0157375_10031393 3300013308 Bacteria 5022
423 Ga0157375_10087135 3300013308 Bacteria 3174
424 Ga0157375_10118768 3300013308 Bacteria 2751
425 Ga0157375_10129216 3300013308 Bacteria 2644
426 Ga0157375_10207352 3300013308 Unclassified 2117
427 Ga0157375_10327179 3300013308 Bacteria 1697
428 Ga0157375_10547655 3300013308 Bacteria 1319
429 Ga0157375_10712279 3300013308 Unclassified 1157
430 Ga0157375_10963622 3300013308 Bacteria 994
431 Ga0163163_10404237 3300014325 Bacteria 1424
432 Ga0157380_10018392 3300014326 Bacteria 5186
433 Ga0157380_10153424 3300014326 Bacteria 1994
434 Ga0157380_10619835 3300014326 Bacteria 1074
435 Ga0157380_10889341 3300014326 Bacteria 916
436 Ga0182008_10034854 3300014497 Bacteria 2523
437 Ga0182008_10217373 3300014497 Bacteria 977
438 Ga0157377_10004196 3300014745 Bacteria 6590
439 Ga0157377_10008804 3300014745 Bacteria 4935
440 Ga0157377_10021163 3300014745 Bacteria 3418
441 Ga0157377_10112008 3300014745 Bacteria 1641
442 Ga0157377_10406624 3300014745 Bacteria 928
443 Ga0157377_10459183 3300014745 Unclassified 881
444 Ga0157379_10153860 3300014968 Bacteria 2074
445 Ga0157379_10174860 3300014968 Bacteria 1938
446 Ga0157376_10023873 3300014969 Bacteria 4794
447 Ga0157376_10028067 3300014969 Bacteria 4470
448 Ga0157376_10148756 3300014969 Bacteria 2110
449 Ga0157376_10263362 3300014969 Bacteria 1616
450 Ga0157376_10264257 3300014969 Bacteria 1614
451 Ga0157376_10818627 3300014969 Bacteria 945
452 Ga0157376_11503521 3300014969 Bacteria 706
453 Ga0163161_10086635 3300017792 Bacteria 2312
454 Ga0163161_10267202 3300017792 Bacteria 1337
455 Ga0163161_10476654 3300017792 Unclassified 1013
456 Ga0163161_10494437 3300017792 Bacteria 995
457 Ga0197907_10313724 3300020069 Bacteria 1486
458 Ga0197907_11172580 3300020069 Bacteria 970
459 Ga0206356_10973984 3300020070 Bacteria 1095
460 Ga0224712_10350727 3300022467 Bacteria 697
461 Ga0207697_10282368 3300025315 Bacteria 736
462 Ga0207656_10069889 3300025321 Bacteria 1558
463 Ga0207653_10133751 3300025885 Bacteria 902
464 Ga0207692_10013929 3300025898 Unclassified 3502
465 Ga0207692_10067944 3300025898 Bacteria 1867
466 Ga0207692_10407512 3300025898 Bacteria 849
467 Ga0207642_10047715 3300025899 Bacteria 1916
468 Ga0207710_10115894 3300025900 Bacteria 1276
469 Ga0207688_10011008 3300025901 Bacteria 4921
470 Ga0207688_10054867 3300025901 Bacteria 2236
471 Ga0207688_10089444 3300025901 Bacteria 1767
472 Ga0207688_10131783 3300025901 Bacteria 1466
473 Ga0207688_10136331 3300025901 Bacteria 1442
474 Ga0207688_10284066 3300025901 Bacteria 1009
475 Ga0207680_10260457 3300025903 Bacteria 1200
476 Ga0207647_10038276 3300025904 Bacteria 3033
477 Ga0207685_10056970 3300025905 Bacteria 1531
478 Ga0207685_10073638 3300025905 Bacteria 1392
479 Ga0207699_10145707 3300025906 Bacteria 1561
480 Ga0207699_10307691 3300025906 Bacteria 1108
481 Ga0207699_10547100 3300025906 Unclassified 839
482 Ga0207645_10656003 3300025907 Bacteria 713
483 Ga0207643_10008599 3300025908 Bacteria 5474
484 Ga0207643_10356533 3300025908 Bacteria 919
485 Ga0207705_10267098 3300025909 Unclassified 1307
486 Ga0207684_10096781 3300025910 Bacteria 2519
487 Ga0207654_10053813 3300025911 Bacteria 2325
488 Ga0207654_10070117 3300025911 Unclassified 2080
489 Ga0207707_10002380 3300025912 Bacteria 16951
490 Ga0207707_10014095 3300025912 Bacteria 6968
491 Ga0207707_10083855 3300025912 Bacteria 2783
492 Ga0207707_10086840 3300025912 Bacteria 2733
493 Ga0207707_10261357 3300025912 Bacteria 1502
494 Ga0207707_10292858 3300025912 Bacteria 1408
495 Ga0207695_10631882 3300025913 Bacteria 952
496 Ga0207695_11219194 3300025913 Bacteria 633
497 Ga0207671_10048749 3300025914 Bacteria 3135
498 Ga0207693_10005349 3300025915 Bacteria 10728
499 Ga0207693_10389573 3300025915 Bacteria 1090
500 Ga0207663_10059476 3300025916 Bacteria 2418
501 Ga0207660_10136592 3300025917 Bacteria 1871
502 Ga0207660_10654518 3300025917 Unclassified 857
503 Ga0207662_10072931 3300025918 Bacteria 2082
504 Ga0207662_10483614 3300025918 Bacteria 850
505 Ga0207657_10000941 3300025919 Bacteria 30830
506 Ga0207657_10005874 3300025919 Bacteria 12787
507 Ga0207657_10066876 3300025919 Bacteria 3058
508 Ga0207657_10069084 3300025919 Bacteria 2999
509 Ga0207657_10269964 3300025919 Unclassified 1352
510 Ga0207649_10037560 3300025920 Bacteria 2926
511 Ga0207649_10100604 3300025920 Bacteria 1912
512 Ga0207649_10135233 3300025920 Unclassified 1680
513 Ga0207649_10644917 3300025920 Bacteria 818
514 Ga0207652_10010690 3300025921 Bacteria 7390
515 Ga0207652_10015606 3300025921 Bacteria 6182
516 Ga0207652_10019122 3300025921 Bacteria 5628
517 Ga0207652_10066236 3300025921 Bacteria 3130
518 Ga0207652_10213940 3300025921 Bacteria 1736
519 Ga0207652_10331764 3300025921 Bacteria 1373
520 Ga0207646_10002487 3300025922 Bacteria 21765
521 Ga0207646_10098852 3300025922 Bacteria 2615
522 Ga0207646_10484004 3300025922 Bacteria 1116
523 Ga0207681_10045300 3300025923 Unclassified 2953
524 Ga0207681_10194571 3300025923 Bacteria 1554
525 Ga0207681_10252032 3300025923 Bacteria 1379
526 Ga0207694_10521641 3300025924 Bacteria 996
527 Ga0207650_10259495 3300025925 Unclassified 1409
528 Ga0207659_10045490 3300025926 Bacteria 3095
529 Ga0207659_10069162 3300025926 Bacteria 2570
530 Ga0207659_10070085 3300025926 Bacteria 2556
531 Ga0207687_10017504 3300025927 Bacteria 4720
532 Ga0207687_10108990 3300025927 Bacteria 2051
533 Ga0207687_10130770 3300025927 Bacteria 1892
534 Ga0207687_10163871 3300025927 Bacteria 1709
535 Ga0207687_10307823 3300025927 Bacteria 1278
536 Ga0207687_10309420 3300025927 Bacteria 1275
537 Ga0207700_10000006 3300025928 Bacteria 348187
538 Ga0207664_10026133 3300025929 Bacteria 4408
539 Ga0207664_10167459 3300025929 Bacteria 1878
540 Ga0207644_10207153 3300025931 Bacteria 1549
541 Ga0207644_10216073 3300025931 Bacteria 1518
542 Ga0207644_10392370 3300025931 Bacteria 1133
543 Ga0207690_10099319 3300025932 Bacteria 2075
544 Ga0207690_10124237 3300025932 Bacteria 1879
545 Ga0207690_10125592 3300025932 Bacteria 1870
546 Ga0207690_10182696 3300025932 Bacteria 1580
547 Ga0207690_10209454 3300025932 Bacteria 1485
548 Ga0207706_10006537 3300025933 Bacteria 10802
549 Ga0207706_10225138 3300025933 Bacteria 1642
550 Ga0207706_10287459 3300025933 Bacteria 1433
551 Ga0207706_10348230 3300025933 Bacteria 1288
552 Ga0207706_10476945 3300025933 Bacteria 1078
553 Ga0207706_10750737 3300025933 Bacteria 831
554 Ga0207686_10108936 3300025934 Unclassified 1864
555 Ga0207686_10155245 3300025934 Bacteria 1598
556 Ga0207686_10231673 3300025934 Bacteria 1339
557 Ga0207686_10313772 3300025934 Bacteria 1169
558 Ga0207686_10732309 3300025934 Bacteria 788
559 Ga0207709_10001437 3300025935 Bacteria 16621
560 Ga0207709_10110638 3300025935 Bacteria 1836
561 Ga0207709_10156617 3300025935 Bacteria 1584
562 Ga0207670_10116442 3300025936 Bacteria 1935
563 Ga0207670_10173061 3300025936 Bacteria 1620
564 Ga0207669_10000947 3300025937 Bacteria 12291
565 Ga0207669_10006120 3300025937 Bacteria 5468
566 Ga0207669_10049230 3300025937 Bacteria 2510
567 Ga0207669_10151608 3300025937 Bacteria 1624
568 Ga0207669_10240137 3300025937 Bacteria 1342
569 Ga0207669_10241204 3300025937 Bacteria 1340
570 Ga0207669_10313897 3300025937 Bacteria 1197
571 Ga0207669_10440515 3300025937 Bacteria 1030
572 Ga0207669_10468231 3300025937 Bacteria 1002
573 Ga0207704_10023320 3300025938 Bacteria 3333
574 Ga0207704_10062915 3300025938 Bacteria 2310
575 Ga0207704_10077341 3300025938 Bacteria 2136
576 Ga0207704_10128948 3300025938 Bacteria 1747
577 Ga0207665_10016548 3300025939 Bacteria 4845
578 Ga0207665_10030779 3300025939 Bacteria 3549
579 Ga0207665_10065771 3300025939 Bacteria 2466
580 Ga0207665_10893819 3300025939 Bacteria 704
581 Ga0207691_10003841 3300025940 Bacteria 14577
582 Ga0207691_10006369 3300025940 Bacteria 11405
583 Ga0207691_10008449 3300025940 Bacteria 9887
584 Ga0207691_10104092 3300025940 Bacteria 2530
585 Ga0207691_10190749 3300025940 Bacteria 1787
586 Ga0207691_10343210 3300025940 Bacteria 1278
587 Ga0207691_10712908 3300025940 Unclassified 846
588 Ga0207711_10009650 3300025941 Bacteria 8042
589 Ga0207711_10273383 3300025941 Bacteria 1555
590 Ga0207711_10359983 3300025941 Bacteria 1348
591 Ga0207689_10089764 3300025942 Bacteria 2524
592 Ga0207689_10193742 3300025942 Bacteria 1677
593 Ga0207689_10321019 3300025942 Bacteria 1285
594 Ga0207689_11106369 3300025942 Bacteria 668
595 Ga0207661_10002036 3300025944 Bacteria 13944
596 Ga0207661_10007125 3300025944 Bacteria 7946
597 Ga0207661_10082144 3300025944 Bacteria 2663
598 Ga0207661_10132253 3300025944 Bacteria 2139
599 Ga0207661_10202798 3300025944 Bacteria 1744
600 Ga0207661_10700650 3300025944 Bacteria 931
601 Ga0207679_10021002 3300025945 Bacteria 4418
602 Ga0207679_10207458 3300025945 Bacteria 1641
603 Ga0207679_10358443 3300025945 Bacteria 1273
604 Ga0207679_11180324 3300025945 Bacteria 702
605 Ga0207667_10030954 3300025949 Bacteria 5782
606 Ga0207667_10055537 3300025949 Bacteria 4162
607 Ga0207667_10166877 3300025949 Bacteria 2263
608 Ga0207667_10349807 3300025949 Bacteria 1507
609 Ga0207667_10497585 3300025949 Bacteria 1237
610 Ga0207667_10586555 3300025949 Bacteria 1125
611 Ga0207667_10986807 3300025949 Unclassified 830
612 Ga0207651_10147625 3300025960 Bacteria 1826
613 Ga0207712_10032939 3300025961 Bacteria 3500
614 Ga0207712_10091634 3300025961 Bacteria 2239
615 Ga0207668_10074588 3300025972 Bacteria 2436
616 Ga0207668_10110331 3300025972 Bacteria 2063
617 Ga0207668_10116078 3300025972 Bacteria 2018
618 Ga0207668_10349224 3300025972 Bacteria 1236
619 Ga0207668_10873734 3300025972 Bacteria 799
620 Ga0207640_10012755 3300025981 Bacteria 4797
621 Ga0207640_10189765 3300025981 Bacteria 1548
622 Ga0207658_10004308 3300025986 Bacteria 9909
623 Ga0207658_10482172 3300025986 Bacteria 1102
624 Ga0207677_10009016 3300026023 Bacteria 5597
625 Ga0207677_10049683 3300026023 Bacteria 2832
626 Ga0207677_10321978 3300026023 Bacteria 1285
627 Ga0207677_10567767 3300026023 Bacteria 991
628 Ga0207677_10659204 3300026023 Unclassified 925
629 Ga0207703_10280079 3300026035 Bacteria 1514
630 Ga0207639_10030317 3300026041 Bacteria 3967
631 Ga0207639_10599737 3300026041 Bacteria 1015
632 Ga0207678_10031959 3300026067 Bacteria 4589
633 Ga0207678_10149383 3300026067 Bacteria 1995
634 Ga0207708_10002124 3300026075 Bacteria 14612
635 Ga0207708_10006686 3300026075 Bacteria 8528
636 Ga0207708_10110388 3300026075 Bacteria 2134
637 Ga0207708_10264944 3300026075 Bacteria 1388
638 Ga0207708_10384297 3300026075 Unclassified 1158
639 Ga0207708_10744853 3300026075 Bacteria 840
640 Ga0207702_10245536 3300026078 Bacteria 1679
641 Ga0207702_10788869 3300026078 Bacteria 939
642 Ga0207702_11080384 3300026078 Bacteria 796
643 Ga0207702_11163827 3300026078 Bacteria 765
644 Ga0207702_11723882 3300026078 Bacteria 619
645 Ga0207641_10257216 3300026088 Bacteria 1633
646 Ga0207641_10871722 3300026088 Unclassified 893
647 Ga0207648_10003665 3300026089 Bacteria 16078
648 Ga0207648_10009895 3300026089 Bacteria 9090
649 Ga0207648_10039067 3300026089 Bacteria 4173
650 Ga0207648_10072896 3300026089 Bacteria 2993
651 Ga0207648_10301333 3300026089 Bacteria 1437
652 Ga0207648_10547597 3300026089 Unclassified 1062
653 Ga0207676_10275849 3300026095 Bacteria 1524
654 Ga0207674_10003286 3300026116 Bacteria 19888
655 Ga0207674_10021501 3300026116 Bacteria 6947
656 Ga0207674_10027334 3300026116 Bacteria 6037
657 Ga0207674_10193162 3300026116 Unclassified 1986
658 Ga0207674_10197444 3300026116 Bacteria 1962
659 Ga0207674_10548324 3300026116 Bacteria 1117
660 Ga0207675_100056521 3300026118 Bacteria 3660
661 Ga0207675_100056538 3300026118 Bacteria 3660
662 Ga0207675_100212709 3300026118 Bacteria 1860
663 Ga0207675_101304271 3300026118 Bacteria 746
664 Ga0207683_10000549 3300026121 Bacteria 34716
665 Ga0207683_10036267 3300026121 Bacteria 4293
666 Ga0207683_10047330 3300026121 Bacteria 3766
667 Ga0207683_10223264 3300026121 Bacteria 1717
668 Ga0207683_10245648 3300026121 Bacteria 1633
669 Ga0207683_10368552 3300026121 Bacteria 1319
670 Ga0207683_10537118 3300026121 Bacteria 1081
671 Ga0207698_10019467 3300026142 Bacteria 4648
672 Ga0207698_10082054 3300026142 Bacteria 2605
673 Ga0207698_10158978 3300026142 Unclassified 1973
674 Ga0207698_10295128 3300026142 Bacteria 1506
675 Ga0207698_10572317 3300026142 Bacteria 1110
676 Ga0209984_1029244 3300027424 Bacteria 776
677 Ga0207428_10000281 3300027907 Bacteria 68694
678 Ga0207428_10001649 3300027907 Bacteria 23211
679 Ga0207428_10012035 3300027907 Bacteria 7613
680 Ga0207428_10154897 3300027907 Bacteria 1743
681 Ga0268266_10050971 3300028379 Unclassified 3552
682 Ga0268265_10221831 3300028380 Bacteria 1655
683 Ga0268265_10582407 3300028380 Unclassified 1067
684 Ga0268264_10026449 3300028381 Bacteria 4742
685 Ga0265319_1021462 3300028563 Bacteria 2371
686 Ga0265334_10005832 3300028573 Bacteria 5363
687 Ga0265318_10016712 3300028577 Bacteria 3024
688 Ga0265318_10140149 3300028577 Bacteria 888
689 Ga0265318_10212242 3300028577 Bacteria 707
690 Ga0265323_10030176 3300028653 Bacteria 2022
691 Ga0265322_10003425 3300028654 Bacteria 4794
692 Ga0265336_10046234 3300028666 Bacteria 1323
693 Ga0265338_10008039 3300028800 Bacteria 12898
694 Ga0265338_10138014 3300028800 Bacteria 1913
695 Ga0265338_10337294 3300028800 Bacteria 1087
696 Ga0265330_10035402 3300031235 Bacteria 2228
697 Ga0265320_10242363 3300031240 Bacteria 800
698 Ga0265325_10008607 3300031241 Bacteria 6012
699 Ga0265329_10009734 3300031242 Bacteria 3565
700 Ga0265340_10010024 3300031247 Bacteria 5075
701 Ga0265340_10055518 3300031247 Bacteria 1908
702 Ga0265340_10058319 3300031247 Bacteria 1854
703 Ga0265340_10136756 3300031247 Bacteria 1122
704 Ga0265339_10127012 3300031249 Bacteria 1306
705 Ga0265327_10032463 3300031251 Bacteria 2921
706 Ga0265316_10009104 3300031344 Bacteria 9145
707 Ga0307408_100230399 3300031548 Bacteria 1517
708 Ga0307408_100304815 3300031548 Bacteria 1336
709 Ga0265313_10014492 3300031595 Bacteria 4653
710 Ga0265314_10024770 3300031711 Bacteria 4541
711 Ga0265342_10022224 3300031712 Bacteria 4037
712 Ga0265342_10246270 3300031712 Bacteria 955
713 Ga0307412_10158228 3300031911 Bacteria 1680
714 Ga0307409_100355041 3300031995 Bacteria 1385
715 Ga0307409_100882680 3300031995 Bacteria 907
716 Ga0307416_100030308 3300032002 Bacteria 4057
717 Ga0307416_100077088 3300032002 Bacteria 2798
718 Ga0307416_100464532 3300032002 Bacteria 1322
719 Ga0307416_100484709 3300032002 Bacteria 1297
720 Ga0307416_100553527 3300032002 Bacteria 1224
721 Ga0307415_100322925 3300032126 Bacteria 1288
722 Ga0307415_100665901 3300032126 Bacteria 935
723 Ga0373948_0021494 3300034817 Bacteria 1236
724 Ga0373950_0020163 3300034818 Bacteria 1171
725 Ga0373926_0063106 3300035083 Bacteria 1353
726 Ga0373926_0086331 3300035083 Bacteria 1164
727 Ga0373928_0023996 3300035084 Bacteria 1305
728 Ga0373944_0128109 3300035089 Bacteria 880
729 Ga0373951_0117435 3300035091 Unclassified 721
730 Ga0373932_0012542 3300035112 Unclassified 2089
731 Ga0373936_0259098 3300035113 Bacteria 778
732 Ga0373939_0009939 3300035114 Bacteria 2369
733 Ga0373945_0007187 3300035116 Bacteria 3604
734 Ga0373945_0307099 3300035116 Bacteria 680
735 Ga0373953_0171233 3300035117 Bacteria 935
736 Ga0373960_0014956 3300035121 Unclassified 1974
737 Ga0373943_0000101 3300035170 Bacteria 31609
738 Ga0373943_0002380 3300035170 Bacteria 8526
739 Ga0373943_0024799 3300035170 Bacteria 2799
740 Ga0373955_0087801 3300035172 Bacteria 1768
741 Ga0373942_0104227 3300035207 Bacteria 870
742 Ga0373961_0026558 3300035241 Bacteria 1583
743 Ga0373924_0048589 3300035410 Bacteria 1753
744 Ga0373931_0148644 3300035691 Bacteria 1364
745 Ga0373935_0003186 3300035692 Bacteria 9463
746 Ga0373935_0545454 3300035692 Bacteria 845
747 Ga0373927_0216590 3300035695 Bacteria 1258
748 Ga0373927_0416620 3300035695 Bacteria 886
749 Ga0373933_0188237 3300035724 Bacteria 1318
750 Ga0373947_0004984 3300035725 Bacteria 7772
751 Ga0373947_0015720 3300035725 Bacteria 4348
752 Ga0373947_0016356 3300035725 Bacteria 4263
753 Ga0373947_0081432 3300035725 Bacteria 2004
754 Ga0373937_0045512 3300036401 Bacteria 4010
755 Ga0373937_0059832 3300036401 Bacteria 3501
756 Ga0373925_0001828 3300037068 Bacteria 17755
757 Ga0373925_0010452 3300037068 Bacteria 6730
758 Ga0373925_0079083 3300037068 Bacteria 2498
759 Ga0373925_0096348 3300037068 Bacteria 2268
760 Ga0395899_0003147 3300037312 Bacteria 13110
761 Ga0395899_0010040 3300037312 Bacteria 7258
762 Ga0395899_0021434 3300037312 Bacteria 4901
763 Ga0395899_0032419 3300037312 Bacteria 3924
764 Ga0395899_0049967 3300037312 Bacteria 3106
765 Ga0395899_0080081 3300037312 Bacteria 2378
766 Ga0395899_0135604 3300037312 Bacteria 1754
767 Ga0395899_0174544 3300037312 Bacteria 1512
768 Ga0395899_0188481 3300037312 Bacteria 1444
769 Ga0395899_0264649 3300037312 Bacteria 1175
770 Ga0395899_0271107 3300037312 Bacteria 1158
771 Ga0395899_0316986 3300037312 Unclassified 1051
772 Ga0395899_0409445 3300037312 Bacteria 896
773 Ga0395900_0001024 3300037418 Bacteria 35866
774 Ga0395900_0012099 3300037418 Bacteria 8816
775 Ga0395900_0012528 3300037418 Bacteria 8676
776 Ga0395900_0012687 3300037418 Bacteria 8614
777 Ga0395900_0013415 3300037418 Bacteria 8372
778 Ga0395900_0017742 3300037418 Bacteria 7263
779 Ga0395900_0021094 3300037418 Bacteria 6658
780 Ga0395900_0024421 3300037418 Bacteria 6189
781 Ga0395900_0027352 3300037418 Bacteria 5840
782 Ga0395900_0038465 3300037418 Bacteria 4931
783 Ga0395900_0099610 3300037418 Bacteria 2985
784 Ga0395900_0105641 3300037418 Bacteria 2893
785 Ga0395900_0135204 3300037418 Bacteria 2526
786 Ga0395900_0154503 3300037418 Bacteria 2344
787 Ga0395900_0311967 3300037418 Bacteria 1556
788 Ga0395900_0353818 3300037418 Bacteria 1442
789 Ga0395900_0426865 3300037418 Bacteria 1285
790 Ga0395900_0429376 3300037418 Bacteria 1281
791 Ga0395900_0511889 3300037418 Bacteria 1149
792 Ga0395900_0535671 3300037418 Bacteria 1117
793 Ga0395900_0573777 3300037418 Unclassified 1070
794 Ga0395900_0651534 3300037418 Bacteria 990
795 Ga0395900_0687557 3300037418 Bacteria 957
796 Ga0395898_0002538 3300037466 Bacteria 21397
797 Ga0395898_0014811 3300037466 Bacteria 8004
798 Ga0395898_0024460 3300037466 Bacteria 6092
799 Ga0395898_0025550 3300037466 Bacteria 5949
800 Ga0395898_0039581 3300037466 Bacteria 4666
801 Ga0395898_0044611 3300037466 Bacteria 4362
802 Ga0395898_0045782 3300037466 Bacteria 4299
803 Ga0395898_0063561 3300037466 Bacteria 3581
804 Ga0395898_0065003 3300037466 Bacteria 3537
805 Ga0395898_0081440 3300037466 Bacteria 3121
806 Ga0395898_0086495 3300037466 Bacteria 3021
807 Ga0395898_0126047 3300037466 Bacteria 2453
808 Ga0395898_0192431 3300037466 Bacteria 1949
809 Ga0395898_0203722 3300037466 Bacteria 1888
810 Ga0395898_0228734 3300037466 Bacteria 1774
811 Ga0395898_0270714 3300037466 Bacteria 1620
812 Ga0395898_0313956 3300037466 Bacteria 1495
813 Ga0395898_0328552 3300037466 Bacteria 1458
814 Ga0395898_0373143 3300037466 Unclassified 1360
815 Ga0395905_0005601 3300037471 Bacteria 12795
816 Ga0395905_0008711 3300037471 Bacteria 9986
817 Ga0395905_0013885 3300037471 Bacteria 7706
818 Ga0395905_0014723 3300037471 Bacteria 7457
819 Ga0395905_0022631 3300037471 Bacteria 5941
820 Ga0395905_0051935 3300037471 Bacteria 3839
821 Ga0395905_0056874 3300037471 Bacteria 3658
822 Ga0395905_0082418 3300037471 Bacteria 3014
823 Ga0395905_0093067 3300037471 Bacteria 2827
824 Ga0395905_0098791 3300037471 Bacteria 2741
825 Ga0395905_0106700 3300037471 Bacteria 2630
826 Ga0395905_0149900 3300037471 Bacteria 2194
827 Ga0395905_0194824 3300037471 Bacteria 1900
828 Ga0395905_0234634 3300037471 Bacteria 1715
829 Ga0395905_0306968 3300037471 Bacteria 1475
830 Ga0395905_0346391 3300037471 Bacteria 1377
831 Ga0395905_0366670 3300037471 Unclassified 1333
832 Ga0395905_1163978 3300037471 Unclassified 675
833 Ga0395901_0001193 3300038443 Bacteria 27667
834 Ga0395901_0005850 3300038443 Bacteria 12439
835 Ga0395901_0006596 3300038443 Bacteria 11730
836 Ga0395901_0010416 3300038443 Bacteria 9418
837 Ga0395901_0012045 3300038443 Bacteria 8772
838 Ga0395901_0021717 3300038443 Bacteria 6577
839 Ga0395901_0023493 3300038443 Bacteria 6322
840 Ga0395901_0059975 3300038443 Bacteria 3958
841 Ga0395901_0059988 3300038443 Bacteria 3958
842 Ga0395901_0065579 3300038443 Bacteria 3781
843 Ga0395901_0073467 3300038443 Bacteria 3566
844 Ga0395901_0086070 3300038443 Bacteria 3286
845 Ga0395901_0086161 3300038443 Bacteria 3284
846 Ga0395901_0091290 3300038443 Bacteria 3188
847 Ga0395901_0199163 3300038443 Bacteria 2099
848 Ga0395901_0199419 3300038443 Bacteria 2098
849 Ga0395901_0224770 3300038443 Bacteria 1961
850 Ga0395901_0251360 3300038443 Bacteria 1841
851 Ga0395901_0261387 3300038443 Bacteria 1801
852 Ga0395901_0289161 3300038443 Bacteria 1701
853 Ga0395901_0574803 3300038443 Bacteria 1139
854 Ga0395901_0657841 3300038443 Bacteria 1050
855 Ga0395901_1229725 3300038443 Bacteria 713
856 Ga0395901_1465656 3300038443 Bacteria 639
857 Ga0436363_0252435 3300039450 Bacteria 885
858 Ga0436363_0840640 3300039450 Bacteria 642
859 Ga0439438_011492 3300041405 Bacteria 2754
860 Ga0439439_0001037 3300041406 Bacteria 5248
861 Ga0439447_030313 3300041407 Bacteria 1364
862 Ga0439453_0008564 3300041408 Bacteria 1645
863 Ga0439461_0011486 3300041410 Bacteria 1644
864 Ga0439466_0027129 3300041411 Bacteria 1985
865 Ga0439466_0186432 3300041411 Bacteria 632
866 Ga0451839_0366405 3300041496 Bacteria 893
867 Ga0451841_0281777 3300041498 Bacteria 823
868 Ga0451853_2505818 3300041512 Bacteria 1223
869 Ga0439431_0002677 3300041997 Bacteria 3928
870 Ga0439431_0075838 3300041997 Bacteria 902
871 Ga0439441_004017 3300042001 Unclassified 2206
872 Ga0439442_009550 3300042002 Bacteria 1963
873 Ga0439445_0085422 3300042004 Bacteria 885
874 Ga0439448_0048539 3300042005 Bacteria 1386
875 Ga0439448_0194377 3300042005 Bacteria 710
876 Ga0439449_0150972 3300042007 Bacteria 866
877 Ga0439451_000740 3300042009 Bacteria 6207
878 Ga0439454_038204 3300042011 Bacteria 777
879 Ga0439457_010156 3300042014 Bacteria 2172
880 Ga0439462_0000280 3300042015 Bacteria 9395
881 Ga0439463_032301 3300042016 Bacteria 1323
882 Ga0450920_012039 3300042122 Bacteria 1618
883 Ga0450906_005415 3300042145 Bacteria 2624
884 Ga0439446_0001239 3300042156 Bacteria 5726
885 Ga0439446_0007392 3300042156 Bacteria 2886
886 Ga0439446_0013561 3300042156 Bacteria 2238
887 Ga0439446_0155337 3300042156 Bacteria 754
888 Ga0450908_016948 3300042184 Bacteria 1296
889 Ga0439434_0002323 3300042435 Bacteria 5535
890 Ga0439434_0020330 3300042435 Bacteria 1993
891 Ga0439434_0064673 3300042435 Bacteria 1147
892 Ga0466969_0164408 3300044656 Bacteria 1019
893 Ga0466966_0002588 3300044684 Bacteria 11853
894 Ga0466961_0010006 3300044693 Bacteria 6042
895 Ga0466961_0144025 3300044693 Bacteria 1491
896 Ga0466961_0225218 3300044693 Bacteria 1155
897 Ga0466963_0008626 3300044694 Bacteria 6117
898 Ga0466963_0018747 3300044694 Bacteria 4331
899 Ga0466963_0038511 3300044694 Bacteria 3126
900 Ga0466963_0038616 3300044694 Bacteria 3123
901 Ga0466963_0070737 3300044694 Bacteria 2347
902 Ga0466963_0083257 3300044694 Bacteria 2170
903 Ga0466963_0137444 3300044694 Bacteria 1691
904 Ga0466963_0163206 3300044694 Bacteria 1551
905 Ga0466963_0352098 3300044694 Bacteria 1037
906 Ga0466963_0417671 3300044694 Bacteria 946
907 Ga0466964_0010748 3300044706 Bacteria 3457
908 Ga0466964_0019693 3300044706 Bacteria 2596
909 Ga0466971_0000282 3300044719 Bacteria 19481
910 Ga0466971_0337840 3300044719 Bacteria 727
911 Ga0466968_0228453 3300044735 Bacteria 878
912 Ga0466970_0274733 3300044765 Bacteria 947
913 Ga0466957_0021243 3300044842 Bacteria 3823
914 Ga0466957_0072999 3300044842 Bacteria 2126
915 Ga0466957_0150353 3300044842 Bacteria 1505
916 Ga0466957_0190270 3300044842 Bacteria 1344
917 Ga0466960_0213785 3300044901 Bacteria 1058
918 Ga0466959_0015352 3300045049 Bacteria 5577
919 Ga0466959_0022070 3300045049 Bacteria 4702
920 Ga0466959_0048878 3300045049 Bacteria 3108
921 Ga0466959_0637054 3300045049 Unclassified 716
922 Ga0451576_0548808 3300045051 Bacteria 1214
923 Ga0466958_0079432 3300045836 Bacteria 2017
924 Ga0466958_0100793 3300045836 Bacteria 1795
925 Ga0466967_0003105 3300045976 Bacteria 10682
926 Ga0466967_0012620 3300045976 Bacteria 6477
927 Ga0466967_0019897 3300045976 Bacteria 5411
928 Ga0466967_0036912 3300045976 Bacteria 4176
929 Ga0466967_0039574 3300045976 Bacteria 4054
930 Ga0466967_0057547 3300045976 Bacteria 3432
931 Ga0466967_0066054 3300045976 Bacteria 3222
932 Ga0466967_0089803 3300045976 Bacteria 2790
933 Ga0466967_0098543 3300045976 Bacteria 2669
934 Ga0466967_0107028 3300045976 Bacteria 2564
935 Ga0466967_0132537 3300045976 Bacteria 2315
936 Ga0466967_0169773 3300045976 Bacteria 2052
937 Ga0466967_0205207 3300045976 Bacteria 1868
938 Ga0466967_0345485 3300045976 Bacteria 1439
939 Ga0466967_1028402 3300045976 Bacteria 820
940 Ga0466967_1244920 3300045976 Bacteria 741
941 Ga0495592_0012708 3300046454 Bacteria 6400
942 Ga0495592_0044335 3300046454 Bacteria 3324
943 Ga0495592_0062905 3300046454 Bacteria 2723
944 Ga0495592_0074482 3300046454 Bacteria 2466
945 Ga0495603_0003671 3300046455 Bacteria 9133
946 Ga0495603_0009496 3300046455 Bacteria 5878
947 Ga0495603_0053150 3300046455 Bacteria 2404
948 Ga0495603_0094203 3300046455 Bacteria 1750
949 Ga0495603_0287731 3300046455 Bacteria 944
950 Ga0495629_0000670 3300046459 Bacteria 27725
951 Ga0495629_0007457 3300046459 Bacteria 8059
952 Ga0495629_0064008 3300046459 Bacteria 2568
953 Ga0495641_0000374 3300046461 Bacteria 37120
954 Ga0495641_0054214 3300046461 Bacteria 1822
955 Ga0495641_0104167 3300046461 Bacteria 1266
956 Ga0495641_0222404 3300046461 Bacteria 847
957 Ga0495651_0032871 3300046462 Bacteria 4046
958 Ga0495651_0055949 3300046462 Bacteria 3030
959 Ga0495653_0011141 3300046463 Bacteria 7354
960 Ga0495653_0026252 3300046463 Bacteria 4674
961 Ga0495653_0106485 3300046463 Bacteria 2022
962 Ga0495580_0095413 3300046472 Bacteria 2069
963 Ga0495582_0000124 3300046473 Bacteria 41197
964 Ga0495582_0027743 3300046473 Bacteria 3105
965 Ga0495582_0043604 3300046473 Bacteria 2471
966 Ga0495582_0184982 3300046473 Bacteria 1188
967 Ga0495582_0246860 3300046473 Bacteria 1023
968 Ga0495605_0149814 3300046474 Bacteria 1042
969 Ga0495605_0200248 3300046474 Unclassified 871
970 Ga0495639_0000786 3300046475 Bacteria 14467
971 Ga0495639_0003815 3300046475 Bacteria 6470
972 Ga0495662_0000898 3300046476 Bacteria 14537
973 Ga0495664_0113377 3300046477 Bacteria 1637
974 Ga0495584_0062100 3300046491 Bacteria 1878
975 Ga0495584_0212362 3300046491 Unclassified 983
976 Ga0495584_0240925 3300046491 Bacteria 920
977 Ga0495584_0243869 3300046491 Bacteria 914
978 Ga0495585_0077794 3300046492 Unclassified 1801
979 Ga0495594_0121806 3300046499 Bacteria 1475
980 Ga0495594_0211173 3300046499 Bacteria 1107
981 Ga0495596_0021413 3300046500 Bacteria 2639
982 Ga0495596_0095088 3300046500 Bacteria 1157
983 Ga0495583_0126736 3300046506 Bacteria 1071
984 Ga0495608_0034518 3300046511 Bacteria 3414
985 Ga0495608_0066715 3300046511 Bacteria 2355
986 Ga0495608_0184984 3300046511 Bacteria 1317
987 Ga0495618_0352738 3300046514 Bacteria 906
988 Ga0495628_0028880 3300046516 Bacteria 4502
989 Ga0495628_0045354 3300046516 Bacteria 3496
990 Ga0495628_0204537 3300046516 Unclassified 1486
991 Ga0495628_0396560 3300046516 Bacteria 1009
992 Ga0495630_0007417 3300046517 Bacteria 7836
993 Ga0495630_0024990 3300046517 Bacteria 4416
994 Ga0495630_0070277 3300046517 Bacteria 2634
995 Ga0495631_0053729 3300046518 Unclassified 1758
996 Ga0495631_0133649 3300046518 Bacteria 1066
997 Ga0495663_0118965 3300046525 Bacteria 883
998 Ga0495666_0059325 3300046526 Bacteria 1830
999 Ga0495666_0127260 3300046526 Bacteria 1191
1000 Ga0495652_0041211 3300046529 Bacteria 3987
1001 Ga0495652_0049614 3300046529 Bacteria 3592
1002 Ga0495652_0059198 3300046529 Bacteria 3242
1003 Ga0495665_0000249 3300046531 Bacteria 27073
1004 Ga0495665_0187753 3300046531 Bacteria 1073
1005 Ga0495665_0284862 3300046531 Bacteria 847
1006 Ga0495640_0002423 3300046533 Bacteria 14977
1007 Ga0495640_0099521 3300046533 Bacteria 1910
1008 Ga0495640_0153073 3300046533 Unclassified 1481
1009 Ga0495640_0262113 3300046533 Bacteria 1080
1010 Ga0495586_0028291 3300046535 Bacteria 2999
1011 Ga0495586_0186918 3300046535 Bacteria 1173
1012 Ga0495586_0211600 3300046535 Bacteria 1100
1013 Ga0495586_0603010 3300046535 Bacteria 634
1014 Ga0495587_0007388 3300046536 Bacteria 7118
1015 Ga0495587_0011842 3300046536 Bacteria 5513
1016 Ga0495598_0052795 3300046537 Bacteria 1229
1017 Ga0495609_0022647 3300046538 Bacteria 2894
1018 Ga0495645_0031449 3300046543 Bacteria 3868
1019 Ga0495645_0094798 3300046543 Bacteria 2128
1020 Ga0495667_0029105 3300046559 Bacteria 3717
1021 Ga0495667_0116073 3300046559 Bacteria 1729
1022 Ga0495667_0268961 3300046559 Bacteria 1083
1023 Ga0495656_0008465 3300046615 Bacteria 3673
1024 Ga0495656_0032415 3300046615 Bacteria 2126
1025 Ga0495634_0008524 3300046642 Bacteria 7622
1026 Ga0495634_0012520 3300046642 Bacteria 6138
1027 Ga0495634_0023607 3300046642 Bacteria 4320
1028 Ga0495634_0120128 3300046642 Bacteria 1683
1029 Ga0495635_0008656 3300046663 Bacteria 7106
1030 Ga0495635_0037003 3300046663 Bacteria 3379
1031 Ga0495659_0008968 3300046664 Bacteria 3185
1032 Ga0495588_0065866 3300046674 Bacteria 1880
1033 Ga0495588_0120144 3300046674 Bacteria 1385
1034 Ga0495657_0021681 3300046675 Bacteria 4607
1035 Ga0495657_0153397 3300046675 Bacteria 1429
1036 Ga0495599_0430941 3300046678 Bacteria 782
1037 Ga0495623_0180069 3300046679 Bacteria 1229
1038 Ga0495623_0353927 3300046679 Bacteria 799
1039 Ga0495646_0035173 3300046680 Unclassified 3108
1040 Ga0495646_0311118 3300046680 Bacteria 831
1041 Ga0495647_0001940 3300046681 Bacteria 6447
1042 Ga0495647_0008423 3300046681 Bacteria 3468
1043 Ga0495647_0045113 3300046681 Bacteria 1692
1044 Ga0495647_0192159 3300046681 Bacteria 892
1045 Ga0495658_0000247 3300046683 Bacteria 30977
1046 Ga0495658_0007032 3300046683 Bacteria 5551
1047 Ga0495658_0027415 3300046683 Bacteria 3065
1048 Ga0495658_0056870 3300046683 Bacteria 2232
1049 Ga0495658_0060215 3300046683 Bacteria 2177
1050 Ga0495658_0208448 3300046683 Bacteria 1220
1051 Ga0495658_0620463 3300046683 Bacteria 693
1052 Ga0495613_0019190 3300046689 Bacteria 5097
1053 Ga0495613_0105827 3300046689 Bacteria 2030
1054 Ga0495613_0137857 3300046689 Unclassified 1745
1055 Ga0495613_0223374 3300046689 Bacteria 1322
1056 Ga0495613_0243819 3300046689 Bacteria 1256
1057 Ga0495613_0585220 3300046689 Unclassified 744
1058 Ga0495624_0057677 3300046690 Bacteria 2441
1059 Ga0495624_0067947 3300046690 Bacteria 2222
1060 Ga0495624_0086082 3300046690 Bacteria 1941
1061 Ga0495670_0156634 3300046691 Bacteria 1196
1062 Ga0495670_0358174 3300046691 Unclassified 786
1063 Ga0495589_0053546 3300046794 Unclassified 1991
1064 Ga0495589_0079443 3300046794 Bacteria 1596
1065 Ga0495589_0082966 3300046794 Bacteria 1558
1066 Ga0495589_0139710 3300046794 Bacteria 1161
1067 Ga0495589_0249247 3300046794 Bacteria 830
1068 Ga0495600_0035965 3300046809 Bacteria 3218
1069 Ga0495581_0002147 3300047315 Bacteria 11128
1070 Ga0495581_0004417 3300047315 Bacteria 8130
1071 Ga0495581_0019975 3300047315 Bacteria 3890
1072 Ga0495581_0340826 3300047315 Bacteria 875
1073 Ga0495604_0015169 3300047317 Bacteria 6150
1074 Ga0495604_0018709 3300047317 Bacteria 5547
1075 Ga0495604_0119002 3300047317 Bacteria 1914
1076 Ga0495604_0402934 3300047317 Bacteria 901
1077 Ga0495674_0003941 3300047319 Bacteria 14400
1078 Ga0495674_0011930 3300047319 Bacteria 8194
1079 Ga0495674_0022470 3300047319 Bacteria 5819
1080 Ga0495674_0024895 3300047319 Bacteria 5493
1081 Ga0495674_0058362 3300047319 Bacteria 3374
1082 Ga0495674_0282770 3300047319 Bacteria 1359
1083 Ga0495674_0526933 3300047319 Bacteria 943
1084 Ga0495676_0001077 3300047321 Bacteria 23118
1085 Ga0495676_0045165 3300047321 Bacteria 3588
1086 Ga0495676_0051848 3300047321 Bacteria 3279
1087 Ga0495676_0129514 3300047321 Bacteria 1824
1088 Ga0495676_0464069 3300047321 Bacteria 834
1089 Ga0495676_0479392 3300047321 Bacteria 818
1090 Ga0495680_0003365 3300047322 Bacteria 15791
1091 Ga0495680_0006023 3300047322 Bacteria 11341
1092 Ga0495680_0019563 3300047322 Bacteria 5711
1093 Ga0495680_0083212 3300047322 Bacteria 2413
1094 Ga0495680_0133443 3300047322 Bacteria 1822
1095 Ga0495680_0170949 3300047322 Bacteria 1573
1096 Ga0495683_0301024 3300047323 Bacteria 689
1097 Ga0495675_0000878 3300047444 Bacteria 18381
1098 Ga0495677_0054560 3300047445 Unclassified 1474
1099 Ga0495684_0036467 3300047471 Bacteria 3769
1100 Ga0495684_0038933 3300047471 Bacteria 3644
1101 Ga0495593_0027759 3300047673 Bacteria 3113
1102 Ga0495593_0090592 3300047673 Bacteria 1575
1103 Ga0495593_0225909 3300047673 Bacteria 939
1104 Ga0495602_0091376 3300048088 Bacteria 2525
1105 Ga0495614_0016364 3300048089 Bacteria 3228
1106 Ga0495614_0324823 3300048089 Bacteria 714
1107 Ga0496100_0019720 3300048903 Bacteria 4029
1108 Ga0496100_0032856 3300048903 Bacteria 3241
1109 Ga0496100_0064418 3300048903 Bacteria 2425
1110 Ga0496100_0078981 3300048903 Unclassified 2216
1111 Ga0496100_0081501 3300048903 Bacteria 2186
1112 Ga0496100_0330889 3300048903 Bacteria 1146
1113 Ga0496100_0381827 3300048903 Bacteria 1070
1114 Ga0496100_0395330 3300048903 Bacteria 1052
1115 Ga0496100_0577610 3300048903 Unclassified 871
1116 Ga0496101_0009476 3300048904 Bacteria 6401
1117 Ga0496101_0016050 3300048904 Bacteria 5055
1118 Ga0496101_0017088 3300048904 Bacteria 4914
1119 Ga0496101_0018810 3300048904 Bacteria 4704
1120 Ga0496101_0054090 3300048904 Bacteria 2898
1121 Ga0496101_0089027 3300048904 Bacteria 2293
1122 Ga0496101_0136430 3300048904 Bacteria 1867
1123 Ga0496101_0189139 3300048904 Bacteria 1588
1124 Ga0496101_0283558 3300048904 Bacteria 1295
1125 Ga0496101_0390527 3300048904 Bacteria 1095
1126 Ga0496101_0473457 3300048904 Bacteria 989
1127 Ga0496101_0578947 3300048904 Bacteria 888
1128 Ga0496102_0012890 3300048905 Bacteria 7236
1129 Ga0496102_0027537 3300048905 Bacteria 5076
1130 Ga0496102_0028906 3300048905 Bacteria 4955
1131 Ga0496102_0032044 3300048905 Bacteria 4721
1132 Ga0496102_0055435 3300048905 Bacteria 3615
1133 Ga0496102_0105897 3300048905 Bacteria 2617
1134 Ga0496102_0223199 3300048905 Bacteria 1777
1135 Ga0496102_0250547 3300048905 Bacteria 1670
1136 Ga0496102_0254483 3300048905 Bacteria 1656
1137 Ga0496102_0339477 3300048905 Bacteria 1415
1138 Ga0496102_0386868 3300048905 Bacteria 1316
1139 Ga0496102_0582884 3300048905 Bacteria 1041
1140 Ga0496103_0001779 3300048906 Bacteria 14061
1141 Ga0496103_0005695 3300048906 Bacteria 7447
1142 Ga0496103_0096720 3300048906 Bacteria 1866
1143 Ga0496103_0227213 3300048906 Bacteria 1200
1144 Ga0496103_0248071 3300048906 Bacteria 1146
1145 Ga0496104_0002542 3300048907 Bacteria 15712
1146 Ga0496104_0019413 3300048907 Bacteria 6218
1147 Ga0496104_0057530 3300048907 Bacteria 3679
1148 Ga0496104_0060408 3300048907 Bacteria 3591
1149 Ga0496104_0068373 3300048907 Bacteria 3376
1150 Ga0496104_0085444 3300048907 Bacteria 3011
1151 Ga0496104_0092033 3300048907 Bacteria 2899
1152 Ga0496104_0136643 3300048907 Bacteria 2355
1153 Ga0496104_0188485 3300048907 Bacteria 1973
1154 Ga0496104_0596004 3300048907 Bacteria 1015
1155 Ga0496104_0641981 3300048907 Bacteria 971
1156 Ga0496105_0000594 3300048908 Bacteria 24087
1157 Ga0496105_0002629 3300048908 Bacteria 13070
1158 Ga0496105_0016150 3300048908 Bacteria 5955
1159 Ga0496105_0037041 3300048908 Bacteria 4019
1160 Ga0496105_0038309 3300048908 Bacteria 3949
1161 Ga0496105_0100325 3300048908 Bacteria 2391
1162 Ga0496105_0184941 3300048908 Bacteria 1705
1163 Ga0496105_0229369 3300048908 Bacteria 1509
1164 Ga0496105_0265414 3300048908 Bacteria 1387
1165 Ga0496105_0304991 3300048908 Bacteria 1279
1166 Ga0496105_0321550 3300048908 Bacteria 1240
1167 Ga0496105_0349621 3300048908 Bacteria 1181
1168 Ga0496105_0590246 3300048908 Bacteria 863
1169 Ga0496106_0020462 3300048909 Bacteria 4910
1170 Ga0496106_0046554 3300048909 Bacteria 3261
1171 Ga0496106_0078323 3300048909 Bacteria 2536
1172 Ga0496106_0080908 3300048909 Bacteria 2495
1173 Ga0496106_0083679 3300048909 Bacteria 2454
1174 Ga0496106_0150529 3300048909 Bacteria 1835
1175 Ga0496106_0196852 3300048909 Bacteria 1603
1176 Ga0496106_0204466 3300048909 Bacteria 1572
1177 Ga0496106_0255171 3300048909 Bacteria 1402
1178 Ga0496106_0357352 3300048909 Bacteria 1173
1179 Ga0496107_0007782 3300048910 Bacteria 7401
1180 Ga0496107_0009167 3300048910 Bacteria 6860
1181 Ga0496107_0028962 3300048910 Bacteria 3938
1182 Ga0496107_0034717 3300048910 Bacteria 3613
1183 Ga0496107_0094627 3300048910 Bacteria 2185
1184 Ga0496107_0196205 3300048910 Bacteria 1500
1185 Ga0496107_0515437 3300048910 Bacteria 887
1186 Ga0496107_0558441 3300048910 Bacteria 848
1187 Ga0496108_0002772 3300048911 Bacteria 14039
1188 Ga0496108_0002961 3300048911 Bacteria 13659
1189 Ga0496108_0010621 3300048911 Bacteria 7469
1190 Ga0496108_0012918 3300048911 Bacteria 6805
1191 Ga0496108_0033557 3300048911 Bacteria 4263
1192 Ga0496108_0035869 3300048911 Bacteria 4124
1193 Ga0496108_0070057 3300048911 Bacteria 2959
1194 Ga0496108_0071796 3300048911 Bacteria 2922
1195 Ga0496108_0098963 3300048911 Unclassified 2485
1196 Ga0496108_0101023 3300048911 Bacteria 2460
1197 Ga0496108_0444905 3300048911 Bacteria 1132
1198 Ga0496108_0506759 3300048911 Bacteria 1054
1199 Ga0496108_0546329 3300048911 Bacteria 1011
1200 Ga0496109_0000463 3300048912 Bacteria 34599
1201 Ga0496109_0002273 3300048912 Bacteria 15968
1202 Ga0496109_0007742 3300048912 Bacteria 9095
1203 Ga0496109_0013960 3300048912 Bacteria 6985
1204 Ga0496109_0026915 3300048912 Bacteria 5130
1205 Ga0496109_0043098 3300048912 Bacteria 4090
1206 Ga0496109_0043170 3300048912 Bacteria 4086
1207 Ga0496109_0046500 3300048912 Bacteria 3942
1208 Ga0496109_0144377 3300048912 Bacteria 2226
1209 Ga0496109_0147382 3300048912 Bacteria 2203
1210 Ga0496109_0159036 3300048912 Bacteria 2116
1211 Ga0496109_0178134 3300048912 Bacteria 1996
1212 Ga0496109_0225958 3300048912 Bacteria 1761
1213 Ga0496109_0354289 3300048912 Bacteria 1386
1214 Ga0496109_0366537 3300048912 Bacteria 1361
1215 Ga0496109_0459310 3300048912 Bacteria 1203
1216 Ga0496109_0736219 3300048912 Unclassified 924
1217 Ga0496109_0792870 3300048912 Bacteria 885
1218 Ga0496109_1461006 3300048912 Bacteria 619
1219 Ga0496110_0001516 3300048913 Bacteria 16857
1220 Ga0496110_0005397 3300048913 Bacteria 10022
1221 Ga0496110_0007165 3300048913 Bacteria 8879
1222 Ga0496110_0020062 3300048913 Bacteria 5637
1223 Ga0496110_0029842 3300048913 Bacteria 4698
1224 Ga0496110_0033236 3300048913 Bacteria 4460
1225 Ga0496110_0033425 3300048913 Unclassified 4448
1226 Ga0496110_0045999 3300048913 Bacteria 3817
1227 Ga0496110_0065042 3300048913 Bacteria 3224
1228 Ga0496110_0065623 3300048913 Bacteria 3210
1229 Ga0496110_0130540 3300048913 Bacteria 2268
1230 Ga0496110_0148827 3300048913 Unclassified 2119
1231 Ga0496110_0167005 3300048913 Bacteria 1996
1232 Ga0496110_0249118 3300048913 Bacteria 1617
1233 Ga0496110_0432652 3300048913 Bacteria 1199
1234 Ga0496111_0001509 3300048914 Bacteria 13345
1235 Ga0496111_0004584 3300048914 Bacteria 8749
1236 Ga0496111_0011653 3300048914 Bacteria 5932
1237 Ga0496111_0018266 3300048914 Bacteria 4856
1238 Ga0496111_0021224 3300048914 Bacteria 4532
1239 Ga0496111_0023541 3300048914 Bacteria 4325
1240 Ga0496111_0051968 3300048914 Bacteria 2959
1241 Ga0496111_0073818 3300048914 Bacteria 2484
1242 Ga0496111_0127975 3300048914 Bacteria 1878
1243 Ga0496111_0326108 3300048914 Bacteria 1137
1244 Ga0496111_0354464 3300048914 Bacteria 1086
1245 Ga0496112_0006274 3300048915 Bacteria 10426
1246 Ga0496112_0006938 3300048915 Bacteria 9997
1247 Ga0496112_0012134 3300048915 Bacteria 7906
1248 Ga0496112_0035402 3300048915 Bacteria 4863
1249 Ga0496112_0052362 3300048915 Bacteria 4006
1250 Ga0496112_0087695 3300048915 Bacteria 3079
1251 Ga0496112_0108591 3300048915 Bacteria 2745
1252 Ga0496112_0163712 3300048915 Bacteria 2190
1253 Ga0496112_0205946 3300048915 Bacteria 1925
1254 Ga0496112_0606663 3300048915 Bacteria 1026
1255 Ga0496113_0035774 3300048916 Bacteria 3634
1256 Ga0496113_0043795 3300048916 Bacteria 3314
1257 Ga0496113_0066200 3300048916 Bacteria 2736
1258 Ga0496114_0000690 3300048917 Bacteria 25130
1259 Ga0496114_0001536 3300048917 Bacteria 17490
1260 Ga0496114_0023117 3300048917 Bacteria 5068
1261 Ga0496114_0023564 3300048917 Bacteria 5024
1262 Ga0496114_0029394 3300048917 Bacteria 4517
1263 Ga0496114_0069445 3300048917 Bacteria 2958
1264 Ga0496114_0152272 3300048917 Bacteria 2007
1265 Ga0496114_0219351 3300048917 Bacteria 1669
1266 Ga0496114_0286043 3300048917 Bacteria 1454
1267 Ga0496114_0373942 3300048917 Bacteria 1261
1268 Ga0496114_0403523 3300048917 Unclassified 1210
1269 Ga0496114_0403875 3300048917 Bacteria 1210
1270 Ga0496114_0493459 3300048917 Bacteria 1083
1271 Ga0496114_0579897 3300048917 Bacteria 990
1272 Ga0496114_0706949 3300048917 Bacteria 883
1273 Ga0496115_0002513 3300048918 Bacteria 13172
1274 Ga0496115_0006958 3300048918 Bacteria 8308
1275 Ga0496115_0042123 3300048918 Bacteria 3637
1276 Ga0496115_0089421 3300048918 Bacteria 2515
1277 Ga0496115_0246353 3300048918 Unclassified 1472
1278 Ga0501031_0001464 3300049568 Bacteria 14649
1279 Ga0501031_0002862 3300049568 Bacteria 11023
1280 Ga0501031_0014843 3300049568 Bacteria 5062
1281 Ga0501031_0017305 3300049568 Bacteria 4683
1282 Ga0501031_0022062 3300049568 Bacteria 4149
1283 Ga0501031_0022527 3300049568 Bacteria 4104
1284 Ga0501031_0022982 3300049568 Bacteria 4066
1285 Ga0501031_0035994 3300049568 Bacteria 3228
1286 Ga0501031_0108348 3300049568 Bacteria 1814
1287 Ga0501031_0379882 3300049568 Bacteria 914
1288 Ga0501032_0001151 3300049569 Bacteria 21176
1289 Ga0501032_0002549 3300049569 Bacteria 14258
1290 Ga0501032_0010844 3300049569 Bacteria 6556
1291 Ga0501032_0032349 3300049569 Bacteria 3585
1292 Ga0501032_0097332 3300049569 Bacteria 1950
1293 Ga0501032_0226921 3300049569 Bacteria 1215
1294 Ga0501032_0287520 3300049569 Bacteria 1064
1295 Ga0501032_0463298 3300049569 Bacteria 811
1296 Ga0501033_0002394 3300049570 Bacteria 15962
1297 Ga0501033_0009712 3300049570 Bacteria 7397
1298 Ga0501033_0030817 3300049570 Bacteria 4031
1299 Ga0501033_0058879 3300049570 Bacteria 2837
1300 Ga0501033_0145138 3300049570 Bacteria 1714
1301 Ga0501033_0165342 3300049570 Unclassified 1591
1302 Ga0501034_0005171 3300049571 Bacteria 14311
1303 Ga0501036_0000693 3300049572 Bacteria 24868
1304 Ga0501036_0003288 3300049572 Bacteria 12889
1305 Ga0501036_0008999 3300049572 Bacteria 8211
1306 Ga0501036_0016429 3300049572 Bacteria 6181
1307 Ga0501036_0016728 3300049572 Bacteria 6126
1308 Ga0501036_0029351 3300049572 Bacteria 4647
1309 Ga0501036_0066807 3300049572 Bacteria 3042
1310 Ga0501036_0172382 3300049572 Bacteria 1823
1311 Ga0501036_0173817 3300049572 Unclassified 1814
1312 Ga0501036_0242896 3300049572 Bacteria 1510
1313 Ga0501036_0804556 3300049572 Bacteria 774
1314 Ga0501037_0000912 3300049573 Bacteria 22025
1315 Ga0501037_0001411 3300049573 Bacteria 17615
1316 Ga0501037_0007140 3300049573 Bacteria 8164
1317 Ga0501037_0010845 3300049573 Bacteria 6696
1318 Ga0501037_0011391 3300049573 Bacteria 6547
1319 Ga0501037_0080781 3300049573 Bacteria 2358
1320 Ga0501037_0110709 3300049573 Bacteria 1978
1321 Ga0501037_0140113 3300049573 Unclassified 1731
1322 Ga0501037_0333643 3300049573 Bacteria 1048
1323 Ga0501037_0342259 3300049573 Bacteria 1033
1324 Ga0501037_0395522 3300049573 Bacteria 948
1325 Ga0501038_0000324 3300049574 Bacteria 41091
1326 Ga0501038_0001233 3300049574 Bacteria 23205
1327 Ga0501038_0004780 3300049574 Bacteria 12588
1328 Ga0501038_0008959 3300049574 Bacteria 9180
1329 Ga0501038_0011360 3300049574 Bacteria 8127
1330 Ga0501038_0049975 3300049574 Bacteria 3613
1331 Ga0501038_0084967 3300049574 Bacteria 2662
1332 Ga0501038_0106861 3300049574 Bacteria 2322
1333 Ga0501038_0128461 3300049574 Bacteria 2083
1334 Ga0501038_0422649 3300049574 Unclassified 1028
1335 Ga0501038_0579878 3300049574 Bacteria 850
1336 Ga0501039_0003272 3300049575 Bacteria 12110
1337 Ga0501039_0009674 3300049575 Bacteria 7348
1338 Ga0501039_0010604 3300049575 Bacteria 7021
1339 Ga0501039_0014054 3300049575 Bacteria 6127
1340 Ga0501039_0016565 3300049575 Bacteria 5646
1341 Ga0501039_0019130 3300049575 Bacteria 5254
1342 Ga0501039_0053657 3300049575 Bacteria 3119
1343 Ga0501039_0058713 3300049575 Bacteria 2980
1344 Ga0501039_0072523 3300049575 Bacteria 2675
1345 Ga0501039_0079407 3300049575 Bacteria 2552
1346 Ga0501039_0120371 3300049575 Bacteria 2057
1347 Ga0501039_0250890 3300049575 Bacteria 1391
1348 Ga0501039_0320812 3300049575 Bacteria 1218
1349 Ga0501040_0001388 3300049576 Bacteria 15296
1350 Ga0501040_0001492 3300049576 Bacteria 14846
1351 Ga0501040_0002437 3300049576 Bacteria 11977
1352 Ga0501040_0003958 3300049576 Bacteria 9620
1353 Ga0501040_0005985 3300049576 Bacteria 7875
1354 Ga0501040_0027339 3300049576 Bacteria 3840
1355 Ga0501040_0032936 3300049576 Bacteria 3508
1356 Ga0501040_0036406 3300049576 Bacteria 3340
1357 Ga0501040_0044103 3300049576 Bacteria 3040
1358 Ga0501040_0093214 3300049576 Bacteria 2094
1359 Ga0501040_0117238 3300049576 Bacteria 1866
1360 Ga0501040_0220391 3300049576 Bacteria 1349
1361 Ga0501040_0278327 3300049576 Bacteria 1195
1362 Ga0501040_0309569 3300049576 Bacteria 1129
1363 Ga0501040_0323798 3300049576 Bacteria 1103
1364 Ga0501040_0415654 3300049576 Bacteria 966
1365 Ga0501040_0848030 3300049576 Bacteria 661
1366 Ga0501041_0000022 3300049577 Bacteria 52719
1367 Ga0501041_0002614 3300049577 Bacteria 10267
1368 Ga0501041_0004752 3300049577 Bacteria 7883
1369 Ga0501041_0006585 3300049577 Bacteria 6802
1370 Ga0501041_0024829 3300049577 Bacteria 3599
1371 Ga0501041_0037062 3300049577 Bacteria 2954
1372 Ga0501041_0037145 3300049577 Bacteria 2950
1373 Ga0501041_0116576 3300049577 Bacteria 1658
1374 Ga0501041_0144044 3300049577 Bacteria 1487
1375 Ga0501041_0144422 3300049577 Bacteria 1484
1376 Ga0501041_0324354 3300049577 Bacteria 971
1377 Ga0501041_0432054 3300049577 Bacteria 835
1378 Ga0501042_0000116 3300049578 Bacteria 33871
1379 Ga0501042_0001944 3300049578 Bacteria 12443
1380 Ga0501042_0005494 3300049578 Bacteria 8169
1381 Ga0501042_0013618 3300049578 Bacteria 5538
1382 Ga0501042_0013760 3300049578 Bacteria 5511
1383 Ga0501042_0017953 3300049578 Bacteria 4892
1384 Ga0501042_0018587 3300049578 Bacteria 4814
1385 Ga0501042_0022669 3300049578 Bacteria 4386
1386 Ga0501042_0043026 3300049578 Bacteria 3215
1387 Ga0501042_0043475 3300049578 Bacteria 3199
1388 Ga0501042_0092990 3300049578 Bacteria 2165
1389 Ga0501042_0187496 3300049578 Bacteria 1492
1390 Ga0501042_0199322 3300049578 Bacteria 1443
1391 Ga0501042_0214189 3300049578 Bacteria 1389
1392 Ga0501042_0299149 3300049578 Bacteria 1162
1393 Ga0501042_0383999 3300049578 Bacteria 1017
1394 Ga0501042_0535793 3300049578 Bacteria 851
1395 Ga0501042_0737717 3300049578 Bacteria 716
1396 Ga0501042_0839813 3300049578 Bacteria 669
1397 Ga0501043_0001346 3300049579 Bacteria 21514
1398 Ga0501043_0002017 3300049579 Bacteria 17338
1399 Ga0501043_0032075 3300049579 Bacteria 4130
1400 Ga0501043_0046599 3300049579 Bacteria 3409
1401 Ga0501043_0094825 3300049579 Bacteria 2345
1402 Ga0501043_0099043 3300049579 Bacteria 2291
1403 Ga0501043_0137099 3300049579 Bacteria 1917
1404 Ga0501043_0170739 3300049579 Bacteria 1697
1405 Ga0501043_0211422 3300049579 Bacteria 1503
1406 Ga0501046_0003365 3300049580 Bacteria 14690
1407 Ga0501046_0007245 3300049580 Bacteria 9750
1408 Ga0501046_0018976 3300049580 Bacteria 5708
1409 Ga0501046_0019122 3300049580 Bacteria 5682
1410 Ga0501046_0030397 3300049580 Bacteria 4383
1411 Ga0501046_0095432 3300049580 Bacteria 2284
1412 Ga0501046_0191034 3300049580 Bacteria 1527
1413 Ga0501046_0195163 3300049580 Bacteria 1508
1414 Ga0501046_0340300 3300049580 Bacteria 1090
1415 Ga0501046_0343447 3300049580 Bacteria 1085
1416 Ga0501047_0000555 3300049581 Bacteria 40171
1417 Ga0501047_0007968 3300049581 Bacteria 9989
1418 Ga0501047_0030253 3300049581 Bacteria 5221
1419 Ga0501047_0074626 3300049581 Bacteria 3265
1420 Ga0501047_0188188 3300049581 Bacteria 1929
1421 Ga0501047_0265771 3300049581 Bacteria 1562
1422 Ga0501047_0585936 3300049581 Bacteria 938
1423 Ga0501047_0669936 3300049581 Bacteria 856
1424 Ga0501048_0001118 3300049582 Bacteria 20134
1425 Ga0501048_0002671 3300049582 Bacteria 13612
1426 Ga0501048_0003636 3300049582 Bacteria 11744
1427 Ga0501048_0008878 3300049582 Bacteria 7568
1428 Ga0501048_0009494 3300049582 Bacteria 7303
1429 Ga0501048_0009715 3300049582 Bacteria 7215
1430 Ga0501048_0022562 3300049582 Bacteria 4603
1431 Ga0501048_0030317 3300049582 Bacteria 3913
1432 Ga0501048_0037553 3300049582 Bacteria 3478
1433 Ga0501048_0068642 3300049582 Bacteria 2504
1434 Ga0501048_0076079 3300049582 Bacteria 2369
1435 Ga0501048_0108378 3300049582 Bacteria 1961
1436 Ga0501048_0145740 3300049582 Bacteria 1675
1437 Ga0501048_0442460 3300049582 Bacteria 930
1438 Ga0501048_0639529 3300049582 Bacteria 764
1439 Ga0501048_0678541 3300049582 Bacteria 740
1440 Ga0501067_0000684 3300049583 Bacteria 18236
1441 Ga0501067_0006645 3300049583 Bacteria 6416
1442 Ga0501067_0019647 3300049583 Bacteria 3740
1443 Ga0501067_0063224 3300049583 Bacteria 2049
1444 Ga0501067_0314422 3300049583 Bacteria 872
1445 Ga0501068_0000275 3300049584 Bacteria 25451
1446 Ga0501068_0010266 3300049584 Bacteria 5256
1447 Ga0501068_0016250 3300049584 Bacteria 4289
1448 Ga0501068_0017811 3300049584 Bacteria 4111
1449 Ga0501068_0036154 3300049584 Bacteria 2952
1450 Ga0501068_0036324 3300049584 Bacteria 2945
1451 Ga0501068_0047184 3300049584 Bacteria 2598
1452 Ga0501068_0067042 3300049584 Unclassified 2186
1453 Ga0501068_0092365 3300049584 Bacteria 1868
1454 Ga0501068_0169545 3300049584 Bacteria 1377
1455 Ga0501068_0213945 3300049584 Bacteria 1224
1456 Ga0501068_0241494 3300049584 Bacteria 1150
1457 Ga0501069_0000355 3300049585 Bacteria 20569
1458 Ga0501069_0002263 3300049585 Bacteria 9718
1459 Ga0501069_0005008 3300049585 Bacteria 6872
1460 Ga0501069_0005641 3300049585 Bacteria 6516
1461 Ga0501069_0007569 3300049585 Bacteria 5700
1462 Ga0501069_0018820 3300049585 Bacteria 3729
1463 Ga0501069_0061571 3300049585 Bacteria 2096
1464 Ga0501069_0094058 3300049585 Bacteria 1696
1465 Ga0501069_0109921 3300049585 Bacteria 1569
1466 Ga0501069_0148100 3300049585 Bacteria 1348
1467 Ga0501069_0526655 3300049585 Bacteria 706
1468 Ga0501069_0688097 3300049585 Bacteria 616
1469 Ga0501070_0000880 3300049586 Bacteria 27241
1470 Ga0501070_0002869 3300049586 Bacteria 15012
1471 Ga0501070_0006372 3300049586 Bacteria 10044
1472 Ga0501070_0010528 3300049586 Bacteria 7820
1473 Ga0501070_0021898 3300049586 Bacteria 5355
1474 Ga0501070_0133943 3300049586 Bacteria 2046
1475 Ga0501070_0156236 3300049586 Bacteria 1881
1476 Ga0501070_0202344 3300049586 Bacteria 1630
1477 Ga0501070_0825629 3300049586 Bacteria 727
1478 Ga0501071_0000004 3300049587 Bacteria 79181
1479 Ga0501071_0002369 3300049587 Bacteria 11409
1480 Ga0501071_0003710 3300049587 Bacteria 9587
1481 Ga0501071_0004478 3300049587 Bacteria 8870
1482 Ga0501071_0007586 3300049587 Bacteria 7143
1483 Ga0501071_0008508 3300049587 Bacteria 6787
1484 Ga0501071_0034399 3300049587 Bacteria 3606
1485 Ga0501071_0037022 3300049587 Bacteria 3482
1486 Ga0501071_0037477 3300049587 Bacteria 3462
1487 Ga0501071_0113177 3300049587 Bacteria 2007
1488 Ga0501071_0173535 3300049587 Bacteria 1614
1489 Ga0501071_0190229 3300049587 Bacteria 1539
1490 Ga0501071_0190893 3300049587 Bacteria 1536
1491 Ga0501071_0212284 3300049587 Bacteria 1455
1492 Ga0501071_0296048 3300049587 Unclassified 1226
1493 Ga0501071_0417339 3300049587 Unclassified 1025
1494 Ga0501071_0464570 3300049587 Bacteria 969
1495 Ga0501071_0505019 3300049587 Bacteria 928
1496 Ga0501071_0546950 3300049587 Bacteria 889
1497 Ga0501071_0663627 3300049587 Bacteria 802
1498 Ga0501072_0000318 3300049588 Bacteria 34284
1499 Ga0501072_0002296 3300049588 Bacteria 14314
1500 Ga0501072_0003182 3300049588 Bacteria 12348
1501 Ga0501072_0004251 3300049588 Bacteria 10859
1502 Ga0501072_0015977 3300049588 Bacteria 5755
1503 Ga0501072_0039738 3300049588 Bacteria 3693
1504 Ga0501072_0047089 3300049588 Bacteria 3395
1505 Ga0501072_0050934 3300049588 Bacteria 3260
1506 Ga0501072_0105231 3300049588 Bacteria 2244
1507 Ga0501072_0112130 3300049588 Bacteria 2171
1508 Ga0501072_0143168 3300049588 Bacteria 1906
1509 Ga0501072_0167042 3300049588 Bacteria 1755
1510 Ga0501072_0194470 3300049588 Bacteria 1617
1511 Ga0501072_0325808 3300049588 Unclassified 1221
1512 Ga0501072_0338966 3300049588 Unclassified 1194
1513 Ga0501072_0371472 3300049588 Bacteria 1135
1514 Ga0501072_0395348 3300049588 Bacteria 1096
1515 Ga0501072_0597183 3300049588 Bacteria 870
1516 Ga0501073_0001183 3300049589 Bacteria 19046
1517 Ga0501073_0008042 3300049589 Bacteria 7829
1518 Ga0501073_0022856 3300049589 Bacteria 4497
1519 Ga0501073_0093666 3300049589 Bacteria 2087
1520 Ga0501073_0143919 3300049589 Bacteria 1652
1521 Ga0501073_0179672 3300049589 Bacteria 1464
1522 Ga0501073_0313691 3300049589 Bacteria 1082
1523 Ga0501073_0505562 3300049589 Unclassified 835
1524 Ga0501073_0543202 3300049589 Bacteria 803
1525 Ga0501074_0002199 3300049590 Bacteria 13520
1526 Ga0501074_0002631 3300049590 Bacteria 12571
1527 Ga0501074_0004703 3300049590 Bacteria 9775
1528 Ga0501074_0007545 3300049590 Bacteria 7871
1529 Ga0501074_0023368 3300049590 Bacteria 4495
1530 Ga0501074_0053387 3300049590 Bacteria 2916
1531 Ga0501074_0060292 3300049590 Bacteria 2733
1532 Ga0501074_0067173 3300049590 Bacteria 2579
1533 Ga0501074_0204190 3300049590 Bacteria 1408
1534 Ga0501074_0205970 3300049590 Bacteria 1401
1535 Ga0501074_0221615 3300049590 Bacteria 1347
1536 Ga0501074_0302700 3300049590 Bacteria 1135
1537 Ga0501074_0316297 3300049590 Bacteria 1109
1538 Ga0501074_0410364 3300049590 Bacteria 960
1539 Ga0501075_0001247 3300049591 Bacteria 16517
1540 Ga0501075_0001696 3300049591 Bacteria 14485
1541 Ga0501075_0001838 3300049591 Bacteria 14004
1542 Ga0501075_0005666 3300049591 Bacteria 8549
1543 Ga0501075_0008350 3300049591 Bacteria 7221
1544 Ga0501075_0010101 3300049591 Bacteria 6623
1545 Ga0501075_0012766 3300049591 Bacteria 5979
1546 Ga0501075_0058400 3300049591 Bacteria 2906
1547 Ga0501075_0059705 3300049591 Bacteria 2873
1548 Ga0501075_0069944 3300049591 Bacteria 2653
1549 Ga0501075_0102197 3300049591 Bacteria 2177
1550 Ga0501075_0169017 3300049591 Bacteria 1668
1551 Ga0501075_0188243 3300049591 Bacteria 1574
1552 Ga0501075_0216900 3300049591 Bacteria 1459
1553 Ga0501075_0261720 3300049591 Bacteria 1318
1554 Ga0501075_0285750 3300049591 Bacteria 1257
1555 Ga0501075_0367138 3300049591 Bacteria 1097
1556 Ga0501075_0510564 3300049591 Bacteria 917
1557 Ga0501076_0000462 3300049592 Bacteria 25816
1558 Ga0501076_0002880 3300049592 Bacteria 11915
1559 Ga0501076_0003560 3300049592 Bacteria 10941
1560 Ga0501076_0004637 3300049592 Bacteria 9793
1561 Ga0501076_0008270 3300049592 Bacteria 7622
1562 Ga0501076_0011587 3300049592 Bacteria 6576
1563 Ga0501076_0016402 3300049592 Bacteria 5617
1564 Ga0501076_0018958 3300049592 Bacteria 5250
1565 Ga0501076_0021722 3300049592 Bacteria 4926
1566 Ga0501076_0023760 3300049592 Bacteria 4729
1567 Ga0501076_0065206 3300049592 Bacteria 2904
1568 Ga0501076_0116275 3300049592 Bacteria 2164
1569 Ga0501076_0262317 3300049592 Bacteria 1414
1570 Ga0501076_0372205 3300049592 Bacteria 1174
1571 Ga0501076_0452555 3300049592 Bacteria 1057
1572 Ga0501076_0589998 3300049592 Bacteria 916
1573 Ga0501076_0600643 3300049592 Bacteria 908
1574 Ga0501076_0817477 3300049592 Bacteria 769
1575 Ga0501076_0971750 3300049592 Bacteria 700
1576 Ga0501077_0000711 3300049593 Bacteria 20088
1577 Ga0501077_0003209 3300049593 Bacteria 9851
1578 Ga0501077_0005135 3300049593 Bacteria 7951
1579 Ga0501077_0006304 3300049593 Bacteria 7260
1580 Ga0501077_0007460 3300049593 Bacteria 6746
1581 Ga0501077_0007581 3300049593 Bacteria 6697
1582 Ga0501077_0010863 3300049593 Bacteria 5672
1583 Ga0501077_0031304 3300049593 Bacteria 3384
1584 Ga0501077_0037598 3300049593 Bacteria 3082
1585 Ga0501077_0047025 3300049593 Bacteria 2741
1586 Ga0501077_0103457 3300049593 Bacteria 1804
1587 Ga0501077_0108876 3300049593 Bacteria 1755
1588 Ga0501077_0133121 3300049593 Bacteria 1577
1589 Ga0501077_0153580 3300049593 Bacteria 1461
1590 Ga0501077_0244876 3300049593 Bacteria 1140
1591 Ga0501077_0280439 3300049593 Bacteria 1061
1592 Ga0501079_0000221 3300049741 Bacteria 33871
1593 Ga0501079_0003109 3300049741 Bacteria 12163
1594 Ga0501079_0003554 3300049741 Bacteria 11460
1595 Ga0501079_0003580 3300049741 Bacteria 11424
1596 Ga0501079_0010406 3300049741 Bacteria 7071
1597 Ga0501079_0013392 3300049741 Bacteria 6255
1598 Ga0501079_0013947 3300049741 Bacteria 6129
1599 Ga0501079_0025740 3300049741 Bacteria 4512
1600 Ga0501079_0044109 3300049741 Bacteria 3441
1601 Ga0501079_0060900 3300049741 Bacteria 2911
1602 Ga0501079_0079489 3300049741 Bacteria 2536
1603 Ga0501079_0214827 3300049741 Bacteria 1502
1604 Ga0501079_0222576 3300049741 Bacteria 1474
1605 Ga0501079_0242689 3300049741 Bacteria 1407
1606 Ga0501079_0247289 3300049741 Bacteria 1393
1607 Ga0501079_0322967 3300049741 Bacteria 1208
1608 Ga0501079_0373690 3300049741 Bacteria 1117
1609 Ga0501079_0479773 3300049741 Bacteria 977
1610 Ga0501079_0751289 3300049741 Bacteria 768
1611 Ga0501079_0798126 3300049741 Bacteria 743
1612 Ga0501080_0000858 3300049742 Bacteria 24882
1613 Ga0501080_0018442 3300049742 Bacteria 6459
1614 Ga0501080_0025706 3300049742 Bacteria 5468
1615 Ga0501080_0032915 3300049742 Bacteria 4837
1616 Ga0501080_0050526 3300049742 Bacteria 3869
1617 Ga0501080_0061511 3300049742 Bacteria 3495
1618 Ga0501080_0081704 3300049742 Bacteria 3001
1619 Ga0501080_0082288 3300049742 Bacteria 2990
1620 Ga0501080_0148522 3300049742 Bacteria 2167
1621 Ga0501080_0160622 3300049742 Bacteria 2075
1622 Ga0501080_0205506 3300049742 Bacteria 1806
1623 Ga0501080_0237142 3300049742 Bacteria 1666
1624 Ga0501080_0677566 3300049742 Bacteria 911
1625 Ga0501081_0000040 3300049743 Bacteria 48110
1626 Ga0501081_0000284 3300049743 Bacteria 26831
1627 Ga0501081_0006913 3300049743 Bacteria 7371
1628 Ga0501081_0006985 3300049743 Bacteria 7341
1629 Ga0501081_0007415 3300049743 Bacteria 7117
1630 Ga0501081_0011035 3300049743 Bacteria 5907
1631 Ga0501081_0021399 3300049743 Bacteria 4316
1632 Ga0501081_0031025 3300049743 Bacteria 3621
1633 Ga0501081_0033929 3300049743 Bacteria 3470
1634 Ga0501081_0044984 3300049743 Bacteria 3031
1635 Ga0501081_0059118 3300049743 Bacteria 2653
1636 Ga0501081_0159206 3300049743 Bacteria 1626
1637 Ga0501081_0325559 3300049743 Bacteria 1130
1638 Ga0501083_0001237 3300049744 Bacteria 17325
1639 Ga0501083_0005368 3300049744 Bacteria 9068
1640 Ga0501083_0007908 3300049744 Bacteria 7530
1641 Ga0501083_0010421 3300049744 Bacteria 6541
1642 Ga0501083_0022824 3300049744 Bacteria 4341
1643 Ga0501083_0135574 3300049744 Bacteria 1613
1644 Ga0501083_0290412 3300049744 Bacteria 1063
1645 Ga0501083_0386668 3300049744 Bacteria 910
1646 Ga0501083_0612307 3300049744 Bacteria 708
1647 Ga0501035_0006912 3300049822 Bacteria 10599
1648 Ga0501035_0011080 3300049822 Bacteria 8348
1649 Ga0501035_0014634 3300049822 Bacteria 7243
1650 Ga0501035_0050408 3300049822 Bacteria 3730
1651 Ga0501035_0272371 3300049822 Bacteria 1432
1652 Ga0501035_0322710 3300049822 Bacteria 1297
1653 Ga0501044_0009492 3300049823 Bacteria 10593
1654 Ga0501044_0027578 3300049823 Bacteria 6000
1655 Ga0501044_0039262 3300049823 Bacteria 4939
1656 Ga0501044_0045490 3300049823 Bacteria 4546
1657 Ga0501044_0077024 3300049823 Bacteria 3383
1658 Ga0501044_0136770 3300049823 Bacteria 2441
1659 Ga0501044_0182261 3300049823 Bacteria 2066
1660 Ga0501044_0373669 3300049823 Bacteria 1342
1661 Ga0501044_0634284 3300049823 Bacteria 959
1662 Ga0501045_0000014 3300049824 Bacteria 73464
1663 Ga0501045_0000729 3300049824 Bacteria 20961
1664 Ga0501045_0003686 3300049824 Bacteria 10533
1665 Ga0501045_0007442 3300049824 Bacteria 7605
1666 Ga0501045_0010764 3300049824 Bacteria 6409
1667 Ga0501045_0012129 3300049824 Bacteria 6065
1668 Ga0501045_0022079 3300049824 Bacteria 4554
1669 Ga0501045_0026752 3300049824 Bacteria 4152
1670 Ga0501045_0037937 3300049824 Bacteria 3504
1671 Ga0501045_0074560 3300049824 Bacteria 2498
1672 Ga0501045_0156900 3300049824 Bacteria 1693
1673 Ga0501045_0187670 3300049824 Bacteria 1540
1674 Ga0501045_0262028 3300049824 Bacteria 1287
1675 Ga0501045_0266290 3300049824 Bacteria 1276
1676 Ga0501045_0290785 3300049824 Bacteria 1216
1677 Ga0501045_0522452 3300049824 Bacteria 881
1678 nmdc:mga03n38_35160_c1 3300050490 Bacteria 2144
1679 nmdc:mga00v17_43153_c1 3300050491 Unclassified 2715
1680 nmdc:mga0yw44_142824_c1 3300050492 Bacteria 1556
1681 nmdc:mga0yw44_150115_c1 3300050492 Bacteria 1519
1682 nmdc:mga0yw44_242426_c1 3300050492 Unclassified 1198
1683 nmdc:mga0yw44_318244_c1 3300050492 Bacteria 1044
1684 nmdc:mga0yw44_32873_c1 3300050492 Bacteria 3026
1685 nmdc:mga0yw44_660017_c1 3300050492 Bacteria 711
1686 nmdc:mga0yw44_95046_c1 3300050492 Bacteria 1890
1687 nmdc:mga0k408_239435_c1 3300050493 Bacteria 1083
1688 nmdc:mga06z11_150550_c1 3300050494 Bacteria 1322
1689 nmdc:mga06z11_197371_c1 3300050494 Bacteria 1167
1690 nmdc:mga06z11_267518_c1 3300050494 Bacteria 1010
1691 nmdc:mga07m45_105007_c2 3300050496 Bacteria 1048
1692 nmdc:mga05p37_132777_c1 3300050507 Bacteria 3054
1693 nmdc:mga05p37_144811_c1 3300050507 Bacteria 2910
1694 nmdc:mga05p37_163951_c1 3300050507 Bacteria 2713
1695 nmdc:mga05p37_190449_c1 3300050507 Bacteria 2491
1696 nmdc:mga05p37_223732_c1 3300050507 Bacteria 2270
1697 nmdc:mga05p37_342264_c1 3300050507 Bacteria 1763
1698 nmdc:mga05p37_3867_c1 3300050507 Bacteria 17516
1699 nmdc:mga05p37_563914_c1 3300050507 Bacteria 1293
1700 nmdc:mga05p37_6099_c1 3300050507 Bacteria 14195
1701 nmdc:mga05p37_612509_c1 3300050507 Bacteria 1227
1702 nmdc:mga05p37_692461_c1 3300050507 Bacteria 1134
1703 nmdc:mga05p37_8824_c1 3300050507 Bacteria 7753
1704 nmdc:mga05p37_93965_c1 3300050507 Bacteria 3695
1705 nmdc:mga09592_129860_c1 3300050508 Bacteria 2167
1706 nmdc:mga09592_14787_c1 3300050508 Bacteria 6370
1707 nmdc:mga09592_402205_c1 3300050508 Bacteria 1184
1708 nmdc:mga09592_450123_c1 3300050508 Bacteria 1111
1709 nmdc:mga09592_591478_c1 3300050508 Bacteria 951
1710 nmdc:mga0qj67_309566_c1 3300050509 Bacteria 1279
1711 nmdc:mga0qj67_31790_c1 3300050509 Bacteria 4113
1712 nmdc:mga06r32_22566_c1 3300050510 Bacteria 5820
1713 nmdc:mga06r32_88867_c1 3300050510 Bacteria 3016
1714 nmdc:mga08y16_10062_c1 3300050511 Bacteria 9926
1715 nmdc:mga08y16_189918_c1 3300050511 Bacteria 2131
1716 nmdc:mga08y16_21198_c1 3300050511 Bacteria 6862
1717 nmdc:mga08y16_89822_c1 3300050511 Bacteria 3202
1718 nmdc:mga0n895_1234683_c1 3300050512 Bacteria 720
1719 nmdc:mga0n895_483585_c1 3300050512 Bacteria 1248
1720 nmdc:mga0n895_50752_c1 3300050512 Bacteria 4068
1721 nmdc:mga0n895_805921_c1 3300050512 Bacteria 929
1722 nmdc:mga0n895_96983_c1 3300050512 Bacteria 2953
1723 nmdc:mga0rr50_403748_c1 3300050513 Bacteria 1154
1724 nmdc:mga0rr50_47113_c1 3300050513 Bacteria 3178
1725 nmdc:mga0rr50_773715_c1 3300050513 Unclassified 819
1726 nmdc:mga0rr50_923446_c1 3300050513 Unclassified 744
1727 nmdc:mga08x19_47179_c1 3300050514 Bacteria 2757
1728 nmdc:mga08x19_779872_c1 3300050514 Bacteria 679
1729 nmdc:mga0a205_11415_c1 3300050515 Bacteria 8177
1730 nmdc:mga0a205_132430_c1 3300050515 Bacteria 2393
1731 nmdc:mga0a205_297344_c1 3300050515 Unclassified 1488
1732 nmdc:mga0a205_365985_c1 3300050515 Bacteria 1308
1733 nmdc:mga0a205_39860_c1 3300050515 Bacteria 4521
1734 nmdc:mga0a205_529032_c1 3300050515 Bacteria 1035
1735 nmdc:mga0a205_813799_c1 3300050515 Bacteria 782
1736 Ga0495601_0089045 3300053077 Bacteria 1985
1737 Ga0495601_0156411 3300053077 Bacteria 1488
1738 Ga0495612_0017665 3300053078 Bacteria 2856
1739 Ga0495612_0140873 3300053078 Bacteria 1046
1740 Ga0495612_0263276 3300053078 Bacteria 768
1741 Ga0495612_0327636 3300053078 Bacteria 689
1742 Ga0495595_0050103 3300053084 Bacteria 1933
1743 Ga0495595_0207317 3300053084 Bacteria 976
1744 Ga0495619_0002878 3300053085 Bacteria 11188
1745 Ga0495619_0004757 3300053085 Bacteria 8632
1746 Ga0501084_0000228 3300054114 Bacteria 42475
1747 Ga0501084_0003048 3300054114 Bacteria 13579
1748 Ga0501084_0008276 3300054114 Bacteria 8580
1749 Ga0501084_0010081 3300054114 Bacteria 7807
1750 Ga0501084_0011771 3300054114 Bacteria 7244
1751 Ga0501084_0012092 3300054114 Bacteria 7147
1752 Ga0501084_0012809 3300054114 Bacteria 6947
1753 Ga0501084_0015324 3300054114 Bacteria 6356
1754 Ga0501084_0026862 3300054114 Bacteria 4809
1755 Ga0501084_0034559 3300054114 Bacteria 4227
1756 Ga0501084_0037739 3300054114 Bacteria 4037
1757 Ga0501084_0047251 3300054114 Bacteria 3605
1758 Ga0501084_0069232 3300054114 Bacteria 2954
1759 Ga0501084_0097569 3300054114 Bacteria 2467
1760 Ga0501084_0100063 3300054114 Bacteria 2434
1761 Ga0501084_0110726 3300054114 Bacteria 2307
1762 Ga0501084_0135563 3300054114 Bacteria 2073
1763 Ga0501084_0135770 3300054114 Bacteria 2071
1764 Ga0501084_0166886 3300054114 Bacteria 1858
1765 Ga0501084_0256455 3300054114 Bacteria 1476
1766 Ga0501084_0356597 3300054114 Bacteria 1235
1767 Ga0501084_0384261 3300054114 Bacteria 1186
1768 Ga0501084_0661801 3300054114 Bacteria 881
1769 Ga0501084_0680670 3300054114 Bacteria 868
1770 Ga0501084_0699818 3300054114 Bacteria 854
1771 Ga0590074_020698 3300059423 Bacteria 1132
1772 Ga0590075_003752 3300059424 Bacteria 3604
1773 Ga0590077_020412 3300059426 Bacteria 1407
1774 Ga0501082_0000313 3300060353 Bacteria 43217
1775 Ga0501082_0001301 3300060353 Bacteria 21897
1776 Ga0501082_0003297 3300060353 Bacteria 14087
1777 Ga0501082_0007105 3300060353 Bacteria 9659
1778 Ga0501082_0021793 3300060353 Bacteria 5524
1779 Ga0501082_0026005 3300060353 Bacteria 5045
1780 Ga0501082_0125037 3300060353 Bacteria 2230
1781 Ga0501082_0172874 3300060353 Bacteria 1878
1782 Ga0501082_0272276 3300060353 Bacteria 1474
1783 Ga0501082_0333018 3300060353 Bacteria 1323
1784 Ga0501082_0367752 3300060353 Bacteria 1254
1785 Ga0501082_0439623 3300060353 Bacteria 1139
1786 Ga0501082_0647740 3300060353 Bacteria 924
1787 Ga0501082_0701678 3300060353 Bacteria 886
1788 Ga0530510_0000233 3300061734 Bacteria 34858
1789 Ga0530510_0002740 3300061734 Bacteria 12110
1790 Ga0530510_0003037 3300061734 Bacteria 11528
1791 Ga0530510_0007830 3300061734 Bacteria 7450
1792 Ga0530510_0008483 3300061734 Bacteria 7164
1793 Ga0530510_0012266 3300061734 Bacteria 6015
1794 Ga0530510_0012335 3300061734 Bacteria 6002
1795 Ga0530510_0025521 3300061734 Bacteria 4226
1796 Ga0530510_0045478 3300061734 Bacteria 3171
1797 Ga0530510_0048189 3300061734 Bacteria 3079
1798 Ga0530510_0062708 3300061734 Bacteria 2691
1799 Ga0530510_0067100 3300061734 Bacteria 2602
1800 Ga0530510_0087351 3300061734 Bacteria 2272
1801 Ga0530510_0171518 3300061734 Bacteria 1607
1802 Ga0530510_0233524 3300061734 Bacteria 1368
1803 Ga0530510_0258166 3300061734 Bacteria 1299
1804 Ga0530510_0263652 3300061734 Bacteria 1285
1805 Ga0530510_0358695 3300061734 Bacteria 1095
1806 Ga0530510_0458181 3300061734 Bacteria 964
1807 Ga0530510_0549338 3300061734 Bacteria 877
1808 Ga0530510_0626056 3300061734 Unclassified 819

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046794 Ga0495589_0139710 Ga0495589_0139710_393_995 178
2 3300050513 nmdc:mga0rr50_923446_c1 nmdc:mga0rr50_923446_c1_76_711 180
3 3300005614 Ga0068856_100846384 Ga0068856_1008463842 182
4 3300006847 Ga0075431_100019830 Ga0075431_1000198303 182
5 3300006871 Ga0075434_100091009 Ga0075434_1000910093 182
6 3300009147 Ga0114129_10013910 Ga0114129_100139106 182
7 3300013307 Ga0157372_11302351 Ga0157372_113023512 182
8 3300014497 Ga0182008_10217373 Ga0182008_102173732 182
9 3300025898 Ga0207692_10407512 Ga0207692_104075122 182
10 3300037312 Ga0395899_0271107 Ga0395899_0271107_166_714 182
11 3300037418 Ga0395900_0021094 Ga0395900_0021094_2089_2637 182
12 3300037466 Ga0395898_0025550 Ga0395898_0025550_2980_3528 182
13 3300037471 Ga0395905_0051935 Ga0395905_0051935_1008_1556 182
14 3300038443 Ga0395901_0251360 Ga0395901_0251360_882_1430 182
15 3300048904 Ga0496101_0136430 Ga0496101_0136430_452_1000 182
16 3300048905 Ga0496102_0027537 Ga0496102_0027537_1756_2307 182
17 3300048905 Ga0496102_0032044 Ga0496102_0032044_3905_4453 182
18 3300048906 Ga0496103_0005695 Ga0496103_0005695_2986_3537 182
19 3300048906 Ga0496103_0096720 Ga0496103_0096720_489_1037 182
20 3300048907 Ga0496104_0060408 Ga0496104_0060408_911_1459 182
21 3300048908 Ga0496105_0037041 Ga0496105_0037041_3129_3677 182
22 3300048909 Ga0496106_0080908 Ga0496106_0080908_1174_1725 182
23 3300048909 Ga0496106_0357352 Ga0496106_0357352_568_1116 182
24 3300048911 Ga0496108_0035869 Ga0496108_0035869_595_1143 182
25 3300048912 Ga0496109_0026915 Ga0496109_0026915_2512_3063 182
26 3300048913 Ga0496110_0033236 Ga0496110_0033236_862_1410 182
27 3300048913 Ga0496110_0045999 Ga0496110_0045999_2054_2605 182
28 3300048914 Ga0496111_0023541 Ga0496111_0023541_961_1509 182
29 3300048915 Ga0496112_0163712 Ga0496112_0163712_1336_1884 182
30 3300048915 Ga0496112_0205946 Ga0496112_0205946_956_1507 182
31 3300048917 Ga0496114_0029394 Ga0496114_0029394_1178_1726 182
32 3300050494 nmdc:mga06z11_197371_c1 nmdc:mga06z11_197371_c1_54_605 182
33 3300050507 nmdc:mga05p37_223732_c1 nmdc:mga05p37_223732_c1_809_1357 182
34 3300050507 nmdc:mga05p37_3867_c1 nmdc:mga05p37_3867_c1_10285_10836 182
35 3300050510 nmdc:mga06r32_88867_c1 nmdc:mga06r32_88867_c1_2083_2634 182
36 3300050512 nmdc:mga0n895_50752_c1 nmdc:mga0n895_50752_c1_140_691 182
37 3300050513 nmdc:mga0rr50_47113_c1 nmdc:mga0rr50_47113_c1_2379_2930 182
38 3300050514 nmdc:mga08x19_47179_c1 nmdc:mga08x19_47179_c1_481_1032 182
39 3300050515 nmdc:mga0a205_11415_c1 nmdc:mga0a205_11415_c1_4565_5116 182
40 3300005834 Ga0068851_10596996 Ga0068851_105969961 184
41 3300013307 Ga0157372_10482658 Ga0157372_104826583 184
42 3300014745 Ga0157377_10406624 Ga0157377_104066242 184
43 3300049591 Ga0501075_0169017 Ga0501075_0169017_874_1443 184
44 3300028800 Ga0265338_10337294 Ga0265338_103372942 185
45 3300031247 Ga0265340_10058319 Ga0265340_100583192 185
46 3300049568 Ga0501031_0002862 Ga0501031_0002862_9902_10459 185
47 3300049570 Ga0501033_0058879 Ga0501033_0058879_616_1173 185
48 3300049572 Ga0501036_0016728 Ga0501036_0016728_3324_3881 185
49 3300049573 Ga0501037_0080781 Ga0501037_0080781_1769_2326 185
50 3300049574 Ga0501038_0011360 Ga0501038_0011360_5737_6294 185
51 3300049575 Ga0501039_0009674 Ga0501039_0009674_803_1360 185
52 3300049576 Ga0501040_0003958 Ga0501040_0003958_3488_4045 185
53 3300049576 Ga0501040_0309569 Ga0501040_0309569_173_745 185
54 3300049578 Ga0501042_0043475 Ga0501042_0043475_1142_1699 185
55 3300049579 Ga0501043_0170739 Ga0501043_0170739_68_625 185
56 3300049580 Ga0501046_0019122 Ga0501046_0019122_4773_5330 185
57 3300049582 Ga0501048_0009715 Ga0501048_0009715_5993_6550 185
58 3300049585 Ga0501069_0094058 Ga0501069_0094058_112_669 185
59 3300049587 Ga0501071_0004478 Ga0501071_0004478_3625_4182 185
60 3300049588 Ga0501072_0000318 Ga0501072_0000318_5993_6550 185
61 3300049589 Ga0501073_0543202 Ga0501073_0543202_17_574 185
62 3300049590 Ga0501074_0002199 Ga0501074_0002199_1755_2312 185
63 3300049590 Ga0501074_0053387 Ga0501074_0053387_1333_1905 185
64 3300049591 Ga0501075_0005666 Ga0501075_0005666_6933_7490 185
65 3300049592 Ga0501076_0021722 Ga0501076_0021722_3324_3881 185
66 3300049593 Ga0501077_0006304 Ga0501077_0006304_6201_6758 185
67 3300049741 Ga0501079_0003554 Ga0501079_0003554_4635_5192 185
68 3300049742 Ga0501080_0025706 Ga0501080_0025706_4822_5379 185
69 3300049743 Ga0501081_0021399 Ga0501081_0021399_231_803 185
70 3300049823 Ga0501044_0373669 Ga0501044_0373669_87_644 185
71 3300049824 Ga0501045_0074560 Ga0501045_0074560_1276_1833 185
72 3300050512 nmdc:mga0n895_96983_c1 nmdc:mga0n895_96983_c1_553_1113 185
73 3300050515 nmdc:mga0a205_365985_c1 nmdc:mga0a205_365985_c1_50_610 185
74 3300054114 Ga0501084_0012092 Ga0501084_0012092_6326_6883 185
75 3300061734 Ga0530510_0045478 Ga0530510_0045478_1732_2289 185
76 3300005327 Ga0070658_10308321 Ga0070658_103083212 186
77 3300005329 Ga0070683_100120725 Ga0070683_1001207252 186
78 3300005435 Ga0070714_100368773 Ga0070714_1003687732 186
79 3300005436 Ga0070713_101563380 Ga0070713_1015633801 186
80 3300005439 Ga0070711_100057522 Ga0070711_1000575222 186
81 3300005439 Ga0070711_100085617 Ga0070711_1000856172 186
82 3300005456 Ga0070678_100630451 Ga0070678_1006304512 186
83 3300005457 Ga0070662_100449040 Ga0070662_1004490402 186
84 3300005458 Ga0070681_10073162 Ga0070681_100731622 186
85 3300005471 Ga0070698_100437505 Ga0070698_1004375051 186
86 3300005530 Ga0070679_100037238 Ga0070679_1000372384 186
87 3300005535 Ga0070684_100025817 Ga0070684_1000258174 186
88 3300005563 Ga0068855_100071334 Ga0068855_1000713342 186
89 3300005578 Ga0068854_100916797 Ga0068854_1009167972 186
90 3300005614 Ga0068856_100957705 Ga0068856_1009577052 186
91 3300005937 Ga0081455_10018021 Ga0081455_100180213 186
92 3300006028 Ga0070717_10007911 Ga0070717_100079115 186
93 3300006038 Ga0075365_10024308 Ga0075365_100243082 186
94 3300006175 Ga0070712_100213720 Ga0070712_1002137202 186
95 3300006175 Ga0070712_100826663 Ga0070712_1008266632 186
96 3300006358 Ga0068871_100353738 Ga0068871_1003537382 186
97 3300009093 Ga0105240_10479184 Ga0105240_104791842 186
98 3300009098 Ga0105245_10248883 Ga0105245_102488832 186
99 3300009545 Ga0105237_11304743 Ga0105237_113047432 186
100 3300011119 Ga0105246_10711687 Ga0105246_107116872 186
101 3300013100 Ga0157373_10338621 Ga0157373_103386212 186
102 3300013105 Ga0157369_10002394 Ga0157369_1000239415 186
103 3300013105 Ga0157369_10003170 Ga0157369_100031709 186
104 3300013297 Ga0157378_10125043 Ga0157378_101250432 186
105 3300013308 Ga0157375_10207352 Ga0157375_102073521 186
106 3300014497 Ga0182008_10034854 Ga0182008_100348542 186
107 3300014969 Ga0157376_10263362 Ga0157376_102633622 186
108 3300020069 Ga0197907_11172580 Ga0197907_111725802 186
109 3300025916 Ga0207663_10059476 Ga0207663_100594762 186
110 3300025921 Ga0207652_10066236 Ga0207652_100662364 186
111 3300025929 Ga0207664_10167459 Ga0207664_101674591 186
112 3300025934 Ga0207686_10732309 Ga0207686_107323092 186
113 3300025937 Ga0207669_10313897 Ga0207669_103138972 186
114 3300025939 Ga0207665_10065771 Ga0207665_100657712 186
115 3300025939 Ga0207665_10893819 Ga0207665_108938191 186
116 3300025949 Ga0207667_10030954 Ga0207667_100309544 186
117 3300025949 Ga0207667_10586555 Ga0207667_105865552 186
118 3300026023 Ga0207677_10567767 Ga0207677_105677671 186
119 3300026121 Ga0207683_10537118 Ga0207683_105371182 186
120 3300028577 Ga0265318_10140149 Ga0265318_101401492 186
121 3300035083 Ga0373926_0063106 Ga0373926_0063106_317_877 186
122 3300035116 Ga0373945_0307099 Ga0373945_0307099_41_601 186
123 3300035117 Ga0373953_0171233 Ga0373953_0171233_248_808 186
124 3300035170 Ga0373943_0024799 Ga0373943_0024799_41_601 186
125 3300035172 Ga0373955_0087801 Ga0373955_0087801_646_1206 186
126 3300035410 Ga0373924_0048589 Ga0373924_0048589_15_575 186
127 3300035695 Ga0373927_0416620 Ga0373927_0416620_174_734 186
128 3300035725 Ga0373947_0015720 Ga0373947_0015720_1749_2312 186
129 3300035725 Ga0373947_0081432 Ga0373947_0081432_810_1370 186
130 3300036401 Ga0373937_0059832 Ga0373937_0059832_98_658 186
131 3300037068 Ga0373925_0096348 Ga0373925_0096348_1179_1739 186
132 3300037418 Ga0395900_0651534 Ga0395900_0651534_375_935 186
133 3300037471 Ga0395905_0194824 Ga0395905_0194824_78_641 186
134 3300038443 Ga0395901_0199163 Ga0395901_0199163_111_674 186
135 3300044694 Ga0466963_0137444 Ga0466963_0137444_179_739 186
136 3300044694 Ga0466963_0417671 Ga0466963_0417671_217_777 186
137 3300044735 Ga0466968_0228453 Ga0466968_0228453_45_605 186
138 3300044842 Ga0466957_0072999 Ga0466957_0072999_664_1224 186
139 3300044842 Ga0466957_0150353 Ga0466957_0150353_907_1467 186
140 3300045836 Ga0466958_0079432 Ga0466958_0079432_1251_1811 186
141 3300045976 Ga0466967_0019897 Ga0466967_0019897_4499_5059 186
142 3300045976 Ga0466967_0039574 Ga0466967_0039574_330_890 186
143 3300045976 Ga0466967_0089803 Ga0466967_0089803_899_1459 186
144 3300045976 Ga0466967_0098543 Ga0466967_0098543_461_1021 186
145 3300045976 Ga0466967_0345485 Ga0466967_0345485_320_880 186
146 3300045976 Ga0466967_1028402 Ga0466967_1028402_128_688 186
147 3300046454 Ga0495592_0012708 Ga0495592_0012708_3191_3751 186
148 3300046459 Ga0495629_0007457 Ga0495629_0007457_1836_2399 186
149 3300046461 Ga0495641_0104167 Ga0495641_0104167_298_861 186
150 3300046472 Ga0495580_0095413 Ga0495580_0095413_160_720 186
151 3300046473 Ga0495582_0043604 Ga0495582_0043604_1068_1631 186
152 3300046473 Ga0495582_0184982 Ga0495582_0184982_341_904 186
153 3300046473 Ga0495582_0246860 Ga0495582_0246860_285_845 186
154 3300046477 Ga0495664_0113377 Ga0495664_0113377_626_1186 186
155 3300046514 Ga0495618_0352738 Ga0495618_0352738_73_633 186
156 3300046516 Ga0495628_0028880 Ga0495628_0028880_1699_2259 186
157 3300046529 Ga0495652_0041211 Ga0495652_0041211_1522_2082 186
158 3300046535 Ga0495586_0211600 Ga0495586_0211600_329_892 186
159 3300046536 Ga0495587_0011842 Ga0495587_0011842_2578_3138 186
160 3300046543 Ga0495645_0094798 Ga0495645_0094798_1510_2070 186
161 3300046642 Ga0495634_0023607 Ga0495634_0023607_2445_3008 186
162 3300046642 Ga0495634_0120128 Ga0495634_0120128_275_838 186
163 3300046678 Ga0495599_0430941 Ga0495599_0430941_127_687 186
164 3300046679 Ga0495623_0180069 Ga0495623_0180069_122_682 186
165 3300046680 Ga0495646_0311118 Ga0495646_0311118_111_671 186
166 3300046681 Ga0495647_0001940 Ga0495647_0001940_3718_4281 186
167 3300046681 Ga0495647_0045113 Ga0495647_0045113_281_841 186
168 3300046681 Ga0495647_0192159 Ga0495647_0192159_51_611 186
169 3300046683 Ga0495658_0027415 Ga0495658_0027415_2431_2991 186
170 3300046683 Ga0495658_0056870 Ga0495658_0056870_388_951 186
171 3300046689 Ga0495613_0105827 Ga0495613_0105827_405_968 186
172 3300046690 Ga0495624_0086082 Ga0495624_0086082_236_796 186
173 3300047315 Ga0495581_0340826 Ga0495581_0340826_201_764 186
174 3300047317 Ga0495604_0015169 Ga0495604_0015169_1623_2183 186
175 3300047319 Ga0495674_0058362 Ga0495674_0058362_2475_3035 186
176 3300047321 Ga0495676_0045165 Ga0495676_0045165_2698_3258 186
177 3300047321 Ga0495676_0051848 Ga0495676_0051848_2067_2630 186
178 3300047321 Ga0495676_0129514 Ga0495676_0129514_357_917 186
179 3300047673 Ga0495593_0090592 Ga0495593_0090592_86_646 186
180 3300047673 Ga0495593_0225909 Ga0495593_0225909_135_698 186
181 3300048088 Ga0495602_0091376 Ga0495602_0091376_1712_2272 186
182 3300048903 Ga0496100_0064418 Ga0496100_0064418_1129_1689 186
183 3300048904 Ga0496101_0016050 Ga0496101_0016050_2689_3249 186
184 3300048905 Ga0496102_0028906 Ga0496102_0028906_4147_4707 186
185 3300048907 Ga0496104_0085444 Ga0496104_0085444_518_1078 186
186 3300048907 Ga0496104_0136643 Ga0496104_0136643_924_1487 186
187 3300048907 Ga0496104_0641981 Ga0496104_0641981_229_789 186
188 3300048908 Ga0496105_0002629 Ga0496105_0002629_3545_4105 186
189 3300048908 Ga0496105_0229369 Ga0496105_0229369_693_1256 186
190 3300048909 Ga0496106_0046554 Ga0496106_0046554_2590_3150 186
191 3300048909 Ga0496106_0083679 Ga0496106_0083679_1185_1748 186
192 3300048910 Ga0496107_0007782 Ga0496107_0007782_3990_4550 186
193 3300048911 Ga0496108_0002961 Ga0496108_0002961_9694_10254 186
194 3300048911 Ga0496108_0012918 Ga0496108_0012918_2666_3229 186
195 3300048912 Ga0496109_0002273 Ga0496109_0002273_9968_10528 186
196 3300048912 Ga0496109_0147382 Ga0496109_0147382_1502_2065 186
197 3300048912 Ga0496109_0459310 Ga0496109_0459310_624_1184 186
198 3300048912 Ga0496109_0736219 Ga0496109_0736219_202_762 186
199 3300048913 Ga0496110_0020062 Ga0496110_0020062_2968_3528 186
200 3300048913 Ga0496110_0148827 Ga0496110_0148827_703_1266 186
201 3300048914 Ga0496111_0018266 Ga0496111_0018266_1837_2397 186
202 3300048914 Ga0496111_0073818 Ga0496111_0073818_574_1137 186
203 3300048915 Ga0496112_0006274 Ga0496112_0006274_9764_10324 186
204 3300048915 Ga0496112_0012134 Ga0496112_0012134_2012_2572 186
205 3300048915 Ga0496112_0052362 Ga0496112_0052362_3212_3772 186
206 3300048916 Ga0496113_0043795 Ga0496113_0043795_303_863 186
207 3300048917 Ga0496114_0001536 Ga0496114_0001536_14242_14802 186
208 3300048917 Ga0496114_0219351 Ga0496114_0219351_1082_1645 186
209 3300048917 Ga0496114_0403523 Ga0496114_0403523_40_600 186
210 3300048918 Ga0496115_0002513 Ga0496115_0002513_4890_5450 186
211 3300048918 Ga0496115_0246353 Ga0496115_0246353_323_883 186
212 3300049576 Ga0501040_0027339 Ga0501040_0027339_1658_2221 186
213 3300049578 Ga0501042_0187496 Ga0501042_0187496_416_979 186
214 3300049582 Ga0501048_0145740 Ga0501048_0145740_335_898 186
215 3300049590 Ga0501074_0205970 Ga0501074_0205970_167_727 186
216 3300049591 Ga0501075_0188243 Ga0501075_0188243_919_1482 186
217 3300049741 Ga0501079_0373690 Ga0501079_0373690_359_922 186
218 3300049742 Ga0501080_0677566 Ga0501080_0677566_32_592 186
219 3300049743 Ga0501081_0059118 Ga0501081_0059118_894_1457 186
220 3300049824 Ga0501045_0026752 Ga0501045_0026752_1390_1953 186
221 3300050492 nmdc:mga0yw44_142824_c1 nmdc:mga0yw44_142824_c1_844_1407 186
222 3300050494 nmdc:mga06z11_267518_c1 nmdc:mga06z11_267518_c1_12_575 186
223 3300050507 nmdc:mga05p37_132777_c1 nmdc:mga05p37_132777_c1_1415_1975 186
224 3300050512 nmdc:mga0n895_805921_c1 nmdc:mga0n895_805921_c1_246_812 186
225 3300053077 Ga0495601_0156411 Ga0495601_0156411_232_792 186
226 3300053078 Ga0495612_0263276 Ga0495612_0263276_123_683 186
227 3300054114 Ga0501084_0110726 Ga0501084_0110726_1303_1866 186
228 3300061734 Ga0530510_0258166 Ga0530510_0258166_594_1154 186
229 3300005367 Ga0070667_100003011 Ga0070667_10000301114 187
230 3300005535 Ga0070684_100229000 Ga0070684_1002290002 187
231 3300005842 Ga0068858_100345761 Ga0068858_1003457611 187
232 3300005985 Ga0081539_10003477 Ga0081539_1000347724 187
233 3300006051 Ga0075364_10556400 Ga0075364_105564002 187
234 3300009148 Ga0105243_10171898 Ga0105243_101718982 187
235 3300009177 Ga0105248_10214872 Ga0105248_102148722 187
236 3300009553 Ga0105249_10543357 Ga0105249_105433572 187
237 3300010375 Ga0105239_11872141 Ga0105239_118721411 187
238 3300012515 Ga0157338_1008147 Ga0157338_10081472 187
239 3300013104 Ga0157370_10016374 Ga0157370_100163747 187
240 3300013105 Ga0157369_10267171 Ga0157369_102671712 187
241 3300013306 Ga0163162_10842564 Ga0163162_108425642 187
242 3300013308 Ga0157375_10963622 Ga0157375_109636221 187
243 3300020069 Ga0197907_10313724 Ga0197907_103137241 187
244 3300025901 Ga0207688_10089444 Ga0207688_100894442 187
245 3300025986 Ga0207658_10004308 Ga0207658_100043086 187
246 3300026078 Ga0207702_10788869 Ga0207702_107888692 187
247 3300028563 Ga0265319_1021462 Ga0265319_10214622 187
248 3300028573 Ga0265334_10005832 Ga0265334_100058323 187
249 3300028577 Ga0265318_10016712 Ga0265318_100167122 187
250 3300028577 Ga0265318_10212242 Ga0265318_102122422 187
251 3300028653 Ga0265323_10030176 Ga0265323_100301762 187
252 3300028654 Ga0265322_10003425 Ga0265322_100034252 187
253 3300028666 Ga0265336_10046234 Ga0265336_100462342 187
254 3300028800 Ga0265338_10008039 Ga0265338_100080397 187
255 3300028800 Ga0265338_10138014 Ga0265338_101380142 187
256 3300031235 Ga0265330_10035402 Ga0265330_100354022 187
257 3300031240 Ga0265320_10242363 Ga0265320_102423631 187
258 3300031241 Ga0265325_10008607 Ga0265325_100086072 187
259 3300031242 Ga0265329_10009734 Ga0265329_100097342 187
260 3300031247 Ga0265340_10010024 Ga0265340_100100242 187
261 3300031247 Ga0265340_10055518 Ga0265340_100555182 187
262 3300031249 Ga0265339_10127012 Ga0265339_101270122 187
263 3300031251 Ga0265327_10032463 Ga0265327_100324633 187
264 3300031344 Ga0265316_10009104 Ga0265316_100091044 187
265 3300031595 Ga0265313_10014492 Ga0265313_100144923 187
266 3300031711 Ga0265314_10024770 Ga0265314_100247704 187
267 3300031712 Ga0265342_10022224 Ga0265342_100222242 187
268 3300031712 Ga0265342_10246270 Ga0265342_102462702 187
269 3300035089 Ga0373944_0128109 Ga0373944_0128109_302_865 187
270 3300035113 Ga0373936_0259098 Ga0373936_0259098_127_690 187
271 3300035170 Ga0373943_0002380 Ga0373943_0002380_1550_2113 187
272 3300035692 Ga0373935_0545454 Ga0373935_0545454_167_730 187
273 3300035695 Ga0373927_0216590 Ga0373927_0216590_444_1007 187
274 3300035725 Ga0373947_0016356 Ga0373947_0016356_2511_3074 187
275 3300036401 Ga0373937_0045512 Ga0373937_0045512_119_682 187
276 3300037068 Ga0373925_0010452 Ga0373925_0010452_1376_1939 187
277 3300037418 Ga0395900_0105641 Ga0395900_0105641_1849_2412 187
278 3300037466 Ga0395898_0328552 Ga0395898_0328552_508_1071 187
279 3300038443 Ga0395901_0065579 Ga0395901_0065579_1925_2488 187
280 3300039450 Ga0436363_0840640 Ga0436363_0840640_36_599 187
281 3300044694 Ga0466963_0038616 Ga0466963_0038616_2219_2782 187
282 3300044694 Ga0466963_0352098 Ga0466963_0352098_12_575 187
283 3300045976 Ga0466967_0012620 Ga0466967_0012620_3198_3761 187
284 3300046462 Ga0495651_0032871 Ga0495651_0032871_3447_4010 187
285 3300046463 Ga0495653_0026252 Ga0495653_0026252_116_679 187
286 3300046473 Ga0495582_0027743 Ga0495582_0027743_1359_1922 187
287 3300046491 Ga0495584_0240925 Ga0495584_0240925_285_848 187
288 3300046511 Ga0495608_0066715 Ga0495608_0066715_1480_2043 187
289 3300046516 Ga0495628_0204537 Ga0495628_0204537_513_1076 187
290 3300046517 Ga0495630_0070277 Ga0495630_0070277_1193_1756 187
291 3300046518 Ga0495631_0133649 Ga0495631_0133649_207_770 187
292 3300046529 Ga0495652_0049614 Ga0495652_0049614_163_726 187
293 3300046533 Ga0495640_0153073 Ga0495640_0153073_175_738 187
294 3300046535 Ga0495586_0603010 Ga0495586_0603010_22_588 187
295 3300046536 Ga0495587_0007388 Ga0495587_0007388_259_822 187
296 3300046543 Ga0495645_0031449 Ga0495645_0031449_1209_1772 187
297 3300046559 Ga0495667_0116073 Ga0495667_0116073_1070_1633 187
298 3300046675 Ga0495657_0021681 Ga0495657_0021681_216_779 187
299 3300046680 Ga0495646_0035173 Ga0495646_0035173_454_1017 187
300 3300046683 Ga0495658_0208448 Ga0495658_0208448_371_934 187
301 3300046809 Ga0495600_0035965 Ga0495600_0035965_25_588 187
302 3300047317 Ga0495604_0018709 Ga0495604_0018709_4585_5148 187
303 3300047321 Ga0495676_0479392 Ga0495676_0479392_25_588 187
304 3300047322 Ga0495680_0003365 Ga0495680_0003365_8960_9523 187
305 3300047444 Ga0495675_0000878 Ga0495675_0000878_8839_9402 187
306 3300048089 Ga0495614_0324823 Ga0495614_0324823_89_652 187
307 3300048903 Ga0496100_0032856 Ga0496100_0032856_1948_2520 187
308 3300048904 Ga0496101_0054090 Ga0496101_0054090_809_1381 187
309 3300048904 Ga0496101_0283558 Ga0496101_0283558_159_722 187
310 3300048905 Ga0496102_0250547 Ga0496102_0250547_120_698 187
311 3300048905 Ga0496102_0582884 Ga0496102_0582884_43_615 187
312 3300048908 Ga0496105_0038309 Ga0496105_0038309_2087_2659 187
313 3300048908 Ga0496105_0349621 Ga0496105_0349621_42_605 187
314 3300048909 Ga0496106_0150529 Ga0496106_0150529_1124_1696 187
315 3300048910 Ga0496107_0034717 Ga0496107_0034717_2032_2604 187
316 3300048911 Ga0496108_0101023 Ga0496108_0101023_1804_2376 187
317 3300048911 Ga0496108_0506759 Ga0496108_0506759_239_802 187
318 3300048912 Ga0496109_0043170 Ga0496109_0043170_1112_1684 187
319 3300048913 Ga0496110_0029842 Ga0496110_0029842_2587_3159 187
320 3300048913 Ga0496110_0432652 Ga0496110_0432652_566_1129 187
321 3300048916 Ga0496113_0035774 Ga0496113_0035774_1972_2544 187
322 3300048917 Ga0496114_0023564 Ga0496114_0023564_3774_4346 187
323 3300048917 Ga0496114_0152272 Ga0496114_0152272_817_1389 187
324 3300049576 Ga0501040_0117238 Ga0501040_0117238_407_970 187
325 3300049591 Ga0501075_0510564 Ga0501075_0510564_333_896 187
326 3300049592 Ga0501076_0372205 Ga0501076_0372205_506_1069 187
327 3300049741 Ga0501079_0751289 Ga0501079_0751289_78_641 187
328 3300053084 Ga0495595_0207317 Ga0495595_0207317_26_589 187
329 3300053085 Ga0495619_0004757 Ga0495619_0004757_3225_3788 187
330 3300005327 Ga0070658_10118369 Ga0070658_101183693 188
331 3300005329 Ga0070683_100204943 Ga0070683_1002049433 188
332 3300005329 Ga0070683_100676112 Ga0070683_1006761121 188
333 3300005334 Ga0068869_100461885 Ga0068869_1004618851 188
334 3300005336 Ga0070680_100127018 Ga0070680_1001270182 188
335 3300005337 Ga0070682_100549185 Ga0070682_1005491851 188
336 3300005339 Ga0070660_100386357 Ga0070660_1003863572 188
337 3300005344 Ga0070661_100261024 Ga0070661_1002610241 188
338 3300005435 Ga0070714_100064384 Ga0070714_1000643845 188
339 3300005530 Ga0070679_100021038 Ga0070679_1000210388 188
340 3300005535 Ga0070684_100023347 Ga0070684_1000233476 188
341 3300005546 Ga0070696_100612957 Ga0070696_1006129572 188
342 3300005547 Ga0070693_100004902 Ga0070693_1000049022 188
343 3300005563 Ga0068855_100229095 Ga0068855_1002290952 188
344 3300005614 Ga0068856_100388328 Ga0068856_1003883282 188
345 3300005616 Ga0068852_100811760 Ga0068852_1008117602 188
346 3300005840 Ga0068870_10191577 Ga0068870_101915772 188
347 3300005937 Ga0081455_10116605 Ga0081455_101166052 188
348 3300005981 Ga0081538_10000303 Ga0081538_1000030356 188
349 3300006028 Ga0070717_10002029 Ga0070717_1000202910 188
350 3300006175 Ga0070712_100073707 Ga0070712_1000737073 188
351 3300006237 Ga0097621_100167183 Ga0097621_1001671832 188
352 3300006358 Ga0068871_100119864 Ga0068871_1001198642 188
353 3300009093 Ga0105240_10827561 Ga0105240_108275612 188
354 3300009098 Ga0105245_10002363 Ga0105245_100023634 188
355 3300009176 Ga0105242_10352962 Ga0105242_103529622 188
356 3300009545 Ga0105237_10228283 Ga0105237_102282832 188
357 3300013296 Ga0157374_10435291 Ga0157374_104352912 188
358 3300013308 Ga0157375_10087135 Ga0157375_100871355 188
359 3300014969 Ga0157376_10264257 Ga0157376_102642572 188
360 3300017792 Ga0163161_10267202 Ga0163161_102672022 188
361 3300025905 Ga0207685_10073638 Ga0207685_100736382 188
362 3300025908 Ga0207643_10356533 Ga0207643_103565332 188
363 3300025909 Ga0207705_10267098 Ga0207705_102670982 188
364 3300025912 Ga0207707_10014095 Ga0207707_100140953 188
365 3300025915 Ga0207693_10389573 Ga0207693_103895732 188
366 3300025919 Ga0207657_10269964 Ga0207657_102699642 188
367 3300025920 Ga0207649_10135233 Ga0207649_101352332 188
368 3300025921 Ga0207652_10010690 Ga0207652_100106908 188
369 3300025927 Ga0207687_10017504 Ga0207687_100175042 188
370 3300025929 Ga0207664_10026133 Ga0207664_100261335 188
371 3300025935 Ga0207709_10110638 Ga0207709_101106382 188
372 3300025940 Ga0207691_10190749 Ga0207691_101907492 188
373 3300025942 Ga0207689_10193742 Ga0207689_101937421 188
374 3300025944 Ga0207661_10007125 Ga0207661_100071259 188
375 3300025986 Ga0207658_10482172 Ga0207658_104821722 188
376 3300026121 Ga0207683_10047330 Ga0207683_100473305 188
377 3300037418 Ga0395900_0353818 Ga0395900_0353818_755_1321 188
378 3300041496 Ga0451839_0366405 Ga0451839_0366405_274_846 188
379 3300041498 Ga0451841_0281777 Ga0451841_0281777_147_713 188
380 3300044694 Ga0466963_0018747 Ga0466963_0018747_88_654 188
381 3300044706 Ga0466964_0010748 Ga0466964_0010748_345_911 188
382 3300045976 Ga0466967_0003105 Ga0466967_0003105_3326_3892 188
383 3300045976 Ga0466967_0107028 Ga0466967_0107028_1842_2408 188
384 3300046511 Ga0495608_0184984 Ga0495608_0184984_412_984 188
385 3300046533 Ga0495640_0262113 Ga0495640_0262113_375_947 188
386 3300047322 Ga0495680_0133443 Ga0495680_0133443_170_742 188
387 3300048903 Ga0496100_0081501 Ga0496100_0081501_1096_1662 188
388 3300048904 Ga0496101_0018810 Ga0496101_0018810_3499_4065 188
389 3300048904 Ga0496101_0390527 Ga0496101_0390527_58_627 188
390 3300048905 Ga0496102_0055435 Ga0496102_0055435_1933_2502 188
391 3300048907 Ga0496104_0092033 Ga0496104_0092033_21_590 188
392 3300048909 Ga0496106_0020462 Ga0496106_0020462_2993_3559 188
393 3300048909 Ga0496106_0078323 Ga0496106_0078323_294_863 188
394 3300048910 Ga0496107_0028962 Ga0496107_0028962_2457_3023 188
395 3300048915 Ga0496112_0606663 Ga0496112_0606663_187_756 188
396 3300049568 Ga0501031_0108348 Ga0501031_0108348_844_1425 188
397 3300049570 Ga0501033_0165342 Ga0501033_0165342_146_712 188
398 3300049572 Ga0501036_0008999 Ga0501036_0008999_6024_6590 188
399 3300049573 Ga0501037_0140113 Ga0501037_0140113_143_709 188
400 3300049575 Ga0501039_0014054 Ga0501039_0014054_1147_1713 188
401 3300049576 Ga0501040_0002437 Ga0501040_0002437_8967_9533 188
402 3300049577 Ga0501041_0002614 Ga0501041_0002614_1745_2311 188
403 3300049578 Ga0501042_0013618 Ga0501042_0013618_3681_4247 188
404 3300049581 Ga0501047_0188188 Ga0501047_0188188_762_1328 188
405 3300049582 Ga0501048_0003636 Ga0501048_0003636_10275_10841 188
406 3300049584 Ga0501068_0067042 Ga0501068_0067042_1579_2145 188
407 3300049585 Ga0501069_0148100 Ga0501069_0148100_679_1245 188
408 3300049587 Ga0501071_0007586 Ga0501071_0007586_5498_6064 188
409 3300049587 Ga0501071_0417339 Ga0501071_0417339_180_761 188
410 3300049588 Ga0501072_0004251 Ga0501072_0004251_8238_8804 188
411 3300049588 Ga0501072_0597183 Ga0501072_0597183_129_710 188
412 3300049589 Ga0501073_0505562 Ga0501073_0505562_96_662 188
413 3300049591 Ga0501075_0216900 Ga0501075_0216900_653_1219 188
414 3300049592 Ga0501076_0002880 Ga0501076_0002880_1110_1676 188
415 3300049593 Ga0501077_0007460 Ga0501077_0007460_4682_5248 188
416 3300049593 Ga0501077_0280439 Ga0501077_0280439_57_638 188
417 3300049741 Ga0501079_0003580 Ga0501079_0003580_1953_2519 188
418 3300049742 Ga0501080_0018442 Ga0501080_0018442_5624_6190 188
419 3300049742 Ga0501080_0237142 Ga0501080_0237142_497_1078 188
420 3300049824 Ga0501045_0003686 Ga0501045_0003686_1062_1628 188
421 3300053078 Ga0495612_0017665 Ga0495612_0017665_795_1367 188
422 3300054114 Ga0501084_0034559 Ga0501084_0034559_2283_2864 188
423 3300054114 Ga0501084_0097569 Ga0501084_0097569_1590_2156 188
424 3300059423 Ga0590074_020698 Ga0590074_020698_36_602 188
425 3300061734 Ga0530510_0012266 Ga0530510_0012266_4384_4950 188
426 3300061734 Ga0530510_0067100 Ga0530510_0067100_1979_2560 188
427 3300003373 JGI25407J50210_10063487 JGI25407J50210_100634871 189
428 3300005336 Ga0070680_100073747 Ga0070680_1000737473 189
429 3300005336 Ga0070680_100838072 Ga0070680_1008380722 189
430 3300005339 Ga0070660_100001690 Ga0070660_1000016905 189
431 3300005344 Ga0070661_100281374 Ga0070661_1002813742 189
432 3300005344 Ga0070661_101369313 Ga0070661_1013693131 189
433 3300005366 Ga0070659_100018433 Ga0070659_1000184335 189
434 3300005366 Ga0070659_100073515 Ga0070659_1000735152 189
435 3300005366 Ga0070659_100239674 Ga0070659_1002396742 189
436 3300005435 Ga0070714_100202224 Ga0070714_1002022242 189
437 3300005435 Ga0070714_101186382 Ga0070714_1011863821 189
438 3300005444 Ga0070694_100048280 Ga0070694_1000482802 189
439 3300005458 Ga0070681_10001213 Ga0070681_1000121316 189
440 3300005458 Ga0070681_10110050 Ga0070681_101100503 189
441 3300005530 Ga0070679_100028543 Ga0070679_1000285432 189
442 3300005539 Ga0068853_100418787 Ga0068853_1004187872 189
443 3300005547 Ga0070693_100239756 Ga0070693_1002397562 189
444 3300005563 Ga0068855_100015442 Ga0068855_1000154429 189
445 3300005563 Ga0068855_100285623 Ga0068855_1002856231 189
446 3300005563 Ga0068855_100628542 Ga0068855_1006285422 189
447 3300005577 Ga0068857_100020406 Ga0068857_1000204062 189
448 3300005614 Ga0068856_100363965 Ga0068856_1003639652 189
449 3300005616 Ga0068852_100242155 Ga0068852_1002421552 189
450 3300005981 Ga0081538_10000136 Ga0081538_1000013646 189
451 3300005981 Ga0081538_10005639 Ga0081538_1000563912 189
452 3300005981 Ga0081538_10048536 Ga0081538_100485363 189
453 3300009093 Ga0105240_10583101 Ga0105240_105831011 189
454 3300009094 Ga0111539_10199030 Ga0111539_101990302 189
455 3300009098 Ga0105245_10166146 Ga0105245_101661462 189
456 3300009148 Ga0105243_11134418 Ga0105243_111344181 189
457 3300009174 Ga0105241_10367742 Ga0105241_103677422 189
458 3300009176 Ga0105242_10332892 Ga0105242_103328921 189
459 3300009545 Ga0105237_10241255 Ga0105237_102412552 189
460 3300010375 Ga0105239_10132134 Ga0105239_101321343 189
461 3300013100 Ga0157373_10039976 Ga0157373_100399765 189
462 3300013105 Ga0157369_10162654 Ga0157369_101626541 189
463 3300013297 Ga0157378_11167955 Ga0157378_111679552 189
464 3300013307 Ga0157372_10044755 Ga0157372_100447553 189
465 3300013307 Ga0157372_10171621 Ga0157372_101716212 189
466 3300020070 Ga0206356_10973984 Ga0206356_109739841 189
467 3300022467 Ga0224712_10350727 Ga0224712_103507271 189
468 3300025898 Ga0207692_10067944 Ga0207692_100679443 189
469 3300025911 Ga0207654_10070117 Ga0207654_100701173 189
470 3300025912 Ga0207707_10002380 Ga0207707_100023803 189
471 3300025912 Ga0207707_10083855 Ga0207707_100838552 189
472 3300025912 Ga0207707_10261357 Ga0207707_102613571 189
473 3300025913 Ga0207695_10631882 Ga0207695_106318821 189
474 3300025913 Ga0207695_11219194 Ga0207695_112191941 189
475 3300025914 Ga0207671_10048749 Ga0207671_100487491 189
476 3300025917 Ga0207660_10654518 Ga0207660_106545182 189
477 3300025919 Ga0207657_10000941 Ga0207657_1000094128 189
478 3300025921 Ga0207652_10015606 Ga0207652_100156066 189
479 3300025932 Ga0207690_10182696 Ga0207690_101826961 189
480 3300025937 Ga0207669_10241204 Ga0207669_102412042 189
481 3300025949 Ga0207667_10166877 Ga0207667_101668772 189
482 3300025949 Ga0207667_10349807 Ga0207667_103498071 189
483 3300025949 Ga0207667_10986807 Ga0207667_109868071 189
484 3300026041 Ga0207639_10599737 Ga0207639_105997371 189
485 3300026078 Ga0207702_10245536 Ga0207702_102455361 189
486 3300026116 Ga0207674_10027334 Ga0207674_100273348 189
487 3300026116 Ga0207674_10548324 Ga0207674_105483241 189
488 3300026121 Ga0207683_10223264 Ga0207683_102232642 189
489 3300026142 Ga0207698_10158978 Ga0207698_101589782 189
490 3300026142 Ga0207698_10572317 Ga0207698_105723171 189
491 3300035691 Ga0373931_0148644 Ga0373931_0148644_684_1253 189
492 3300037312 Ga0395899_0080081 Ga0395899_0080081_513_1097 189
493 3300037418 Ga0395900_0429376 Ga0395900_0429376_370_954 189
494 3300037466 Ga0395898_0081440 Ga0395898_0081440_1697_2281 189
495 3300037471 Ga0395905_0082418 Ga0395905_0082418_2171_2755 189
496 3300038443 Ga0395901_0021717 Ga0395901_0021717_4665_5234 189
497 3300038443 Ga0395901_0059975 Ga0395901_0059975_1496_2080 189
498 3300042156 Ga0439446_0013561 Ga0439446_0013561_230_799 189
499 3300042435 Ga0439434_0064673 Ga0439434_0064673_24_593 189
500 3300044684 Ga0466966_0002588 Ga0466966_0002588_10502_11071 189
501 3300044693 Ga0466961_0010006 Ga0466961_0010006_3711_4280 189
502 3300044694 Ga0466963_0008626 Ga0466963_0008626_1477_2046 189
503 3300044694 Ga0466963_0038511 Ga0466963_0038511_95_664 189
504 3300044694 Ga0466963_0070737 Ga0466963_0070737_587_1156 189
505 3300044694 Ga0466963_0083257 Ga0466963_0083257_560_1129 189
506 3300044706 Ga0466964_0019693 Ga0466964_0019693_1597_2166 189
507 3300044719 Ga0466971_0000282 Ga0466971_0000282_6273_6842 189
508 3300044719 Ga0466971_0337840 Ga0466971_0337840_51_620 189
509 3300044765 Ga0466970_0274733 Ga0466970_0274733_162_731 189
510 3300044842 Ga0466957_0021243 Ga0466957_0021243_138_707 189
511 3300044842 Ga0466957_0190270 Ga0466957_0190270_172_741 189
512 3300044901 Ga0466960_0213785 Ga0466960_0213785_261_830 189
513 3300045049 Ga0466959_0015352 Ga0466959_0015352_3304_3873 189
514 3300045049 Ga0466959_0022070 Ga0466959_0022070_852_1421 189
515 3300045836 Ga0466958_0100793 Ga0466958_0100793_955_1524 189
516 3300045976 Ga0466967_0036912 Ga0466967_0036912_3162_3731 189
517 3300045976 Ga0466967_0057547 Ga0466967_0057547_1217_1786 189
518 3300045976 Ga0466967_0066054 Ga0466967_0066054_2062_2631 189
519 3300045976 Ga0466967_0169773 Ga0466967_0169773_1024_1602 189
520 3300045976 Ga0466967_0205207 Ga0466967_0205207_482_1051 189
521 3300046455 Ga0495603_0094203 Ga0495603_0094203_509_1078 189
522 3300046459 Ga0495629_0064008 Ga0495629_0064008_561_1130 189
523 3300046463 Ga0495653_0106485 Ga0495653_0106485_1059_1628 189
524 3300046663 Ga0495635_0008656 Ga0495635_0008656_1048_1617 189
525 3300046689 Ga0495613_0223374 Ga0495613_0223374_731_1300 189
526 3300046690 Ga0495624_0057677 Ga0495624_0057677_278_847 189
527 3300047319 Ga0495674_0022470 Ga0495674_0022470_3720_4289 189
528 3300047322 Ga0495680_0019563 Ga0495680_0019563_2111_2680 189
529 3300048905 Ga0496102_0386868 Ga0496102_0386868_22_591 189
530 3300048908 Ga0496105_0100325 Ga0496105_0100325_475_1053 189
531 3300048917 Ga0496114_0493459 Ga0496114_0493459_132_701 189
532 3300048918 Ga0496115_0006958 Ga0496115_0006958_1092_1661 189
533 3300049568 Ga0501031_0001464 Ga0501031_0001464_7804_8373 189
534 3300049568 Ga0501031_0014843 Ga0501031_0014843_3239_3808 189
535 3300049569 Ga0501032_0001151 Ga0501032_0001151_15540_16109 189
536 3300049569 Ga0501032_0002549 Ga0501032_0002549_1813_2382 189
537 3300049570 Ga0501033_0002394 Ga0501033_0002394_9849_10418 189
538 3300049570 Ga0501033_0009712 Ga0501033_0009712_5911_6480 189
539 3300049571 Ga0501034_0005171 Ga0501034_0005171_5642_6211 189
540 3300049572 Ga0501036_0000693 Ga0501036_0000693_18611_19180 189
541 3300049572 Ga0501036_0003288 Ga0501036_0003288_6819_7388 189
542 3300049573 Ga0501037_0000912 Ga0501037_0000912_15180_15749 189
543 3300049573 Ga0501037_0007140 Ga0501037_0007140_1685_2254 189
544 3300049574 Ga0501038_0000324 Ga0501038_0000324_38349_38918 189
545 3300049574 Ga0501038_0049975 Ga0501038_0049975_2145_2714 189
546 3300049574 Ga0501038_0084967 Ga0501038_0084967_1239_1808 189
547 3300049575 Ga0501039_0003272 Ga0501039_0003272_6487_7056 189
548 3300049575 Ga0501039_0010604 Ga0501039_0010604_67_636 189
549 3300049575 Ga0501039_0079407 Ga0501039_0079407_1468_2037 189
550 3300049576 Ga0501040_0001388 Ga0501040_0001388_9660_10229 189
551 3300049576 Ga0501040_0001492 Ga0501040_0001492_5055_5624 189
552 3300049577 Ga0501041_0000022 Ga0501041_0000022_31287_31856 189
553 3300049577 Ga0501041_0004752 Ga0501041_0004752_1813_2382 189
554 3300049577 Ga0501041_0116576 Ga0501041_0116576_638_1207 189
555 3300049577 Ga0501041_0144044 Ga0501041_0144044_419_988 189
556 3300049578 Ga0501042_0000116 Ga0501042_0000116_6261_6830 189
557 3300049578 Ga0501042_0018587 Ga0501042_0018587_905_1474 189
558 3300049578 Ga0501042_0022669 Ga0501042_0022669_3791_4360 189
559 3300049578 Ga0501042_0299149 Ga0501042_0299149_70_639 189
560 3300049579 Ga0501043_0001346 Ga0501043_0001346_19762_20331 189
561 3300049579 Ga0501043_0046599 Ga0501043_0046599_1813_2382 189
562 3300049579 Ga0501043_0137099 Ga0501043_0137099_1126_1695 189
563 3300049580 Ga0501046_0003365 Ga0501046_0003365_2145_2714 189
564 3300049580 Ga0501046_0018976 Ga0501046_0018976_3544_4113 189
565 3300049580 Ga0501046_0191034 Ga0501046_0191034_39_608 189
566 3300049581 Ga0501047_0000555 Ga0501047_0000555_29860_30429 189
567 3300049581 Ga0501047_0007968 Ga0501047_0007968_1685_2254 189
568 3300049582 Ga0501048_0001118 Ga0501048_0001118_5630_6199 189
569 3300049582 Ga0501048_0002671 Ga0501048_0002671_3195_3764 189
570 3300049582 Ga0501048_0009494 Ga0501048_0009494_5194_5763 189
571 3300049583 Ga0501067_0000684 Ga0501067_0000684_17280_17849 189
572 3300049583 Ga0501067_0063224 Ga0501067_0063224_735_1304 189
573 3300049583 Ga0501067_0314422 Ga0501067_0314422_156_725 189
574 3300049584 Ga0501068_0000275 Ga0501068_0000275_9805_10374 189
575 3300049584 Ga0501068_0017811 Ga0501068_0017811_1427_1996 189
576 3300049585 Ga0501069_0002263 Ga0501069_0002263_5911_6480 189
577 3300049585 Ga0501069_0005641 Ga0501069_0005641_4109_4678 189
578 3300049585 Ga0501069_0018820 Ga0501069_0018820_94_663 189
579 3300049585 Ga0501069_0526655 Ga0501069_0526655_16_585 189
580 3300049586 Ga0501070_0002869 Ga0501070_0002869_5630_6199 189
581 3300049586 Ga0501070_0010528 Ga0501070_0010528_6335_6904 189
582 3300049587 Ga0501071_0000004 Ga0501071_0000004_63075_63644 189
583 3300049587 Ga0501071_0002369 Ga0501071_0002369_5786_6355 189
584 3300049587 Ga0501071_0190893 Ga0501071_0190893_938_1507 189
585 3300049587 Ga0501071_0212284 Ga0501071_0212284_244_813 189
586 3300049588 Ga0501072_0002296 Ga0501072_0002296_9845_10414 189
587 3300049588 Ga0501072_0003182 Ga0501072_0003182_6725_7294 189
588 3300049588 Ga0501072_0143168 Ga0501072_0143168_45_614 189
589 3300049588 Ga0501072_0371472 Ga0501072_0371472_13_621 189
590 3300049589 Ga0501073_0001183 Ga0501073_0001183_9714_10283 189
591 3300049589 Ga0501073_0022856 Ga0501073_0022856_1813_2382 189
592 3300049590 Ga0501074_0002631 Ga0501074_0002631_10876_11445 189
593 3300049590 Ga0501074_0007545 Ga0501074_0007545_1614_2183 189
594 3300049590 Ga0501074_0023368 Ga0501074_0023368_3430_3999 189
595 3300049591 Ga0501075_0001696 Ga0501075_0001696_8862_9431 189
596 3300049591 Ga0501075_0001838 Ga0501075_0001838_3776_4345 189
597 3300049591 Ga0501075_0012766 Ga0501075_0012766_408_977 189
598 3300049591 Ga0501075_0058400 Ga0501075_0058400_645_1253 189
599 3300049592 Ga0501076_0000462 Ga0501076_0000462_21472_22041 189
600 3300049592 Ga0501076_0008270 Ga0501076_0008270_5055_5624 189
601 3300049592 Ga0501076_0018958 Ga0501076_0018958_1055_1624 189
602 3300049592 Ga0501076_0589998 Ga0501076_0589998_156_725 189
603 3300049592 Ga0501076_0600643 Ga0501076_0600643_218_787 189
604 3300049593 Ga0501077_0000711 Ga0501077_0000711_5911_6480 189
605 3300049593 Ga0501077_0003209 Ga0501077_0003209_7802_8371 189
606 3300049741 Ga0501079_0000221 Ga0501079_0000221_6261_6830 189
607 3300049741 Ga0501079_0003109 Ga0501079_0003109_7804_8373 189
608 3300049741 Ga0501079_0013392 Ga0501079_0013392_675_1244 189
609 3300049741 Ga0501079_0079489 Ga0501079_0079489_1253_1861 189
610 3300049742 Ga0501080_0000858 Ga0501080_0000858_15552_16121 189
611 3300049742 Ga0501080_0061511 Ga0501080_0061511_1058_1627 189
612 3300049742 Ga0501080_0160622 Ga0501080_0160622_752_1321 189
613 3300049743 Ga0501081_0000040 Ga0501081_0000040_5068_5637 189
614 3300049743 Ga0501081_0000284 Ga0501081_0000284_11003_11572 189
615 3300049743 Ga0501081_0011035 Ga0501081_0011035_225_794 189
616 3300049743 Ga0501081_0325559 Ga0501081_0325559_99_707 189
617 3300049744 Ga0501083_0005368 Ga0501083_0005368_8369_8938 189
618 3300049744 Ga0501083_0010421 Ga0501083_0010421_918_1487 189
619 3300049744 Ga0501083_0135574 Ga0501083_0135574_769_1338 189
620 3300049744 Ga0501083_0612307 Ga0501083_0612307_30_599 189
621 3300049822 Ga0501035_0011080 Ga0501035_0011080_5068_5637 189
622 3300049822 Ga0501035_0050408 Ga0501035_0050408_2244_2813 189
623 3300049823 Ga0501044_0009492 Ga0501044_0009492_8194_8763 189
624 3300049823 Ga0501044_0045490 Ga0501044_0045490_1961_2530 189
625 3300049824 Ga0501045_0000014 Ga0501045_0000014_9849_10418 189
626 3300049824 Ga0501045_0000729 Ga0501045_0000729_10900_11469 189
627 3300049824 Ga0501045_0007442 Ga0501045_0007442_788_1357 189
628 3300049824 Ga0501045_0022079 Ga0501045_0022079_3720_4289 189
629 3300054114 Ga0501084_0000228 Ga0501084_0000228_29238_29807 189
630 3300054114 Ga0501084_0003048 Ga0501084_0003048_6261_6830 189
631 3300054114 Ga0501084_0012809 Ga0501084_0012809_5003_5572 189
632 3300054114 Ga0501084_0661801 Ga0501084_0661801_283_852 189
633 3300059426 Ga0590077_020412 Ga0590077_020412_414_983 189
634 3300060353 Ga0501082_0000313 Ga0501082_0000313_1353_1922 189
635 3300060353 Ga0501082_0003297 Ga0501082_0003297_6750_7319 189
636 3300061734 Ga0530510_0000233 Ga0530510_0000233_5068_5637 189
637 3300061734 Ga0530510_0002740 Ga0530510_0002740_6487_7056 189
638 3300061734 Ga0530510_0007830 Ga0530510_0007830_6360_6929 189
639 3300061734 Ga0530510_0087351 Ga0530510_0087351_538_1107 189
640 3300005435 Ga0070714_100021504 Ga0070714_1000215042 190
641 3300005441 Ga0070700_100480089 Ga0070700_1004800892 190
642 3300005617 Ga0068859_100628170 Ga0068859_1006281702 190
643 3300005937 Ga0081455_10037679 Ga0081455_100376794 190
644 3300006175 Ga0070712_100096628 Ga0070712_1000966283 190
645 3300006175 Ga0070712_100637167 Ga0070712_1006371672 190
646 3300006931 Ga0097620_100628163 Ga0097620_1006281632 190
647 3300009553 Ga0105249_10738350 Ga0105249_107383502 190
648 3300010375 Ga0105239_10284608 Ga0105239_102846082 190
649 3300017792 Ga0163161_10476654 Ga0163161_104766542 190
650 3300025906 Ga0207699_10145707 Ga0207699_101457072 190
651 3300025927 Ga0207687_10309420 Ga0207687_103094202 190
652 3300025928 Ga0207700_10000006 Ga0207700_10000006182 190
653 3300025933 Ga0207706_10476945 Ga0207706_104769452 190
654 3300025939 Ga0207665_10016548 Ga0207665_100165485 190
655 3300025944 Ga0207661_10132253 Ga0207661_101322533 190
656 3300025945 Ga0207679_10358443 Ga0207679_103584432 190
657 3300026089 Ga0207648_10072896 Ga0207648_100728962 190
658 3300026116 Ga0207674_10003286 Ga0207674_1000328610 190
659 3300027907 Ga0207428_10012035 Ga0207428_100120354 190
660 3300028380 Ga0268265_10582407 Ga0268265_105824072 190
661 3300031995 Ga0307409_100355041 Ga0307409_1003550412 190
662 3300032002 Ga0307416_100030308 Ga0307416_1000303082 190
663 3300035724 Ga0373933_0188237 Ga0373933_0188237_324_896 190
664 3300037418 Ga0395900_0687557 Ga0395900_0687557_71_643 190
665 3300037466 Ga0395898_0039581 Ga0395898_0039581_2948_3559 190
666 3300037466 Ga0395898_0192431 Ga0395898_0192431_825_1397 190
667 3300037471 Ga0395905_0093067 Ga0395905_0093067_1845_2456 190
668 3300038443 Ga0395901_0086161 Ga0395901_0086161_1045_1656 190
669 3300038443 Ga0395901_0091290 Ga0395901_0091290_2168_2740 190
670 3300039450 Ga0436363_0252435 Ga0436363_0252435_278_850 190
671 3300041405 Ga0439438_011492 Ga0439438_011492_1215_1787 190
672 3300041407 Ga0439447_030313 Ga0439447_030313_221_793 190
673 3300041410 Ga0439461_0011486 Ga0439461_0011486_670_1242 190
674 3300041411 Ga0439466_0027129 Ga0439466_0027129_1131_1703 190
675 3300041997 Ga0439431_0075838 Ga0439431_0075838_285_857 190
676 3300042004 Ga0439445_0085422 Ga0439445_0085422_248_820 190
677 3300042122 Ga0450920_012039 Ga0450920_012039_466_1038 190
678 3300042156 Ga0439446_0007392 Ga0439446_0007392_665_1237 190
679 3300042156 Ga0439446_0155337 Ga0439446_0155337_166_738 190
680 3300042435 Ga0439434_0002323 Ga0439434_0002323_509_1081 190
681 3300045976 Ga0466967_0132537 Ga0466967_0132537_1638_2225 190
682 3300046454 Ga0495592_0044335 Ga0495592_0044335_2081_2653 190
683 3300046454 Ga0495592_0074482 Ga0495592_0074482_331_903 190
684 3300046461 Ga0495641_0054214 Ga0495641_0054214_644_1216 190
685 3300046462 Ga0495651_0055949 Ga0495651_0055949_121_693 190
686 3300046511 Ga0495608_0034518 Ga0495608_0034518_2381_2953 190
687 3300046516 Ga0495628_0045354 Ga0495628_0045354_523_1095 190
688 3300046516 Ga0495628_0396560 Ga0495628_0396560_339_911 190
689 3300046517 Ga0495630_0024990 Ga0495630_0024990_1091_1663 190
690 3300046525 Ga0495663_0118965 Ga0495663_0118965_162_737 190
691 3300046529 Ga0495652_0059198 Ga0495652_0059198_2337_2909 190
692 3300046531 Ga0495665_0284862 Ga0495665_0284862_174_746 190
693 3300046533 Ga0495640_0002423 Ga0495640_0002423_5275_5847 190
694 3300046559 Ga0495667_0029105 Ga0495667_0029105_2218_2790 190
695 3300046615 Ga0495656_0008465 Ga0495656_0008465_926_1501 190
696 3300046642 Ga0495634_0012520 Ga0495634_0012520_5272_5844 190
697 3300046675 Ga0495657_0153397 Ga0495657_0153397_761_1333 190
698 3300046679 Ga0495623_0353927 Ga0495623_0353927_174_746 190
699 3300046689 Ga0495613_0243819 Ga0495613_0243819_184_756 190
700 3300046689 Ga0495613_0585220 Ga0495613_0585220_56_628 190
701 3300046690 Ga0495624_0067947 Ga0495624_0067947_13_585 190
702 3300047317 Ga0495604_0119002 Ga0495604_0119002_959_1531 190
703 3300047319 Ga0495674_0024895 Ga0495674_0024895_2488_3060 190
704 3300047319 Ga0495674_0282770 Ga0495674_0282770_314_901 190
705 3300047322 Ga0495680_0006023 Ga0495680_0006023_159_731 190
706 3300047471 Ga0495684_0038933 Ga0495684_0038933_2943_3515 190
707 3300048903 Ga0496100_0078981 Ga0496100_0078981_1196_1771 190
708 3300048904 Ga0496101_0473457 Ga0496101_0473457_356_943 190
709 3300048907 Ga0496104_0057530 Ga0496104_0057530_1921_2493 190
710 3300048907 Ga0496104_0068373 Ga0496104_0068373_1261_1848 190
711 3300048908 Ga0496105_0321550 Ga0496105_0321550_331_903 190
712 3300048909 Ga0496106_0204466 Ga0496106_0204466_574_1149 190
713 3300048910 Ga0496107_0558441 Ga0496107_0558441_100_672 190
714 3300048912 Ga0496109_0178134 Ga0496109_0178134_270_857 190
715 3300048913 Ga0496110_0033425 Ga0496110_0033425_37_612 190
716 3300048914 Ga0496111_0021224 Ga0496111_0021224_3069_3644 190
717 3300048915 Ga0496112_0108591 Ga0496112_0108591_283_855 190
718 3300048916 Ga0496113_0066200 Ga0496113_0066200_1814_2416 190
719 3300048917 Ga0496114_0706949 Ga0496114_0706949_231_806 190
720 3300048918 Ga0496115_0042123 Ga0496115_0042123_2620_3192 190
721 3300049572 Ga0501036_0804556 Ga0501036_0804556_182_754 190
722 3300049581 Ga0501047_0265771 Ga0501047_0265771_195_767 190
723 3300049584 Ga0501068_0213945 Ga0501068_0213945_262_834 190
724 3300049585 Ga0501069_0005008 Ga0501069_0005008_4615_5187 190
725 3300049586 Ga0501070_0133943 Ga0501070_0133943_1170_1742 190
726 3300049587 Ga0501071_0113177 Ga0501071_0113177_810_1382 190
727 3300049588 Ga0501072_0105231 Ga0501072_0105231_1557_2129 190
728 3300049590 Ga0501074_0316297 Ga0501074_0316297_527_1099 190
729 3300049592 Ga0501076_0065206 Ga0501076_0065206_227_799 190
730 3300049741 Ga0501079_0322967 Ga0501079_0322967_471_1043 190
731 3300049742 Ga0501080_0081704 Ga0501080_0081704_2111_2683 190
732 3300050493 nmdc:mga0k408_239435_c1 nmdc:mga0k408_239435_c1_37_609 190
733 3300050511 nmdc:mga08y16_89822_c1 nmdc:mga08y16_89822_c1_955_1527 190
734 3300050513 nmdc:mga0rr50_403748_c1 nmdc:mga0rr50_403748_c1_73_648 190
735 3300050514 nmdc:mga08x19_779872_c1 nmdc:mga08x19_779872_c1_89_661 190
736 3300053077 Ga0495601_0089045 Ga0495601_0089045_908_1480 190
737 3300053078 Ga0495612_0140873 Ga0495612_0140873_368_985 190
738 3300053084 Ga0495595_0050103 Ga0495595_0050103_35_607 190
739 3300054114 Ga0501084_0135563 Ga0501084_0135563_177_749 190
740 3300054114 Ga0501084_0166886 Ga0501084_0166886_685_1257 190
741 3300001991 JGI24743J22301_10016347 JGI24743J22301_100163472 191
742 3300002075 JGI24738J21930_10003707 JGI24738J21930_100037073 191
743 3300002075 JGI24738J21930_10037124 JGI24738J21930_100371242 191
744 3300002077 JGI24744J21845_10004702 JGI24744J21845_100047022 191
745 3300003203 JGI25406J46586_10025659 JGI25406J46586_100256592 191
746 3300003373 JGI25407J50210_10001246 JGI25407J50210_100012462 191
747 3300003373 JGI25407J50210_10016413 JGI25407J50210_100164132 191
748 3300005327 Ga0070658_10036847 Ga0070658_100368473 191
749 3300005327 Ga0070658_10278074 Ga0070658_102780742 191
750 3300005327 Ga0070658_10318066 Ga0070658_103180662 191
751 3300005328 Ga0070676_10160695 Ga0070676_101606952 191
752 3300005328 Ga0070676_10522178 Ga0070676_105221782 191
753 3300005329 Ga0070683_100012761 Ga0070683_1000127618 191
754 3300005329 Ga0070683_100075320 Ga0070683_1000753203 191
755 3300005329 Ga0070683_100159278 Ga0070683_1001592781 191
756 3300005329 Ga0070683_100531542 Ga0070683_1005315422 191
757 3300005329 Ga0070683_101052195 Ga0070683_1010521951 191
758 3300005330 Ga0070690_100147041 Ga0070690_1001470412 191
759 3300005330 Ga0070690_100280341 Ga0070690_1002803412 191
760 3300005331 Ga0070670_100002961 Ga0070670_1000029611 191
761 3300005331 Ga0070670_100041998 Ga0070670_1000419981 191
762 3300005331 Ga0070670_100424567 Ga0070670_1004245672 191
763 3300005334 Ga0068869_100284567 Ga0068869_1002845672 191
764 3300005334 Ga0068869_100400471 Ga0068869_1004004712 191
765 3300005335 Ga0070666_10113528 Ga0070666_101135282 191
766 3300005336 Ga0070680_100041373 Ga0070680_1000413733 191
767 3300005336 Ga0070680_100073220 Ga0070680_1000732203 191
768 3300005336 Ga0070680_100118439 Ga0070680_1001184392 191
769 3300005337 Ga0070682_100001712 Ga0070682_1000017124 191
770 3300005337 Ga0070682_100108645 Ga0070682_1001086452 191
771 3300005338 Ga0068868_100013592 Ga0068868_1000135928 191
772 3300005338 Ga0068868_100073439 Ga0068868_1000734392 191
773 3300005338 Ga0068868_100621077 Ga0068868_1006210771 191
774 3300005339 Ga0070660_100172033 Ga0070660_1001720332 191
775 3300005339 Ga0070660_100187162 Ga0070660_1001871622 191
776 3300005340 Ga0070689_100007496 Ga0070689_1000074963 191
777 3300005340 Ga0070689_100014920 Ga0070689_1000149201 191
778 3300005340 Ga0070689_101038300 Ga0070689_1010383001 191
779 3300005341 Ga0070691_10000781 Ga0070691_1000078115 191
780 3300005343 Ga0070687_100069376 Ga0070687_1000693762 191
781 3300005343 Ga0070687_100093269 Ga0070687_1000932692 191
782 3300005344 Ga0070661_100306793 Ga0070661_1003067932 191
783 3300005345 Ga0070692_10110453 Ga0070692_101104532 191
784 3300005345 Ga0070692_10296676 Ga0070692_102966762 191
785 3300005347 Ga0070668_100123839 Ga0070668_1001238392 191
786 3300005347 Ga0070668_100163660 Ga0070668_1001636602 191
787 3300005347 Ga0070668_100165355 Ga0070668_1001653551 191
788 3300005353 Ga0070669_100227242 Ga0070669_1002272422 191
789 3300005354 Ga0070675_100013253 Ga0070675_1000132533 191
790 3300005354 Ga0070675_100047731 Ga0070675_1000477313 191
791 3300005354 Ga0070675_100350783 Ga0070675_1003507832 191
792 3300005355 Ga0070671_100165482 Ga0070671_1001654822 191
793 3300005355 Ga0070671_100353449 Ga0070671_1003534491 191
794 3300005356 Ga0070674_100002662 Ga0070674_1000026626 191
795 3300005356 Ga0070674_100005767 Ga0070674_1000057676 191
796 3300005356 Ga0070674_100008638 Ga0070674_1000086387 191
797 3300005356 Ga0070674_100019808 Ga0070674_1000198085 191
798 3300005356 Ga0070674_100157022 Ga0070674_1001570221 191
799 3300005364 Ga0070673_100001958 Ga0070673_10000195812 191
800 3300005364 Ga0070673_100018928 Ga0070673_1000189282 191
801 3300005364 Ga0070673_100042159 Ga0070673_1000421593 191
802 3300005364 Ga0070673_100908902 Ga0070673_1009089021 191
803 3300005364 Ga0070673_100972307 Ga0070673_1009723071 191
804 3300005365 Ga0070688_100006185 Ga0070688_1000061856 191
805 3300005366 Ga0070659_100006531 Ga0070659_1000065312 191
806 3300005366 Ga0070659_100008477 Ga0070659_1000084774 191
807 3300005366 Ga0070659_100085982 Ga0070659_1000859822 191
808 3300005366 Ga0070659_100088259 Ga0070659_1000882592 191
809 3300005366 Ga0070659_100147056 Ga0070659_1001470562 191
810 3300005366 Ga0070659_100935867 Ga0070659_1009358671 191
811 3300005406 Ga0070703_10026156 Ga0070703_100261561 191
812 3300005437 Ga0070710_10016437 Ga0070710_100164373 191
813 3300005438 Ga0070701_10001717 Ga0070701_100017176 191
814 3300005438 Ga0070701_10005023 Ga0070701_100050231 191
815 3300005438 Ga0070701_10008511 Ga0070701_100085116 191
816 3300005438 Ga0070701_10081364 Ga0070701_100813642 191
817 3300005439 Ga0070711_100182298 Ga0070711_1001822982 191
818 3300005441 Ga0070700_100018616 Ga0070700_1000186163 191
819 3300005441 Ga0070700_100090432 Ga0070700_1000904322 191
820 3300005441 Ga0070700_100789415 Ga0070700_1007894151 191
821 3300005441 Ga0070700_100791574 Ga0070700_1007915742 191
822 3300005445 Ga0070708_100028302 Ga0070708_1000283025 191
823 3300005455 Ga0070663_100056361 Ga0070663_1000563612 191
824 3300005455 Ga0070663_100291009 Ga0070663_1002910092 191
825 3300005456 Ga0070678_100008915 Ga0070678_1000089152 191
826 3300005456 Ga0070678_100059160 Ga0070678_1000591604 191
827 3300005456 Ga0070678_100068605 Ga0070678_1000686052 191
828 3300005456 Ga0070678_100240757 Ga0070678_1002407571 191
829 3300005456 Ga0070678_100274520 Ga0070678_1002745202 191
830 3300005456 Ga0070678_100333546 Ga0070678_1003335462 191
831 3300005457 Ga0070662_100077590 Ga0070662_1000775902 191
832 3300005457 Ga0070662_100179861 Ga0070662_1001798611 191
833 3300005459 Ga0068867_100001791 Ga0068867_1000017916 191
834 3300005459 Ga0068867_100158103 Ga0068867_1001581032 191
835 3300005459 Ga0068867_100421869 Ga0068867_1004218691 191
836 3300005466 Ga0070685_10001703 Ga0070685_100017032 191
837 3300005466 Ga0070685_10009536 Ga0070685_100095366 191
838 3300005466 Ga0070685_10287638 Ga0070685_102876382 191
839 3300005467 Ga0070706_100107531 Ga0070706_1001075312 191
840 3300005468 Ga0070707_100003768 Ga0070707_1000037688 191
841 3300005468 Ga0070707_100287779 Ga0070707_1002877792 191
842 3300005468 Ga0070707_100294819 Ga0070707_1002948192 191
843 3300005468 Ga0070707_100655076 Ga0070707_1006550762 191
844 3300005471 Ga0070698_100037325 Ga0070698_1000373253 191
845 3300005471 Ga0070698_100073650 Ga0070698_1000736504 191
846 3300005471 Ga0070698_100131064 Ga0070698_1001310642 191
847 3300005518 Ga0070699_100069022 Ga0070699_1000690222 191
848 3300005518 Ga0070699_100107013 Ga0070699_1001070132 191
849 3300005518 Ga0070699_100425954 Ga0070699_1004259542 191
850 3300005530 Ga0070679_100001403 Ga0070679_10000140319 191
851 3300005530 Ga0070679_100168855 Ga0070679_1001688552 191
852 3300005530 Ga0070679_101213028 Ga0070679_1012130281 191
853 3300005535 Ga0070684_100007800 Ga0070684_1000078008 191
854 3300005535 Ga0070684_100169179 Ga0070684_1001691792 191
855 3300005535 Ga0070684_101256167 Ga0070684_1012561671 191
856 3300005539 Ga0068853_100035480 Ga0068853_1000354802 191
857 3300005543 Ga0070672_100019493 Ga0070672_1000194931 191
858 3300005543 Ga0070672_100099257 Ga0070672_1000992573 191
859 3300005543 Ga0070672_100178976 Ga0070672_1001789762 191
860 3300005543 Ga0070672_100219230 Ga0070672_1002192303 191
861 3300005544 Ga0070686_100022046 Ga0070686_1000220462 191
862 3300005544 Ga0070686_100145091 Ga0070686_1001450913 191
863 3300005546 Ga0070696_100015057 Ga0070696_1000150576 191
864 3300005546 Ga0070696_100271437 Ga0070696_1002714372 191
865 3300005546 Ga0070696_100273307 Ga0070696_1002733072 191
866 3300005547 Ga0070693_100027797 Ga0070693_1000277974 191
867 3300005547 Ga0070693_100066727 Ga0070693_1000667271 191
868 3300005547 Ga0070693_100079315 Ga0070693_1000793152 191
869 3300005547 Ga0070693_100241737 Ga0070693_1002417372 191
870 3300005548 Ga0070665_100012505 Ga0070665_10001250513 191
871 3300005548 Ga0070665_100018342 Ga0070665_1000183424 191
872 3300005548 Ga0070665_100048975 Ga0070665_1000489754 191
873 3300005549 Ga0070704_100017045 Ga0070704_1000170452 191
874 3300005549 Ga0070704_100052532 Ga0070704_1000525324 191
875 3300005549 Ga0070704_100315098 Ga0070704_1003150981 191
876 3300005549 Ga0070704_100616549 Ga0070704_1006165492 191
877 3300005563 Ga0068855_100233339 Ga0068855_1002333392 191
878 3300005564 Ga0070664_100005843 Ga0070664_1000058437 191
879 3300005577 Ga0068857_100180528 Ga0068857_1001805282 191
880 3300005577 Ga0068857_100242098 Ga0068857_1002420982 191
881 3300005577 Ga0068857_101131231 Ga0068857_1011312312 191
882 3300005578 Ga0068854_100022013 Ga0068854_1000220135 191
883 3300005578 Ga0068854_100390097 Ga0068854_1003900972 191
884 3300005614 Ga0068856_100016313 Ga0068856_1000163133 191
885 3300005614 Ga0068856_100124921 Ga0068856_1001249212 191
886 3300005614 Ga0068856_100129229 Ga0068856_1001292293 191
887 3300005615 Ga0070702_100009253 Ga0070702_1000092532 191
888 3300005615 Ga0070702_100077139 Ga0070702_1000771392 191
889 3300005615 Ga0070702_100091164 Ga0070702_1000911641 191
890 3300005615 Ga0070702_100391278 Ga0070702_1003912782 191
891 3300005616 Ga0068852_100002371 Ga0068852_1000023713 191
892 3300005617 Ga0068859_100170337 Ga0068859_1001703372 191
893 3300005617 Ga0068859_100181417 Ga0068859_1001814173 191
894 3300005618 Ga0068864_100056903 Ga0068864_1000569034 191
895 3300005618 Ga0068864_100060948 Ga0068864_1000609483 191
896 3300005618 Ga0068864_100173434 Ga0068864_1001734343 191
897 3300005718 Ga0068866_10001672 Ga0068866_100016727 191
898 3300005718 Ga0068866_10014836 Ga0068866_100148364 191
899 3300005718 Ga0068866_10304239 Ga0068866_103042392 191
900 3300005719 Ga0068861_100246496 Ga0068861_1002464962 191
901 3300005719 Ga0068861_100445172 Ga0068861_1004451722 191
902 3300005719 Ga0068861_101466080 Ga0068861_1014660801 191
903 3300005834 Ga0068851_10020613 Ga0068851_100206132 191
904 3300005840 Ga0068870_10000685 Ga0068870_100006857 191
905 3300005840 Ga0068870_10019676 Ga0068870_100196763 191
906 3300005840 Ga0068870_10054016 Ga0068870_100540162 191
907 3300005841 Ga0068863_100073888 Ga0068863_1000738883 191
908 3300005841 Ga0068863_100847150 Ga0068863_1008471502 191
909 3300005842 Ga0068858_100190991 Ga0068858_1001909912 191
910 3300005843 Ga0068860_100018472 Ga0068860_1000184729 191
911 3300005843 Ga0068860_100073222 Ga0068860_1000732221 191
912 3300005844 Ga0068862_100200168 Ga0068862_1002001682 191
913 3300005844 Ga0068862_100618459 Ga0068862_1006184592 191
914 3300005937 Ga0081455_10003417 Ga0081455_100034175 191
915 3300005937 Ga0081455_10012226 Ga0081455_100122268 191
916 3300005937 Ga0081455_10026678 Ga0081455_100266785 191
917 3300005937 Ga0081455_10045388 Ga0081455_100453884 191
918 3300005937 Ga0081455_10056972 Ga0081455_100569724 191
919 3300005981 Ga0081538_10000286 Ga0081538_1000028646 191
920 3300005981 Ga0081538_10001394 Ga0081538_100013947 191
921 3300005981 Ga0081538_10002571 Ga0081538_100025714 191
922 3300005981 Ga0081538_10010466 Ga0081538_100104669 191
923 3300005981 Ga0081538_10130305 Ga0081538_101303052 191
924 3300005985 Ga0081539_10001263 Ga0081539_1000126333 191
925 3300005985 Ga0081539_10001773 Ga0081539_1000177340 191
926 3300006038 Ga0075365_10054270 Ga0075365_100542702 191
927 3300006048 Ga0075363_100027800 Ga0075363_1000278002 191
928 3300006051 Ga0075364_10037199 Ga0075364_100371992 191
929 3300006051 Ga0075364_10101944 Ga0075364_101019442 191
930 3300006058 Ga0075432_10000733 Ga0075432_1000073310 191
931 3300006058 Ga0075432_10016947 Ga0075432_100169472 191
932 3300006163 Ga0070715_10233959 Ga0070715_102339592 191
933 3300006173 Ga0070716_100348765 Ga0070716_1003487652 191
934 3300006175 Ga0070712_100055179 Ga0070712_1000551793 191
935 3300006178 Ga0075367_10158500 Ga0075367_101585002 191
936 3300006195 Ga0075366_10189756 Ga0075366_101897562 191
937 3300006237 Ga0097621_100036335 Ga0097621_1000363352 191
938 3300006237 Ga0097621_100073901 Ga0097621_1000739012 191
939 3300006358 Ga0068871_100437394 Ga0068871_1004373942 191
940 3300006358 Ga0068871_100599820 Ga0068871_1005998201 191
941 3300006844 Ga0075428_100000369 Ga0075428_10000036951 191
942 3300006844 Ga0075428_100009861 Ga0075428_10000986112 191
943 3300006844 Ga0075428_100034263 Ga0075428_1000342634 191
944 3300006844 Ga0075428_100275608 Ga0075428_1002756082 191
945 3300006846 Ga0075430_100159353 Ga0075430_1001593533 191
946 3300006847 Ga0075431_100019487 Ga0075431_1000194873 191
947 3300006847 Ga0075431_100175495 Ga0075431_1001754953 191
948 3300006847 Ga0075431_100269105 Ga0075431_1002691052 191
949 3300006852 Ga0075433_10047244 Ga0075433_100472442 191
950 3300006852 Ga0075433_10085433 Ga0075433_100854332 191
951 3300006852 Ga0075433_10376458 Ga0075433_103764582 191
952 3300006852 Ga0075433_10453765 Ga0075433_104537652 191
953 3300006871 Ga0075434_100070341 Ga0075434_1000703414 191
954 3300006871 Ga0075434_100181463 Ga0075434_1001814632 191
955 3300006871 Ga0075434_100896576 Ga0075434_1008965761 191
956 3300006880 Ga0075429_100098233 Ga0075429_1000982333 191
957 3300006880 Ga0075429_100806673 Ga0075429_1008066732 191
958 3300006881 Ga0068865_100001919 Ga0068865_10000191912 191
959 3300006881 Ga0068865_100018740 Ga0068865_1000187403 191
960 3300006881 Ga0068865_100027165 Ga0068865_1000271653 191
961 3300006881 Ga0068865_100215762 Ga0068865_1002157623 191
962 3300006881 Ga0068865_100766466 Ga0068865_1007664661 191
963 3300006881 Ga0068865_101055927 Ga0068865_1010559272 191
964 3300006931 Ga0097620_100170344 Ga0097620_1001703442 191
965 3300006931 Ga0097620_100181427 Ga0097620_1001814272 191
966 3300007076 Ga0075435_100477263 Ga0075435_1004772632 191
967 3300009094 Ga0111539_10006960 Ga0111539_100069608 191
968 3300009094 Ga0111539_10055878 Ga0111539_100558782 191
969 3300009094 Ga0111539_10168122 Ga0111539_101681222 191
970 3300009094 Ga0111539_10439319 Ga0111539_104393192 191
971 3300009094 Ga0111539_10909786 Ga0111539_109097862 191
972 3300009094 Ga0111539_11006395 Ga0111539_110063952 191
973 3300009098 Ga0105245_10025153 Ga0105245_100251535 191
974 3300009098 Ga0105245_10156503 Ga0105245_101565033 191
975 3300009098 Ga0105245_10348765 Ga0105245_103487652 191
976 3300009098 Ga0105245_10366369 Ga0105245_103663692 191
977 3300009098 Ga0105245_10621054 Ga0105245_106210541 191
978 3300009098 Ga0105245_10758224 Ga0105245_107582242 191
979 3300009101 Ga0105247_10092852 Ga0105247_100928522 191
980 3300009147 Ga0114129_10007795 Ga0114129_100077956 191
981 3300009147 Ga0114129_10029482 Ga0114129_100294828 191
982 3300009147 Ga0114129_10029648 Ga0114129_100296483 191
983 3300009147 Ga0114129_10069567 Ga0114129_100695674 191
984 3300009147 Ga0114129_10094167 Ga0114129_100941672 191
985 3300009147 Ga0114129_10135140 Ga0114129_101351403 191
986 3300009147 Ga0114129_10192615 Ga0114129_101926153 191
987 3300009147 Ga0114129_10718974 Ga0114129_107189742 191
988 3300009148 Ga0105243_10002852 Ga0105243_100028527 191
989 3300009148 Ga0105243_10004018 Ga0105243_1000401812 191
990 3300009148 Ga0105243_10018298 Ga0105243_100182984 191
991 3300009148 Ga0105243_10045839 Ga0105243_100458392 191
992 3300009148 Ga0105243_10207030 Ga0105243_102070302 191
993 3300009148 Ga0105243_11139448 Ga0105243_111394482 191
994 3300009174 Ga0105241_10154909 Ga0105241_101549092 191
995 3300009176 Ga0105242_10003918 Ga0105242_100039187 191
996 3300009176 Ga0105242_10034315 Ga0105242_100343153 191
997 3300009176 Ga0105242_10324597 Ga0105242_103245972 191
998 3300009176 Ga0105242_10388772 Ga0105242_103887721 191
999 3300009176 Ga0105242_10518025 Ga0105242_105180252 191
1000 3300009177 Ga0105248_10013646 Ga0105248_100136463 191
1001 3300009177 Ga0105248_10023640 Ga0105248_100236406 191
1002 3300009177 Ga0105248_10056409 Ga0105248_100564093 191
1003 3300009177 Ga0105248_10070230 Ga0105248_100702304 191
1004 3300009177 Ga0105248_10139691 Ga0105248_101396913 191
1005 3300009177 Ga0105248_10151006 Ga0105248_101510063 191
1006 3300009545 Ga0105237_10189263 Ga0105237_101892634 191
1007 3300009551 Ga0105238_10226868 Ga0105238_102268682 191
1008 3300009551 Ga0105238_10690342 Ga0105238_106903421 191
1009 3300009551 Ga0105238_11775024 Ga0105238_117750241 191
1010 3300009553 Ga0105249_10036159 Ga0105249_100361592 191
1011 3300009553 Ga0105249_10242218 Ga0105249_102422181 191
1012 3300009553 Ga0105249_10861173 Ga0105249_108611732 191
1013 3300009553 Ga0105249_10878109 Ga0105249_108781091 191
1014 3300009553 Ga0105249_10948732 Ga0105249_109487321 191
1015 3300009553 Ga0105249_11575946 Ga0105249_115759461 191
1016 3300010375 Ga0105239_10003594 Ga0105239_1000359420 191
1017 3300010375 Ga0105239_10057682 Ga0105239_100576825 191
1018 3300010375 Ga0105239_10231951 Ga0105239_102319512 191
1019 3300010375 Ga0105239_10657540 Ga0105239_106575402 191
1020 3300011119 Ga0105246_10059133 Ga0105246_100591332 191
1021 3300011119 Ga0105246_10086227 Ga0105246_100862272 191
1022 3300011119 Ga0105246_10175537 Ga0105246_101755372 191
1023 3300012480 Ga0157346_1007217 Ga0157346_10072171 191
1024 3300012495 Ga0157323_1011177 Ga0157323_10111771 191
1025 3300013102 Ga0157371_10003237 Ga0157371_100032373 191
1026 3300013104 Ga0157370_10077949 Ga0157370_100779495 191
1027 3300013104 Ga0157370_10134105 Ga0157370_101341052 191
1028 3300013105 Ga0157369_10082328 Ga0157369_100823285 191
1029 3300013296 Ga0157374_10002922 Ga0157374_100029228 191
1030 3300013296 Ga0157374_10064373 Ga0157374_100643734 191
1031 3300013297 Ga0157378_10009605 Ga0157378_1000960511 191
1032 3300013297 Ga0157378_10204936 Ga0157378_102049361 191
1033 3300013306 Ga0163162_10012972 Ga0163162_100129724 191
1034 3300013306 Ga0163162_10244349 Ga0163162_102443492 191
1035 3300013307 Ga0157372_10138023 Ga0157372_101380232 191
1036 3300013308 Ga0157375_10010091 Ga0157375_100100912 191
1037 3300013308 Ga0157375_10031393 Ga0157375_100313937 191
1038 3300013308 Ga0157375_10118768 Ga0157375_101187682 191
1039 3300013308 Ga0157375_10129216 Ga0157375_101292162 191
1040 3300013308 Ga0157375_10327179 Ga0157375_103271792 191
1041 3300013308 Ga0157375_10547655 Ga0157375_105476552 191
1042 3300013308 Ga0157375_10712279 Ga0157375_107122793 191
1043 3300014325 Ga0163163_10404237 Ga0163163_104042372 191
1044 3300014326 Ga0157380_10018392 Ga0157380_100183927 191
1045 3300014326 Ga0157380_10153424 Ga0157380_101534242 191
1046 3300014326 Ga0157380_10619835 Ga0157380_106198351 191
1047 3300014326 Ga0157380_10889341 Ga0157380_108893411 191
1048 3300014745 Ga0157377_10004196 Ga0157377_100041962 191
1049 3300014745 Ga0157377_10008804 Ga0157377_100088042 191
1050 3300014745 Ga0157377_10021163 Ga0157377_100211631 191
1051 3300014745 Ga0157377_10112008 Ga0157377_101120082 191
1052 3300014745 Ga0157377_10459183 Ga0157377_104591832 191
1053 3300014968 Ga0157379_10153860 Ga0157379_101538602 191
1054 3300014968 Ga0157379_10174860 Ga0157379_101748602 191
1055 3300014969 Ga0157376_10023873 Ga0157376_100238732 191
1056 3300014969 Ga0157376_10028067 Ga0157376_100280675 191
1057 3300014969 Ga0157376_10148756 Ga0157376_101487562 191
1058 3300014969 Ga0157376_10818627 Ga0157376_108186272 191
1059 3300014969 Ga0157376_11503521 Ga0157376_115035212 191
1060 3300017792 Ga0163161_10086635 Ga0163161_100866352 191
1061 3300017792 Ga0163161_10494437 Ga0163161_104944372 191
1062 3300025315 Ga0207697_10282368 Ga0207697_102823681 191
1063 3300025321 Ga0207656_10069889 Ga0207656_100698892 191
1064 3300025885 Ga0207653_10133751 Ga0207653_101337512 191
1065 3300025898 Ga0207692_10013929 Ga0207692_100139294 191
1066 3300025899 Ga0207642_10047715 Ga0207642_100477152 191
1067 3300025900 Ga0207710_10115894 Ga0207710_101158942 191
1068 3300025901 Ga0207688_10011008 Ga0207688_100110084 191
1069 3300025901 Ga0207688_10054867 Ga0207688_100548671 191
1070 3300025901 Ga0207688_10131783 Ga0207688_101317832 191
1071 3300025901 Ga0207688_10136331 Ga0207688_101363312 191
1072 3300025901 Ga0207688_10284066 Ga0207688_102840662 191
1073 3300025903 Ga0207680_10260457 Ga0207680_102604572 191
1074 3300025904 Ga0207647_10038276 Ga0207647_100382765 191
1075 3300025905 Ga0207685_10056970 Ga0207685_100569702 191
1076 3300025906 Ga0207699_10307691 Ga0207699_103076912 191
1077 3300025906 Ga0207699_10547100 Ga0207699_105471002 191
1078 3300025907 Ga0207645_10656003 Ga0207645_106560031 191
1079 3300025908 Ga0207643_10008599 Ga0207643_100085995 191
1080 3300025910 Ga0207684_10096781 Ga0207684_100967813 191
1081 3300025911 Ga0207654_10053813 Ga0207654_100538132 191
1082 3300025912 Ga0207707_10086840 Ga0207707_100868402 191
1083 3300025912 Ga0207707_10292858 Ga0207707_102928581 191
1084 3300025915 Ga0207693_10005349 Ga0207693_100053498 191
1085 3300025917 Ga0207660_10136592 Ga0207660_101365922 191
1086 3300025918 Ga0207662_10072931 Ga0207662_100729313 191
1087 3300025918 Ga0207662_10483614 Ga0207662_104836141 191
1088 3300025919 Ga0207657_10005874 Ga0207657_100058744 191
1089 3300025919 Ga0207657_10066876 Ga0207657_100668764 191
1090 3300025919 Ga0207657_10069084 Ga0207657_100690843 191
1091 3300025920 Ga0207649_10037560 Ga0207649_100375602 191
1092 3300025920 Ga0207649_10100604 Ga0207649_101006042 191
1093 3300025920 Ga0207649_10644917 Ga0207649_106449172 191
1094 3300025921 Ga0207652_10019122 Ga0207652_100191225 191
1095 3300025921 Ga0207652_10213940 Ga0207652_102139402 191
1096 3300025921 Ga0207652_10331764 Ga0207652_103317642 191
1097 3300025922 Ga0207646_10002487 Ga0207646_1000248712 191
1098 3300025922 Ga0207646_10098852 Ga0207646_100988522 191
1099 3300025922 Ga0207646_10484004 Ga0207646_104840042 191
1100 3300025923 Ga0207681_10045300 Ga0207681_100453002 191
1101 3300025923 Ga0207681_10194571 Ga0207681_101945712 191
1102 3300025923 Ga0207681_10252032 Ga0207681_102520322 191
1103 3300025924 Ga0207694_10521641 Ga0207694_105216412 191
1104 3300025925 Ga0207650_10259495 Ga0207650_102594952 191
1105 3300025926 Ga0207659_10045490 Ga0207659_100454902 191
1106 3300025926 Ga0207659_10069162 Ga0207659_100691622 191
1107 3300025926 Ga0207659_10070085 Ga0207659_100700851 191
1108 3300025927 Ga0207687_10108990 Ga0207687_101089902 191
1109 3300025927 Ga0207687_10130770 Ga0207687_101307702 191
1110 3300025927 Ga0207687_10163871 Ga0207687_101638711 191
1111 3300025927 Ga0207687_10307823 Ga0207687_103078232 191
1112 3300025931 Ga0207644_10207153 Ga0207644_102071532 191
1113 3300025931 Ga0207644_10216073 Ga0207644_102160732 191
1114 3300025931 Ga0207644_10392370 Ga0207644_103923702 191
1115 3300025932 Ga0207690_10099319 Ga0207690_100993192 191
1116 3300025932 Ga0207690_10124237 Ga0207690_101242372 191
1117 3300025932 Ga0207690_10125592 Ga0207690_101255922 191
1118 3300025932 Ga0207690_10209454 Ga0207690_102094542 191
1119 3300025933 Ga0207706_10006537 Ga0207706_1000653712 191
1120 3300025933 Ga0207706_10225138 Ga0207706_102251382 191
1121 3300025933 Ga0207706_10287459 Ga0207706_102874592 191
1122 3300025933 Ga0207706_10348230 Ga0207706_103482302 191
1123 3300025933 Ga0207706_10750737 Ga0207706_107507371 191
1124 3300025934 Ga0207686_10108936 Ga0207686_101089362 191
1125 3300025934 Ga0207686_10155245 Ga0207686_101552453 191
1126 3300025934 Ga0207686_10231673 Ga0207686_102316731 191
1127 3300025934 Ga0207686_10313772 Ga0207686_103137722 191
1128 3300025935 Ga0207709_10001437 Ga0207709_1000143719 191
1129 3300025935 Ga0207709_10156617 Ga0207709_101566171 191
1130 3300025936 Ga0207670_10116442 Ga0207670_101164422 191
1131 3300025936 Ga0207670_10173061 Ga0207670_101730611 191
1132 3300025937 Ga0207669_10000947 Ga0207669_1000094715 191
1133 3300025937 Ga0207669_10006120 Ga0207669_100061203 191
1134 3300025937 Ga0207669_10049230 Ga0207669_100492302 191
1135 3300025937 Ga0207669_10151608 Ga0207669_101516082 191
1136 3300025937 Ga0207669_10240137 Ga0207669_102401372 191
1137 3300025937 Ga0207669_10440515 Ga0207669_104405152 191
1138 3300025937 Ga0207669_10468231 Ga0207669_104682312 191
1139 3300025938 Ga0207704_10023320 Ga0207704_100233203 191
1140 3300025938 Ga0207704_10062915 Ga0207704_100629152 191
1141 3300025938 Ga0207704_10077341 Ga0207704_100773412 191
1142 3300025938 Ga0207704_10128948 Ga0207704_101289482 191
1143 3300025939 Ga0207665_10030779 Ga0207665_100307795 191
1144 3300025940 Ga0207691_10003841 Ga0207691_1000384117 191
1145 3300025940 Ga0207691_10006369 Ga0207691_100063691 191
1146 3300025940 Ga0207691_10008449 Ga0207691_1000844911 191
1147 3300025940 Ga0207691_10104092 Ga0207691_101040922 191
1148 3300025940 Ga0207691_10343210 Ga0207691_103432103 191
1149 3300025940 Ga0207691_10712908 Ga0207691_107129082 191
1150 3300025941 Ga0207711_10009650 Ga0207711_100096507 191
1151 3300025941 Ga0207711_10273383 Ga0207711_102733832 191
1152 3300025941 Ga0207711_10359983 Ga0207711_103599832 191
1153 3300025942 Ga0207689_10089764 Ga0207689_100897643 191
1154 3300025942 Ga0207689_10321019 Ga0207689_103210192 191
1155 3300025942 Ga0207689_11106369 Ga0207689_111063691 191
1156 3300025944 Ga0207661_10002036 Ga0207661_1000203611 191
1157 3300025944 Ga0207661_10082144 Ga0207661_100821442 191
1158 3300025944 Ga0207661_10202798 Ga0207661_102027982 191
1159 3300025944 Ga0207661_10700650 Ga0207661_107006502 191
1160 3300025945 Ga0207679_10021002 Ga0207679_100210022 191
1161 3300025945 Ga0207679_10207458 Ga0207679_102074582 191
1162 3300025945 Ga0207679_11180324 Ga0207679_111803242 191
1163 3300025949 Ga0207667_10055537 Ga0207667_100555373 191
1164 3300025949 Ga0207667_10497585 Ga0207667_104975852 191
1165 3300025960 Ga0207651_10147625 Ga0207651_101476251 191
1166 3300025961 Ga0207712_10032939 Ga0207712_100329393 191
1167 3300025961 Ga0207712_10091634 Ga0207712_100916342 191
1168 3300025972 Ga0207668_10074588 Ga0207668_100745882 191
1169 3300025972 Ga0207668_10110331 Ga0207668_101103313 191
1170 3300025972 Ga0207668_10116078 Ga0207668_101160782 191
1171 3300025972 Ga0207668_10349224 Ga0207668_103492242 191
1172 3300025972 Ga0207668_10873734 Ga0207668_108737341 191
1173 3300025981 Ga0207640_10012755 Ga0207640_100127552 191
1174 3300025981 Ga0207640_10189765 Ga0207640_101897652 191
1175 3300026023 Ga0207677_10009016 Ga0207677_100090167 191
1176 3300026023 Ga0207677_10049683 Ga0207677_100496834 191
1177 3300026023 Ga0207677_10321978 Ga0207677_103219782 191
1178 3300026023 Ga0207677_10659204 Ga0207677_106592042 191
1179 3300026035 Ga0207703_10280079 Ga0207703_102800792 191
1180 3300026041 Ga0207639_10030317 Ga0207639_100303172 191
1181 3300026067 Ga0207678_10031959 Ga0207678_100319594 191
1182 3300026067 Ga0207678_10149383 Ga0207678_101493832 191
1183 3300026075 Ga0207708_10002124 Ga0207708_1000212412 191
1184 3300026075 Ga0207708_10006686 Ga0207708_100066866 191
1185 3300026075 Ga0207708_10110388 Ga0207708_101103883 191
1186 3300026075 Ga0207708_10264944 Ga0207708_102649442 191
1187 3300026075 Ga0207708_10384297 Ga0207708_103842972 191
1188 3300026075 Ga0207708_10744853 Ga0207708_107448532 191
1189 3300026078 Ga0207702_11080384 Ga0207702_110803841 191
1190 3300026078 Ga0207702_11163827 Ga0207702_111638271 191
1191 3300026078 Ga0207702_11723882 Ga0207702_117238821 191
1192 3300026088 Ga0207641_10257216 Ga0207641_102572162 191
1193 3300026088 Ga0207641_10871722 Ga0207641_108717222 191
1194 3300026089 Ga0207648_10003665 Ga0207648_1000366520 191
1195 3300026089 Ga0207648_10009895 Ga0207648_1000989510 191
1196 3300026089 Ga0207648_10039067 Ga0207648_100390673 191
1197 3300026089 Ga0207648_10301333 Ga0207648_103013332 191
1198 3300026089 Ga0207648_10547597 Ga0207648_105475972 191
1199 3300026095 Ga0207676_10275849 Ga0207676_102758492 191
1200 3300026116 Ga0207674_10021501 Ga0207674_100215016 191
1201 3300026116 Ga0207674_10193162 Ga0207674_101931622 191
1202 3300026116 Ga0207674_10197444 Ga0207674_101974442 191
1203 3300026118 Ga0207675_100056521 Ga0207675_1000565212 191
1204 3300026118 Ga0207675_100056538 Ga0207675_1000565381 191
1205 3300026118 Ga0207675_100212709 Ga0207675_1002127092 191
1206 3300026118 Ga0207675_101304271 Ga0207675_1013042712 191
1207 3300026121 Ga0207683_10000549 Ga0207683_100005492 191
1208 3300026121 Ga0207683_10036267 Ga0207683_100362674 191
1209 3300026121 Ga0207683_10245648 Ga0207683_102456482 191
1210 3300026121 Ga0207683_10368552 Ga0207683_103685522 191
1211 3300026142 Ga0207698_10019467 Ga0207698_100194673 191
1212 3300026142 Ga0207698_10082054 Ga0207698_100820542 191
1213 3300026142 Ga0207698_10295128 Ga0207698_102951281 191
1214 3300027424 Ga0209984_1029244 Ga0209984_10292441 191
1215 3300027907 Ga0207428_10000281 Ga0207428_1000028172 191
1216 3300027907 Ga0207428_10001649 Ga0207428_1000164916 191
1217 3300027907 Ga0207428_10154897 Ga0207428_101548972 191
1218 3300028379 Ga0268266_10050971 Ga0268266_100509712 191
1219 3300028380 Ga0268265_10221831 Ga0268265_102218312 191
1220 3300028381 Ga0268264_10026449 Ga0268264_100264496 191
1221 3300031247 Ga0265340_10136756 Ga0265340_101367562 191
1222 3300031548 Ga0307408_100230399 Ga0307408_1002303992 191
1223 3300031548 Ga0307408_100304815 Ga0307408_1003048152 191
1224 3300031911 Ga0307412_10158228 Ga0307412_101582282 191
1225 3300031995 Ga0307409_100882680 Ga0307409_1008826801 191
1226 3300032002 Ga0307416_100077088 Ga0307416_1000770883 191
1227 3300032002 Ga0307416_100464532 Ga0307416_1004645322 191
1228 3300032002 Ga0307416_100484709 Ga0307416_1004847091 191
1229 3300032002 Ga0307416_100553527 Ga0307416_1005535272 191
1230 3300032126 Ga0307415_100322925 Ga0307415_1003229251 191
1231 3300032126 Ga0307415_100665901 Ga0307415_1006659012 191
1232 3300034817 Ga0373948_0021494 Ga0373948_0021494_557_1132 191
1233 3300034818 Ga0373950_0020163 Ga0373950_0020163_468_1043 191
1234 3300035083 Ga0373926_0086331 Ga0373926_0086331_397_981 191
1235 3300035084 Ga0373928_0023996 Ga0373928_0023996_28_603 191
1236 3300035091 Ga0373951_0117435 Ga0373951_0117435_94_684 191
1237 3300035112 Ga0373932_0012542 Ga0373932_0012542_403_978 191
1238 3300035114 Ga0373939_0009939 Ga0373939_0009939_795_1370 191
1239 3300035116 Ga0373945_0007187 Ga0373945_0007187_1401_1985 191
1240 3300035121 Ga0373960_0014956 Ga0373960_0014956_1035_1610 191
1241 3300035170 Ga0373943_0000101 Ga0373943_0000101_15518_16102 191
1242 3300035207 Ga0373942_0104227 Ga0373942_0104227_59_634 191
1243 3300035241 Ga0373961_0026558 Ga0373961_0026558_577_1152 191
1244 3300035692 Ga0373935_0003186 Ga0373935_0003186_4176_4760 191
1245 3300035725 Ga0373947_0004984 Ga0373947_0004984_1729_2313 191
1246 3300037068 Ga0373925_0001828 Ga0373925_0001828_5899_6483 191
1247 3300037068 Ga0373925_0079083 Ga0373925_0079083_773_1348 191
1248 3300037312 Ga0395899_0003147 Ga0395899_0003147_12087_12665 191
1249 3300037312 Ga0395899_0010040 Ga0395899_0010040_3950_4528 191
1250 3300037312 Ga0395899_0021434 Ga0395899_0021434_2601_3191 191
1251 3300037312 Ga0395899_0032419 Ga0395899_0032419_2798_3373 191
1252 3300037312 Ga0395899_0049967 Ga0395899_0049967_549_1127 191
1253 3300037312 Ga0395899_0135604 Ga0395899_0135604_674_1252 191
1254 3300037312 Ga0395899_0174544 Ga0395899_0174544_796_1377 191
1255 3300037312 Ga0395899_0188481 Ga0395899_0188481_725_1306 191
1256 3300037312 Ga0395899_0264649 Ga0395899_0264649_398_982 191
1257 3300037312 Ga0395899_0316986 Ga0395899_0316986_86_667 191
1258 3300037312 Ga0395899_0409445 Ga0395899_0409445_174_755 191
1259 3300037418 Ga0395900_0001024 Ga0395900_0001024_13892_14473 191
1260 3300037418 Ga0395900_0012099 Ga0395900_0012099_6659_7234 191
1261 3300037418 Ga0395900_0012528 Ga0395900_0012528_1345_1923 191
1262 3300037418 Ga0395900_0012687 Ga0395900_0012687_3993_4574 191
1263 3300037418 Ga0395900_0013415 Ga0395900_0013415_4602_5180 191
1264 3300037418 Ga0395900_0017742 Ga0395900_0017742_992_1570 191
1265 3300037418 Ga0395900_0024421 Ga0395900_0024421_972_1553 191
1266 3300037418 Ga0395900_0027352 Ga0395900_0027352_2545_3135 191
1267 3300037418 Ga0395900_0038465 Ga0395900_0038465_132_707 191
1268 3300037418 Ga0395900_0099610 Ga0395900_0099610_498_1076 191
1269 3300037418 Ga0395900_0135204 Ga0395900_0135204_1033_1611 191
1270 3300037418 Ga0395900_0154503 Ga0395900_0154503_1043_1624 191
1271 3300037418 Ga0395900_0311967 Ga0395900_0311967_148_735 191
1272 3300037418 Ga0395900_0426865 Ga0395900_0426865_33_614 191
1273 3300037418 Ga0395900_0511889 Ga0395900_0511889_535_1119 191
1274 3300037418 Ga0395900_0535671 Ga0395900_0535671_59_637 191
1275 3300037418 Ga0395900_0573777 Ga0395900_0573777_386_964 191
1276 3300037466 Ga0395898_0002538 Ga0395898_0002538_5317_5898 191
1277 3300037466 Ga0395898_0014811 Ga0395898_0014811_699_1280 191
1278 3300037466 Ga0395898_0024460 Ga0395898_0024460_5013_5591 191
1279 3300037466 Ga0395898_0044611 Ga0395898_0044611_3212_3787 191
1280 3300037466 Ga0395898_0045782 Ga0395898_0045782_2546_3124 191
1281 3300037466 Ga0395898_0063561 Ga0395898_0063561_209_784 191
1282 3300037466 Ga0395898_0065003 Ga0395898_0065003_472_1050 191
1283 3300037466 Ga0395898_0086495 Ga0395898_0086495_1599_2180 191
1284 3300037466 Ga0395898_0126047 Ga0395898_0126047_753_1334 191
1285 3300037466 Ga0395898_0203722 Ga0395898_0203722_965_1546 191
1286 3300037466 Ga0395898_0228734 Ga0395898_0228734_540_1121 191
1287 3300037466 Ga0395898_0270714 Ga0395898_0270714_598_1176 191
1288 3300037466 Ga0395898_0313956 Ga0395898_0313956_19_600 191
1289 3300037466 Ga0395898_0373143 Ga0395898_0373143_662_1240 191
1290 3300037471 Ga0395905_0005601 Ga0395905_0005601_11459_12034 191
1291 3300037471 Ga0395905_0008711 Ga0395905_0008711_7813_8403 191
1292 3300037471 Ga0395905_0013885 Ga0395905_0013885_6741_7319 191
1293 3300037471 Ga0395905_0014723 Ga0395905_0014723_3851_4429 191
1294 3300037471 Ga0395905_0022631 Ga0395905_0022631_4812_5393 191
1295 3300037471 Ga0395905_0056874 Ga0395905_0056874_655_1233 191
1296 3300037471 Ga0395905_0098791 Ga0395905_0098791_479_1057 191
1297 3300037471 Ga0395905_0106700 Ga0395905_0106700_618_1199 191
1298 3300037471 Ga0395905_0149900 Ga0395905_0149900_1324_1908 191
1299 3300037471 Ga0395905_0234634 Ga0395905_0234634_495_1073 191
1300 3300037471 Ga0395905_0306968 Ga0395905_0306968_748_1326 191
1301 3300037471 Ga0395905_0346391 Ga0395905_0346391_357_935 191
1302 3300037471 Ga0395905_0366670 Ga0395905_0366670_291_872 191
1303 3300037471 Ga0395905_1163978 Ga0395905_1163978_71_652 191
1304 3300038443 Ga0395901_0001193 Ga0395901_0001193_13892_14473 191
1305 3300038443 Ga0395901_0005850 Ga0395901_0005850_10109_10690 191
1306 3300038443 Ga0395901_0006596 Ga0395901_0006596_7921_8502 191
1307 3300038443 Ga0395901_0010416 Ga0395901_0010416_1806_2381 191
1308 3300038443 Ga0395901_0012045 Ga0395901_0012045_1239_1817 191
1309 3300038443 Ga0395901_0023493 Ga0395901_0023493_3264_3845 191
1310 3300038443 Ga0395901_0059988 Ga0395901_0059988_689_1273 191
1311 3300038443 Ga0395901_0073467 Ga0395901_0073467_1176_1754 191
1312 3300038443 Ga0395901_0086070 Ga0395901_0086070_2335_2916 191
1313 3300038443 Ga0395901_0199419 Ga0395901_0199419_156_734 191
1314 3300038443 Ga0395901_0224770 Ga0395901_0224770_845_1423 191
1315 3300038443 Ga0395901_0261387 Ga0395901_0261387_569_1147 191
1316 3300038443 Ga0395901_0289161 Ga0395901_0289161_475_1059 191
1317 3300038443 Ga0395901_0574803 Ga0395901_0574803_45_620 191
1318 3300038443 Ga0395901_0657841 Ga0395901_0657841_193_774 191
1319 3300038443 Ga0395901_1229725 Ga0395901_1229725_31_612 191
1320 3300038443 Ga0395901_1465656 Ga0395901_1465656_13_591 191
1321 3300041406 Ga0439439_0001037 Ga0439439_0001037_3666_4241 191
1322 3300041408 Ga0439453_0008564 Ga0439453_0008564_740_1315 191
1323 3300041411 Ga0439466_0186432 Ga0439466_0186432_15_590 191
1324 3300041512 Ga0451853_2505818 Ga0451853_2505818_553_1128 191
1325 3300041997 Ga0439431_0002677 Ga0439431_0002677_1195_1770 191
1326 3300042001 Ga0439441_004017 Ga0439441_004017_17_601 191
1327 3300042002 Ga0439442_009550 Ga0439442_009550_475_1050 191
1328 3300042005 Ga0439448_0048539 Ga0439448_0048539_553_1128 191
1329 3300042005 Ga0439448_0194377 Ga0439448_0194377_33_608 191
1330 3300042007 Ga0439449_0150972 Ga0439449_0150972_17_592 191
1331 3300042009 Ga0439451_000740 Ga0439451_000740_186_761 191
1332 3300042011 Ga0439454_038204 Ga0439454_038204_143_718 191
1333 3300042014 Ga0439457_010156 Ga0439457_010156_1423_1998 191
1334 3300042015 Ga0439462_0000280 Ga0439462_0000280_2334_2909 191
1335 3300042016 Ga0439463_032301 Ga0439463_032301_520_1095 191
1336 3300042145 Ga0450906_005415 Ga0450906_005415_985_1560 191
1337 3300042156 Ga0439446_0001239 Ga0439446_0001239_119_694 191
1338 3300042184 Ga0450908_016948 Ga0450908_016948_203_778 191
1339 3300042435 Ga0439434_0020330 Ga0439434_0020330_826_1401 191
1340 3300044656 Ga0466969_0164408 Ga0466969_0164408_231_809 191
1341 3300044693 Ga0466961_0144025 Ga0466961_0144025_901_1479 191
1342 3300044693 Ga0466961_0225218 Ga0466961_0225218_69_647 191
1343 3300044694 Ga0466963_0163206 Ga0466963_0163206_775_1353 191
1344 3300045049 Ga0466959_0048878 Ga0466959_0048878_754_1332 191
1345 3300045049 Ga0466959_0637054 Ga0466959_0637054_96_674 191
1346 3300045051 Ga0451576_0548808 Ga0451576_0548808_86_661 191
1347 3300045976 Ga0466967_1244920 Ga0466967_1244920_118_693 191
1348 3300046454 Ga0495592_0062905 Ga0495592_0062905_764_1342 191
1349 3300046455 Ga0495603_0003671 Ga0495603_0003671_4877_5452 191
1350 3300046455 Ga0495603_0009496 Ga0495603_0009496_1409_1987 191
1351 3300046455 Ga0495603_0053150 Ga0495603_0053150_1738_2322 191
1352 3300046455 Ga0495603_0287731 Ga0495603_0287731_175_756 191
1353 3300046459 Ga0495629_0000670 Ga0495629_0000670_2370_2954 191
1354 3300046461 Ga0495641_0000374 Ga0495641_0000374_12848_13432 191
1355 3300046461 Ga0495641_0222404 Ga0495641_0222404_89_664 191
1356 3300046463 Ga0495653_0011141 Ga0495653_0011141_1704_2288 191
1357 3300046473 Ga0495582_0000124 Ga0495582_0000124_24561_25145 191
1358 3300046474 Ga0495605_0149814 Ga0495605_0149814_417_995 191
1359 3300046474 Ga0495605_0200248 Ga0495605_0200248_163_738 191
1360 3300046475 Ga0495639_0000786 Ga0495639_0000786_12542_13126 191
1361 3300046475 Ga0495639_0003815 Ga0495639_0003815_428_1003 191
1362 3300046476 Ga0495662_0000898 Ga0495662_0000898_5474_6058 191
1363 3300046491 Ga0495584_0062100 Ga0495584_0062100_1152_1727 191
1364 3300046491 Ga0495584_0212362 Ga0495584_0212362_134_709 191
1365 3300046491 Ga0495584_0243869 Ga0495584_0243869_246_821 191
1366 3300046492 Ga0495585_0077794 Ga0495585_0077794_863_1447 191
1367 3300046499 Ga0495594_0121806 Ga0495594_0121806_267_842 191
1368 3300046499 Ga0495594_0211173 Ga0495594_0211173_170_754 191
1369 3300046500 Ga0495596_0021413 Ga0495596_0021413_592_1167 191
1370 3300046500 Ga0495596_0095088 Ga0495596_0095088_86_670 191
1371 3300046506 Ga0495583_0126736 Ga0495583_0126736_95_679 191
1372 3300046517 Ga0495630_0007417 Ga0495630_0007417_6910_7494 191
1373 3300046518 Ga0495631_0053729 Ga0495631_0053729_357_941 191
1374 3300046526 Ga0495666_0059325 Ga0495666_0059325_187_771 191
1375 3300046526 Ga0495666_0127260 Ga0495666_0127260_274_849 191
1376 3300046531 Ga0495665_0000249 Ga0495665_0000249_5377_5961 191
1377 3300046531 Ga0495665_0187753 Ga0495665_0187753_335_910 191
1378 3300046533 Ga0495640_0099521 Ga0495640_0099521_1072_1656 191
1379 3300046535 Ga0495586_0028291 Ga0495586_0028291_1667_2347 191
1380 3300046535 Ga0495586_0186918 Ga0495586_0186918_247_831 191
1381 3300046537 Ga0495598_0052795 Ga0495598_0052795_469_1044 191
1382 3300046538 Ga0495609_0022647 Ga0495609_0022647_1669_2253 191
1383 3300046559 Ga0495667_0268961 Ga0495667_0268961_57_632 191
1384 3300046615 Ga0495656_0032415 Ga0495656_0032415_789_1364 191
1385 3300046642 Ga0495634_0008524 Ga0495634_0008524_1343_1927 191
1386 3300046663 Ga0495635_0037003 Ga0495635_0037003_2296_2880 191
1387 3300046664 Ga0495659_0008968 Ga0495659_0008968_2220_2804 191
1388 3300046674 Ga0495588_0065866 Ga0495588_0065866_276_857 191
1389 3300046674 Ga0495588_0120144 Ga0495588_0120144_722_1297 191
1390 3300046681 Ga0495647_0008423 Ga0495647_0008423_658_1233 191
1391 3300046683 Ga0495658_0000247 Ga0495658_0000247_15770_16354 191
1392 3300046683 Ga0495658_0007032 Ga0495658_0007032_2855_3535 191
1393 3300046683 Ga0495658_0060215 Ga0495658_0060215_573_1148 191
1394 3300046683 Ga0495658_0620463 Ga0495658_0620463_25_600 191
1395 3300046689 Ga0495613_0019190 Ga0495613_0019190_385_1065 191
1396 3300046689 Ga0495613_0137857 Ga0495613_0137857_247_837 191
1397 3300046691 Ga0495670_0156634 Ga0495670_0156634_599_1174 191
1398 3300046691 Ga0495670_0358174 Ga0495670_0358174_106_681 191
1399 3300046794 Ga0495589_0053546 Ga0495589_0053546_1108_1692 191
1400 3300046794 Ga0495589_0079443 Ga0495589_0079443_870_1445 191
1401 3300046794 Ga0495589_0082966 Ga0495589_0082966_621_1205 191
1402 3300046794 Ga0495589_0249247 Ga0495589_0249247_113_691 191
1403 3300047315 Ga0495581_0002147 Ga0495581_0002147_8646_9221 191
1404 3300047315 Ga0495581_0004417 Ga0495581_0004417_637_1221 191
1405 3300047315 Ga0495581_0019975 Ga0495581_0019975_1345_1920 191
1406 3300047317 Ga0495604_0402934 Ga0495604_0402934_109_699 191
1407 3300047319 Ga0495674_0003941 Ga0495674_0003941_4932_5516 191
1408 3300047319 Ga0495674_0011930 Ga0495674_0011930_2854_3534 191
1409 3300047319 Ga0495674_0526933 Ga0495674_0526933_339_917 191
1410 3300047321 Ga0495676_0001077 Ga0495676_0001077_15502_16086 191
1411 3300047321 Ga0495676_0464069 Ga0495676_0464069_64_642 191
1412 3300047322 Ga0495680_0083212 Ga0495680_0083212_1071_1655 191
1413 3300047322 Ga0495680_0170949 Ga0495680_0170949_529_1107 191
1414 3300047323 Ga0495683_0301024 Ga0495683_0301024_76_654 191
1415 3300047445 Ga0495677_0054560 Ga0495677_0054560_529_1113 191
1416 3300047471 Ga0495684_0036467 Ga0495684_0036467_3093_3677 191
1417 3300047673 Ga0495593_0027759 Ga0495593_0027759_107_691 191
1418 3300048089 Ga0495614_0016364 Ga0495614_0016364_2502_3086 191
1419 3300048903 Ga0496100_0019720 Ga0496100_0019720_2969_3550 191
1420 3300048903 Ga0496100_0330889 Ga0496100_0330889_286_861 191
1421 3300048903 Ga0496100_0381827 Ga0496100_0381827_73_648 191
1422 3300048903 Ga0496100_0395330 Ga0496100_0395330_434_1015 191
1423 3300048903 Ga0496100_0577610 Ga0496100_0577610_121_696 191
1424 3300048904 Ga0496101_0009476 Ga0496101_0009476_4497_5072 191
1425 3300048904 Ga0496101_0017088 Ga0496101_0017088_782_1363 191
1426 3300048904 Ga0496101_0089027 Ga0496101_0089027_1400_1975 191
1427 3300048904 Ga0496101_0189139 Ga0496101_0189139_377_958 191
1428 3300048904 Ga0496101_0578947 Ga0496101_0578947_92_667 191
1429 3300048905 Ga0496102_0012890 Ga0496102_0012890_5325_5900 191
1430 3300048905 Ga0496102_0105897 Ga0496102_0105897_1255_1872 191
1431 3300048905 Ga0496102_0223199 Ga0496102_0223199_85_663 191
1432 3300048905 Ga0496102_0254483 Ga0496102_0254483_231_812 191
1433 3300048905 Ga0496102_0339477 Ga0496102_0339477_344_925 191
1434 3300048906 Ga0496103_0001779 Ga0496103_0001779_9687_10262 191
1435 3300048906 Ga0496103_0227213 Ga0496103_0227213_95_670 191
1436 3300048906 Ga0496103_0248071 Ga0496103_0248071_246_821 191
1437 3300048907 Ga0496104_0002542 Ga0496104_0002542_5185_5766 191
1438 3300048907 Ga0496104_0019413 Ga0496104_0019413_1150_1725 191
1439 3300048907 Ga0496104_0188485 Ga0496104_0188485_971_1546 191
1440 3300048907 Ga0496104_0596004 Ga0496104_0596004_93_668 191
1441 3300048908 Ga0496105_0000594 Ga0496105_0000594_15173_15754 191
1442 3300048908 Ga0496105_0016150 Ga0496105_0016150_387_962 191
1443 3300048908 Ga0496105_0184941 Ga0496105_0184941_761_1336 191
1444 3300048908 Ga0496105_0265414 Ga0496105_0265414_642_1217 191
1445 3300048908 Ga0496105_0304991 Ga0496105_0304991_679_1254 191
1446 3300048908 Ga0496105_0590246 Ga0496105_0590246_76_651 191
1447 3300048909 Ga0496106_0196852 Ga0496106_0196852_639_1214 191
1448 3300048909 Ga0496106_0255171 Ga0496106_0255171_642_1217 191
1449 3300048910 Ga0496107_0009167 Ga0496107_0009167_2551_3126 191
1450 3300048910 Ga0496107_0094627 Ga0496107_0094627_1318_1899 191
1451 3300048910 Ga0496107_0196205 Ga0496107_0196205_682_1257 191
1452 3300048910 Ga0496107_0515437 Ga0496107_0515437_28_603 191
1453 3300048911 Ga0496108_0002772 Ga0496108_0002772_7045_7626 191
1454 3300048911 Ga0496108_0010621 Ga0496108_0010621_6120_6704 191
1455 3300048911 Ga0496108_0033557 Ga0496108_0033557_2920_3495 191
1456 3300048911 Ga0496108_0070057 Ga0496108_0070057_1098_1673 191
1457 3300048911 Ga0496108_0071796 Ga0496108_0071796_1884_2462 191
1458 3300048911 Ga0496108_0098963 Ga0496108_0098963_1836_2453 191
1459 3300048911 Ga0496108_0444905 Ga0496108_0444905_468_1052 191
1460 3300048911 Ga0496108_0546329 Ga0496108_0546329_302_877 191
1461 3300048912 Ga0496109_0000463 Ga0496109_0000463_24577_25158 191
1462 3300048912 Ga0496109_0007742 Ga0496109_0007742_5896_6513 191
1463 3300048912 Ga0496109_0013960 Ga0496109_0013960_3464_4048 191
1464 3300048912 Ga0496109_0043098 Ga0496109_0043098_2126_2701 191
1465 3300048912 Ga0496109_0046500 Ga0496109_0046500_2352_2936 191
1466 3300048912 Ga0496109_0144377 Ga0496109_0144377_565_1152 191
1467 3300048912 Ga0496109_0159036 Ga0496109_0159036_1153_1728 191
1468 3300048912 Ga0496109_0225958 Ga0496109_0225958_44_619 191
1469 3300048912 Ga0496109_0354289 Ga0496109_0354289_111_686 191
1470 3300048912 Ga0496109_0366537 Ga0496109_0366537_138_725 191
1471 3300048912 Ga0496109_0792870 Ga0496109_0792870_189_770 191
1472 3300048912 Ga0496109_1461006 Ga0496109_1461006_17_592 191
1473 3300048913 Ga0496110_0001516 Ga0496110_0001516_5685_6269 191
1474 3300048913 Ga0496110_0005397 Ga0496110_0005397_7709_8290 191
1475 3300048913 Ga0496110_0007165 Ga0496110_0007165_5991_6608 191
1476 3300048913 Ga0496110_0065042 Ga0496110_0065042_2347_2928 191
1477 3300048913 Ga0496110_0065623 Ga0496110_0065623_1922_2497 191
1478 3300048913 Ga0496110_0130540 Ga0496110_0130540_1439_2014 191
1479 3300048913 Ga0496110_0167005 Ga0496110_0167005_1296_1871 191
1480 3300048913 Ga0496110_0249118 Ga0496110_0249118_767_1348 191
1481 3300048914 Ga0496111_0001509 Ga0496111_0001509_7608_8192 191
1482 3300048914 Ga0496111_0004584 Ga0496111_0004584_3507_4088 191
1483 3300048914 Ga0496111_0011653 Ga0496111_0011653_3771_4388 191
1484 3300048914 Ga0496111_0051968 Ga0496111_0051968_1107_1682 191
1485 3300048914 Ga0496111_0127975 Ga0496111_0127975_927_1502 191
1486 3300048914 Ga0496111_0326108 Ga0496111_0326108_45_623 191
1487 3300048914 Ga0496111_0354464 Ga0496111_0354464_417_992 191
1488 3300048915 Ga0496112_0006938 Ga0496112_0006938_7211_7786 191
1489 3300048915 Ga0496112_0035402 Ga0496112_0035402_3850_4425 191
1490 3300048915 Ga0496112_0087695 Ga0496112_0087695_1404_2021 191
1491 3300048917 Ga0496114_0000690 Ga0496114_0000690_11780_12361 191
1492 3300048917 Ga0496114_0023117 Ga0496114_0023117_639_1214 191
1493 3300048917 Ga0496114_0069445 Ga0496114_0069445_1092_1667 191
1494 3300048917 Ga0496114_0286043 Ga0496114_0286043_544_1128 191
1495 3300048917 Ga0496114_0373942 Ga0496114_0373942_545_1120 191
1496 3300048917 Ga0496114_0403875 Ga0496114_0403875_192_776 191
1497 3300048917 Ga0496114_0579897 Ga0496114_0579897_82_663 191
1498 3300048918 Ga0496115_0089421 Ga0496115_0089421_44_625 191
1499 3300049568 Ga0501031_0017305 Ga0501031_0017305_3531_4106 191
1500 3300049568 Ga0501031_0022062 Ga0501031_0022062_3464_4066 191
1501 3300049568 Ga0501031_0022527 Ga0501031_0022527_1466_2041 191
1502 3300049568 Ga0501031_0022982 Ga0501031_0022982_384_959 191
1503 3300049568 Ga0501031_0035994 Ga0501031_0035994_351_926 191
1504 3300049568 Ga0501031_0379882 Ga0501031_0379882_282_860 191
1505 3300049569 Ga0501032_0010844 Ga0501032_0010844_3541_4152 191
1506 3300049569 Ga0501032_0032349 Ga0501032_0032349_232_807 191
1507 3300049569 Ga0501032_0097332 Ga0501032_0097332_829_1404 191
1508 3300049569 Ga0501032_0226921 Ga0501032_0226921_414_1019 191
1509 3300049569 Ga0501032_0287520 Ga0501032_0287520_370_945 191
1510 3300049569 Ga0501032_0463298 Ga0501032_0463298_40_615 191
1511 3300049570 Ga0501033_0030817 Ga0501033_0030817_2526_3101 191
1512 3300049570 Ga0501033_0145138 Ga0501033_0145138_996_1571 191
1513 3300049572 Ga0501036_0016429 Ga0501036_0016429_3777_4379 191
1514 3300049572 Ga0501036_0029351 Ga0501036_0029351_464_1039 191
1515 3300049572 Ga0501036_0066807 Ga0501036_0066807_2066_2641 191
1516 3300049572 Ga0501036_0172382 Ga0501036_0172382_563_1138 191
1517 3300049572 Ga0501036_0173817 Ga0501036_0173817_1212_1787 191
1518 3300049572 Ga0501036_0242896 Ga0501036_0242896_814_1389 191
1519 3300049573 Ga0501037_0001411 Ga0501037_0001411_5899_6474 191
1520 3300049573 Ga0501037_0010845 Ga0501037_0010845_2347_2958 191
1521 3300049573 Ga0501037_0011391 Ga0501037_0011391_377_952 191
1522 3300049573 Ga0501037_0110709 Ga0501037_0110709_1292_1867 191
1523 3300049573 Ga0501037_0333643 Ga0501037_0333643_238_813 191
1524 3300049573 Ga0501037_0342259 Ga0501037_0342259_393_995 191
1525 3300049573 Ga0501037_0395522 Ga0501037_0395522_233_835 191
1526 3300049574 Ga0501038_0001233 Ga0501038_0001233_12646_13221 191
1527 3300049574 Ga0501038_0004780 Ga0501038_0004780_248_823 191
1528 3300049574 Ga0501038_0008959 Ga0501038_0008959_6627_7202 191
1529 3300049574 Ga0501038_0106861 Ga0501038_0106861_943_1518 191
1530 3300049574 Ga0501038_0128461 Ga0501038_0128461_615_1193 191
1531 3300049574 Ga0501038_0422649 Ga0501038_0422649_190_765 191
1532 3300049574 Ga0501038_0579878 Ga0501038_0579878_79_681 191
1533 3300049575 Ga0501039_0016565 Ga0501039_0016565_2860_3462 191
1534 3300049575 Ga0501039_0019130 Ga0501039_0019130_1576_2151 191
1535 3300049575 Ga0501039_0053657 Ga0501039_0053657_2062_2637 191
1536 3300049575 Ga0501039_0058713 Ga0501039_0058713_1953_2531 191
1537 3300049575 Ga0501039_0072523 Ga0501039_0072523_1375_1950 191
1538 3300049575 Ga0501039_0120371 Ga0501039_0120371_561_1136 191
1539 3300049575 Ga0501039_0250890 Ga0501039_0250890_265_870 191
1540 3300049575 Ga0501039_0320812 Ga0501039_0320812_503_1078 191
1541 3300049576 Ga0501040_0005985 Ga0501040_0005985_2526_3101 191
1542 3300049576 Ga0501040_0032936 Ga0501040_0032936_1710_2285 191
1543 3300049576 Ga0501040_0036406 Ga0501040_0036406_921_1523 191
1544 3300049576 Ga0501040_0044103 Ga0501040_0044103_856_1431 191
1545 3300049576 Ga0501040_0093214 Ga0501040_0093214_1237_1812 191
1546 3300049576 Ga0501040_0220391 Ga0501040_0220391_559_1134 191
1547 3300049576 Ga0501040_0278327 Ga0501040_0278327_73_648 191
1548 3300049576 Ga0501040_0323798 Ga0501040_0323798_11_586 191
1549 3300049576 Ga0501040_0415654 Ga0501040_0415654_154_765 191
1550 3300049576 Ga0501040_0848030 Ga0501040_0848030_18_599 191
1551 3300049577 Ga0501041_0006585 Ga0501041_0006585_2936_3547 191
1552 3300049577 Ga0501041_0024829 Ga0501041_0024829_2094_2669 191
1553 3300049577 Ga0501041_0037062 Ga0501041_0037062_446_1054 191
1554 3300049577 Ga0501041_0037145 Ga0501041_0037145_526_1101 191
1555 3300049577 Ga0501041_0144422 Ga0501041_0144422_538_1116 191
1556 3300049577 Ga0501041_0324354 Ga0501041_0324354_289_864 191
1557 3300049577 Ga0501041_0432054 Ga0501041_0432054_215_790 191
1558 3300049578 Ga0501042_0001944 Ga0501042_0001944_4726_5301 191
1559 3300049578 Ga0501042_0005494 Ga0501042_0005494_5839_6414 191
1560 3300049578 Ga0501042_0013760 Ga0501042_0013760_911_1489 191
1561 3300049578 Ga0501042_0017953 Ga0501042_0017953_723_1334 191
1562 3300049578 Ga0501042_0043026 Ga0501042_0043026_912_1487 191
1563 3300049578 Ga0501042_0092990 Ga0501042_0092990_1494_2069 191
1564 3300049578 Ga0501042_0199322 Ga0501042_0199322_761_1336 191
1565 3300049578 Ga0501042_0214189 Ga0501042_0214189_579_1154 191
1566 3300049578 Ga0501042_0383999 Ga0501042_0383999_168_743 191
1567 3300049578 Ga0501042_0535793 Ga0501042_0535793_19_618 191
1568 3300049578 Ga0501042_0737717 Ga0501042_0737717_12_602 191
1569 3300049578 Ga0501042_0839813 Ga0501042_0839813_35_637 191
1570 3300049579 Ga0501043_0002017 Ga0501043_0002017_12396_12971 191
1571 3300049579 Ga0501043_0032075 Ga0501043_0032075_1966_2541 191
1572 3300049579 Ga0501043_0094825 Ga0501043_0094825_365_940 191
1573 3300049579 Ga0501043_0099043 Ga0501043_0099043_1303_1878 191
1574 3300049579 Ga0501043_0211422 Ga0501043_0211422_206_808 191
1575 3300049580 Ga0501046_0007245 Ga0501046_0007245_1487_2062 191
1576 3300049580 Ga0501046_0030397 Ga0501046_0030397_2850_3461 191
1577 3300049580 Ga0501046_0095432 Ga0501046_0095432_450_1025 191
1578 3300049580 Ga0501046_0195163 Ga0501046_0195163_869_1444 191
1579 3300049580 Ga0501046_0340300 Ga0501046_0340300_94_696 191
1580 3300049580 Ga0501046_0343447 Ga0501046_0343447_77_652 191
1581 3300049581 Ga0501047_0030253 Ga0501047_0030253_585_1160 191
1582 3300049581 Ga0501047_0074626 Ga0501047_0074626_1793_2386 191
1583 3300049581 Ga0501047_0585936 Ga0501047_0585936_34_624 191
1584 3300049581 Ga0501047_0669936 Ga0501047_0669936_36_641 191
1585 3300049582 Ga0501048_0008878 Ga0501048_0008878_5513_6088 191
1586 3300049582 Ga0501048_0022562 Ga0501048_0022562_3839_4441 191
1587 3300049582 Ga0501048_0030317 Ga0501048_0030317_202_813 191
1588 3300049582 Ga0501048_0037553 Ga0501048_0037553_1472_2047 191
1589 3300049582 Ga0501048_0068642 Ga0501048_0068642_168_743 191
1590 3300049582 Ga0501048_0076079 Ga0501048_0076079_980_1558 191
1591 3300049582 Ga0501048_0108378 Ga0501048_0108378_533_1138 191
1592 3300049582 Ga0501048_0442460 Ga0501048_0442460_248_823 191
1593 3300049582 Ga0501048_0639529 Ga0501048_0639529_133_720 191
1594 3300049582 Ga0501048_0678541 Ga0501048_0678541_71_673 191
1595 3300049583 Ga0501067_0006645 Ga0501067_0006645_2620_3198 191
1596 3300049583 Ga0501067_0019647 Ga0501067_0019647_3106_3681 191
1597 3300049584 Ga0501068_0010266 Ga0501068_0010266_761_1336 191
1598 3300049584 Ga0501068_0016250 Ga0501068_0016250_82_657 191
1599 3300049584 Ga0501068_0036154 Ga0501068_0036154_2343_2918 191
1600 3300049584 Ga0501068_0036324 Ga0501068_0036324_1548_2123 191
1601 3300049584 Ga0501068_0047184 Ga0501068_0047184_1619_2194 191
1602 3300049584 Ga0501068_0092365 Ga0501068_0092365_48_650 191
1603 3300049584 Ga0501068_0169545 Ga0501068_0169545_401_976 191
1604 3300049584 Ga0501068_0241494 Ga0501068_0241494_327_902 191
1605 3300049585 Ga0501069_0000355 Ga0501069_0000355_16140_16715 191
1606 3300049585 Ga0501069_0007569 Ga0501069_0007569_309_884 191
1607 3300049585 Ga0501069_0061571 Ga0501069_0061571_697_1275 191
1608 3300049585 Ga0501069_0109921 Ga0501069_0109921_253_828 191
1609 3300049585 Ga0501069_0688097 Ga0501069_0688097_18_593 191
1610 3300049586 Ga0501070_0000880 Ga0501070_0000880_7954_8529 191
1611 3300049586 Ga0501070_0006372 Ga0501070_0006372_6231_6836 191
1612 3300049586 Ga0501070_0021898 Ga0501070_0021898_1993_2568 191
1613 3300049586 Ga0501070_0156236 Ga0501070_0156236_987_1562 191
1614 3300049586 Ga0501070_0202344 Ga0501070_0202344_477_1052 191
1615 3300049586 Ga0501070_0825629 Ga0501070_0825629_30_605 191
1616 3300049587 Ga0501071_0003710 Ga0501071_0003710_2416_3018 191
1617 3300049587 Ga0501071_0008508 Ga0501071_0008508_4296_4871 191
1618 3300049587 Ga0501071_0034399 Ga0501071_0034399_2811_3386 191
1619 3300049587 Ga0501071_0037022 Ga0501071_0037022_570_1145 191
1620 3300049587 Ga0501071_0037477 Ga0501071_0037477_1404_1979 191
1621 3300049587 Ga0501071_0173535 Ga0501071_0173535_553_1131 191
1622 3300049587 Ga0501071_0190229 Ga0501071_0190229_505_1080 191
1623 3300049587 Ga0501071_0296048 Ga0501071_0296048_422_1012 191
1624 3300049587 Ga0501071_0464570 Ga0501071_0464570_30_605 191
1625 3300049587 Ga0501071_0505019 Ga0501071_0505019_55_657 191
1626 3300049587 Ga0501071_0546950 Ga0501071_0546950_203_781 191
1627 3300049587 Ga0501071_0663627 Ga0501071_0663627_202_786 191
1628 3300049588 Ga0501072_0015977 Ga0501072_0015977_3777_4352 191
1629 3300049588 Ga0501072_0039738 Ga0501072_0039738_211_786 191
1630 3300049588 Ga0501072_0047089 Ga0501072_0047089_2278_2880 191
1631 3300049588 Ga0501072_0050934 Ga0501072_0050934_2125_2700 191
1632 3300049588 Ga0501072_0112130 Ga0501072_0112130_287_895 191
1633 3300049588 Ga0501072_0167042 Ga0501072_0167042_422_1033 191
1634 3300049588 Ga0501072_0194470 Ga0501072_0194470_119_694 191
1635 3300049588 Ga0501072_0325808 Ga0501072_0325808_230_829 191
1636 3300049588 Ga0501072_0338966 Ga0501072_0338966_433_1008 191
1637 3300049588 Ga0501072_0395348 Ga0501072_0395348_361_936 191
1638 3300049589 Ga0501073_0008042 Ga0501073_0008042_994_1569 191
1639 3300049589 Ga0501073_0093666 Ga0501073_0093666_692_1267 191
1640 3300049589 Ga0501073_0143919 Ga0501073_0143919_971_1546 191
1641 3300049589 Ga0501073_0179672 Ga0501073_0179672_401_976 191
1642 3300049589 Ga0501073_0313691 Ga0501073_0313691_161_736 191
1643 3300049590 Ga0501074_0004703 Ga0501074_0004703_8903_9478 191
1644 3300049590 Ga0501074_0060292 Ga0501074_0060292_547_1122 191
1645 3300049590 Ga0501074_0067173 Ga0501074_0067173_506_1108 191
1646 3300049590 Ga0501074_0204190 Ga0501074_0204190_93_668 191
1647 3300049590 Ga0501074_0221615 Ga0501074_0221615_331_906 191
1648 3300049590 Ga0501074_0302700 Ga0501074_0302700_109_684 191
1649 3300049590 Ga0501074_0410364 Ga0501074_0410364_278_853 191
1650 3300049591 Ga0501075_0001247 Ga0501075_0001247_982_1557 191
1651 3300049591 Ga0501075_0008350 Ga0501075_0008350_6462_7037 191
1652 3300049591 Ga0501075_0010101 Ga0501075_0010101_4296_4871 191
1653 3300049591 Ga0501075_0059705 Ga0501075_0059705_186_761 191
1654 3300049591 Ga0501075_0069944 Ga0501075_0069944_253_855 191
1655 3300049591 Ga0501075_0102197 Ga0501075_0102197_1129_1707 191
1656 3300049591 Ga0501075_0261720 Ga0501075_0261720_283_858 191
1657 3300049591 Ga0501075_0285750 Ga0501075_0285750_479_1054 191
1658 3300049591 Ga0501075_0367138 Ga0501075_0367138_320_895 191
1659 3300049592 Ga0501076_0003560 Ga0501076_0003560_8126_8701 191
1660 3300049592 Ga0501076_0004637 Ga0501076_0004637_8117_8692 191
1661 3300049592 Ga0501076_0011587 Ga0501076_0011587_5581_6159 191
1662 3300049592 Ga0501076_0016402 Ga0501076_0016402_2855_3457 191
1663 3300049592 Ga0501076_0023760 Ga0501076_0023760_797_1372 191
1664 3300049592 Ga0501076_0116275 Ga0501076_0116275_1400_1975 191
1665 3300049592 Ga0501076_0262317 Ga0501076_0262317_778_1389 191
1666 3300049592 Ga0501076_0452555 Ga0501076_0452555_243_818 191
1667 3300049592 Ga0501076_0817477 Ga0501076_0817477_143_718 191
1668 3300049592 Ga0501076_0971750 Ga0501076_0971750_18_593 191
1669 3300049593 Ga0501077_0005135 Ga0501077_0005135_3294_3875 191
1670 3300049593 Ga0501077_0007581 Ga0501077_0007581_4750_5325 191
1671 3300049593 Ga0501077_0010863 Ga0501077_0010863_1227_1802 191
1672 3300049593 Ga0501077_0031304 Ga0501077_0031304_406_1008 191
1673 3300049593 Ga0501077_0037598 Ga0501077_0037598_700_1275 191
1674 3300049593 Ga0501077_0047025 Ga0501077_0047025_2041_2616 191
1675 3300049593 Ga0501077_0103457 Ga0501077_0103457_888_1463 191
1676 3300049593 Ga0501077_0108876 Ga0501077_0108876_422_1033 191
1677 3300049593 Ga0501077_0133121 Ga0501077_0133121_581_1156 191
1678 3300049593 Ga0501077_0153580 Ga0501077_0153580_445_1032 191
1679 3300049593 Ga0501077_0244876 Ga0501077_0244876_320_928 191
1680 3300049741 Ga0501079_0010406 Ga0501079_0010406_876_1451 191
1681 3300049741 Ga0501079_0013947 Ga0501079_0013947_164_742 191
1682 3300049741 Ga0501079_0025740 Ga0501079_0025740_2788_3363 191
1683 3300049741 Ga0501079_0044109 Ga0501079_0044109_2741_3343 191
1684 3300049741 Ga0501079_0060900 Ga0501079_0060900_2010_2585 191
1685 3300049741 Ga0501079_0214827 Ga0501079_0214827_73_648 191
1686 3300049741 Ga0501079_0222576 Ga0501079_0222576_550_1125 191
1687 3300049741 Ga0501079_0242689 Ga0501079_0242689_595_1206 191
1688 3300049741 Ga0501079_0247289 Ga0501079_0247289_375_950 191
1689 3300049741 Ga0501079_0479773 Ga0501079_0479773_34_636 191
1690 3300049741 Ga0501079_0798126 Ga0501079_0798126_49_630 191
1691 3300049742 Ga0501080_0032915 Ga0501080_0032915_936_1514 191
1692 3300049742 Ga0501080_0050526 Ga0501080_0050526_572_1147 191
1693 3300049742 Ga0501080_0082288 Ga0501080_0082288_1604_2179 191
1694 3300049742 Ga0501080_0148522 Ga0501080_0148522_1264_1842 191
1695 3300049742 Ga0501080_0205506 Ga0501080_0205506_152_757 191
1696 3300049743 Ga0501081_0006913 Ga0501081_0006913_4208_4810 191
1697 3300049743 Ga0501081_0006985 Ga0501081_0006985_2595_3170 191
1698 3300049743 Ga0501081_0007415 Ga0501081_0007415_5714_6289 191
1699 3300049743 Ga0501081_0031025 Ga0501081_0031025_2866_3441 191
1700 3300049743 Ga0501081_0033929 Ga0501081_0033929_1459_2037 191
1701 3300049743 Ga0501081_0044984 Ga0501081_0044984_1860_2435 191
1702 3300049743 Ga0501081_0159206 Ga0501081_0159206_326_901 191
1703 3300049744 Ga0501083_0001237 Ga0501083_0001237_16084_16659 191
1704 3300049744 Ga0501083_0007908 Ga0501083_0007908_6399_6974 191
1705 3300049744 Ga0501083_0022824 Ga0501083_0022824_2258_2869 191
1706 3300049744 Ga0501083_0290412 Ga0501083_0290412_79_681 191
1707 3300049744 Ga0501083_0386668 Ga0501083_0386668_261_836 191
1708 3300049822 Ga0501035_0006912 Ga0501035_0006912_5566_6141 191
1709 3300049822 Ga0501035_0014634 Ga0501035_0014634_1343_1954 191
1710 3300049822 Ga0501035_0272371 Ga0501035_0272371_694_1269 191
1711 3300049822 Ga0501035_0322710 Ga0501035_0322710_336_914 191
1712 3300049823 Ga0501044_0027578 Ga0501044_0027578_3246_3857 191
1713 3300049823 Ga0501044_0039262 Ga0501044_0039262_1587_2162 191
1714 3300049823 Ga0501044_0077024 Ga0501044_0077024_1238_1813 191
1715 3300049823 Ga0501044_0136770 Ga0501044_0136770_1451_2026 191
1716 3300049823 Ga0501044_0182261 Ga0501044_0182261_1431_2006 191
1717 3300049823 Ga0501044_0634284 Ga0501044_0634284_132_707 191
1718 3300049824 Ga0501045_0010764 Ga0501045_0010764_2397_2999 191
1719 3300049824 Ga0501045_0012129 Ga0501045_0012129_3363_3968 191
1720 3300049824 Ga0501045_0037937 Ga0501045_0037937_1131_1706 191
1721 3300049824 Ga0501045_0156900 Ga0501045_0156900_419_997 191
1722 3300049824 Ga0501045_0187670 Ga0501045_0187670_298_873 191
1723 3300049824 Ga0501045_0262028 Ga0501045_0262028_306_905 191
1724 3300049824 Ga0501045_0266290 Ga0501045_0266290_20_703 191
1725 3300049824 Ga0501045_0290785 Ga0501045_0290785_198_779 191
1726 3300049824 Ga0501045_0522452 Ga0501045_0522452_187_762 191
1727 3300050490 nmdc:mga03n38_35160_c1 nmdc:mga03n38_35160_c1_92_667 191
1728 3300050491 nmdc:mga00v17_43153_c1 nmdc:mga00v17_43153_c1_1737_2312 191
1729 3300050492 nmdc:mga0yw44_150115_c1 nmdc:mga0yw44_150115_c1_375_950 191
1730 3300050492 nmdc:mga0yw44_242426_c1 nmdc:mga0yw44_242426_c1_517_1092 191
1731 3300050492 nmdc:mga0yw44_318244_c1 nmdc:mga0yw44_318244_c1_129_731 191
1732 3300050492 nmdc:mga0yw44_32873_c1 nmdc:mga0yw44_32873_c1_1647_2231 191
1733 3300050492 nmdc:mga0yw44_660017_c1 nmdc:mga0yw44_660017_c1_57_632 191
1734 3300050492 nmdc:mga0yw44_95046_c1 nmdc:mga0yw44_95046_c1_1259_1834 191
1735 3300050494 nmdc:mga06z11_150550_c1 nmdc:mga06z11_150550_c1_519_1094 191
1736 3300050496 nmdc:mga07m45_105007_c2 nmdc:mga07m45_105007_c2_315_890 191
1737 3300050507 nmdc:mga05p37_144811_c1 nmdc:mga05p37_144811_c1_686_1273 191
1738 3300050507 nmdc:mga05p37_163951_c1 nmdc:mga05p37_163951_c1_849_1424 191
1739 3300050507 nmdc:mga05p37_190449_c1 nmdc:mga05p37_190449_c1_1217_1795 191
1740 3300050507 nmdc:mga05p37_342264_c1 nmdc:mga05p37_342264_c1_1059_1634 191
1741 3300050507 nmdc:mga05p37_563914_c1 nmdc:mga05p37_563914_c1_424_1005 191
1742 3300050507 nmdc:mga05p37_6099_c1 nmdc:mga05p37_6099_c1_1129_1731 191
1743 3300050507 nmdc:mga05p37_612509_c1 nmdc:mga05p37_612509_c1_232_810 191
1744 3300050507 nmdc:mga05p37_692461_c1 nmdc:mga05p37_692461_c1_428_1009 191
1745 3300050507 nmdc:mga05p37_8824_c1 nmdc:mga05p37_8824_c1_6194_6778 191
1746 3300050507 nmdc:mga05p37_93965_c1 nmdc:mga05p37_93965_c1_565_1140 191
1747 3300050508 nmdc:mga09592_129860_c1 nmdc:mga09592_129860_c1_1413_1991 191
1748 3300050508 nmdc:mga09592_14787_c1 nmdc:mga09592_14787_c1_515_1117 191
1749 3300050508 nmdc:mga09592_402205_c1 nmdc:mga09592_402205_c1_109_684 191
1750 3300050508 nmdc:mga09592_450123_c1 nmdc:mga09592_450123_c1_147_731 191
1751 3300050508 nmdc:mga09592_591478_c1 nmdc:mga09592_591478_c1_46_627 191
1752 3300050509 nmdc:mga0qj67_309566_c1 nmdc:mga0qj67_309566_c1_345_923 191
1753 3300050509 nmdc:mga0qj67_31790_c1 nmdc:mga0qj67_31790_c1_2978_3616 191
1754 3300050510 nmdc:mga06r32_22566_c1 nmdc:mga06r32_22566_c1_3452_4090 191
1755 3300050511 nmdc:mga08y16_10062_c1 nmdc:mga08y16_10062_c1_6530_7105 191
1756 3300050511 nmdc:mga08y16_189918_c1 nmdc:mga08y16_189918_c1_1244_1825 191
1757 3300050511 nmdc:mga08y16_21198_c1 nmdc:mga08y16_21198_c1_1776_2351 191
1758 3300050512 nmdc:mga0n895_1234683_c1 nmdc:mga0n895_1234683_c1_17_595 191
1759 3300050512 nmdc:mga0n895_483585_c1 nmdc:mga0n895_483585_c1_26_622 191
1760 3300050513 nmdc:mga0rr50_773715_c1 nmdc:mga0rr50_773715_c1_232_807 191
1761 3300050515 nmdc:mga0a205_132430_c1 nmdc:mga0a205_132430_c1_240_815 191
1762 3300050515 nmdc:mga0a205_297344_c1 nmdc:mga0a205_297344_c1_553_1134 191
1763 3300050515 nmdc:mga0a205_39860_c1 nmdc:mga0a205_39860_c1_717_1319 191
1764 3300050515 nmdc:mga0a205_529032_c1 nmdc:mga0a205_529032_c1_222_803 191
1765 3300050515 nmdc:mga0a205_813799_c1 nmdc:mga0a205_813799_c1_69_656 191
1766 3300053078 Ga0495612_0327636 Ga0495612_0327636_90_674 191
1767 3300053085 Ga0495619_0002878 Ga0495619_0002878_5360_5944 191
1768 3300054114 Ga0501084_0008276 Ga0501084_0008276_3346_3921 191
1769 3300054114 Ga0501084_0010081 Ga0501084_0010081_2666_3241 191
1770 3300054114 Ga0501084_0011771 Ga0501084_0011771_4429_5007 191
1771 3300054114 Ga0501084_0015324 Ga0501084_0015324_2548_3150 191
1772 3300054114 Ga0501084_0026862 Ga0501084_0026862_1657_2232 191
1773 3300054114 Ga0501084_0037739 Ga0501084_0037739_1626_2201 191
1774 3300054114 Ga0501084_0047251 Ga0501084_0047251_2121_2696 191
1775 3300054114 Ga0501084_0069232 Ga0501084_0069232_799_1377 191
1776 3300054114 Ga0501084_0100063 Ga0501084_0100063_683_1258 191
1777 3300054114 Ga0501084_0135770 Ga0501084_0135770_162_743 191
1778 3300054114 Ga0501084_0256455 Ga0501084_0256455_312_920 191
1779 3300054114 Ga0501084_0356597 Ga0501084_0356597_153_764 191
1780 3300054114 Ga0501084_0384261 Ga0501084_0384261_470_1048 191
1781 3300054114 Ga0501084_0680670 Ga0501084_0680670_167_742 191
1782 3300054114 Ga0501084_0699818 Ga0501084_0699818_32_607 191
1783 3300059424 Ga0590075_003752 Ga0590075_003752_2468_3043 191
1784 3300060353 Ga0501082_0001301 Ga0501082_0001301_18946_19548 191
1785 3300060353 Ga0501082_0007105 Ga0501082_0007105_1345_1920 191
1786 3300060353 Ga0501082_0021793 Ga0501082_0021793_728_1318 191
1787 3300060353 Ga0501082_0026005 Ga0501082_0026005_1275_1856 191
1788 3300060353 Ga0501082_0125037 Ga0501082_0125037_667_1242 191
1789 3300060353 Ga0501082_0172874 Ga0501082_0172874_1257_1832 191
1790 3300060353 Ga0501082_0272276 Ga0501082_0272276_806_1396 191
1791 3300060353 Ga0501082_0333018 Ga0501082_0333018_11_586 191
1792 3300060353 Ga0501082_0367752 Ga0501082_0367752_484_1059 191
1793 3300060353 Ga0501082_0439623 Ga0501082_0439623_186_761 191
1794 3300060353 Ga0501082_0647740 Ga0501082_0647740_154_759 191
1795 3300060353 Ga0501082_0701678 Ga0501082_0701678_145_747 191
1796 3300061734 Ga0530510_0003037 Ga0530510_0003037_5442_6017 191
1797 3300061734 Ga0530510_0008483 Ga0530510_0008483_4166_4741 191
1798 3300061734 Ga0530510_0012335 Ga0530510_0012335_2927_3529 191
1799 3300061734 Ga0530510_0025521 Ga0530510_0025521_2589_3164 191
1800 3300061734 Ga0530510_0048189 Ga0530510_0048189_2371_2949 191
1801 3300061734 Ga0530510_0062708 Ga0530510_0062708_916_1497 191
1802 3300061734 Ga0530510_0171518 Ga0530510_0171518_927_1526 191
1803 3300061734 Ga0530510_0233524 Ga0530510_0233524_331_906 191
1804 3300061734 Ga0530510_0263652 Ga0530510_0263652_253_831 191
1805 3300061734 Ga0530510_0358695 Ga0530510_0358695_104_679 191
1806 3300061734 Ga0530510_0458181 Ga0530510_0458181_152_763 191
1807 3300061734 Ga0530510_0549338 Ga0530510_0549338_85_660 191
1808 3300061734 Ga0530510_0626056 Ga0530510_0626056_70_648 191

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01966

HD

HD domain

57

150

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
4s1c-assembly3.cif.gz_A crystal structure of l. monocytogenes phosphodiesterase pgph hd domain 0.6257 8 178
4s1c-assembly3.cif.gz_D-2 crystal structure of l. monocytogenes phosphodiesterase pgph hd domain 0.5787 8 178
4s1c-assembly3.cif.gz_A crystal structure of l. monocytogenes phosphodiesterase pgph hd domain 0.5664 8 178
4s1b-assembly3.cif.gz_A crystal structure of l. monocytogenes phosphodiesterase pgph hd domain in complex with cyclic-di-amp 0.555 7 178
4s1b-assembly3.cif.gz_D-2 crystal structure of l. monocytogenes phosphodiesterase pgph hd domain in complex with cyclic-di-amp 0.5417 8 178
ID Description Score Start End Superfamily
af_Q2FZ08_320_474_1.10.3210.10 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.6924 8 140 1.10.3210.10
af_Q58188_1_153_1.10.3210.10 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.6783 6 147 1.10.3210.10
af_Q58188_1_153_1.10.3210.10 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.6274 6 147 1.10.3210.10
2pjqD01 Mainly Alpha;Orthogonal Bundle;Cyclin A; domain 1;HD-domain/PDEase-like 0.5721 6 88 1.10.472.50
af_Q2FZ08_320_474_1.10.3210.10 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.553 8 140 1.10.3210.10
ID Description Score Start End GO Terms
AF-A0A7W0UD44-F1-model_v4 HAD family hydrolase 0.9968 99 186 GO:0016787
AF-A0A538F517-F1-model_v4 HDIG domain-containing protein 0.9935 1 190
AF-A0A3D0N6Q7-F1-model_v4 HAD family hydrolase 0.9891 4 184 GO:0016787
AF-A0A7V9FXL8-F1-model_v4 Metal-dependent phosphohydrolase 0.9875 84 190 GO:0016787
AF-A0A3N5RY85-F1-model_v4 HDIG domain-containing protein 0.9868 5 98

Feature Viewer

pLDDT pTM Quality
96.27 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map