F495772

General Info

Members Datasets Scaffolds Average Seq Length
1814 611 3626 263

Family's Representative Sequence

Representative Sequence 3300031251|Ga0265327_10021872|Ga0265327_100218724
Length 300
Sequence LTTFNKIVVSGYRRNNRYLDFTQLNVRLGGLGVIMARIIGVANQKGGVGKTTSAINVAASLAVLEFKTLLVDADPQANSTTGVGFDLHNITNSLYDCMVNNALAADVILKSEIPNLDIVPSHIDLVGAEIEMINYPNRENVLKGILDAVRDRYDFIIIDCSPSLGLITVNSLVASDSVIVPVQCEFFALEGLGKLLNTIKIVQSRLNPELQIEGILMTMYDGRLRLCNQVVSEVRRHFDDMVFDTIIHRNTRLSEAPSVGKPVILYDAESKGAVNYLNLAKEILQNNGMTKMSNQERIIE

Samples

Sample ID Description Type Environment
1 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
6 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
7 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
8 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
9 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
10 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
11 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
12 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
13 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
14 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
15 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
16 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
17 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
18 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
19 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
20 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
21 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
22 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
23 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
24 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
25 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
26 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
27 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
28 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
29 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
30 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
31 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
32 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
33 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
34 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
35 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
36 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
37 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
38 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
39 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
40 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
41 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
42 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
43 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
44 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
45 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
46 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
47 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
48 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
49 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
50 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
51 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
52 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
53 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
54 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
55 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
56 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
57 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
58 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
59 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
60 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
61 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
62 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
63 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
64 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
65 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
66 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
67 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
68 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
69 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
70 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
71 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
72 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
73 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
74 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
75 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
76 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
77 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
78 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
79 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
80 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
81 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
82 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
83 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
84 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
85 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
86 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
87 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
88 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
89 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
90 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
91 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
92 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
93 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
94 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
95 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
96 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
97 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
98 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
99 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
100 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
101 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
102 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
103 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
104 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
105 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
106 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
107 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
108 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
109 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
110 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
111 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
112 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
113 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
114 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
115 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
116 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
117 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
118 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
119 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
120 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
121 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
122 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
123 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
124 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
125 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
126 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
127 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
128 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
129 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
130 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
131 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
132 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
133 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
134 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
135 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
136 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
137 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
138 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
139 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
140 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
141 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
142 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
143 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
144 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
145 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
146 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
147 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
148 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
149 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
150 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
151 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
152 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
153 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
154 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
155 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
156 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
157 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
158 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
159 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
161 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
162 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
163 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
164 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
165 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
166 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
167 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
168 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
169 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
170 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
229 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
230 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
231 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
234 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
235 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
236 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
237 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
238 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
239 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
240 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
241 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
242 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
243 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
244 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
245 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
246 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
247 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
248 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
249 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
250 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
251 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
252 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
253 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
254 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
255 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
256 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
257 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
258 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
259 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
260 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
261 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
262 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
263 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
264 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
265 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
266 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
267 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
268 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
269 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
270 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
271 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
272 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
273 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
274 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
275 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
276 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
277 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
278 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
279 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
280 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
281 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
282 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
283 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
284 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
285 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
286 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
287 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
288 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
289 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
290 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
291 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
292 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
293 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
294 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
295 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
296 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
297 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
298 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
299 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
300 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
301 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
302 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
303 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
304 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
305 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
306 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
307 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
308 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
309 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
310 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
311 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
312 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
313 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
314 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
315 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
316 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
317 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
318 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
319 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
320 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
321 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
322 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
323 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
324 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
325 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
326 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
327 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
328 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
329 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
330 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
331 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
332 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
333 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
334 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
335 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
336 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
337 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
338 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
339 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
340 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
341 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
342 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
343 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
344 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
345 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
346 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
347 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
348 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
349 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
350 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
351 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
352 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
353 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
354 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
355 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
356 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
357 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
358 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
359 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
360 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
361 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
362 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
363 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
364 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
365 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
366 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
367 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
368 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
369 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
370 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
371 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
372 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
373 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
374 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
375 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
376 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
377 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
378 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
379 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
380 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
381 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
382 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
383 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
384 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
385 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
386 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
387 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
388 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
389 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
390 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
391 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
392 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
393 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
394 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
395 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
396 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
397 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
398 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
399 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
400 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
401 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
402 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
403 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
404 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
405 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
406 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
407 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
408 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
409 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
410 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
411 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
412 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
413 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
414 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
415 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
416 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
417 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
418 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
419 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
420 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
421 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
422 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
423 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
424 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
425 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
426 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
427 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
428 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
429 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
430 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
431 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
432 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
433 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
434 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
435 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
436 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
437 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
438 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
439 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
440 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
441 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
442 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
443 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
444 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
445 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
446 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
447 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
448 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
449 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
450 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
451 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
452 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
453 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
454 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
455 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
456 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
457 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
458 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
459 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
460 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
461 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
462 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
463 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
464 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
465 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
466 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
467 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
468 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
469 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
470 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
471 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
472 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
473 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
474 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
475 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
476 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
477 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
478 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
479 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
480 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
481 3300053726 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 endosphere Metagenome Endosphere
482 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
483 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
484 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
485 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
486 2511231000 Chryseobacterium populi CF314 Isolate Rhizosphere
487 2513020052 Flavobacterium sp. CF136 Isolate Rhizosphere
488 2519899754 Flavobacterium sp. F52 Isolate Rhizosphere
489 2523533629 Kaistella palustris DSM 21579 Isolate Rhizosphere
490 2582581278 Chryseobacterium sp. CF365 Isolate Rhizosphere
491 2582581281 Chryseobacterium sp. CF284 Isolate Rhizosphere
492 2582581282 Chryseobacterium sp. CF299 Isolate Rhizosphere
493 2582581873 Chryseobacterium sp. OV259 Isolate Rhizosphere
494 2585427687 Pedobacter borealis DSM 19626 Isolate Rhizosphere
495 2585428045 Chryseobacterium sp. OV705 Isolate Rhizosphere
496 2585428060 Chryseobacterium sp. OV715 Isolate Rhizosphere
497 2585428061 Chryseobacterium sp. CF356 Isolate Rhizosphere
498 2585428095 Chryseobacterium sp. YR005 Isolate Rhizosphere
499 2585428115 Chryseobacterium sp. YR561 Isolate Rhizosphere
500 2585428182 Chryseobacterium sp. YR477 Isolate Rhizosphere
501 2585428183 Chryseobacterium sp. YR485 Isolate Rhizosphere
502 2585428184 Chryseobacterium sp. YR480 Isolate Rhizosphere
503 2585428185 Chryseobacterium sp. YR459 Isolate Rhizosphere
504 2585428187 Chryseobacterium sp. YR460 Isolate Rhizosphere
505 2588253712 Chryseobacterium sp. OV279 Isolate Rhizosphere
506 2588254255 Chryseobacterium sp. YR221 Isolate Rhizosphere
507 2588254257 Chryseobacterium sp. YR203 Isolate Rhizosphere
508 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
509 2643221600 Flavobacterium sp. Root186 Isolate Unclassified
510 2643221667 Flavobacterium sp. Root420 Isolate Unclassified
511 2643221716 Flavobacterium sp. Root901 Isolate Unclassified
512 2643221725 Flavobacterium sp. Root935 Isolate Unclassified
513 2728369107 Chryseobacterium kwangjuense KJ1R5 Isolate Unclassified
514 2738541273 Elizabethkingia sp. YR214 Isolate Unclassified
515 2738541278 Niastella sp. CF465 Isolate Unclassified
516 2738541279 Flavobacterium sp. GV069 Isolate Unclassified
517 2738541283 Pedobacter sp. OK701 Isolate Unclassified
518 2738541285 Flavobacterium sp. GV030 Isolate Unclassified
519 2738541302 Pedobacter sp. CF074 Isolate Unclassified
520 2738543007 Flavobacterium sp. GV063 Isolate Unclassified
521 2738543014 Elizabethkingia sp. YR191 Isolate Unclassified
522 2738543023 Pedobacter sp. OK628 Isolate Unclassified
523 2739367651 Pedobacter sp. OK291 Isolate Unclassified
524 2739367656 Pedobacter sp. CF523 Isolate Unclassified
525 2739367663 Pedobacter sp. YR510 Isolate Unclassified
526 2739367857 Flavobacterium sp. GV029 Isolate Unclassified
527 2739367858 Flavobacterium sp. GV028 Isolate Unclassified
528 2739367866 Hymenobacter sp. YR204 Isolate Unclassified
529 2739367874 Chryseobacterium sp. T16E-39 Isolate Unclassified
530 2751185877 Chryseobacterium artocarpi UTM-3 Isolate Rhizosphere
531 2765235839 Chryseobacterium indologenes AA5 Isolate Unclassified
532 2772190705 Chryseobacterium contaminans C-26 Isolate Rhizosphere
533 2775506739 Chryseobacterium sp. 1335 Isolate Unclassified
534 2802428842 Flavobacterium sp. S87F.05.LMB.W.Kidney.N Isolate Unclassified
535 2816332188 Chryseobacterium aquifrigidense 110 (version 2) Isolate Unclassified
536 2816332280 Flavobacterium johnsoniae GSE09 Isolate Unclassified
537 2818991437 Pedobacter terrae 518 Isolate Unclassified
538 2818991442 Chitinophaga pinensis 1204 Isolate Unclassified
539 2818991444 Filimonas endophytica 3197 Isolate Unclassified
540 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
541 2821136567 Chitinophaga sancti 1232 Isolate Unclassified
542 2833640130 Mariniflexile sp. TRM1-10 Isolate Rhizosphere
543 2839989709 Pontibacter arcticus 2b14 Isolate Unclassified
544 2840677318 Chitinophaga alhagiae T22 Isolate Unclassified
545 2842083920 Chryseobacterium lathyri KCTC 22544 Isolate Rhizosphere
546 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
547 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
548 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
549 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
550 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
551 2852627209 Pedobacter sp. AK017 Isolate Rhizosphere
552 2857613821 Flavobacterium sp. R-72247 Isolate Unclassified
553 2857618242 Flavobacterium sp. R-74482 Isolate Unclassified
554 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
555 2871720351 Chryseobacterium sp. KLBC 52 Isolate Nodule
556 2881359912 Flavobacterium ustbae T13 Isolate Rhizosphere
557 2883068021 Chitinophaga rhizosphaerae T16R-86 Isolate Rhizosphere
558 2884634485 Algoriphagus kandeliae XY-J91 Isolate Unclassified
559 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
560 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
561 2889290771 Chryseobacterium sp. PvR013 Isolate Rhizosphere
562 2890737413 Parapedobacter sp. SGR-10 Isolate Rhizosphere
563 2896085136 Chitinophaga alhagiae T22 Isolate Unclassified
564 2896109856 Chitinophaga sp. SYP-B3965 Isolate Rhizosphere
565 2902048731 Pedobacter ureilyticus THG-T11 Isolate Rhizosphere
566 2903895155 Flavobacterium sp. HBTb2-11-1 Isolate Rhizosphere
567 2904419702 Flavobacterium sp. 1355 Isolate Rhizosphere
568 2904445276 Pedobacter terrae 1734 Isolate Rhizosphere
569 2904467357 Chitinophaga sancti 3198 Isolate Unclassified
570 2904555929 Flavobacterium sp. 1750 Isolate Rhizosphere
571 2905999023 Chryseobacterium elymi KCTC 22547 Isolate Rhizosphere
572 2914759650 Rhizosphaericola mali Isolate Rhizosphere
573 2919097161 Chryseobacterium ginsenosidimutans 1394 Isolate Rhizosphere
574 2919186247 Pedobacter africanus 2697 Isolate Rhizosphere
575 2919191525 Flavobacterium sp. 2755 Isolate Rhizosphere
576 2919399522 Chryseobacterium sp. 2987 Isolate Unclassified
577 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
578 2919509842 Flavobacterium arsenatis 3773 Isolate Unclassified
579 2919683626 Flavobacterium piscis 4129 Isolate Unclassified
580 2919692658 Algoriphagus sp. 4150 Isolate Rhizosphere
581 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
582 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
583 2929150217 Flavobacterium sp. R-74510 Hybrid assembly Isolate Unclassified
584 2929154850 Filimonas sp. R-72421 Hybrid assembly Isolate Unclassified
585 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
586 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
587 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
588 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
589 2939664404 Pedobacter africanus 2990 Isolate Rhizosphere
590 2945924605 Chryseobacterium ginsenosidimutans W1I9 Isolate Rhizosphere
591 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
592 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
593 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere
594 2946019816 Chryseobacterium sp. W4I1 Isolate Rhizosphere
595 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
596 2958458903 Flavobacterium anhuiense RCM74 Isolate Rhizosphere
597 2958512119 Flavobacterium sp. Sd200 Isolate Rhizosphere
598 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified
599 2977243572 Chryseobacterium sp. SORGH_AS 447 Isolate Unclassified
600 2977268062 Flavobacterium sp. SORGH_AS 622 Isolate Unclassified
601 2984572630 Chryseobacterium sp. SORGH_AS909 Isolate Aerial Root
602 2984606641 Chryseobacterium sp. SORGH_AS1175 Isolate Aerial Root
603 2993372514 Chryseobacterium sp. SLBN-27 Isolate Rhizosphere
604 2993480792 Chryseobacterium nepalense SLBN-92 Isolate Rhizosphere
605 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified
606 8036736890 Flavobacterium dauae TCH3-2 Isolate Rhizosphere
607 8054307821 Flavobacterium soyae SCIV07 Isolate Rhizosphere
608 8055419101 Flavobacterium tyrosinilyticum KCTC 42726 Isolate Rhizosphere
609 8055588893 Parapedobacter lycopersici KACC 18788 Isolate Rhizosphere
610 8055592153 Flavobacterium panacis DCY106 Isolate Rhizosphere
611 8056440228 Flavobacterium hibisci THG-HG1.4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.56
Metatranscriptomes 0.5
Isolates 6.95

Biome Distribution

Category Percentage (%)
Aerial Root 0.11
Bulb 0
Endosphere 6.78
Nodule 0.28
Rhizoplane 0.99
Rhizosphere 83.79
Stem 0
Stem Tuber 0
Unclassified 1.71

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265327_10021872 3300031251 Bacteria 3846
2 SwRhRL2b_contig_1663050 2162886007 Bacteria 482194
3 SwRhRL2b_contig_2423129 2162886007 Bacteria 1187
4 SwRhRL2b_contig_2703482 2162886007 Bacteria 3290
5 SwRhRL2b_contig_3243847 2162886007 Bacteria 2425
6 SwRhRL2b_contig_3661140 2162886007 Bacteria 2767
7 SwRhRL2b_contig_595006 2162886007 Bacteria 3181
8 SwRhRL2b_contig_829818 2162886007 Bacteria 4778
9 JGI24736J21556_1001877 3300001904 Bacteria 3745
10 JGI24740J21852_10050141 3300001979 Bacteria 1202
11 JGI24739J22299_10003467 3300001989 Bacteria 6018
12 JGI24739J22299_10064304 3300001989 Bacteria 1153
13 JGI24737J22298_10000321 3300001990 Bacteria 16053
14 JGI24737J22298_10011017 3300001990 Bacteria 2969
15 JGI24735J21928_10000003 3300002067 Bacteria 385983
16 JGI24735J21928_10003137 3300002067 Bacteria 5663
17 JGI24744J21845_10010382 3300002077 Bacteria 1907
18 JGI24751J29686_10000452 3300002459 Bacteria 12421
19 JGI25162J39368_1000203 3300002737 Bacteria 62704
20 JGI25154J39366_1000007 3300002738 Bacteria 335932
21 JGI25158J39367_1002516 3300002739 Bacteria 2963
22 JGI25157J39369_1005353 3300002741 Bacteria 2110
23 JGI25164J39214_1001360 3300002772 Bacteria 5927
24 JGI25150J39212_1000001 3300002774 Bacteria 1318726
25 JGI25151J46595_10000001 3300003187 Bacteria 887211
26 JGI25165J46597_1000728 3300003214 Bacteria 25784
27 JGI25153J46596_10000001 3300003215 Bacteria 748985
28 JGI25153J46596_10001266 3300003215 Bacteria 15183
29 rootH1_10063301 3300003316 Bacteria 4209
30 rootH1_10134510 3300003316 Bacteria 2650
31 rootH1_10149292 3300003316 Bacteria 3994
32 rootH2_10011084 3300003320 Bacteria 22647
33 rootH2_10013162 3300003320 Bacteria 43068
34 rootH2_10015381 3300003320 Bacteria 19009
35 rootH2_10045041 3300003320 Bacteria 11638
36 rootH2_10129787 3300003320 Bacteria 7276
37 rootL2_10007168 3300003322 Bacteria 8195
38 rootL2_10021621 3300003322 Bacteria 2872
39 rootL2_10038289 3300003322 Bacteria 5760
40 rootL2_10074114 3300003322 Bacteria 1744
41 rootL2_10143549 3300003322 Bacteria 3773
42 rootL2_10319714 3300003322 Bacteria 3332
43 rootH1_10007512 3300003323 Bacteria 10354
44 rootH1_10015224 3300003323 Bacteria 25733
45 rootH1_10078749 3300003323 Bacteria 4864
46 rootH1_10115746 3300003323 Bacteria 2912
47 rootH1_10120031 3300003323 Bacteria 18612
48 rootH1_10319305 3300003323 Bacteria 1176
49 JGI25160J50197_1004668 3300003354 Bacteria 5877
50 JGI25160J50197_1010918 3300003354 Bacteria 3255
51 Ga0006562J51391_1002343 3300003578 Bacteria 4752
52 Ga0006562J51391_1004923 3300003578 Bacteria 5120
53 Ga0055535_1001785 3300003761 Bacteria 9460
54 Ga0055526_1022313 3300003771 Bacteria 2158
55 Ga0055536_1000004 3300003781 Bacteria 411108
56 Ga0055534_1001279 3300003784 Bacteria 10213
57 Ga0055528_1000164 3300003790 Bacteria 55729
58 Ga0055530_10000869 3300003791 Bacteria 24868
59 Ga0055530_10007673 3300003791 Bacteria 4491
60 Ga0055531_10000085 3300003794 Bacteria 102372
61 Ga0055531_10000156 3300003794 Bacteria 78858
62 Ga0058863_10001245 3300004799 Bacteria 4009
63 Ga0058862_12212891 3300004803 Bacteria 1359
64 Ga0065165_1000010 3300005262 Bacteria 323737
65 Ga0065165_1008512 3300005262 Bacteria 4780
66 Ga0065714_10002572 3300005288 Bacteria 21257
67 Ga0065714_10003280 3300005288 Bacteria 26984
68 Ga0065714_10010985 3300005288 Bacteria 2492
69 Ga0065714_10026377 3300005288 Bacteria 898
70 Ga0065714_10078231 3300005288 Bacteria 2618
71 Ga0065714_10085630 3300005288 Bacteria 2140
72 Ga0065714_10100557 3300005288 Bacteria 1661
73 Ga0065704_10005473 3300005289 Bacteria 3457
74 Ga0065704_10070140 3300005289 Bacteria 482257
75 Ga0065704_10070251 3300005289 Bacteria 48366
76 Ga0065704_10072129 3300005289 Bacteria 9103
77 Ga0065704_10073887 3300005289 Bacteria 6700
78 Ga0065704_10074138 3300005289 Bacteria 6479
79 Ga0065704_10074182 3300005289 Bacteria 6469
80 Ga0065704_10090076 3300005289 Bacteria 2814
81 Ga0065704_10106177 3300005289 Bacteria 2090
82 Ga0065704_10110352 3300005289 Bacteria 1982
83 Ga0065712_10086352 3300005290 Bacteria 2641
84 Ga0065712_10088663 3300005290 Bacteria 2508
85 Ga0065715_10040176 3300005293 Bacteria 1317
86 Ga0065715_10117030 3300005293 Bacteria 2361
87 Ga0065715_10250221 3300005293 Unclassified 1170
88 Ga0065715_10291366 3300005293 Bacteria 1062
89 Ga0065715_10393194 3300005293 Bacteria 875
90 Ga0065707_10094480 3300005295 Bacteria 3492
91 Ga0065707_10098181 3300005295 Unclassified 3106
92 Ga0070658_10000655 3300005327 Bacteria 29871
93 Ga0070658_10013517 3300005327 Bacteria 6551
94 Ga0070658_10018406 3300005327 Bacteria 5592
95 Ga0070658_10041372 3300005327 Bacteria 3718
96 Ga0070658_10199625 3300005327 Unclassified 1687
97 Ga0070658_10335126 3300005327 Bacteria 1293
98 Ga0070658_10416509 3300005327 Unclassified 1155
99 Ga0070658_10444731 3300005327 Bacteria 1116
100 Ga0070676_10000091 3300005328 Bacteria 31424
101 Ga0070676_10189409 3300005328 Bacteria 1342
102 Ga0070676_10291635 3300005328 Bacteria 1103
103 Ga0070683_100002417 3300005329 Bacteria 14841
104 Ga0070683_100005694 3300005329 Bacteria 10408
105 Ga0070683_100016399 3300005329 Bacteria 6534
106 Ga0070683_100241764 3300005329 Bacteria 1717
107 Ga0070683_100410959 3300005329 Bacteria 1291
108 Ga0070683_100568753 3300005329 Bacteria 1084
109 Ga0070690_100062384 3300005330 Bacteria 2403
110 Ga0070690_100342684 3300005330 Bacteria 1083
111 Ga0070690_100397634 3300005330 Bacteria 1011
112 Ga0070670_100019261 3300005331 Bacteria 5853
113 Ga0070670_100070231 3300005331 Bacteria 3007
114 Ga0070670_100113045 3300005331 Bacteria 2340
115 Ga0070670_100125336 3300005331 Bacteria 2217
116 Ga0070670_100135234 3300005331 Bacteria 2130
117 Ga0070670_100179130 3300005331 Bacteria 1840
118 Ga0070670_100201775 3300005331 Bacteria 1728
119 Ga0070670_100306184 3300005331 Bacteria 1390
120 Ga0070670_100520698 3300005331 Bacteria 1059
121 Ga0070677_10007031 3300005333 Bacteria 3745
122 Ga0068869_100005770 3300005334 Bacteria 7808
123 Ga0068869_100021631 3300005334 Bacteria 4426
124 Ga0068869_100059054 3300005334 Unclassified 2807
125 Ga0068869_100066745 3300005334 Bacteria 2652
126 Ga0068869_100071113 3300005334 Bacteria 2576
127 Ga0068869_100136280 3300005334 Bacteria 1892
128 Ga0068869_100169837 3300005334 Bacteria 1703
129 Ga0068869_100179568 3300005334 Bacteria 1659
130 Ga0068869_100580421 3300005334 Bacteria 945
131 Ga0070666_10000125 3300005335 Bacteria 53673
132 Ga0070666_10001433 3300005335 Bacteria 14445
133 Ga0070666_10006591 3300005335 Bacteria 7136
134 Ga0070666_10030595 3300005335 Bacteria 3548
135 Ga0070666_10067739 3300005335 Bacteria 2424
136 Ga0070680_100007073 3300005336 Bacteria 8555
137 Ga0070680_100008794 3300005336 Bacteria 7747
138 Ga0070680_100339831 3300005336 Unclassified 1276
139 Ga0070682_100000125 3300005337 Bacteria 67243
140 Ga0070682_100000394 3300005337 Bacteria 29106
141 Ga0070682_100008503 3300005337 Bacteria 5793
142 Ga0070682_100038423 3300005337 Bacteria 2936
143 Ga0070682_100096963 3300005337 Bacteria 1940
144 Ga0070682_100146145 3300005337 Bacteria 1617
145 Ga0070682_100209980 3300005337 Bacteria 1379
146 Ga0070682_100264800 3300005337 Bacteria 1246
147 Ga0070682_100282543 3300005337 Bacteria 1210
148 Ga0070682_100401938 3300005337 Bacteria 1036
149 Ga0070682_100404658 3300005337 Bacteria 1033
150 Ga0068868_100000075 3300005338 Bacteria 58452
151 Ga0068868_100022531 3300005338 Bacteria 4756
152 Ga0068868_100032252 3300005338 Bacteria 4029
153 Ga0068868_100039548 3300005338 Bacteria 3665
154 Ga0068868_100331792 3300005338 Bacteria 1298
155 Ga0070660_100000211 3300005339 Bacteria 39121
156 Ga0070660_100004005 3300005339 Bacteria 10169
157 Ga0070660_100019733 3300005339 Bacteria 4944
158 Ga0070660_100033263 3300005339 Bacteria 3885
159 Ga0070660_100288113 3300005339 Bacteria 1345
160 Ga0070660_100327588 3300005339 Bacteria 1259
161 Ga0070689_100007698 3300005340 Bacteria 7546
162 Ga0070689_100077163 3300005340 Bacteria 2611
163 Ga0070689_100367353 3300005340 Bacteria 1210
164 Ga0070689_100470020 3300005340 Bacteria 1073
165 Ga0070691_10010843 3300005341 Bacteria 4159
166 Ga0070691_10018376 3300005341 Bacteria 3223
167 Ga0070687_100019144 3300005343 Bacteria 3181
168 Ga0070661_100066797 3300005344 Bacteria 2642
169 Ga0070661_100525792 3300005344 Bacteria 949
170 Ga0070661_100697801 3300005344 Bacteria 827
171 Ga0070668_100037019 3300005347 Bacteria 3725
172 Ga0070668_100306491 3300005347 Bacteria 1333
173 Ga0070669_100088082 3300005353 Bacteria 2323
174 Ga0070669_100504609 3300005353 Bacteria 1004
175 Ga0070675_100011402 3300005354 Bacteria 6957
176 Ga0070675_100016984 3300005354 Bacteria 5783
177 Ga0070675_100023239 3300005354 Bacteria 4954
178 Ga0070675_100033207 3300005354 Bacteria 4182
179 Ga0070675_100038097 3300005354 Bacteria 3917
180 Ga0070675_100190938 3300005354 Bacteria 1775
181 Ga0070671_100281644 3300005355 Bacteria 1414
182 Ga0070671_100332471 3300005355 Bacteria 1295
183 Ga0070671_100361708 3300005355 Bacteria 1239
184 Ga0070671_100391861 3300005355 Bacteria 1188
185 Ga0070674_100013529 3300005356 Bacteria 5047
186 Ga0070673_100000966 3300005364 Bacteria 16306
187 Ga0070673_100044349 3300005364 Bacteria 3443
188 Ga0070673_100047692 3300005364 Bacteria 3335
189 Ga0070673_100065150 3300005364 Bacteria 2905
190 Ga0070673_100068032 3300005364 Bacteria 2850
191 Ga0070673_100073365 3300005364 Bacteria 2754
192 Ga0070673_100310657 3300005364 Bacteria 1390
193 Ga0070688_100026679 3300005365 Bacteria 3434
194 Ga0070688_100074892 3300005365 Bacteria 2175
195 Ga0070688_100081383 3300005365 Bacteria 2097
196 Ga0070688_100262221 3300005365 Bacteria 1234
197 Ga0070659_100003274 3300005366 Bacteria 11522
198 Ga0070659_100005958 3300005366 Bacteria 8788
199 Ga0070659_100007003 3300005366 Bacteria 8164
200 Ga0070659_100009206 3300005366 Bacteria 7248
201 Ga0070659_100038876 3300005366 Bacteria 3712
202 Ga0070667_100000086 3300005367 Bacteria 114861
203 Ga0070667_100013104 3300005367 Bacteria 6853
204 Ga0070667_100065615 3300005367 Bacteria 3082
205 Ga0070667_100115450 3300005367 Bacteria 2331
206 Ga0070667_100187976 3300005367 Bacteria 1829
207 Ga0070667_100209267 3300005367 Bacteria 1733
208 Ga0070667_100332861 3300005367 Bacteria 1372
209 Ga0070714_100082836 3300005435 Unclassified 2796
210 Ga0070663_100502974 3300005455 Unclassified 1007
211 Ga0070678_100107619 3300005456 Bacteria 2175
212 Ga0070678_100282545 3300005456 Bacteria 1404
213 Ga0070662_100003756 3300005457 Bacteria 9504
214 Ga0070662_100007873 3300005457 Bacteria 6923
215 Ga0070662_100025036 3300005457 Bacteria 4118
216 Ga0070662_100059341 3300005457 Bacteria 2787
217 Ga0070681_10101645 3300005458 Bacteria 2820
218 Ga0070681_10135065 3300005458 Bacteria 2398
219 Ga0070681_10139966 3300005458 Bacteria 2350
220 Ga0070681_10200880 3300005458 Bacteria 1912
221 Ga0068867_100003784 3300005459 Bacteria 10649
222 Ga0068867_100005625 3300005459 Bacteria 8879
223 Ga0068867_100010240 3300005459 Bacteria 6614
224 Ga0068867_100012521 3300005459 Bacteria 6003
225 Ga0068867_100104518 3300005459 Bacteria 2168
226 Ga0068867_100285868 3300005459 Bacteria 1354
227 Ga0068867_100292040 3300005459 Bacteria 1341
228 Ga0070685_10005156 3300005466 Bacteria 6624
229 Ga0070685_10017646 3300005466 Bacteria 3824
230 Ga0070685_10394858 3300005466 Bacteria 956
231 Ga0070698_100000911 3300005471 Bacteria 32333
232 Ga0070698_100140156 3300005471 Bacteria 2370
233 Ga0070679_100003584 3300005530 Bacteria 14205
234 Ga0070679_100028081 3300005530 Bacteria 5545
235 Ga0070679_100028359 3300005530 Bacteria 5519
236 Ga0070679_100054957 3300005530 Bacteria 3965
237 Ga0070679_100085742 3300005530 Bacteria 3136
238 Ga0070679_100238729 3300005530 Bacteria 1775
239 Ga0070679_100441954 3300005530 Bacteria 1245
240 Ga0070684_100012884 3300005535 Bacteria 6721
241 Ga0070684_100031170 3300005535 Bacteria 4537
242 Ga0070684_100053969 3300005535 Bacteria 3501
243 Ga0070684_100085939 3300005535 Bacteria 2790
244 Ga0068853_100003690 3300005539 Bacteria 11749
245 Ga0068853_100004573 3300005539 Bacteria 10729
246 Ga0068853_100018812 3300005539 Bacteria 5719
247 Ga0068853_100035707 3300005539 Bacteria 4223
248 Ga0068853_100050476 3300005539 Bacteria 3579
249 Ga0068853_100081542 3300005539 Bacteria 2833
250 Ga0068853_100101004 3300005539 Bacteria 2551
251 Ga0068853_100146456 3300005539 Bacteria 2123
252 Ga0068853_100161284 3300005539 Bacteria 2023
253 Ga0068853_100241333 3300005539 Bacteria 1656
254 Ga0068853_100257644 3300005539 Bacteria 1603
255 Ga0068853_100271523 3300005539 Bacteria 1562
256 Ga0068853_100546898 3300005539 Bacteria 1096
257 Ga0070672_100030440 3300005543 Bacteria 4055
258 Ga0070672_100046118 3300005543 Bacteria 3376
259 Ga0070672_100115402 3300005543 Bacteria 2193
260 Ga0070672_100151535 3300005543 Bacteria 1918
261 Ga0070672_100165848 3300005543 Bacteria 1835
262 Ga0070672_100217348 3300005543 Bacteria 1602
263 Ga0070672_100306262 3300005543 Bacteria 1348
264 Ga0070686_100016259 3300005544 Bacteria 4324
265 Ga0070686_100040335 3300005544 Bacteria 2912
266 Ga0070686_100221822 3300005544 Bacteria 1367
267 Ga0070696_100131205 3300005546 Bacteria 1823
268 Ga0070696_100158534 3300005546 Bacteria 1666
269 Ga0070693_100022402 3300005547 Bacteria 3359
270 Ga0070693_100057609 3300005547 Bacteria 2246
271 Ga0070665_100000009 3300005548 Bacteria 562640
272 Ga0070665_100007286 3300005548 Bacteria 11248
273 Ga0070665_100007390 3300005548 Bacteria 11178
274 Ga0070665_100181811 3300005548 Bacteria 2104
275 Ga0070665_100725664 3300005548 Bacteria 1007
276 Ga0068855_100000279 3300005563 Bacteria 63112
277 Ga0068855_100001370 3300005563 Bacteria 30171
278 Ga0068855_100002137 3300005563 Bacteria 24454
279 Ga0068855_100002597 3300005563 Bacteria 22262
280 Ga0068855_100005875 3300005563 Bacteria 14974
281 Ga0068855_100032803 3300005563 Bacteria 6200
282 Ga0068855_100034861 3300005563 Bacteria 5997
283 Ga0068855_100046506 3300005563 Bacteria 5130
284 Ga0068855_100083464 3300005563 Bacteria 3701
285 Ga0068855_100206373 3300005563 Bacteria 2210
286 Ga0068855_100320880 3300005563 Bacteria 1712
287 Ga0068855_100329075 3300005563 Bacteria 1687
288 Ga0068855_100472966 3300005563 Bacteria 1365
289 Ga0068855_100476339 3300005563 Bacteria 1359
290 Ga0068855_100588981 3300005563 Bacteria 1200
291 Ga0070664_100026719 3300005564 Bacteria 4791
292 Ga0070664_100048105 3300005564 Bacteria 3604
293 Ga0070664_100110232 3300005564 Bacteria 2401
294 Ga0070664_100130951 3300005564 Bacteria 2203
295 Ga0070664_100136918 3300005564 Bacteria 2154
296 Ga0070664_100362998 3300005564 Bacteria 1319
297 Ga0068857_100002499 3300005577 Bacteria 15039
298 Ga0068857_100025412 3300005577 Bacteria 5215
299 Ga0068857_100139694 3300005577 Bacteria 2189
300 Ga0068857_100148748 3300005577 Bacteria 2120
301 Ga0068857_100192907 3300005577 Bacteria 1856
302 Ga0068857_100208774 3300005577 Bacteria 1782
303 Ga0068857_100408625 3300005577 Bacteria 1264
304 Ga0068854_100005998 3300005578 Bacteria 7696
305 Ga0068854_100061236 3300005578 Bacteria 2725
306 Ga0068854_100090507 3300005578 Bacteria 2275
307 Ga0068856_100000006 3300005614 Bacteria 223827
308 Ga0068856_100006116 3300005614 Bacteria 11815
309 Ga0068856_100007791 3300005614 Bacteria 10461
310 Ga0068856_100009483 3300005614 Bacteria 9450
311 Ga0068856_100012161 3300005614 Bacteria 8339
312 Ga0068856_100040389 3300005614 Bacteria 4583
313 Ga0068856_100065842 3300005614 Bacteria 3581
314 Ga0068856_100627842 3300005614 Bacteria 1095
315 Ga0068852_100003711 3300005616 Bacteria 10699
316 Ga0068852_100005387 3300005616 Bacteria 9148
317 Ga0068852_100005815 3300005616 Bacteria 8855
318 Ga0068852_100014561 3300005616 Bacteria 6060
319 Ga0068852_100016001 3300005616 Bacteria 5839
320 Ga0068852_100022206 3300005616 Bacteria 5085
321 Ga0068852_100084320 3300005616 Bacteria 2827
322 Ga0068852_100116263 3300005616 Bacteria 2440
323 Ga0068852_100133672 3300005616 Bacteria 2287
324 Ga0068852_100198363 3300005616 Bacteria 1898
325 Ga0068852_100221698 3300005616 Bacteria 1799
326 Ga0068852_100336275 3300005616 Bacteria 1470
327 Ga0068852_100389802 3300005616 Bacteria 1368
328 Ga0068852_100469089 3300005616 Bacteria 1249
329 Ga0068859_100000242 3300005617 Bacteria 53646
330 Ga0068859_100006439 3300005617 Bacteria 11912
331 Ga0068859_100030908 3300005617 Bacteria 5374
332 Ga0068859_100040043 3300005617 Bacteria 4703
333 Ga0068859_100062210 3300005617 Bacteria 3762
334 Ga0068859_100215791 3300005617 Bacteria 2006
335 Ga0068859_100265713 3300005617 Bacteria 1808
336 Ga0068859_100318747 3300005617 Bacteria 1648
337 Ga0068859_100356490 3300005617 Unclassified 1557
338 Ga0068859_100472068 3300005617 Bacteria 1350
339 Ga0068859_100856564 3300005617 Unclassified 995
340 Ga0068864_100001541 3300005618 Bacteria 18983
341 Ga0068864_100007898 3300005618 Bacteria 8766
342 Ga0068864_100077541 3300005618 Bacteria 2906
343 Ga0068864_100982698 3300005618 Bacteria 836
344 Ga0068866_10085725 3300005718 Unclassified 1703
345 Ga0068861_100001641 3300005719 Bacteria 14272
346 Ga0068861_100059982 3300005719 Bacteria 2914
347 Ga0068861_100265613 3300005719 Bacteria 1471
348 Ga0068861_100486783 3300005719 Bacteria 1112
349 Ga0068851_10000388 3300005834 Bacteria 19910
350 Ga0068851_10053753 3300005834 Bacteria 2051
351 Ga0068851_10149361 3300005834 Unclassified 1276
352 Ga0068870_10010288 3300005840 Bacteria 4291
353 Ga0068870_10044685 3300005840 Bacteria 2316
354 Ga0068870_10143043 3300005840 Bacteria 1401
355 Ga0068863_100016728 3300005841 Bacteria 7037
356 Ga0068863_100023474 3300005841 Bacteria 5889
357 Ga0068863_100026064 3300005841 Bacteria 5578
358 Ga0068863_100045062 3300005841 Bacteria 4186
359 Ga0068863_100083299 3300005841 Bacteria 3030
360 Ga0068863_100094027 3300005841 Bacteria 2845
361 Ga0068863_100184467 3300005841 Bacteria 2003
362 Ga0068863_100330747 3300005841 Bacteria 1481
363 Ga0068863_100418171 3300005841 Bacteria 1313
364 Ga0068863_100450024 3300005841 Bacteria 1264
365 Ga0068863_100734902 3300005841 Bacteria 982
366 Ga0068858_100000258 3300005842 Bacteria 56692
367 Ga0068858_100004144 3300005842 Bacteria 14261
368 Ga0068858_100101557 3300005842 Bacteria 2682
369 Ga0068858_100116755 3300005842 Bacteria 2494
370 Ga0068860_100000033 3300005843 Bacteria 245461
371 Ga0068860_100001856 3300005843 Bacteria 22477
372 Ga0068860_100005747 3300005843 Bacteria 12513
373 Ga0068860_100011911 3300005843 Bacteria 8572
374 Ga0068860_100016937 3300005843 Bacteria 7104
375 Ga0068860_100033498 3300005843 Bacteria 4929
376 Ga0068860_100062300 3300005843 Bacteria 3544
377 Ga0068860_100079404 3300005843 Bacteria 3120
378 Ga0068860_100155267 3300005843 Bacteria 2205
379 Ga0068860_100307810 3300005843 Bacteria 1553
380 Ga0068860_100341185 3300005843 Bacteria 1473
381 Ga0068860_100352641 3300005843 Bacteria 1448
382 Ga0068860_100405002 3300005843 Bacteria 1350
383 Ga0068860_100422195 3300005843 Bacteria 1322
384 Ga0068862_100005917 3300005844 Bacteria 10185
385 Ga0068862_100012762 3300005844 Bacteria 6953
386 Ga0068862_100510626 3300005844 Bacteria 1142
387 Ga0068862_100681511 3300005844 Bacteria 994
388 Ga0081540_1012512 3300005983 Bacteria 5578
389 Ga0075366_10003090 3300006195 Bacteria 8694
390 Ga0075366_10018956 3300006195 Bacteria 3977
391 Ga0075366_10062086 3300006195 Bacteria 2221
392 Ga0075366_10252890 3300006195 Bacteria 1075
393 Ga0097621_100001575 3300006237 Bacteria 15603
394 Ga0097621_100008800 3300006237 Bacteria 7295
395 Ga0097621_100014583 3300006237 Bacteria 5888
396 Ga0097621_100097334 3300006237 Bacteria 2471
397 Ga0097621_100101343 3300006237 Bacteria 2423
398 Ga0097621_100130648 3300006237 Bacteria 2138
399 Ga0097621_100211647 3300006237 Bacteria 1686
400 Ga0068871_100006801 3300006358 Bacteria 8129
401 Ga0068871_100018853 3300006358 Bacteria 5257
402 Ga0068871_100044596 3300006358 Bacteria 3567
403 Ga0068871_100055128 3300006358 Bacteria 3227
404 Ga0068871_100057070 3300006358 Bacteria 3175
405 Ga0068871_100212975 3300006358 Bacteria 1672
406 Ga0075428_100044297 3300006844 Bacteria 4890
407 Ga0075428_100117986 3300006844 Unclassified 2890
408 Ga0075428_100123455 3300006844 Bacteria 2818
409 Ga0075428_100154611 3300006844 Bacteria 2492
410 Ga0075428_100334092 3300006844 Bacteria 1628
411 Ga0075430_100020978 3300006846 Bacteria 5554
412 Ga0075431_100001482 3300006847 Bacteria 21685
413 Ga0075431_100012317 3300006847 Bacteria 8629
414 Ga0075429_100016041 3300006880 Bacteria 6489
415 Ga0075429_100083539 3300006880 Bacteria 2784
416 Ga0068865_100000413 3300006881 Bacteria 23842
417 Ga0068865_100045574 3300006881 Bacteria 3006
418 Ga0068865_100080466 3300006881 Bacteria 2337
419 Ga0068865_100466683 3300006881 Bacteria 1047
420 Ga0097620_100000242 3300006931 Bacteria 53646
421 Ga0097620_100006439 3300006931 Bacteria 11912
422 Ga0097620_100030908 3300006931 Bacteria 5374
423 Ga0097620_100040043 3300006931 Bacteria 4703
424 Ga0097620_100062209 3300006931 Bacteria 3762
425 Ga0097620_100215779 3300006931 Bacteria 2006
426 Ga0097620_100265705 3300006931 Bacteria 1808
427 Ga0097620_100318750 3300006931 Bacteria 1648
428 Ga0097620_100356488 3300006931 Unclassified 1557
429 Ga0097620_100472048 3300006931 Bacteria 1350
430 Ga0097620_100856659 3300006931 Unclassified 995
431 Ga0099824_1006531 3300006942 Bacteria 15947
432 Ga0079104_1000091 3300006946 Bacteria 132682
433 Ga0105251_10053494 3300009011 Bacteria 1919
434 Ga0105251_10175280 3300009011 Bacteria 966
435 Ga0105251_10220065 3300009011 Bacteria 855
436 Ga0105244_10000027 3300009036 Bacteria 207569
437 Ga0105244_10000043 3300009036 Bacteria 150556
438 Ga0105250_10023942 3300009092 Bacteria 2461
439 Ga0105240_10000023 3300009093 Bacteria 385028
440 Ga0105240_10000083 3300009093 Bacteria 192934
441 Ga0105240_10000893 3300009093 Bacteria 53349
442 Ga0105240_10001874 3300009093 Bacteria 34962
443 Ga0105240_10002999 3300009093 Bacteria 26556
444 Ga0105240_10009678 3300009093 Bacteria 13622
445 Ga0105240_10010818 3300009093 Bacteria 12778
446 Ga0105240_10028209 3300009093 Bacteria 7336
447 Ga0105240_10041223 3300009093 Bacteria 5895
448 Ga0105240_10069875 3300009093 Bacteria 4346
449 Ga0105240_10137276 3300009093 Bacteria 2928
450 Ga0105240_10137729 3300009093 Bacteria 2921
451 Ga0105240_10172201 3300009093 Bacteria 2562
452 Ga0105240_10376489 3300009093 Bacteria 1604
453 Ga0105240_10504887 3300009093 Bacteria 1344
454 Ga0105240_11077097 3300009093 Bacteria 856
455 Ga0111539_10018239 3300009094 Bacteria 8691
456 Ga0111539_10107685 3300009094 Bacteria 3271
457 Ga0111539_10108018 3300009094 Bacteria 3265
458 Ga0111539_10199617 3300009094 Bacteria 2332
459 Ga0111539_10266933 3300009094 Bacteria 1992
460 Ga0111539_10577945 3300009094 Bacteria 1309
461 Ga0105247_10017274 3300009101 Bacteria 4330
462 Ga0105247_10035946 3300009101 Bacteria 3021
463 Ga0105247_10124030 3300009101 Bacteria 1677
464 Ga0114129_10004721 3300009147 Bacteria 19243
465 Ga0114129_10460819 3300009147 Bacteria 1666
466 Ga0114129_11019806 3300009147 Bacteria 1041
467 Ga0105243_10000003 3300009148 Bacteria 712931
468 Ga0105243_10002448 3300009148 Bacteria 15512
469 Ga0105243_10225353 3300009148 Bacteria 1660
470 Ga0105243_10419084 3300009148 Bacteria 1248
471 Ga0105241_10000421 3300009174 Bacteria 31984
472 Ga0105241_10000518 3300009174 Bacteria 29032
473 Ga0105241_10014293 3300009174 Bacteria 5813
474 Ga0105241_10018754 3300009174 Bacteria 5097
475 Ga0105241_10068555 3300009174 Bacteria 2749
476 Ga0105241_10128713 3300009174 Bacteria 2047
477 Ga0105241_10157605 3300009174 Bacteria 1863
478 Ga0105242_10002451 3300009176 Bacteria 14549
479 Ga0105242_10021083 3300009176 Bacteria 5113
480 Ga0105242_10024089 3300009176 Bacteria 4805
481 Ga0105242_10104292 3300009176 Bacteria 2407
482 Ga0105242_10376113 3300009176 Bacteria 1319
483 Ga0105242_10578268 3300009176 Bacteria 1081
484 Ga0105248_10044305 3300009177 Bacteria 4990
485 Ga0105248_10049709 3300009177 Bacteria 4702
486 Ga0105248_10054666 3300009177 Bacteria 4478
487 Ga0105237_10000198 3300009545 Bacteria 85302
488 Ga0105237_10000261 3300009545 Bacteria 74745
489 Ga0105237_10003753 3300009545 Bacteria 17897
490 Ga0105237_10005184 3300009545 Bacteria 14739
491 Ga0105237_10006711 3300009545 Bacteria 12720
492 Ga0105237_10011613 3300009545 Bacteria 9319
493 Ga0105237_10015362 3300009545 Bacteria 7972
494 Ga0105237_10016324 3300009545 Bacteria 7719
495 Ga0105237_10028321 3300009545 Bacteria 5708
496 Ga0105237_10043015 3300009545 Bacteria 4553
497 Ga0105237_10062937 3300009545 Bacteria 3709
498 Ga0105237_10091762 3300009545 Bacteria 3027
499 Ga0105237_10117576 3300009545 Bacteria 2652
500 Ga0105237_10130669 3300009545 Bacteria 2505
501 Ga0105237_10160901 3300009545 Bacteria 2243
502 Ga0105237_10338924 3300009545 Bacteria 1508
503 Ga0105238_10001036 3300009551 Bacteria 28205
504 Ga0105238_10016205 3300009551 Bacteria 7542
505 Ga0105238_10060135 3300009551 Bacteria 3805
506 Ga0105238_10098443 3300009551 Bacteria 2909
507 Ga0105238_10121775 3300009551 Bacteria 2588
508 Ga0105249_10000954 3300009553 Bacteria 25555
509 Ga0105249_10006490 3300009553 Bacteria 10175
510 Ga0105249_10007639 3300009553 Bacteria 9430
511 Ga0105249_10066961 3300009553 Bacteria 3307
512 Ga0105249_10067555 3300009553 Bacteria 3294
513 Ga0105249_10079600 3300009553 Bacteria 3042
514 Ga0105249_10095798 3300009553 Bacteria 2783
515 Ga0105249_10357440 3300009553 Bacteria 1481
516 Ga0105239_10000011 3300010375 Bacteria 337500
517 Ga0105239_10001010 3300010375 Bacteria 39353
518 Ga0105239_10001043 3300010375 Bacteria 38594
519 Ga0105239_10001867 3300010375 Bacteria 27574
520 Ga0105239_10002632 3300010375 Bacteria 22682
521 Ga0105239_10003043 3300010375 Bacteria 20841
522 Ga0105239_10003144 3300010375 Bacteria 20493
523 Ga0105239_10007177 3300010375 Bacteria 12814
524 Ga0105239_10013222 3300010375 Bacteria 9172
525 Ga0105239_10019068 3300010375 Bacteria 7581
526 Ga0105239_10022265 3300010375 Bacteria 6985
527 Ga0105239_10042080 3300010375 Bacteria 5006
528 Ga0105239_10077966 3300010375 Bacteria 3646
529 Ga0105239_10146897 3300010375 Bacteria 2630
530 Ga0105239_10541619 3300010375 Bacteria 1325
531 Ga0105239_10860004 3300010375 Bacteria 1040
532 Ga0105246_10066337 3300011119 Bacteria 2527
533 Ga0105246_10637197 3300011119 Bacteria 926
534 Ga0105246_10692731 3300011119 Bacteria 892
535 Ga0157373_10000007 3300013100 Bacteria 216734
536 Ga0157373_10000044 3300013100 Bacteria 113369
537 Ga0157373_10000601 3300013100 Bacteria 27966
538 Ga0157373_10001219 3300013100 Bacteria 19688
539 Ga0157373_10003753 3300013100 Bacteria 11489
540 Ga0157373_10008405 3300013100 Bacteria 7664
541 Ga0157373_10017976 3300013100 Bacteria 5149
542 Ga0157373_10022958 3300013100 Bacteria 4524
543 Ga0157373_10063945 3300013100 Bacteria 2605
544 Ga0157373_10105138 3300013100 Bacteria 1985
545 Ga0157373_10328379 3300013100 Bacteria 1089
546 Ga0157371_10000074 3300013102 Bacteria 162988
547 Ga0157371_10000130 3300013102 Bacteria 114054
548 Ga0157371_10000164 3300013102 Bacteria 96408
549 Ga0157371_10000232 3300013102 Bacteria 79717
550 Ga0157371_10000486 3300013102 Bacteria 48340
551 Ga0157371_10001020 3300013102 Bacteria 30696
552 Ga0157371_10001267 3300013102 Bacteria 26607
553 Ga0157371_10002408 3300013102 Bacteria 17899
554 Ga0157371_10003507 3300013102 Bacteria 14179
555 Ga0157371_10003749 3300013102 Bacteria 13605
556 Ga0157371_10010866 3300013102 Bacteria 7062
557 Ga0157371_10012774 3300013102 Bacteria 6402
558 Ga0157371_10013067 3300013102 Bacteria 6322
559 Ga0157371_10013304 3300013102 Bacteria 6258
560 Ga0157371_10015935 3300013102 Bacteria 5623
561 Ga0157371_10037443 3300013102 Bacteria 3471
562 Ga0157371_10093096 3300013102 Bacteria 2135
563 Ga0157371_10094277 3300013102 Bacteria 2121
564 Ga0157371_10133763 3300013102 Bacteria 1765
565 Ga0157371_10148667 3300013102 Bacteria 1670
566 Ga0157371_10194952 3300013102 Bacteria 1451
567 Ga0157370_10000192 3300013104 Bacteria 76389
568 Ga0157370_10000290 3300013104 Bacteria 63441
569 Ga0157370_10000303 3300013104 Bacteria 61868
570 Ga0157370_10000684 3300013104 Bacteria 42223
571 Ga0157370_10001091 3300013104 Bacteria 34028
572 Ga0157370_10001177 3300013104 Bacteria 32660
573 Ga0157370_10001475 3300013104 Bacteria 29107
574 Ga0157370_10004433 3300013104 Bacteria 16087
575 Ga0157370_10004809 3300013104 Bacteria 15353
576 Ga0157370_10008143 3300013104 Bacteria 11342
577 Ga0157370_10009399 3300013104 Bacteria 10451
578 Ga0157370_10013199 3300013104 Bacteria 8520
579 Ga0157370_10018596 3300013104 Bacteria 6986
580 Ga0157370_10019497 3300013104 Bacteria 6802
581 Ga0157370_10021765 3300013104 Bacteria 6387
582 Ga0157370_10028998 3300013104 Bacteria 5437
583 Ga0157370_10033538 3300013104 Bacteria 5006
584 Ga0157370_10062936 3300013104 Bacteria 3517
585 Ga0157370_10071559 3300013104 Bacteria 3272
586 Ga0157370_10077271 3300013104 Bacteria 3136
587 Ga0157370_10084098 3300013104 Bacteria 2991
588 Ga0157370_10098497 3300013104 Bacteria 2742
589 Ga0157370_10163161 3300013104 Bacteria 2073
590 Ga0157370_10169814 3300013104 Bacteria 2028
591 Ga0157370_10230989 3300013104 Bacteria 1712
592 Ga0157370_10273470 3300013104 Bacteria 1561
593 Ga0157370_10346127 3300013104 Bacteria 1370
594 Ga0157370_10351911 3300013104 Bacteria 1358
595 Ga0157370_10361179 3300013104 Bacteria 1338
596 Ga0157370_10387886 3300013104 Bacteria 1286
597 Ga0157370_10660773 3300013104 Bacteria 955
598 Ga0157369_10000031 3300013105 Bacteria 203214
599 Ga0157369_10000731 3300013105 Bacteria 42343
600 Ga0157369_10004306 3300013105 Bacteria 16809
601 Ga0157369_10006715 3300013105 Bacteria 13276
602 Ga0157369_10018831 3300013105 Bacteria 7737
603 Ga0157369_10024012 3300013105 Bacteria 6784
604 Ga0157369_10028173 3300013105 Bacteria 6217
605 Ga0157369_10030017 3300013105 Bacteria 5999
606 Ga0157369_10083931 3300013105 Bacteria 3406
607 Ga0157369_10134553 3300013105 Bacteria 2618
608 Ga0157369_10147459 3300013105 Bacteria 2487
609 Ga0157369_10159428 3300013105 Bacteria 2382
610 Ga0157369_10196241 3300013105 Bacteria 2120
611 Ga0157369_10221855 3300013105 Bacteria 1979
612 Ga0157369_10478617 3300013105 Bacteria 1289
613 Ga0157369_10774481 3300013105 Bacteria 986
614 Ga0157369_10858837 3300013105 Bacteria 931
615 Ga0157374_10000002 3300013296 Bacteria 1054226
616 Ga0157374_10017014 3300013296 Bacteria 6401
617 Ga0157374_10037407 3300013296 Bacteria 4454
618 Ga0157374_10040398 3300013296 Bacteria 4296
619 Ga0157374_10050624 3300013296 Bacteria 3862
620 Ga0157374_10063132 3300013296 Bacteria 3474
621 Ga0157374_10131963 3300013296 Bacteria 2418
622 Ga0157374_10163274 3300013296 Bacteria 2170
623 Ga0157374_10188572 3300013296 Bacteria 2017
624 Ga0157374_10236984 3300013296 Bacteria 1794
625 Ga0157374_10477348 3300013296 Bacteria 1250
626 Ga0157378_10009151 3300013297 Bacteria 8618
627 Ga0157378_10011530 3300013297 Bacteria 7739
628 Ga0157378_10045824 3300013297 Bacteria 3887
629 Ga0157378_10118346 3300013297 Bacteria 2438
630 Ga0157378_10167778 3300013297 Bacteria 2057
631 Ga0157378_10255303 3300013297 Bacteria 1680
632 Ga0157378_10270856 3300013297 Bacteria 1633
633 Ga0157378_10376075 3300013297 Bacteria 1394
634 Ga0157378_10640381 3300013297 Bacteria 1078
635 Ga0163162_10000377 3300013306 Bacteria 40533
636 Ga0163162_10000554 3300013306 Bacteria 34569
637 Ga0163162_10001734 3300013306 Bacteria 20435
638 Ga0163162_10002043 3300013306 Bacteria 18983
639 Ga0163162_10004752 3300013306 Bacteria 13105
640 Ga0163162_10007639 3300013306 Bacteria 10532
641 Ga0163162_10011055 3300013306 Bacteria 8793
642 Ga0163162_10011263 3300013306 Bacteria 8720
643 Ga0163162_10013276 3300013306 Bacteria 8046
644 Ga0163162_10066034 3300013306 Bacteria 3666
645 Ga0163162_10078628 3300013306 Bacteria 3364
646 Ga0163162_10089334 3300013306 Bacteria 3161
647 Ga0163162_10094486 3300013306 Bacteria 3076
648 Ga0163162_10156314 3300013306 Bacteria 2401
649 Ga0163162_10192894 3300013306 Bacteria 2165
650 Ga0163162_10216962 3300013306 Bacteria 2043
651 Ga0163162_10493759 3300013306 Bacteria 1355
652 Ga0163162_10708950 3300013306 Bacteria 1128
653 Ga0163162_11140970 3300013306 Bacteria 884
654 Ga0157372_10000249 3300013307 Bacteria 59656
655 Ga0157372_10000573 3300013307 Bacteria 40317
656 Ga0157372_10001325 3300013307 Bacteria 26818
657 Ga0157372_10001734 3300013307 Bacteria 23654
658 Ga0157372_10004245 3300013307 Bacteria 15321
659 Ga0157372_10005099 3300013307 Bacteria 13964
660 Ga0157372_10029593 3300013307 Bacteria 5982
661 Ga0157372_10032861 3300013307 Bacteria 5693
662 Ga0157372_10047171 3300013307 Bacteria 4785
663 Ga0157372_10059943 3300013307 Bacteria 4258
664 Ga0157372_10062662 3300013307 Bacteria 4167
665 Ga0157372_10067907 3300013307 Bacteria 4008
666 Ga0157372_10117605 3300013307 Bacteria 3049
667 Ga0157372_10127116 3300013307 Bacteria 2931
668 Ga0157372_10128555 3300013307 Bacteria 2914
669 Ga0157372_10149478 3300013307 Bacteria 2695
670 Ga0157372_10158402 3300013307 Bacteria 2616
671 Ga0157372_10174527 3300013307 Bacteria 2488
672 Ga0157372_10195519 3300013307 Bacteria 2343
673 Ga0157372_10212172 3300013307 Bacteria 2244
674 Ga0157372_10404412 3300013307 Bacteria 1591
675 Ga0157372_10563276 3300013307 Bacteria 1328
676 Ga0157372_10639640 3300013307 Bacteria 1239
677 Ga0157372_10802402 3300013307 Bacteria 1094
678 Ga0157372_10863657 3300013307 Bacteria 1050
679 Ga0157375_10000144 3300013308 Bacteria 70151
680 Ga0157375_10000166 3300013308 Bacteria 61836
681 Ga0157375_10000989 3300013308 Bacteria 24572
682 Ga0157375_10011976 3300013308 Bacteria 7680
683 Ga0157375_10026953 3300013308 Bacteria 5364
684 Ga0157375_10028881 3300013308 Bacteria 5207
685 Ga0157375_10033870 3300013308 Bacteria 4859
686 Ga0157375_10046746 3300013308 Bacteria 4223
687 Ga0157375_10064088 3300013308 Bacteria 3658
688 Ga0157375_10096265 3300013308 Bacteria 3033
689 Ga0157375_10382077 3300013308 Bacteria 1575
690 Ga0157375_10777875 3300013308 Bacteria 1107
691 Ga0157375_10895822 3300013308 Bacteria 1031
692 Ga0163163_10000457 3300014325 Bacteria 37238
693 Ga0163163_10005245 3300014325 Bacteria 11176
694 Ga0163163_10007428 3300014325 Bacteria 9672
695 Ga0163163_10018496 3300014325 Bacteria 6525
696 Ga0163163_10042579 3300014325 Bacteria 4448
697 Ga0163163_10096264 3300014325 Bacteria 2980
698 Ga0163163_10206951 3300014325 Bacteria 2011
699 Ga0163163_10293044 3300014325 Bacteria 1679
700 Ga0163163_10429453 3300014325 Bacteria 1380
701 Ga0163163_10504567 3300014325 Bacteria 1272
702 Ga0163163_10653377 3300014325 Bacteria 1115
703 Ga0157380_10000959 3300014326 Bacteria 18260
704 Ga0157380_10042515 3300014326 Bacteria 3552
705 Ga0157380_10073518 3300014326 Bacteria 2772
706 Ga0157380_10109625 3300014326 Bacteria 2317
707 Ga0157380_10143991 3300014326 Bacteria 2051
708 Ga0157380_10215948 3300014326 Bacteria 1713
709 Ga0157380_10506599 3300014326 Bacteria 1174
710 Ga0157380_10954385 3300014326 Bacteria 888
711 Ga0182008_10000014 3300014497 Bacteria 263844
712 Ga0182008_10000447 3300014497 Bacteria 31386
713 Ga0182008_10000632 3300014497 Bacteria 25744
714 Ga0182008_10000876 3300014497 Bacteria 20916
715 Ga0182008_10004682 3300014497 Bacteria 7944
716 Ga0182008_10016574 3300014497 Bacteria 3829
717 Ga0157377_10001572 3300014745 Bacteria 9924
718 Ga0157377_10006401 3300014745 Bacteria 5614
719 Ga0157377_10026593 3300014745 Bacteria 3098
720 Ga0157377_10043294 3300014745 Bacteria 2505
721 Ga0157379_10000440 3300014968 Bacteria 33697
722 Ga0157379_10010385 3300014968 Bacteria 8111
723 Ga0157379_10016947 3300014968 Bacteria 6411
724 Ga0157379_10020609 3300014968 Bacteria 5833
725 Ga0157379_10037019 3300014968 Bacteria 4350
726 Ga0157379_10071559 3300014968 Bacteria 3102
727 Ga0157379_10129072 3300014968 Bacteria 2275
728 Ga0157379_10183456 3300014968 Bacteria 1890
729 Ga0157379_10315563 3300014968 Bacteria 1427
730 Ga0157376_10000783 3300014969 Bacteria 20773
731 Ga0157376_10001017 3300014969 Bacteria 18313
732 Ga0157376_10003603 3300014969 Bacteria 10688
733 Ga0157376_10004446 3300014969 Bacteria 9769
734 Ga0157376_10005594 3300014969 Bacteria 8793
735 Ga0157376_10019555 3300014969 Bacteria 5223
736 Ga0157376_10529869 3300014969 Bacteria 1162
737 Ga0157376_10541307 3300014969 Unclassified 1151
738 Ga0182006_1000015 3300015261 Bacteria 325938
739 Ga0182006_1000159 3300015261 Bacteria 72265
740 Ga0182006_1000697 3300015261 Bacteria 23266
741 Ga0182006_1001331 3300015261 Bacteria 15112
742 Ga0182006_1005526 3300015261 Bacteria 6005
743 Ga0182006_1005766 3300015261 Bacteria 5843
744 Ga0182006_1022598 3300015261 Bacteria 2613
745 Ga0182006_1042453 3300015261 Bacteria 1782
746 Ga0182006_1115540 3300015261 Bacteria 938
747 Ga0182006_1122512 3300015261 Bacteria 902
748 Ga0182007_10000002 3300015262 Bacteria 564661
749 Ga0182007_10046892 3300015262 Bacteria 1430
750 Ga0182005_1000131 3300015265 Bacteria 53401
751 Ga0183373_1004 3300015682 Bacteria 537398
752 Ga0163161_10000055 3300017792 Bacteria 114949
753 Ga0163161_10000310 3300017792 Bacteria 42437
754 Ga0163161_10000406 3300017792 Bacteria 36130
755 Ga0163161_10001060 3300017792 Bacteria 20831
756 Ga0163161_10001090 3300017792 Bacteria 20550
757 Ga0163161_10002554 3300017792 Bacteria 13004
758 Ga0163161_10007129 3300017792 Bacteria 7727
759 Ga0163161_10010202 3300017792 Bacteria 6503
760 Ga0163161_10012738 3300017792 Bacteria 5841
761 Ga0163161_10021681 3300017792 Bacteria 4515
762 Ga0163161_10022721 3300017792 Bacteria 4417
763 Ga0163161_10032577 3300017792 Bacteria 3722
764 Ga0163161_10033164 3300017792 Bacteria 3690
765 Ga0163161_10081658 3300017792 Bacteria 2380
766 Ga0163161_10084142 3300017792 Bacteria 2345
767 Ga0163161_10214407 3300017792 Bacteria 1488
768 Ga0163161_10248203 3300017792 Bacteria 1387
769 Ga0163161_10271733 3300017792 Bacteria 1327
770 Ga0163161_10449633 3300017792 Bacteria 1041
771 Ga0206351_10132316 3300020077 Bacteria 1139
772 Ga0206350_10385760 3300020080 Bacteria 1013
773 Ga0213876_10007839 3300021384 Bacteria 5793
774 Ga0213876_10036822 3300021384 Bacteria 2581
775 Ga0209436_100821 3300025208 Bacteria 12612
776 Ga0209436_102604 3300025208 Bacteria 5303
777 Ga0209563_105477 3300025230 Bacteria 2294
778 Ga0207427_100210 3300025231 Bacteria 53314
779 Ga0209437_100021 3300025233 Bacteria 646400
780 Ga0209437_100102 3300025233 Bacteria 224216
781 Ga0209258_100219 3300025242 Bacteria 108974
782 Ga0207425_1000002 3300025245 Bacteria 1362590
783 Ga0209646_1000002 3300025246 Bacteria 1425781
784 Ga0209646_1002231 3300025246 Bacteria 4454
785 Ga0209026_1000086 3300025250 Bacteria 185551
786 Ga0209148_1000283 3300025254 Bacteria 77780
787 Ga0209148_1010575 3300025254 Bacteria 1744
788 Ga0209129_1000002 3300025258 Bacteria 1359086
789 Ga0209129_1014317 3300025258 Bacteria 1695
790 Ga0209233_1000035 3300025261 Bacteria 568478
791 Ga0209233_1002196 3300025261 Bacteria 7314
792 Ga0209233_1019182 3300025261 Bacteria 1823
793 Ga0207666_1007757 3300025271 Bacteria 1421
794 Ga0209455_1001657 3300025272 Bacteria 9647
795 Ga0209673_1000082 3300025273 Bacteria 219716
796 Ga0209130_1002528 3300025284 Bacteria 8977
797 Ga0209675_1000095 3300025291 Bacteria 135911
798 Ga0209676_1000009 3300025292 Bacteria 981719
799 Ga0209025_1000004 3300025294 Bacteria 1361782
800 Ga0209758_1000006 3300025297 Bacteria 1359562
801 Ga0209758_1014978 3300025297 Bacteria 4058
802 Ga0209050_1000094 3300025298 Bacteria 242893
803 Ga0209050_1000555 3300025298 Bacteria 61428
804 Ga0207426_1000009 3300025302 Bacteria 797229
805 Ga0207426_1000493 3300025302 Bacteria 59050
806 Ga0207426_1000514 3300025302 Bacteria 56462
807 Ga0207426_1000883 3300025302 Bacteria 30996
808 Ga0209257_1000001 3300025304 Bacteria 2274655
809 Ga0209257_1000005 3300025304 Bacteria 1592528
810 Ga0209257_1004806 3300025304 Bacteria 10049
811 Ga0207697_10017058 3300025315 Bacteria 2986
812 Ga0207697_10025099 3300025315 Bacteria 2437
813 Ga0207656_10001383 3300025321 Bacteria 8006
814 Ga0207656_10091912 3300025321 Unclassified 1379
815 Ga0207656_10240688 3300025321 Bacteria 884
816 Ga0207696_1021549 3300025711 Bacteria 2061
817 Ga0207655_1000038 3300025728 Bacteria 348340
818 Ga0207655_1000237 3300025728 Bacteria 91108
819 Ga0207713_1029354 3300025735 Bacteria 2465
820 Ga0207682_10004258 3300025893 Bacteria 6040
821 Ga0207682_10053198 3300025893 Bacteria 1679
822 Ga0207682_10081045 3300025893 Bacteria 1391
823 Ga0207682_10127847 3300025893 Bacteria 1132
824 Ga0207710_10000635 3300025900 Bacteria 20160
825 Ga0207710_10020924 3300025900 Bacteria 2800
826 Ga0207688_10005632 3300025901 Bacteria 6813
827 Ga0207680_10000018 3300025903 Bacteria 94318
828 Ga0207680_10147108 3300025903 Bacteria 1567
829 Ga0207680_10478007 3300025903 Bacteria 886
830 Ga0207647_10000288 3300025904 Bacteria 41316
831 Ga0207647_10001469 3300025904 Bacteria 18105
832 Ga0207647_10014633 3300025904 Bacteria 5404
833 Ga0207647_10017201 3300025904 Bacteria 4920
834 Ga0207647_10175842 3300025904 Bacteria 1245
835 Ga0207645_10000355 3300025907 Bacteria 37914
836 Ga0207645_10139848 3300025907 Bacteria 1577
837 Ga0207643_10001223 3300025908 Bacteria 15180
838 Ga0207643_10025323 3300025908 Bacteria 3279
839 Ga0207705_10003765 3300025909 Bacteria 11554
840 Ga0207705_10005465 3300025909 Bacteria 9503
841 Ga0207705_10017645 3300025909 Bacteria 5108
842 Ga0207705_10056149 3300025909 Bacteria 2839
843 Ga0207705_10090771 3300025909 Bacteria 2237
844 Ga0207654_10001745 3300025911 Bacteria 11295
845 Ga0207654_10002658 3300025911 Bacteria 9074
846 Ga0207654_10010115 3300025911 Bacteria 4799
847 Ga0207654_10016563 3300025911 Bacteria 3840
848 Ga0207654_10068075 3300025911 Bacteria 2106
849 Ga0207654_10135668 3300025911 Bacteria 1563
850 Ga0207707_10006917 3300025912 Bacteria 9896
851 Ga0207707_10076027 3300025912 Bacteria 2931
852 Ga0207707_10110366 3300025912 Unclassified 2404
853 Ga0207707_10195532 3300025912 Bacteria 1764
854 Ga0207695_10000016 3300025913 Bacteria 771991
855 Ga0207695_10000092 3300025913 Bacteria 270514
856 Ga0207695_10000127 3300025913 Bacteria 227338
857 Ga0207695_10000128 3300025913 Bacteria 226098
858 Ga0207695_10001712 3300025913 Bacteria 35115
859 Ga0207695_10003683 3300025913 Bacteria 21346
860 Ga0207695_10004313 3300025913 Bacteria 19491
861 Ga0207695_10007767 3300025913 Bacteria 13580
862 Ga0207695_10077327 3300025913 Bacteria 3381
863 Ga0207695_10091282 3300025913 Bacteria 3060
864 Ga0207695_10102612 3300025913 Bacteria 2853
865 Ga0207695_10146167 3300025913 Bacteria 2308
866 Ga0207695_10316606 3300025913 Bacteria 1450
867 Ga0207671_10000036 3300025914 Bacteria 236133
868 Ga0207671_10000254 3300025914 Bacteria 79974
869 Ga0207671_10001027 3300025914 Bacteria 33973
870 Ga0207671_10002571 3300025914 Bacteria 19227
871 Ga0207671_10002688 3300025914 Bacteria 18645
872 Ga0207671_10002901 3300025914 Bacteria 17704
873 Ga0207671_10004487 3300025914 Bacteria 13301
874 Ga0207671_10009249 3300025914 Bacteria 8255
875 Ga0207671_10029553 3300025914 Bacteria 4092
876 Ga0207671_10030270 3300025914 Bacteria 4038
877 Ga0207671_10050334 3300025914 Bacteria 3085
878 Ga0207671_10059756 3300025914 Bacteria 2827
879 Ga0207671_10134946 3300025914 Bacteria 1897
880 Ga0207671_10151150 3300025914 Bacteria 1794
881 Ga0207671_10438171 3300025914 Bacteria 1040
882 Ga0207660_10010300 3300025917 Bacteria 6063
883 Ga0207660_10011293 3300025917 Bacteria 5808
884 Ga0207660_10021677 3300025917 Bacteria 4323
885 Ga0207660_10240081 3300025917 Bacteria 1427
886 Ga0207660_10282647 3300025917 Unclassified 1317
887 Ga0207660_10521411 3300025917 Bacteria 965
888 Ga0207662_10004421 3300025918 Bacteria 7392
889 Ga0207662_10073050 3300025918 Unclassified 2080
890 Ga0207657_10002233 3300025919 Bacteria 20999
891 Ga0207657_10005099 3300025919 Bacteria 13760
892 Ga0207657_10019043 3300025919 Bacteria 6531
893 Ga0207657_10054929 3300025919 Bacteria 3442
894 Ga0207649_10123079 3300025920 Unclassified 1751
895 Ga0207649_10160254 3300025920 Bacteria 1558
896 Ga0207649_10359198 3300025920 Bacteria 1080
897 Ga0207652_10000011 3300025921 Bacteria 246742
898 Ga0207652_10000944 3300025921 Bacteria 27335
899 Ga0207652_10008689 3300025921 Bacteria 8179
900 Ga0207652_10009908 3300025921 Bacteria 7668
901 Ga0207652_10014810 3300025921 Bacteria 6322
902 Ga0207652_10018660 3300025921 Bacteria 5692
903 Ga0207652_10097740 3300025921 Bacteria 2588
904 Ga0207652_10112230 3300025921 Bacteria 2419
905 Ga0207681_10150658 3300025923 Bacteria 1742
906 Ga0207681_10200845 3300025923 Bacteria 1531
907 Ga0207681_10299959 3300025923 Bacteria 1271
908 Ga0207694_10045879 3300025924 Bacteria 3377
909 Ga0207694_10055972 3300025924 Bacteria 3063
910 Ga0207694_10187288 3300025924 Bacteria 1680
911 Ga0207694_10219163 3300025924 Bacteria 1551
912 Ga0207694_10359113 3300025924 Bacteria 1207
913 Ga0207650_10023493 3300025925 Bacteria 4372
914 Ga0207650_10040596 3300025925 Bacteria 3406
915 Ga0207650_10054149 3300025925 Bacteria 2975
916 Ga0207650_10065515 3300025925 Bacteria 2723
917 Ga0207650_10069417 3300025925 Bacteria 2648
918 Ga0207650_10124097 3300025925 Bacteria 2014
919 Ga0207650_10232201 3300025925 Bacteria 1488
920 Ga0207650_10241645 3300025925 Bacteria 1460
921 Ga0207650_10302128 3300025925 Bacteria 1307
922 Ga0207659_10012489 3300025926 Bacteria 5406
923 Ga0207659_10026358 3300025926 Bacteria 3921
924 Ga0207659_10109974 3300025926 Bacteria 2093
925 Ga0207659_10349521 3300025926 Bacteria 1226
926 Ga0207644_10047981 3300025931 Bacteria 3050
927 Ga0207644_10233879 3300025931 Bacteria 1461
928 Ga0207644_10282928 3300025931 Bacteria 1332
929 Ga0207644_10456352 3300025931 Bacteria 1050
930 Ga0207644_10459907 3300025931 Bacteria 1046
931 Ga0207690_10003894 3300025932 Bacteria 8826
932 Ga0207690_10005944 3300025932 Bacteria 7226
933 Ga0207690_10023981 3300025932 Bacteria 3815
934 Ga0207690_10176607 3300025932 Bacteria 1604
935 Ga0207690_10313009 3300025932 Bacteria 1232
936 Ga0207690_10364860 3300025932 Bacteria 1145
937 Ga0207706_10019177 3300025933 Bacteria 6151
938 Ga0207706_10035734 3300025933 Bacteria 4416
939 Ga0207706_10443544 3300025933 Bacteria 1123
940 Ga0207686_10003017 3300025934 Bacteria 9072
941 Ga0207686_10270278 3300025934 Bacteria 1250
942 Ga0207686_10310355 3300025934 Bacteria 1175
943 Ga0207709_10000008 3300025935 Bacteria 713099
944 Ga0207709_10000630 3300025935 Bacteria 28876
945 Ga0207670_10118298 3300025936 Bacteria 1921
946 Ga0207670_10188460 3300025936 Bacteria 1559
947 Ga0207669_10090499 3300025937 Bacteria 1990
948 Ga0207669_10218719 3300025937 Bacteria 1396
949 Ga0207704_10013711 3300025938 Bacteria 4067
950 Ga0207704_10014771 3300025938 Bacteria 3956
951 Ga0207704_10050317 3300025938 Bacteria 2513
952 Ga0207704_10106009 3300025938 Bacteria 1887
953 Ga0207704_10124421 3300025938 Bacteria 1772
954 Ga0207691_10000037 3300025940 Bacteria 108385
955 Ga0207691_10022194 3300025940 Bacteria 5987
956 Ga0207691_10022708 3300025940 Bacteria 5915
957 Ga0207691_10049785 3300025940 Bacteria 3839
958 Ga0207691_10085689 3300025940 Bacteria 2828
959 Ga0207691_10158272 3300025940 Bacteria 1988
960 Ga0207691_10357143 3300025940 Bacteria 1250
961 Ga0207691_10407618 3300025940 Bacteria 1159
962 Ga0207711_10127665 3300025941 Bacteria 2276
963 Ga0207689_10019502 3300025942 Bacteria 5715
964 Ga0207689_10073408 3300025942 Bacteria 2810
965 Ga0207689_10074490 3300025942 Bacteria 2789
966 Ga0207689_10076209 3300025942 Bacteria 2758
967 Ga0207689_10079142 3300025942 Bacteria 2702
968 Ga0207689_10099429 3300025942 Bacteria 2390
969 Ga0207689_10128267 3300025942 Bacteria 2086
970 Ga0207689_10196597 3300025942 Bacteria 1664
971 Ga0207689_10345032 3300025942 Bacteria 1237
972 Ga0207661_10002075 3300025944 Bacteria 13781
973 Ga0207661_10002267 3300025944 Bacteria 13264
974 Ga0207661_10060182 3300025944 Bacteria 3063
975 Ga0207661_10369938 3300025944 Bacteria 1296
976 Ga0207679_10027794 3300025945 Bacteria 3917
977 Ga0207679_10059555 3300025945 Bacteria 2833
978 Ga0207679_10072076 3300025945 Unclassified 2608
979 Ga0207679_10300394 3300025945 Bacteria 1384
980 Ga0207667_10000346 3300025949 Bacteria 63247
981 Ga0207667_10000610 3300025949 Bacteria 46234
982 Ga0207667_10001317 3300025949 Bacteria 31149
983 Ga0207667_10011720 3300025949 Bacteria 10170
984 Ga0207667_10013817 3300025949 Bacteria 9224
985 Ga0207667_10052499 3300025949 Bacteria 4293
986 Ga0207667_10060056 3300025949 Bacteria 3980
987 Ga0207667_10067892 3300025949 Bacteria 3714
988 Ga0207667_10145050 3300025949 Bacteria 2444
989 Ga0207667_10214249 3300025949 Bacteria 1974
990 Ga0207667_10258199 3300025949 Bacteria 1782
991 Ga0207667_10306862 3300025949 Bacteria 1621
992 Ga0207667_10551033 3300025949 Bacteria 1166
993 Ga0207651_10001954 3300025960 Bacteria 9692
994 Ga0207651_10027337 3300025960 Bacteria 3582
995 Ga0207651_10169516 3300025960 Bacteria 1720
996 Ga0207651_10273679 3300025960 Bacteria 1392
997 Ga0207712_10031385 3300025961 Unclassified 3578
998 Ga0207712_10032827 3300025961 Bacteria 3506
999 Ga0207712_10033370 3300025961 Bacteria 3479
1000 Ga0207712_10039674 3300025961 Bacteria 3227
1001 Ga0207712_10051430 3300025961 Bacteria 2881
1002 Ga0207712_10054675 3300025961 Bacteria 2805
1003 Ga0207712_10095338 3300025961 Bacteria 2200
1004 Ga0207712_10118743 3300025961 Bacteria 1997
1005 Ga0207668_10001977 3300025972 Bacteria 11985
1006 Ga0207668_10133778 3300025972 Bacteria 1897
1007 Ga0207640_10009102 3300025981 Bacteria 5545
1008 Ga0207640_10278514 3300025981 Bacteria 1312
1009 Ga0207658_10011529 3300025986 Bacteria 6017
1010 Ga0207658_10030280 3300025986 Bacteria 3830
1011 Ga0207658_10079089 3300025986 Bacteria 2514
1012 Ga0207658_10100570 3300025986 Bacteria 2264
1013 Ga0207658_10153346 3300025986 Bacteria 1880
1014 Ga0207658_10156222 3300025986 Bacteria 1864
1015 Ga0207677_10000485 3300026023 Bacteria 25909
1016 Ga0207677_10091658 3300026023 Bacteria 2211
1017 Ga0207703_10016859 3300026035 Bacteria 5696
1018 Ga0207703_10050789 3300026035 Bacteria 3358
1019 Ga0207703_10056347 3300026035 Bacteria 3201
1020 Ga0207703_10152489 3300026035 Bacteria 2016
1021 Ga0207639_10003745 3300026041 Bacteria 10237
1022 Ga0207639_10024644 3300026041 Bacteria 4357
1023 Ga0207639_10054315 3300026041 Bacteria 3061
1024 Ga0207639_10081189 3300026041 Bacteria 2568
1025 Ga0207639_10088442 3300026041 Bacteria 2472
1026 Ga0207639_10175228 3300026041 Bacteria 1820
1027 Ga0207639_10288358 3300026041 Bacteria 1446
1028 Ga0207639_10425543 3300026041 Bacteria 1201
1029 Ga0207678_10007004 3300026067 Bacteria 10008
1030 Ga0207678_10075827 3300026067 Bacteria 2880
1031 Ga0207678_10147956 3300026067 Bacteria 2005
1032 Ga0207708_10031319 3300026075 Bacteria 4037
1033 Ga0207708_10520691 3300026075 Bacteria 999
1034 Ga0207702_10000023 3300026078 Bacteria 189234
1035 Ga0207702_10005843 3300026078 Bacteria 10701
1036 Ga0207702_10028006 3300026078 Bacteria 4681
1037 Ga0207702_10131836 3300026078 Bacteria 2250
1038 Ga0207702_10209080 3300026078 Bacteria 1813
1039 Ga0207702_10535252 3300026078 Bacteria 1145
1040 Ga0207702_10693516 3300026078 Bacteria 1003
1041 Ga0207641_10000053 3300026088 Bacteria 173468
1042 Ga0207641_10004287 3300026088 Bacteria 12394
1043 Ga0207641_10015125 3300026088 Bacteria 6322
1044 Ga0207641_10031185 3300026088 Bacteria 4420
1045 Ga0207641_10158912 3300026088 Bacteria 2053
1046 Ga0207641_10282833 3300026088 Bacteria 1561
1047 Ga0207641_10324899 3300026088 Bacteria 1460
1048 Ga0207641_10584342 3300026088 Bacteria 1092
1049 Ga0207648_10002745 3300026089 Bacteria 18711
1050 Ga0207648_10002984 3300026089 Bacteria 17884
1051 Ga0207648_10021518 3300026089 Bacteria 5796
1052 Ga0207648_10080806 3300026089 Bacteria 2836
1053 Ga0207648_10152433 3300026089 Bacteria 2040
1054 Ga0207648_10284895 3300026089 Bacteria 1478
1055 Ga0207648_10292234 3300026089 Bacteria 1459
1056 Ga0207648_10302914 3300026089 Bacteria 1434
1057 Ga0207676_10007338 3300026095 Bacteria 7820
1058 Ga0207676_10012031 3300026095 Bacteria 6193
1059 Ga0207676_10051922 3300026095 Bacteria 3203
1060 Ga0207676_10069872 3300026095 Bacteria 2814
1061 Ga0207676_10142200 3300026095 Bacteria 2055
1062 Ga0207676_10166047 3300026095 Bacteria 1918
1063 Ga0207676_10543079 3300026095 Bacteria 1109
1064 Ga0207674_10021221 3300026116 Bacteria 7001
1065 Ga0207674_10027137 3300026116 Bacteria 6065
1066 Ga0207674_10035346 3300026116 Bacteria 5215
1067 Ga0207674_10059552 3300026116 Bacteria 3864
1068 Ga0207674_10092507 3300026116 Bacteria 3014
1069 Ga0207674_10105539 3300026116 Bacteria 2795
1070 Ga0207674_10155308 3300026116 Bacteria 2243
1071 Ga0207674_10212088 3300026116 Bacteria 1885
1072 Ga0207674_10249006 3300026116 Bacteria 1724
1073 Ga0207674_10311501 3300026116 Bacteria 1523
1074 Ga0207675_100000124 3300026118 Bacteria 63805
1075 Ga0207675_100040463 3300026118 Bacteria 4353
1076 Ga0207675_100169354 3300026118 Bacteria 2087
1077 Ga0207675_100190769 3300026118 Bacteria 1966
1078 Ga0207675_100372489 3300026118 Bacteria 1403
1079 Ga0207675_100473959 3300026118 Bacteria 1243
1080 Ga0207683_10086170 3300026121 Bacteria 2792
1081 Ga0207683_10170844 3300026121 Bacteria 1969
1082 Ga0207683_10279996 3300026121 Bacteria 1524
1083 Ga0207683_10386350 3300026121 Bacteria 1287
1084 Ga0207698_10001211 3300026142 Bacteria 15062
1085 Ga0207698_10003545 3300026142 Bacteria 9411
1086 Ga0207698_10011425 3300026142 Bacteria 5758
1087 Ga0207698_10033954 3300026142 Bacteria 3713
1088 Ga0207698_10046171 3300026142 Bacteria 3287
1089 Ga0207698_10054931 3300026142 Bacteria 3066
1090 Ga0207698_10065450 3300026142 Bacteria 2855
1091 Ga0207698_10205936 3300026142 Bacteria 1766
1092 Ga0207698_10287448 3300026142 Bacteria 1524
1093 Ga0207698_10287458 3300026142 Bacteria 1524
1094 Ga0209281_1000311 3300027111 Bacteria 86930
1095 Ga0209489_112096 3300027361 Bacteria 8182
1096 Ga0209995_1013121 3300027471 Bacteria 1356
1097 Ga0268266_10000014 3300028379 Bacteria 644033
1098 Ga0268266_10016598 3300028379 Bacteria 6292
1099 Ga0268266_10162530 3300028379 Bacteria 2021
1100 Ga0268266_10545080 3300028379 Bacteria 1111
1101 Ga0268265_10021116 3300028380 Bacteria 4554
1102 Ga0268265_10052714 3300028380 Bacteria 3078
1103 Ga0268264_10000013 3300028381 Bacteria 513859
1104 Ga0268264_10004442 3300028381 Bacteria 11964
1105 Ga0268264_10007626 3300028381 Bacteria 9019
1106 Ga0268264_10014664 3300028381 Bacteria 6439
1107 Ga0268264_10024660 3300028381 Bacteria 4912
1108 Ga0268264_10047358 3300028381 Bacteria 3574
1109 Ga0268264_10062030 3300028381 Bacteria 3138
1110 Ga0268264_10116919 3300028381 Bacteria 2345
1111 Ga0268264_10324998 3300028381 Bacteria 1456
1112 Ga0268264_10394012 3300028381 Bacteria 1329
1113 Ga0307517_10009441 3300028786 Bacteria 13821
1114 Ga0307515_10000002 3300028794 Bacteria 1231751
1115 Ga0307515_10000061 3300028794 Bacteria 251841
1116 Ga0307515_10000676 3300028794 Bacteria 78539
1117 Ga0307515_10001796 3300028794 Bacteria 47846
1118 Ga0307515_10228549 3300028794 Bacteria 1659
1119 Ga0307515_10364670 3300028794 Bacteria 1084
1120 Ga0265338_10000658 3300028800 Bacteria 59815
1121 Ga0265324_10046281 3300029957 Bacteria 1497
1122 Ga0307511_10001218 3300030521 Bacteria 27286
1123 Ga0316177_1046651 3300030731 Bacteria 2602
1124 Ga0316176_1106664 3300030732 Bacteria 8555
1125 Ga0316183_1171692 3300030742 Bacteria 16840
1126 Ga0316181_1177553 3300030744 Bacteria 6181
1127 Ga0316182_1148280 3300030745 Bacteria 2669
1128 Ga0265327_10000093 3300031251 Bacteria 195220
1129 Ga0265327_10000148 3300031251 Bacteria 151952
1130 Ga0265327_10003750 3300031251 Bacteria 14130
1131 Ga0265327_10022676 3300031251 Bacteria 3744
1132 Ga0265327_10024944 3300031251 Bacteria 3497
1133 Ga0265327_10089072 3300031251 Bacteria 1508
1134 Ga0265327_10101452 3300031251 Bacteria 1388
1135 Ga0265316_10201971 3300031344 Bacteria 1473
1136 Ga0307513_10072311 3300031456 Bacteria 3595
1137 Ga0307513_10139618 3300031456 Bacteria 2352
1138 Ga0307509_10034640 3300031507 Bacteria 5546
1139 Ga0307509_10039603 3300031507 Bacteria 5133
1140 Ga0307509_10060843 3300031507 Bacteria 3990
1141 Ga0307509_10193809 3300031507 Bacteria 1879
1142 Ga0307408_100000566 3300031548 Bacteria 31917
1143 Ga0307408_100000736 3300031548 Bacteria 26464
1144 Ga0307408_100000824 3300031548 Bacteria 24639
1145 Ga0307508_10001800 3300031616 Bacteria 23762
1146 Ga0307508_10209485 3300031616 Bacteria 1550
1147 Ga0316579_10062502 3300031691 Bacteria 1753
1148 Ga0265314_10028286 3300031711 Bacteria 4181
1149 Ga0316576_10004240 3300031727 Bacteria 8564
1150 Ga0316576_10030922 3300031727 Unclassified 3795
1151 Ga0316576_10054422 3300031727 Bacteria 2919
1152 Ga0316576_10092344 3300031727 Bacteria 2255
1153 Ga0316576_10103933 3300031727 Bacteria 2125
1154 Ga0316576_10325775 3300031727 Bacteria 1146
1155 Ga0316578_10016865 3300031728 Unclassified 3962
1156 Ga0316578_10069316 3300031728 Bacteria 2087
1157 Ga0316578_10107827 3300031728 Bacteria 1672
1158 Ga0307516_10004774 3300031730 Bacteria 16525
1159 Ga0307516_10220891 3300031730 Bacteria 1604
1160 Ga0307516_10295557 3300031730 Bacteria 1297
1161 Ga0307405_10000001 3300031731 Bacteria 1731270
1162 Ga0307405_10000006 3300031731 Bacteria 361477
1163 Ga0316577_10013852 3300031733 Bacteria 4420
1164 Ga0307413_10000039 3300031824 Bacteria 33762
1165 Ga0307410_10000363 3300031852 Bacteria 17675
1166 Ga0307406_10000950 3300031901 Bacteria 16237
1167 Ga0307406_10065077 3300031901 Bacteria 2368
1168 Ga0307407_10000031 3300031903 Bacteria 87995
1169 Ga0307407_10033702 3300031903 Bacteria 2796
1170 Ga0307412_10000019 3300031911 Bacteria 266611
1171 Ga0307412_10000043 3300031911 Bacteria 166562
1172 Ga0307412_10002048 3300031911 Bacteria 11186
1173 Ga0307412_10035298 3300031911 Bacteria 3193
1174 Ga0307412_10323767 3300031911 Bacteria 1227
1175 Ga0307409_100057513 3300031995 Bacteria 3014
1176 Ga0307416_100000002 3300032002 Bacteria 509907
1177 Ga0307416_100000004 3300032002 Bacteria 505535
1178 Ga0307416_100000179 3300032002 Bacteria 34391
1179 Ga0307416_100263485 3300032002 Bacteria 1686
1180 Ga0307414_10000010 3300032004 Bacteria 357863
1181 Ga0307414_10000011 3300032004 Bacteria 338253
1182 Ga0307414_10000713 3300032004 Bacteria 16976
1183 Ga0307414_10003845 3300032004 Bacteria 8076
1184 Ga0307414_10010702 3300032004 Bacteria 5341
1185 Ga0307414_10018546 3300032004 Bacteria 4288
1186 Ga0307414_10038767 3300032004 Bacteria 3203
1187 Ga0307414_10076998 3300032004 Bacteria 2426
1188 Ga0307414_10079616 3300032004 Bacteria 2392
1189 Ga0307414_10128456 3300032004 Bacteria 1963
1190 Ga0307414_10166483 3300032004 Bacteria 1757
1191 Ga0307414_10205639 3300032004 Bacteria 1605
1192 Ga0307414_10253395 3300032004 Bacteria 1465
1193 Ga0307414_10387745 3300032004 Bacteria 1210
1194 Ga0307411_10000004 3300032005 Bacteria 460327
1195 Ga0307411_10038743 3300032005 Bacteria 3010
1196 Ga0307411_10070585 3300032005 Bacteria 2364
1197 Ga0307411_10219368 3300032005 Bacteria 1474
1198 Ga0307415_100228926 3300032126 Bacteria 1496
1199 Ga0316583_10063105 3300032133 Bacteria 1298
1200 Ga0316580_10055265 3300032139 Bacteria 1221
1201 Ga0307507_10000099 3300033179 Bacteria 139532
1202 Ga0307510_10000299 3300033180 Bacteria 45822
1203 Ga0373944_0124646 3300035089 Bacteria 891
1204 Ga0373955_0088969 3300035172 Bacteria 1757
1205 Ga0373955_0258306 3300035172 Bacteria 1045
1206 Ga0316574_0050496 3300035398 Bacteria 2589
1207 Ga0316574_0098149 3300035398 Bacteria 1873
1208 Ga0373935_0500638 3300035692 Bacteria 882
1209 Ga0373937_0048314 3300036401 Bacteria 3895
1210 Ga0373937_0123286 3300036401 Bacteria 2416
1211 Ga0373937_0487459 3300036401 Bacteria 1171
1212 Ga0316582_0009025 3300036647 Bacteria 5389
1213 Ga0316582_0017395 3300036647 Unclassified 4159
1214 Ga0316582_0086359 3300036647 Bacteria 2057
1215 Ga0316582_0254760 3300036647 Bacteria 1203
1216 Ga0316584_0006014 3300036712 Bacteria 8196
1217 Ga0316584_0008100 3300036712 Bacteria 7220
1218 Ga0316584_0042576 3300036712 Bacteria 3385
1219 Ga0316584_0252682 3300036712 Bacteria 1287
1220 Ga0373925_0115794 3300037068 Bacteria 2076
1221 Ga0395899_0000177 3300037312 Bacteria 94226
1222 Ga0395899_0002106 3300037312 Bacteria 16349
1223 Ga0395899_0025305 3300037312 Bacteria 4481
1224 Ga0395899_0156961 3300037312 Bacteria 1609
1225 Ga0395900_0001729 3300037418 Bacteria 25209
1226 Ga0395900_0013551 3300037418 Bacteria 8328
1227 Ga0395900_0081265 3300037418 Unclassified 3329
1228 Ga0395900_0232663 3300037418 Bacteria 1852
1229 Ga0395900_0234292 3300037418 Bacteria 1845
1230 Ga0395898_0003753 3300037466 Bacteria 16827
1231 Ga0395898_0012532 3300037466 Bacteria 8768
1232 Ga0395898_0019133 3300037466 Bacteria 6972
1233 Ga0395898_0076279 3300037466 Bacteria 3237
1234 Ga0395898_0205045 3300037466 Bacteria 1881
1235 Ga0395898_0503099 3300037466 Bacteria 1152
1236 Ga0395905_0000003 3300037471 Bacteria 1347396
1237 Ga0395905_0001826 3300037471 Bacteria 24589
1238 Ga0395905_0073567 3300037471 Bacteria 3203
1239 Ga0395905_0208421 3300037471 Bacteria 1832
1240 Ga0395905_0293382 3300037471 Bacteria 1513
1241 Ga0395901_0006688 3300038443 Bacteria 11654
1242 Ga0395901_0007184 3300038443 Bacteria 11231
1243 Ga0395901_0012926 3300038443 Bacteria 8469
1244 Ga0395901_0021023 3300038443 Bacteria 6685
1245 Ga0395901_0244529 3300038443 Bacteria 1870
1246 Ga0400483_183977 3300039062 Bacteria 1317
1247 Ga0400483_219275 3300039062 Bacteria 32517
1248 Ga0400489_11482 3300039093 Bacteria 10842
1249 Ga0400489_54591 3300039093 Bacteria 1337
1250 Ga0436365_0480954 3300039437 Bacteria 25378
1251 Ga0436365_1569731 3300039437 Bacteria 4980
1252 Ga0436365_1768392 3300039437 Bacteria 2141
1253 Ga0436361_0728698 3300039447 Bacteria 1120
1254 Ga0439436_0012671 3300041404 Bacteria 2558
1255 Ga0439447_000262 3300041407 Bacteria 18516
1256 Ga0439466_0014367 3300041411 Bacteria 2884
1257 Ga0439465_0002739 3300041413 Bacteria 5764
1258 Ga0451791_1824324 3300041451 Bacteria 1597
1259 Ga0451807_1357051 3300041486 Bacteria 1592
1260 Ga0451841_0372109 3300041498 Bacteria 1229
1261 Ga0451855_0667465 3300041511 Bacteria 2429
1262 Ga0451855_1514386 3300041511 Bacteria 3379
1263 Ga0451853_1013762 3300041512 Bacteria 1095
1264 Ga0439431_0000810 3300041997 Bacteria 6751
1265 Ga0439431_0042653 3300041997 Bacteria 1159
1266 Ga0439442_006092 3300042002 Bacteria 2417
1267 Ga0439445_0000001 3300042004 Bacteria 97032
1268 Ga0439445_0000088 3300042004 Bacteria 14394
1269 Ga0439445_0004839 3300042004 Bacteria 3058
1270 Ga0439449_0005652 3300042007 Bacteria 4783
1271 Ga0439449_0057959 3300042007 Bacteria 1430
1272 Ga0439457_000014 3300042014 Bacteria 36364
1273 Ga0439457_026821 3300042014 Bacteria 1275
1274 Ga0450923_004999 3300042125 Bacteria 2117
1275 Ga0450898_000638 3300042134 Bacteria 4204
1276 Ga0450899_001082 3300042135 Bacteria 3097
1277 Ga0439434_0008135 3300042435 Bacteria 3074
1278 Ga0451577_0000250 3300042876 Bacteria 105934
1279 Ga0451577_0000756 3300042876 Bacteria 49287
1280 Ga0451577_0023282 3300042876 Bacteria 5649
1281 Ga0451577_0033500 3300042876 Bacteria 4631
1282 Ga0451577_0058443 3300042876 Bacteria 3438
1283 Ga0451577_0059945 3300042876 Bacteria 3393
1284 Ga0451577_0070738 3300042876 Bacteria 3111
1285 Ga0451577_0073923 3300042876 Bacteria 3041
1286 Ga0451577_0276851 3300042876 Bacteria 1520
1287 Ga0466969_0000137 3300044656 Bacteria 39423
1288 Ga0466969_0056886 3300044656 Bacteria 1908
1289 Ga0466972_0000023 3300044658 Bacteria 192679
1290 Ga0466972_0000064 3300044658 Bacteria 104558
1291 Ga0466972_0000661 3300044658 Bacteria 16620
1292 Ga0466972_0015911 3300044658 Bacteria 3761
1293 Ga0466972_0192733 3300044658 Bacteria 955
1294 Ga0453683_0000031 3300044673 Bacteria 241998
1295 Ga0453683_0000209 3300044673 Bacteria 78900
1296 Ga0453683_0002457 3300044673 Bacteria 14343
1297 Ga0453683_0014335 3300044673 Bacteria 5150
1298 Ga0453683_0025049 3300044673 Bacteria 3792
1299 Ga0453683_0042349 3300044673 Bacteria 2859
1300 Ga0453683_0129232 3300044673 Bacteria 1591
1301 Ga0453683_0172023 3300044673 Bacteria 1372
1302 Ga0453683_0194507 3300044673 Bacteria 1287
1303 Ga0466966_0000099 3300044684 Bacteria 53474
1304 Ga0466964_0189800 3300044706 Bacteria 980
1305 Ga0466964_0263090 3300044706 Unclassified 855
1306 Ga0453684_0001523 3300044712 Bacteria 64868
1307 Ga0453684_0001816 3300044712 Bacteria 56297
1308 Ga0453684_0002641 3300044712 Bacteria 42804
1309 Ga0453684_0006066 3300044712 Bacteria 23349
1310 Ga0453684_0010591 3300044712 Bacteria 15730
1311 Ga0453684_0012880 3300044712 Bacteria 13701
1312 Ga0453684_0014054 3300044712 Bacteria 12882
1313 Ga0453684_0016267 3300044712 Bacteria 11646
1314 Ga0453684_0018038 3300044712 Bacteria 10866
1315 Ga0453684_0018478 3300044712 Bacteria 10698
1316 Ga0453684_0031266 3300044712 Bacteria 7488
1317 Ga0453684_0040412 3300044712 Bacteria 6334
1318 Ga0453684_0044676 3300044712 Bacteria 5922
1319 Ga0453684_0060293 3300044712 Bacteria 4882
1320 Ga0453684_0061696 3300044712 Bacteria 4810
1321 Ga0453684_0063629 3300044712 Bacteria 4717
1322 Ga0453684_0066188 3300044712 Bacteria 4603
1323 Ga0453684_0074832 3300044712 Unclassified 4261
1324 Ga0453684_0077606 3300044712 Bacteria 4161
1325 Ga0453684_0094645 3300044712 Bacteria 3674
1326 Ga0453684_0199148 3300044712 Bacteria 2336
1327 Ga0453684_0235620 3300044712 Bacteria 2110
1328 Ga0453684_0483707 3300044712 Bacteria 1373
1329 Ga0453684_0676626 3300044712 Bacteria 1124
1330 Ga0466971_0007196 3300044719 Bacteria 4846
1331 Ga0466968_0024252 3300044735 Bacteria 2477
1332 Ga0466968_0082946 3300044735 Bacteria 1411
1333 Ga0466970_0000094 3300044765 Bacteria 37832
1334 Ga0466970_0047720 3300044765 Bacteria 2283
1335 Ga0466957_0002083 3300044842 Bacteria 10703
1336 Ga0466957_0009316 3300044842 Bacteria 5602
1337 Ga0466959_0000074 3300045049 Bacteria 65664
1338 Ga0466959_0014265 3300045049 Bacteria 5767
1339 Ga0451576_0000539 3300045051 Bacteria 81512
1340 Ga0451576_0002019 3300045051 Bacteria 32075
1341 Ga0451576_0003414 3300045051 Bacteria 21860
1342 Ga0451576_0022076 3300045051 Bacteria 6907
1343 Ga0451576_0035160 3300045051 Bacteria 5317
1344 Ga0451576_0043706 3300045051 Bacteria 4726
1345 Ga0451576_0085197 3300045051 Bacteria 3287
1346 Ga0451576_0096200 3300045051 Bacteria 3080
1347 Ga0451576_0112249 3300045051 Bacteria 2837
1348 Ga0451576_0169071 3300045051 Bacteria 2281
1349 Ga0451576_0234149 3300045051 Bacteria 1918
1350 Ga0451576_0253156 3300045051 Bacteria 1841
1351 Ga0451576_0411419 3300045051 Bacteria 1418
1352 Ga0451576_0595790 3300045051 Bacteria 1162
1353 Ga0451576_0936526 3300045051 Bacteria 908
1354 Ga0466967_0091301 3300045976 Bacteria 2768
1355 Ga0495627_000025 3300046453 Bacteria 248825
1356 Ga0495627_001544 3300046453 Bacteria 13158
1357 Ga0495627_004116 3300046453 Bacteria 6178
1358 Ga0495627_024362 3300046453 Bacteria 1973
1359 Ga0495590_0004963 3300046457 Bacteria 5312
1360 Ga0495629_0058077 3300046459 Bacteria 2705
1361 Ga0495638_0067278 3300046460 Bacteria 2200
1362 Ga0495638_0083484 3300046460 Bacteria 1935
1363 Ga0495651_0168704 3300046462 Bacteria 1561
1364 Ga0495651_0173285 3300046462 Bacteria 1534
1365 Ga0495650_0000107 3300046471 Bacteria 200864
1366 Ga0495582_0007561 3300046473 Bacteria 6011
1367 Ga0495639_0117227 3300046475 Bacteria 1268
1368 Ga0495585_0000116 3300046492 Bacteria 86272
1369 Ga0495585_0000170 3300046492 Bacteria 70224
1370 Ga0495607_0087145 3300046501 Bacteria 1700
1371 Ga0495583_0129701 3300046506 Bacteria 1056
1372 Ga0495583_0150615 3300046506 Bacteria 964
1373 Ga0495606_0002103 3300046507 Bacteria 24231
1374 Ga0495606_0009259 3300046507 Bacteria 8361
1375 Ga0495606_0011835 3300046507 Bacteria 7064
1376 Ga0495606_0012971 3300046507 Bacteria 6630
1377 Ga0495606_0020567 3300046507 Bacteria 4860
1378 Ga0495606_0037648 3300046507 Bacteria 3283
1379 Ga0495608_0229760 3300046511 Bacteria 1162
1380 Ga0495610_0000001 3300046512 Bacteria 1620061
1381 Ga0495610_0000724 3300046512 Bacteria 31376
1382 Ga0495610_0000784 3300046512 Bacteria 29827
1383 Ga0495610_0033625 3300046512 Bacteria 2648
1384 Ga0495610_0110737 3300046512 Bacteria 1217
1385 Ga0495616_0000882 3300046513 Bacteria 21777
1386 Ga0495616_0006658 3300046513 Bacteria 6974
1387 Ga0495618_0263834 3300046514 Bacteria 1078
1388 Ga0495628_0330916 3300046516 Bacteria 1123
1389 Ga0495632_0046723 3300046519 Bacteria 2150
1390 Ga0495637_0091612 3300046520 Bacteria 1198
1391 Ga0495643_0002717 3300046522 Bacteria 13619
1392 Ga0495643_0047543 3300046522 Bacteria 2323
1393 Ga0495643_0194823 3300046522 Bacteria 976
1394 Ga0495648_0016029 3300046524 Bacteria 5412
1395 Ga0495648_0023598 3300046524 Bacteria 4207
1396 Ga0495648_0045048 3300046524 Bacteria 2747
1397 Ga0495663_0000022 3300046525 Bacteria 109849
1398 Ga0495652_0122798 3300046529 Bacteria 2068
1399 Ga0495652_0170986 3300046529 Bacteria 1677
1400 Ga0495654_0000242 3300046530 Bacteria 50953
1401 Ga0495654_0044400 3300046530 Bacteria 2198
1402 Ga0495665_0084426 3300046531 Bacteria 1669
1403 Ga0495609_0000113 3300046538 Bacteria 94467
1404 Ga0495609_0001895 3300046538 Bacteria 13334
1405 Ga0495609_0074096 3300046538 Bacteria 1493
1406 Ga0495645_0084246 3300046543 Bacteria 2277
1407 Ga0495633_0000006 3300046558 Bacteria 326774
1408 Ga0495633_0000154 3300046558 Bacteria 90209
1409 Ga0495633_0000341 3300046558 Bacteria 52317
1410 Ga0495633_0014208 3300046558 Bacteria 4171
1411 Ga0495633_0020413 3300046558 Bacteria 3333
1412 Ga0495668_0000011 3300046616 Bacteria 472186
1413 Ga0495668_0000191 3300046616 Bacteria 90923
1414 Ga0495611_0001405 3300046648 Bacteria 12014
1415 Ga0495625_0000021 3300046660 Bacteria 282133
1416 Ga0495625_0000344 3300046660 Bacteria 71298
1417 Ga0495625_0003152 3300046660 Bacteria 16792
1418 Ga0495625_0014051 3300046660 Bacteria 6410
1419 Ga0495625_0014342 3300046660 Bacteria 6331
1420 Ga0495625_0069980 3300046660 Bacteria 2464
1421 Ga0495635_0356889 3300046663 Bacteria 974
1422 Ga0495661_0011479 3300046665 Bacteria 6010
1423 Ga0495647_0089909 3300046681 Bacteria 1258
1424 Ga0495658_0108891 3300046683 Bacteria 1663
1425 Ga0495671_0028196 3300046692 Bacteria 2895
1426 Ga0495649_0000009 3300046694 Bacteria 451725
1427 Ga0495660_0001836 3300046810 Bacteria 13932
1428 Ga0495660_0066210 3300046810 Bacteria 1927
1429 Ga0495581_0067456 3300047315 Bacteria 2069
1430 Ga0495636_0000077 3300047318 Bacteria 40716
1431 Ga0495674_0029758 3300047319 Bacteria 4969
1432 Ga0495672_0058796 3300047320 Bacteria 2227
1433 Ga0495672_0075978 3300047320 Bacteria 1888
1434 Ga0495687_000106 3300047443 Bacteria 128130
1435 Ga0495687_000356 3300047443 Bacteria 57396
1436 Ga0495673_0009304 3300047469 Bacteria 5446
1437 Ga0495686_0000016 3300047472 Bacteria 443701
1438 Ga0495686_0000107 3300047472 Bacteria 174386
1439 Ga0495686_0000324 3300047472 Bacteria 79635
1440 Ga0495686_0000485 3300047472 Bacteria 58800
1441 Ga0495686_0000673 3300047472 Bacteria 46191
1442 Ga0495686_0010011 3300047472 Bacteria 6774
1443 Ga0495686_0021685 3300047472 Bacteria 4260
1444 Ga0495686_0034708 3300047472 Bacteria 3247
1445 Ga0495686_0058484 3300047472 Bacteria 2403
1446 Ga0495686_0066119 3300047472 Bacteria 2235
1447 Ga0495614_0019698 3300048089 Bacteria 2919
1448 Ga0496100_0087754 3300048903 Bacteria 2116
1449 Ga0496101_0056828 3300048904 Bacteria 2829
1450 Ga0496101_0067770 3300048904 Bacteria 2607
1451 Ga0496102_0037210 3300048905 Bacteria 4389
1452 Ga0496104_0000005 3300048907 Bacteria 620360
1453 Ga0496105_0000018 3300048908 Bacteria 197208
1454 Ga0496108_0643425 3300048911 Bacteria 922
1455 Ga0496109_0023654 3300048912 Bacteria 5454
1456 Ga0496110_0069554 3300048913 Bacteria 3118
1457 Ga0496113_0121908 3300048916 Bacteria 2039
1458 Ga0496114_0006504 3300048917 Bacteria 9206
1459 Ga0496114_0344865 3300048917 Bacteria 1317
1460 Ga0496115_0067946 3300048918 Bacteria 2884
1461 Ga0496115_0341431 3300048918 Bacteria 1222
1462 Ga0496115_0427269 3300048918 Bacteria 1073
1463 Ga0496116_0000024 3300048919 Bacteria 471420
1464 Ga0496116_0000919 3300048919 Bacteria 36391
1465 Ga0496117_0000285 3300048920 Bacteria 92381
1466 Ga0496117_0042858 3300048920 Bacteria 3298
1467 Ga0496118_0003532 3300048921 Bacteria 19579
1468 Ga0496119_0000004 3300048922 Bacteria 536344
1469 Ga0496121_0000020 3300048924 Bacteria 498732
1470 Ga0496121_0215393 3300048924 Bacteria 1357
1471 Ga0496122_0000856 3300048925 Bacteria 57260
1472 Ga0496122_0001202 3300048925 Bacteria 44119
1473 Ga0496122_0001336 3300048925 Bacteria 40321
1474 Ga0496122_0003258 3300048925 Bacteria 21547
1475 Ga0496122_0016975 3300048925 Bacteria 6838
1476 Ga0496122_0106068 3300048925 Bacteria 1861
1477 Ga0496123_0002339 3300048926 Bacteria 23786
1478 Ga0496123_0008431 3300048926 Bacteria 9471
1479 Ga0496123_0010972 3300048926 Bacteria 7924
1480 Ga0496123_0032984 3300048926 Bacteria 3735
1481 Ga0496124_0001868 3300048927 Bacteria 28989
1482 Ga0496124_0170598 3300048927 Bacteria 1685
1483 Ga0496124_0443072 3300048927 Bacteria 888
1484 Ga0496125_0000018 3300048928 Bacteria 482390
1485 Ga0496125_0000552 3300048928 Bacteria 64522
1486 Ga0496125_0050649 3300048928 Bacteria 3436
1487 Ga0496125_0065533 3300048928 Bacteria 2877
1488 Ga0496126_0003667 3300048929 Bacteria 19179
1489 Ga0496126_0007711 3300048929 Bacteria 11749
1490 Ga0496126_0029217 3300048929 Bacteria 5239
1491 Ga0501309_000358 3300049129 Bacteria 3480
1492 Ga0495678_015057 3300049459 Bacteria 3573
1493 Ga0501298_012944 3300049521 Bacteria 1469
1494 Ga0501323_011008 3300049539 Bacteria 1086
1495 Ga0501323_013125 3300049539 Bacteria 1021
1496 Ga0501031_0000669 3300049568 Bacteria 20380
1497 Ga0501032_0006377 3300049569 Bacteria 8690
1498 Ga0501032_0006744 3300049569 Bacteria 8429
1499 Ga0501032_0011511 3300049569 Bacteria 6355
1500 Ga0501033_0000005 3300049570 Bacteria 379089
1501 Ga0501033_0045896 3300049570 Bacteria 3250
1502 Ga0501033_0082718 3300049570 Bacteria 2354
1503 Ga0501033_0116037 3300049570 Bacteria 1946
1504 Ga0501033_0218382 3300049570 Bacteria 1358
1505 Ga0501034_0000052 3300049571 Bacteria 207572
1506 Ga0501034_0000399 3300049571 Bacteria 73348
1507 Ga0501034_0007132 3300049571 Bacteria 11922
1508 Ga0501034_0013607 3300049571 Bacteria 8373
1509 Ga0501034_0048621 3300049571 Bacteria 4281
1510 Ga0501034_0057277 3300049571 Bacteria 3918
1511 Ga0501034_0082328 3300049571 Bacteria 3220
1512 Ga0501034_0174368 3300049571 Bacteria 2117
1513 Ga0501034_0204855 3300049571 Bacteria 1929
1514 Ga0501034_0372380 3300049571 Bacteria 1354
1515 Ga0501036_0005324 3300049572 Bacteria 10409
1516 Ga0501036_0038538 3300049572 Bacteria 4045
1517 Ga0501036_0226812 3300049572 Bacteria 1568
1518 Ga0501037_0004614 3300049573 Bacteria 10014
1519 Ga0501037_0028996 3300049573 Bacteria 4088
1520 Ga0501037_0048842 3300049573 Bacteria 3099
1521 Ga0501037_0154742 3300049573 Bacteria 1637
1522 Ga0501038_0008621 3300049574 Bacteria 9360
1523 Ga0501038_0013871 3300049574 Bacteria 7343
1524 Ga0501038_0269014 3300049574 Bacteria 1344
1525 Ga0501038_0315654 3300049574 Bacteria 1223
1526 Ga0501039_0010156 3300049575 Bacteria 7175
1527 Ga0501043_0009194 3300049579 Bacteria 7767
1528 Ga0501043_0097363 3300049579 Bacteria 2313
1529 Ga0501043_0179804 3300049579 Bacteria 1648
1530 Ga0501043_0223723 3300049579 Bacteria 1455
1531 Ga0501043_0326014 3300049579 Bacteria 1170
1532 Ga0501046_0161429 3300049580 Bacteria 1685
1533 Ga0501047_0008976 3300049581 Bacteria 9438
1534 Ga0501047_0028283 3300049581 Bacteria 5404
1535 Ga0501047_0056150 3300049581 Bacteria 3807
1536 Ga0501047_0082702 3300049581 Bacteria 3086
1537 Ga0501047_0375654 3300049581 Bacteria 1256
1538 Ga0501069_0028314 3300049585 Bacteria 3072
1539 Ga0501069_0047967 3300049585 Bacteria 2371
1540 Ga0501069_0064019 3300049585 Bacteria 2055
1541 Ga0501069_0249186 3300049585 Bacteria 1036
1542 Ga0501070_0065524 3300049586 Unclassified 3008
1543 Ga0501070_0066256 3300049586 Bacteria 2990
1544 Ga0501071_0319494 3300049587 Bacteria 1179
1545 Ga0501073_0033311 3300049589 Bacteria 3669
1546 Ga0501073_0232854 3300049589 Bacteria 1272
1547 Ga0501076_0198496 3300049592 Bacteria 1638
1548 Ga0501198_012863 3300049649 Bacteria 1261
1549 Ga0501201_000710 3300049651 Bacteria 3115
1550 Ga0501202_003897 3300049652 Bacteria 2580
1551 Ga0501217_000991 3300049661 Bacteria 5120
1552 Ga0501217_002907 3300049661 Bacteria 3427
1553 Ga0501222_001667 3300049662 Bacteria 3082
1554 Ga0501223_001698 3300049663 Bacteria 5037
1555 Ga0501223_006800 3300049663 Bacteria 2352
1556 Ga0501224_008900 3300049664 Bacteria 1466
1557 Ga0501233_060068 3300049668 Bacteria 941
1558 Ga0501235_003004 3300049669 Bacteria 3638
1559 Ga0501240_009534 3300049673 Bacteria 1271
1560 Ga0501243_017198 3300049675 Bacteria 1172
1561 Ga0501249_000012 3300049679 Bacteria 153759
1562 Ga0501249_001078 3300049679 Bacteria 5790
1563 Ga0501252_002797 3300049682 Bacteria 1761
1564 Ga0501257_001003 3300049686 Bacteria 5690
1565 Ga0501259_001336 3300049688 Bacteria 4128
1566 Ga0501261_000935 3300049690 Bacteria 3612
1567 Ga0501219_000072 3300049703 Bacteria 17183
1568 Ga0501221_001193 3300049704 Bacteria 4300
1569 Ga0501225_0002937 3300049705 Bacteria 5227
1570 Ga0501234_002922 3300049707 Bacteria 2690
1571 Ga0501245_000792 3300049708 Bacteria 3945
1572 Ga0501079_0074461 3300049741 Bacteria 2625
1573 Ga0501080_0046050 3300049742 Bacteria 4062
1574 Ga0501080_0095038 3300049742 Bacteria 2768
1575 Ga0501083_0104398 3300049744 Bacteria 1867
1576 Ga0501241_000014 3300049758 Bacteria 100728
1577 Ga0501241_007126 3300049758 Bacteria 2051
1578 Ga0501241_007683 3300049758 Bacteria 1975
1579 Ga0501241_010614 3300049758 Bacteria 1673
1580 Ga0501241_029215 3300049758 Bacteria 1037
1581 Ga0501264_001446 3300049761 Bacteria 2555
1582 Ga0501264_006301 3300049761 Bacteria 1092
1583 Ga0501266_000002 3300049763 Bacteria 459947
1584 Ga0501266_001794 3300049763 Bacteria 2720
1585 Ga0501269_000413 3300049766 Bacteria 9747
1586 Ga0501269_004616 3300049766 Bacteria 1657
1587 Ga0501280_004064 3300049776 Bacteria 2177
1588 Ga0501282_005718 3300049778 Bacteria 1332
1589 Ga0501035_0008311 3300049822 Bacteria 9666
1590 Ga0501035_0012497 3300049822 Bacteria 7844
1591 Ga0501035_0013123 3300049822 Bacteria 7646
1592 Ga0501035_0058067 3300049822 Bacteria 3449
1593 Ga0501035_0087075 3300049822 Bacteria 2753
1594 Ga0501035_0107483 3300049822 Bacteria 2446
1595 Ga0501044_0001723 3300049823 Bacteria 25593
1596 Ga0501044_0008687 3300049823 Bacteria 11117
1597 Ga0501044_0011700 3300049823 Bacteria 9506
1598 Ga0501044_0015635 3300049823 Bacteria 8174
1599 Ga0501044_0072142 3300049823 Bacteria 3511
1600 Ga0501044_0100915 3300049823 Unclassified 2904
1601 Ga0501044_0121383 3300049823 Bacteria 2614
1602 Ga0501044_0222442 3300049823 Bacteria 1838
1603 Ga0501044_0243374 3300049823 Bacteria 1742
1604 Ga0501044_0332706 3300049823 Bacteria 1441
1605 Ga0501045_0003565 3300049824 Bacteria 10689
1606 Ga0501212_000685 3300049851 Bacteria 3449
1607 Ga0501284_00059 3300050005 Bacteria 39196
1608 nmdc:mga0k408_10235_c1 3300050493 Bacteria 5069
1609 nmdc:mga0k408_102649_c1 3300050493 Bacteria 1687
1610 nmdc:mga0k408_2012_c1 3300050493 Bacteria 9069
1611 nmdc:mga0k408_96192_c1 3300050493 Bacteria 1743
1612 nmdc:mga05p37_375315_c1 3300050507 Bacteria 1668
1613 nmdc:mga09592_37236_c1 3300050508 Bacteria 4081
1614 nmdc:mga09592_45525_c1 3300050508 Bacteria 3696
1615 nmdc:mga0qj67_91800_c1 3300050509 Bacteria 2441
1616 nmdc:mga06r32_36325_c1 3300050510 Bacteria 4654
1617 nmdc:mga06r32_90944_c1 3300050510 Bacteria 2982
1618 nmdc:mga08y16_149587_c1 3300050511 Bacteria 2005
1619 nmdc:mga08y16_154457_c1 3300050511 Bacteria 2385
1620 nmdc:mga08y16_17977_c1 3300050511 Bacteria 7448
1621 nmdc:mga08y16_631759_c1 3300050511 Bacteria 1077
1622 Ga0500635_0000417 3300053080 Bacteria 12581
1623 Ga0495595_0171146 3300053084 Bacteria 1075
1624 Ga0500578_0000144 3300053086 Bacteria 85335
1625 Ga0500578_0014501 3300053086 Bacteria 5068
1626 Ga0500644_0000600 3300053088 Bacteria 13739
1627 Ga0500644_0037786 3300053088 Bacteria 1581
1628 Ga0500644_0078404 3300053088 Bacteria 1209
1629 Ga0500646_0000818 3300053090 Bacteria 8619
1630 Ga0500646_0002249 3300053090 Bacteria 5022
1631 Ga0500646_0003070 3300053090 Bacteria 4281
1632 Ga0500646_0016363 3300053090 Bacteria 1936
1633 Ga0500583_0000060 3300053092 Bacteria 68112
1634 Ga0500583_0002372 3300053092 Bacteria 5644
1635 Ga0500583_0012962 3300053092 Bacteria 3204
1636 Ga0500583_0050778 3300053092 Bacteria 1925
1637 Ga0500583_0067379 3300053092 Bacteria 1705
1638 Ga0500651_0001777 3300053093 Bacteria 11046
1639 Ga0500651_0313237 3300053093 Bacteria 898
1640 Ga0500566_0204195 3300053094 Bacteria 995
1641 Ga0500641_0000010 3300053096 Bacteria 171383
1642 Ga0500641_0000275 3300053096 Bacteria 19089
1643 Ga0500641_0001720 3300053096 Bacteria 7784
1644 Ga0500641_0037152 3300053096 Bacteria 1951
1645 Ga0500660_078635 3300053100 Bacteria 1519
1646 Ga0500555_009160 3300053103 Bacteria 2830
1647 Ga0500556_0023972 3300053104 Bacteria 1999
1648 Ga0500562_014455 3300053108 Bacteria 2021
1649 Ga0500569_000226 3300053109 Bacteria 8932
1650 Ga0500594_0005313 3300053118 Bacteria 2854
1651 Ga0500594_0012961 3300053118 Bacteria 1974
1652 Ga0500607_020375 3300053121 Bacteria 3744
1653 Ga0500618_000016 3300053125 Bacteria 164049
1654 Ga0500652_005154 3300053131 Bacteria 4093
1655 Ga0500658_0000002 3300053134 Bacteria 548440
1656 Ga0500658_0021484 3300053134 Bacteria 2445
1657 Ga0500559_0023756 3300053136 Bacteria 2603
1658 Ga0500568_0005710 3300053139 Bacteria 6381
1659 Ga0500568_0013071 3300053139 Bacteria 3797
1660 Ga0500568_0019967 3300053139 Bacteria 2906
1661 Ga0500573_0131722 3300053140 Bacteria 1384
1662 Ga0500577_0000468 3300053142 Bacteria 10461
1663 Ga0500579_133212 3300053143 Bacteria 1153
1664 Ga0500588_0014453 3300053146 Bacteria 2001
1665 Ga0500588_0059154 3300053146 Bacteria 1222
1666 Ga0500589_030117 3300053147 Bacteria 2527
1667 Ga0500590_010437 3300053148 Bacteria 4693
1668 Ga0500604_0025190 3300053151 Bacteria 1709
1669 Ga0500616_0002790 3300053153 Bacteria 14072
1670 Ga0500616_0014086 3300053153 Bacteria 4609
1671 Ga0500622_0000077 3300053156 Bacteria 108558
1672 Ga0500622_0000304 3300053156 Bacteria 50299
1673 Ga0500622_0005426 3300053156 Bacteria 7663
1674 Ga0500622_0022534 3300053156 Bacteria 3338
1675 Ga0500622_0069802 3300053156 Bacteria 1778
1676 Ga0500622_0089259 3300053156 Bacteria 1532
1677 Ga0500624_000265 3300053157 Bacteria 18286
1678 Ga0500627_0029600 3300053158 Bacteria 2285
1679 Ga0500634_0015358 3300053161 Bacteria 4065
1680 Ga0500636_0039586 3300053177 Bacteria 2789
1681 Ga0500636_0052137 3300053177 Bacteria 2404
1682 Ga0500584_048657 3300053726 Bacteria 1924
1683 Ga0500611_000033 3300053727 Bacteria 79214
1684 Ga0500645_046972 3300053730 Bacteria 1266
1685 Ga0501084_0138796 3300054114 Bacteria 2046
1686 Ga0466962_0003757 3300061719 Bacteria 7252
1687 Ga0466962_0035580 3300061719 Bacteria 2384
1688 2511232051 2511231000 Bacteria 4488346
1689 2513232560 2513020052 Bacteria 5120511
1690 2520879713 2519899754 Bacteria 5336938
1691 2524004576 2523533629 Bacteria 2982326
1692 2585145599 2582581278 Bacteria 5296881
1693 2585156007 2582581281 Bacteria 4487904
1694 2585160069 2582581282 Bacteria 4495830
1695 2585426560 2582581873 Bacteria 3032664
1696 2586210867 2585427687 Bacteria 5544917
1697 2587678078 2585428045 Bacteria 5203023
1698 2587749991 2585428060 Bacteria 5304711
1699 2587753825 2585428061 Bacteria 3939663
1700 2587867678 2585428095 Bacteria 3789702
1701 2587942171 2585428115 Bacteria 4420269
1702 2588209301 2585428182 Bacteria 5007281
1703 2588216000 2585428183 Bacteria 5166119
1704 2588217460 2585428184 Bacteria 4978681
1705 2588222207 2585428185 Bacteria 4969476
1706 2588234867 2585428187 Bacteria 4629388
1707 2588445244 2588253712 Bacteria 5403181
1708 2590600104 2588254255 Bacteria 5014294
1709 2590610941 2588254257 Bacteria 5436094
1710 2599479453 2599185184 Bacteria 6430550
1711 2644009376 2643221600 Bacteria 5530138
1712 2644374120 2643221667 Bacteria 5627472
1713 2644643759 2643221716 Bacteria 4986332
1714 2644681649 2643221725 Bacteria 5087956
1715 2729202928 2728369107 Bacteria 5082720
1716 2738700581 2738541273 Bacteria 4048577
1717 2738731759 2738541278 Bacteria 9755573
1718 2738732874 2738541279 Bacteria 6149495
1719 2738756715 2738541283 Bacteria 7222293
1720 2738765412 2738541285 Bacteria 6150075
1721 2738855406 2738541302 Bacteria 5944758
1722 2739214455 2738543007 Bacteria 6149845
1723 2739254330 2738543014 Bacteria 4048139
1724 2739305244 2738543023 Bacteria 6767879
1725 2739588166 2739367651 Bacteria 6359826
1726 2739614061 2739367656 Bacteria 5152243
1727 2739647036 2739367663 Bacteria 5040914
1728 2740003037 2739367857 Bacteria 5433684
1729 2740007854 2739367858 Bacteria 5432813
1730 2740031102 2739367866 Bacteria 4215900
1731 2740061087 2739367874 Bacteria 4872888
1732 2753671631 2751185877 Bacteria 4921427
1733 2765576406 2765235839 Bacteria 5314748
1734 2772606804 2772190705 Bacteria 4666226
1735 2775673732 2775506739 Bacteria 3855222
1736 2802654724 2802428842 Bacteria 4926114
1737 2816871846 2816332188 Bacteria 5133218
1738 2817413356 2816332280 Bacteria 5109718
1739 2819546116 2818991437 Bacteria 5805520
1740 2819573826 2818991442 Bacteria 8318214
1741 2819588694 2818991444 Bacteria 6968812
1742 2819680443 2818991460 Bacteria 7595395
1743 2821137160 2821136567 Bacteria 8080116
1744 2833642520 2833640130 Bacteria 4858325
1745 2839991201 2839989709 Bacteria 3773432
1746 2840677533 2840677318 Bacteria 2664183
1747 2842085640 2842083920 Bacteria 4857652
1748 2842724027 2842722452 Bacteria 6263924
1749 2842907998 2842903701 Bacteria 6986368
1750 2842912240 2842909656 Bacteria 6185908
1751 2849282669 2849281842 Bacteria 6065644
1752 2852625813 2852623160 Bacteria 4376875
1753 2852630938 2852627209 Bacteria 5896285
1754 2857617230 2857613821 Bacteria 4917088
1755 2857619920 2857618242 Bacteria 5635925
1756 2857629412 2857627736 Bacteria 5625397
1757 2871721218 2871720351 Bacteria 4862476
1758 2881360159 2881359912 Bacteria 4935907
1759 2883072915 2883068021 Bacteria 6192739
1760 2884636827 2884634485 Bacteria 3928637
1761 2884798177 2884791551 Bacteria 8511252
1762 2884935661 2884933994 Bacteria 4535041
1763 2889293087 2889290771 Bacteria 5530962
1764 2890740207 2890737413 Bacteria 4269751
1765 2896085351 2896085136 Bacteria 6129793
1766 2896115250 2896109856 Bacteria 7140722
1767 2902052209 2902048731 Bacteria 4976191
1768 2903898841 2903895155 Bacteria 5258610
1769 2904423125 2904419702 Bacteria 5166287
1770 2904446403 2904445276 Bacteria 5310396
1771 2904468098 2904467357 Bacteria 8057758
1772 2904558687 2904555929 Bacteria 5218588
1773 2906001720 2905999023 Bacteria 4591259
1774 2914759776 2914759650 Bacteria 4701441
1775 2919097838 2919097161 Bacteria 3860339
1776 2919189265 2919186247 Bacteria 6244071
1777 2919194410 2919191525 Bacteria 5765973
1778 2919401171 2919399522 Bacteria 5164947
1779 2919440243 2919437846 Bacteria 6199444
1780 2919512835 2919509842 Bacteria 4104664
1781 2919684418 2919683626 Bacteria 5534354
1782 2919694159 2919692658 Bacteria 5943958
1783 2928082241 2928078545 Bacteria 6534839
1784 2928149182 2928147474 Bacteria 6512076
1785 2929150428 2929150217 Bacteria 5462483
1786 2929157621 2929154850 Bacteria 6753285
1787 2929182742 2929177148 Bacteria 7883697
1788 2929241443 2929239360 Bacteria 7745570
1789 2929923474 2929921140 Bacteria 8649150
1790 2932084958 2932082852 Bacteria 6563563
1791 2939666580 2939664404 Bacteria 6364494
1792 2945926374 2945924605 Bacteria 4296724
1793 2945978695 2945977869 Bacteria 7777518
1794 2945999213 2945997725 Bacteria 6404843
1795 2946015437 2946013367 Bacteria 7766675
1796 2946020296 2946019816 Bacteria 4621265
1797 2954021608 2954016120 Bacteria 6446024
1798 2958463145 2958458903 Bacteria 5301041
1799 2958515963 2958512119 Bacteria 4528530
1800 2977234174 2977232053 Bacteria 5485925
1801 2977247079 2977243572 Bacteria 4374394
1802 2977271890 2977268062 Bacteria 5243061
1803 2984572956 2984572630 Bacteria 4186940
1804 2984610405 2984606641 Bacteria 4186971
1805 2993372618 2993372514 Bacteria 4214139
1806 2993483382 2993480792 Bacteria 4022225
1807 8003152876 8003151029 Bacteria 8187759
1808 8036737695 8036736890 Bacteria 2944828
1809 8054311607 8054307821 Bacteria 5212224
1810 8055423387 8055419101 Bacteria 5289643
1811 8055589977 8055588893 Bacteria 3619545
1812 8055595249 8055592153 Bacteria 5961247
1813 8056443334 8056440228 Bacteria 4946504
1814 Ga0265327_10021872
1815 SwRhRL2b_contig_1663050
1816 SwRhRL2b_contig_2423129
1817 SwRhRL2b_contig_2703482
1818 SwRhRL2b_contig_3243847
1819 SwRhRL2b_contig_3661140
1820 SwRhRL2b_contig_595006
1821 SwRhRL2b_contig_829818
1822 JGI24736J21556_1001877
1823 JGI24740J21852_10050141
1824 JGI24739J22299_10003467
1825 JGI24739J22299_10064304
1826 JGI24737J22298_10000321
1827 JGI24737J22298_10011017
1828 JGI24735J21928_10000003
1829 JGI24735J21928_10003137
1830 JGI24744J21845_10010382
1831 JGI24751J29686_10000452
1832 JGI25162J39368_1000203
1833 JGI25154J39366_1000007
1834 JGI25158J39367_1002516
1835 JGI25157J39369_1005353
1836 JGI25164J39214_1001360
1837 JGI25150J39212_1000001
1838 JGI25151J46595_10000001
1839 JGI25165J46597_1000728
1840 JGI25153J46596_10000001
1841 JGI25153J46596_10001266
1842 rootH1_10063301
1843 rootH1_10134510
1844 rootH1_10149292
1845 rootH2_10011084
1846 rootH2_10013162
1847 rootH2_10015381
1848 rootH2_10045041
1849 rootH2_10129787
1850 rootL2_10007168
1851 rootL2_10021621
1852 rootL2_10038289
1853 rootL2_10074114
1854 rootL2_10143549
1855 rootL2_10319714
1856 rootH1_10007512
1857 rootH1_10015224
1858 rootH1_10078749
1859 rootH1_10115746
1860 rootH1_10120031
1861 rootH1_10319305
1862 JGI25160J50197_1004668
1863 JGI25160J50197_1010918
1864 Ga0006562J51391_1002343
1865 Ga0006562J51391_1004923
1866 Ga0055535_1001785
1867 Ga0055526_1022313
1868 Ga0055536_1000004
1869 Ga0055534_1001279
1870 Ga0055528_1000164
1871 Ga0055530_10000869
1872 Ga0055530_10007673
1873 Ga0055531_10000085
1874 Ga0055531_10000156
1875 Ga0058863_10001245
1876 Ga0058862_12212891
1877 Ga0065165_1000010
1878 Ga0065165_1008512
1879 Ga0065714_10002572
1880 Ga0065714_10003280
1881 Ga0065714_10010985
1882 Ga0065714_10026377
1883 Ga0065714_10078231
1884 Ga0065714_10085630
1885 Ga0065714_10100557
1886 Ga0065704_10005473
1887 Ga0065704_10070140
1888 Ga0065704_10070251
1889 Ga0065704_10072129
1890 Ga0065704_10073887
1891 Ga0065704_10074138
1892 Ga0065704_10074182
1893 Ga0065704_10090076
1894 Ga0065704_10106177
1895 Ga0065704_10110352
1896 Ga0065712_10086352
1897 Ga0065712_10088663
1898 Ga0065715_10040176
1899 Ga0065715_10117030
1900 Ga0065715_10250221
1901 Ga0065715_10291366
1902 Ga0065715_10393194
1903 Ga0065707_10094480
1904 Ga0065707_10098181
1905 Ga0070658_10000655
1906 Ga0070658_10013517
1907 Ga0070658_10018406
1908 Ga0070658_10041372
1909 Ga0070658_10199625
1910 Ga0070658_10335126
1911 Ga0070658_10416509
1912 Ga0070658_10444731
1913 Ga0070676_10000091
1914 Ga0070676_10189409
1915 Ga0070676_10291635
1916 Ga0070683_100002417
1917 Ga0070683_100005694
1918 Ga0070683_100016399
1919 Ga0070683_100241764
1920 Ga0070683_100410959
1921 Ga0070683_100568753
1922 Ga0070690_100062384
1923 Ga0070690_100342684
1924 Ga0070690_100397634
1925 Ga0070670_100019261
1926 Ga0070670_100070231
1927 Ga0070670_100113045
1928 Ga0070670_100125336
1929 Ga0070670_100135234
1930 Ga0070670_100179130
1931 Ga0070670_100201775
1932 Ga0070670_100306184
1933 Ga0070670_100520698
1934 Ga0070677_10007031
1935 Ga0068869_100005770
1936 Ga0068869_100021631
1937 Ga0068869_100059054
1938 Ga0068869_100066745
1939 Ga0068869_100071113
1940 Ga0068869_100136280
1941 Ga0068869_100169837
1942 Ga0068869_100179568
1943 Ga0068869_100580421
1944 Ga0070666_10000125
1945 Ga0070666_10001433
1946 Ga0070666_10006591
1947 Ga0070666_10030595
1948 Ga0070666_10067739
1949 Ga0070680_100007073
1950 Ga0070680_100008794
1951 Ga0070680_100339831
1952 Ga0070682_100000125
1953 Ga0070682_100000394
1954 Ga0070682_100008503
1955 Ga0070682_100038423
1956 Ga0070682_100096963
1957 Ga0070682_100146145
1958 Ga0070682_100209980
1959 Ga0070682_100264800
1960 Ga0070682_100282543
1961 Ga0070682_100401938
1962 Ga0070682_100404658
1963 Ga0068868_100000075
1964 Ga0068868_100022531
1965 Ga0068868_100032252
1966 Ga0068868_100039548
1967 Ga0068868_100331792
1968 Ga0070660_100000211
1969 Ga0070660_100004005
1970 Ga0070660_100019733
1971 Ga0070660_100033263
1972 Ga0070660_100288113
1973 Ga0070660_100327588
1974 Ga0070689_100007698
1975 Ga0070689_100077163
1976 Ga0070689_100367353
1977 Ga0070689_100470020
1978 Ga0070691_10010843
1979 Ga0070691_10018376
1980 Ga0070687_100019144
1981 Ga0070661_100066797
1982 Ga0070661_100525792
1983 Ga0070661_100697801
1984 Ga0070668_100037019
1985 Ga0070668_100306491
1986 Ga0070669_100088082
1987 Ga0070669_100504609
1988 Ga0070675_100011402
1989 Ga0070675_100016984
1990 Ga0070675_100023239
1991 Ga0070675_100033207
1992 Ga0070675_100038097
1993 Ga0070675_100190938
1994 Ga0070671_100281644
1995 Ga0070671_100332471
1996 Ga0070671_100361708
1997 Ga0070671_100391861
1998 Ga0070674_100013529
1999 Ga0070673_100000966
2000 Ga0070673_100044349
2001 Ga0070673_100047692
2002 Ga0070673_100065150
2003 Ga0070673_100068032
2004 Ga0070673_100073365
2005 Ga0070673_100310657
2006 Ga0070688_100026679
2007 Ga0070688_100074892
2008 Ga0070688_100081383
2009 Ga0070688_100262221
2010 Ga0070659_100003274
2011 Ga0070659_100005958
2012 Ga0070659_100007003
2013 Ga0070659_100009206
2014 Ga0070659_100038876
2015 Ga0070667_100000086
2016 Ga0070667_100013104
2017 Ga0070667_100065615
2018 Ga0070667_100115450
2019 Ga0070667_100187976
2020 Ga0070667_100209267
2021 Ga0070667_100332861
2022 Ga0070714_100082836
2023 Ga0070663_100502974
2024 Ga0070678_100107619
2025 Ga0070678_100282545
2026 Ga0070662_100003756
2027 Ga0070662_100007873
2028 Ga0070662_100025036
2029 Ga0070662_100059341
2030 Ga0070681_10101645
2031 Ga0070681_10135065
2032 Ga0070681_10139966
2033 Ga0070681_10200880
2034 Ga0068867_100003784
2035 Ga0068867_100005625
2036 Ga0068867_100010240
2037 Ga0068867_100012521
2038 Ga0068867_100104518
2039 Ga0068867_100285868
2040 Ga0068867_100292040
2041 Ga0070685_10005156
2042 Ga0070685_10017646
2043 Ga0070685_10394858
2044 Ga0070698_100000911
2045 Ga0070698_100140156
2046 Ga0070679_100003584
2047 Ga0070679_100028081
2048 Ga0070679_100028359
2049 Ga0070679_100054957
2050 Ga0070679_100085742
2051 Ga0070679_100238729
2052 Ga0070679_100441954
2053 Ga0070684_100012884
2054 Ga0070684_100031170
2055 Ga0070684_100053969
2056 Ga0070684_100085939
2057 Ga0068853_100003690
2058 Ga0068853_100004573
2059 Ga0068853_100018812
2060 Ga0068853_100035707
2061 Ga0068853_100050476
2062 Ga0068853_100081542
2063 Ga0068853_100101004
2064 Ga0068853_100146456
2065 Ga0068853_100161284
2066 Ga0068853_100241333
2067 Ga0068853_100257644
2068 Ga0068853_100271523
2069 Ga0068853_100546898
2070 Ga0070672_100030440
2071 Ga0070672_100046118
2072 Ga0070672_100115402
2073 Ga0070672_100151535
2074 Ga0070672_100165848
2075 Ga0070672_100217348
2076 Ga0070672_100306262
2077 Ga0070686_100016259
2078 Ga0070686_100040335
2079 Ga0070686_100221822
2080 Ga0070696_100131205
2081 Ga0070696_100158534
2082 Ga0070693_100022402
2083 Ga0070693_100057609
2084 Ga0070665_100000009
2085 Ga0070665_100007286
2086 Ga0070665_100007390
2087 Ga0070665_100181811
2088 Ga0070665_100725664
2089 Ga0068855_100000279
2090 Ga0068855_100001370
2091 Ga0068855_100002137
2092 Ga0068855_100002597
2093 Ga0068855_100005875
2094 Ga0068855_100032803
2095 Ga0068855_100034861
2096 Ga0068855_100046506
2097 Ga0068855_100083464
2098 Ga0068855_100206373
2099 Ga0068855_100320880
2100 Ga0068855_100329075
2101 Ga0068855_100472966
2102 Ga0068855_100476339
2103 Ga0068855_100588981
2104 Ga0070664_100026719
2105 Ga0070664_100048105
2106 Ga0070664_100110232
2107 Ga0070664_100130951
2108 Ga0070664_100136918
2109 Ga0070664_100362998
2110 Ga0068857_100002499
2111 Ga0068857_100025412
2112 Ga0068857_100139694
2113 Ga0068857_100148748
2114 Ga0068857_100192907
2115 Ga0068857_100208774
2116 Ga0068857_100408625
2117 Ga0068854_100005998
2118 Ga0068854_100061236
2119 Ga0068854_100090507
2120 Ga0068856_100000006
2121 Ga0068856_100006116
2122 Ga0068856_100007791
2123 Ga0068856_100009483
2124 Ga0068856_100012161
2125 Ga0068856_100040389
2126 Ga0068856_100065842
2127 Ga0068856_100627842
2128 Ga0068852_100003711
2129 Ga0068852_100005387
2130 Ga0068852_100005815
2131 Ga0068852_100014561
2132 Ga0068852_100016001
2133 Ga0068852_100022206
2134 Ga0068852_100084320
2135 Ga0068852_100116263
2136 Ga0068852_100133672
2137 Ga0068852_100198363
2138 Ga0068852_100221698
2139 Ga0068852_100336275
2140 Ga0068852_100389802
2141 Ga0068852_100469089
2142 Ga0068859_100000242
2143 Ga0068859_100006439
2144 Ga0068859_100030908
2145 Ga0068859_100040043
2146 Ga0068859_100062210
2147 Ga0068859_100215791
2148 Ga0068859_100265713
2149 Ga0068859_100318747
2150 Ga0068859_100356490
2151 Ga0068859_100472068
2152 Ga0068859_100856564
2153 Ga0068864_100001541
2154 Ga0068864_100007898
2155 Ga0068864_100077541
2156 Ga0068864_100982698
2157 Ga0068866_10085725
2158 Ga0068861_100001641
2159 Ga0068861_100059982
2160 Ga0068861_100265613
2161 Ga0068861_100486783
2162 Ga0068851_10000388
2163 Ga0068851_10053753
2164 Ga0068851_10149361
2165 Ga0068870_10010288
2166 Ga0068870_10044685
2167 Ga0068870_10143043
2168 Ga0068863_100016728
2169 Ga0068863_100023474
2170 Ga0068863_100026064
2171 Ga0068863_100045062
2172 Ga0068863_100083299
2173 Ga0068863_100094027
2174 Ga0068863_100184467
2175 Ga0068863_100330747
2176 Ga0068863_100418171
2177 Ga0068863_100450024
2178 Ga0068863_100734902
2179 Ga0068858_100000258
2180 Ga0068858_100004144
2181 Ga0068858_100101557
2182 Ga0068858_100116755
2183 Ga0068860_100000033
2184 Ga0068860_100001856
2185 Ga0068860_100005747
2186 Ga0068860_100011911
2187 Ga0068860_100016937
2188 Ga0068860_100033498
2189 Ga0068860_100062300
2190 Ga0068860_100079404
2191 Ga0068860_100155267
2192 Ga0068860_100307810
2193 Ga0068860_100341185
2194 Ga0068860_100352641
2195 Ga0068860_100405002
2196 Ga0068860_100422195
2197 Ga0068862_100005917
2198 Ga0068862_100012762
2199 Ga0068862_100510626
2200 Ga0068862_100681511
2201 Ga0081540_1012512
2202 Ga0075366_10003090
2203 Ga0075366_10018956
2204 Ga0075366_10062086
2205 Ga0075366_10252890
2206 Ga0097621_100001575
2207 Ga0097621_100008800
2208 Ga0097621_100014583
2209 Ga0097621_100097334
2210 Ga0097621_100101343
2211 Ga0097621_100130648
2212 Ga0097621_100211647
2213 Ga0068871_100006801
2214 Ga0068871_100018853
2215 Ga0068871_100044596
2216 Ga0068871_100055128
2217 Ga0068871_100057070
2218 Ga0068871_100212975
2219 Ga0075428_100044297
2220 Ga0075428_100117986
2221 Ga0075428_100123455
2222 Ga0075428_100154611
2223 Ga0075428_100334092
2224 Ga0075430_100020978
2225 Ga0075431_100001482
2226 Ga0075431_100012317
2227 Ga0075429_100016041
2228 Ga0075429_100083539
2229 Ga0068865_100000413
2230 Ga0068865_100045574
2231 Ga0068865_100080466
2232 Ga0068865_100466683
2233 Ga0097620_100000242
2234 Ga0097620_100006439
2235 Ga0097620_100030908
2236 Ga0097620_100040043
2237 Ga0097620_100062209
2238 Ga0097620_100215779
2239 Ga0097620_100265705
2240 Ga0097620_100318750
2241 Ga0097620_100356488
2242 Ga0097620_100472048
2243 Ga0097620_100856659
2244 Ga0099824_1006531
2245 Ga0079104_1000091
2246 Ga0105251_10053494
2247 Ga0105251_10175280
2248 Ga0105251_10220065
2249 Ga0105244_10000027
2250 Ga0105244_10000043
2251 Ga0105250_10023942
2252 Ga0105240_10000023
2253 Ga0105240_10000083
2254 Ga0105240_10000893
2255 Ga0105240_10001874
2256 Ga0105240_10002999
2257 Ga0105240_10009678
2258 Ga0105240_10010818
2259 Ga0105240_10028209
2260 Ga0105240_10041223
2261 Ga0105240_10069875
2262 Ga0105240_10137276
2263 Ga0105240_10137729
2264 Ga0105240_10172201
2265 Ga0105240_10376489
2266 Ga0105240_10504887
2267 Ga0105240_11077097
2268 Ga0111539_10018239
2269 Ga0111539_10107685
2270 Ga0111539_10108018
2271 Ga0111539_10199617
2272 Ga0111539_10266933
2273 Ga0111539_10577945
2274 Ga0105247_10017274
2275 Ga0105247_10035946
2276 Ga0105247_10124030
2277 Ga0114129_10004721
2278 Ga0114129_10460819
2279 Ga0114129_11019806
2280 Ga0105243_10000003
2281 Ga0105243_10002448
2282 Ga0105243_10225353
2283 Ga0105243_10419084
2284 Ga0105241_10000421
2285 Ga0105241_10000518
2286 Ga0105241_10014293
2287 Ga0105241_10018754
2288 Ga0105241_10068555
2289 Ga0105241_10128713
2290 Ga0105241_10157605
2291 Ga0105242_10002451
2292 Ga0105242_10021083
2293 Ga0105242_10024089
2294 Ga0105242_10104292
2295 Ga0105242_10376113
2296 Ga0105242_10578268
2297 Ga0105248_10044305
2298 Ga0105248_10049709
2299 Ga0105248_10054666
2300 Ga0105237_10000198
2301 Ga0105237_10000261
2302 Ga0105237_10003753
2303 Ga0105237_10005184
2304 Ga0105237_10006711
2305 Ga0105237_10011613
2306 Ga0105237_10015362
2307 Ga0105237_10016324
2308 Ga0105237_10028321
2309 Ga0105237_10043015
2310 Ga0105237_10062937
2311 Ga0105237_10091762
2312 Ga0105237_10117576
2313 Ga0105237_10130669
2314 Ga0105237_10160901
2315 Ga0105237_10338924
2316 Ga0105238_10001036
2317 Ga0105238_10016205
2318 Ga0105238_10060135
2319 Ga0105238_10098443
2320 Ga0105238_10121775
2321 Ga0105249_10000954
2322 Ga0105249_10006490
2323 Ga0105249_10007639
2324 Ga0105249_10066961
2325 Ga0105249_10067555
2326 Ga0105249_10079600
2327 Ga0105249_10095798
2328 Ga0105249_10357440
2329 Ga0105239_10000011
2330 Ga0105239_10001010
2331 Ga0105239_10001043
2332 Ga0105239_10001867
2333 Ga0105239_10002632
2334 Ga0105239_10003043
2335 Ga0105239_10003144
2336 Ga0105239_10007177
2337 Ga0105239_10013222
2338 Ga0105239_10019068
2339 Ga0105239_10022265
2340 Ga0105239_10042080
2341 Ga0105239_10077966
2342 Ga0105239_10146897
2343 Ga0105239_10541619
2344 Ga0105239_10860004
2345 Ga0105246_10066337
2346 Ga0105246_10637197
2347 Ga0105246_10692731
2348 Ga0157373_10000007
2349 Ga0157373_10000044
2350 Ga0157373_10000601
2351 Ga0157373_10001219
2352 Ga0157373_10003753
2353 Ga0157373_10008405
2354 Ga0157373_10017976
2355 Ga0157373_10022958
2356 Ga0157373_10063945
2357 Ga0157373_10105138
2358 Ga0157373_10328379
2359 Ga0157371_10000074
2360 Ga0157371_10000130
2361 Ga0157371_10000164
2362 Ga0157371_10000232
2363 Ga0157371_10000486
2364 Ga0157371_10001020
2365 Ga0157371_10001267
2366 Ga0157371_10002408
2367 Ga0157371_10003507
2368 Ga0157371_10003749
2369 Ga0157371_10010866
2370 Ga0157371_10012774
2371 Ga0157371_10013067
2372 Ga0157371_10013304
2373 Ga0157371_10015935
2374 Ga0157371_10037443
2375 Ga0157371_10093096
2376 Ga0157371_10094277
2377 Ga0157371_10133763
2378 Ga0157371_10148667
2379 Ga0157371_10194952
2380 Ga0157370_10000192
2381 Ga0157370_10000290
2382 Ga0157370_10000303
2383 Ga0157370_10000684
2384 Ga0157370_10001091
2385 Ga0157370_10001177
2386 Ga0157370_10001475
2387 Ga0157370_10004433
2388 Ga0157370_10004809
2389 Ga0157370_10008143
2390 Ga0157370_10009399
2391 Ga0157370_10013199
2392 Ga0157370_10018596
2393 Ga0157370_10019497
2394 Ga0157370_10021765
2395 Ga0157370_10028998
2396 Ga0157370_10033538
2397 Ga0157370_10062936
2398 Ga0157370_10071559
2399 Ga0157370_10077271
2400 Ga0157370_10084098
2401 Ga0157370_10098497
2402 Ga0157370_10163161
2403 Ga0157370_10169814
2404 Ga0157370_10230989
2405 Ga0157370_10273470
2406 Ga0157370_10346127
2407 Ga0157370_10351911
2408 Ga0157370_10361179
2409 Ga0157370_10387886
2410 Ga0157370_10660773
2411 Ga0157369_10000031
2412 Ga0157369_10000731
2413 Ga0157369_10004306
2414 Ga0157369_10006715
2415 Ga0157369_10018831
2416 Ga0157369_10024012
2417 Ga0157369_10028173
2418 Ga0157369_10030017
2419 Ga0157369_10083931
2420 Ga0157369_10134553
2421 Ga0157369_10147459
2422 Ga0157369_10159428
2423 Ga0157369_10196241
2424 Ga0157369_10221855
2425 Ga0157369_10478617
2426 Ga0157369_10774481
2427 Ga0157369_10858837
2428 Ga0157374_10000002
2429 Ga0157374_10017014
2430 Ga0157374_10037407
2431 Ga0157374_10040398
2432 Ga0157374_10050624
2433 Ga0157374_10063132
2434 Ga0157374_10131963
2435 Ga0157374_10163274
2436 Ga0157374_10188572
2437 Ga0157374_10236984
2438 Ga0157374_10477348
2439 Ga0157378_10009151
2440 Ga0157378_10011530
2441 Ga0157378_10045824
2442 Ga0157378_10118346
2443 Ga0157378_10167778
2444 Ga0157378_10255303
2445 Ga0157378_10270856
2446 Ga0157378_10376075
2447 Ga0157378_10640381
2448 Ga0163162_10000377
2449 Ga0163162_10000554
2450 Ga0163162_10001734
2451 Ga0163162_10002043
2452 Ga0163162_10004752
2453 Ga0163162_10007639
2454 Ga0163162_10011055
2455 Ga0163162_10011263
2456 Ga0163162_10013276
2457 Ga0163162_10066034
2458 Ga0163162_10078628
2459 Ga0163162_10089334
2460 Ga0163162_10094486
2461 Ga0163162_10156314
2462 Ga0163162_10192894
2463 Ga0163162_10216962
2464 Ga0163162_10493759
2465 Ga0163162_10708950
2466 Ga0163162_11140970
2467 Ga0157372_10000249
2468 Ga0157372_10000573
2469 Ga0157372_10001325
2470 Ga0157372_10001734
2471 Ga0157372_10004245
2472 Ga0157372_10005099
2473 Ga0157372_10029593
2474 Ga0157372_10032861
2475 Ga0157372_10047171
2476 Ga0157372_10059943
2477 Ga0157372_10062662
2478 Ga0157372_10067907
2479 Ga0157372_10117605
2480 Ga0157372_10127116
2481 Ga0157372_10128555
2482 Ga0157372_10149478
2483 Ga0157372_10158402
2484 Ga0157372_10174527
2485 Ga0157372_10195519
2486 Ga0157372_10212172
2487 Ga0157372_10404412
2488 Ga0157372_10563276
2489 Ga0157372_10639640
2490 Ga0157372_10802402
2491 Ga0157372_10863657
2492 Ga0157375_10000144
2493 Ga0157375_10000166
2494 Ga0157375_10000989
2495 Ga0157375_10011976
2496 Ga0157375_10026953
2497 Ga0157375_10028881
2498 Ga0157375_10033870
2499 Ga0157375_10046746
2500 Ga0157375_10064088
2501 Ga0157375_10096265
2502 Ga0157375_10382077
2503 Ga0157375_10777875
2504 Ga0157375_10895822
2505 Ga0163163_10000457
2506 Ga0163163_10005245
2507 Ga0163163_10007428
2508 Ga0163163_10018496
2509 Ga0163163_10042579
2510 Ga0163163_10096264
2511 Ga0163163_10206951
2512 Ga0163163_10293044
2513 Ga0163163_10429453
2514 Ga0163163_10504567
2515 Ga0163163_10653377
2516 Ga0157380_10000959
2517 Ga0157380_10042515
2518 Ga0157380_10073518
2519 Ga0157380_10109625
2520 Ga0157380_10143991
2521 Ga0157380_10215948
2522 Ga0157380_10506599
2523 Ga0157380_10954385
2524 Ga0182008_10000014
2525 Ga0182008_10000447
2526 Ga0182008_10000632
2527 Ga0182008_10000876
2528 Ga0182008_10004682
2529 Ga0182008_10016574
2530 Ga0157377_10001572
2531 Ga0157377_10006401
2532 Ga0157377_10026593
2533 Ga0157377_10043294
2534 Ga0157379_10000440
2535 Ga0157379_10010385
2536 Ga0157379_10016947
2537 Ga0157379_10020609
2538 Ga0157379_10037019
2539 Ga0157379_10071559
2540 Ga0157379_10129072
2541 Ga0157379_10183456
2542 Ga0157379_10315563
2543 Ga0157376_10000783
2544 Ga0157376_10001017
2545 Ga0157376_10003603
2546 Ga0157376_10004446
2547 Ga0157376_10005594
2548 Ga0157376_10019555
2549 Ga0157376_10529869
2550 Ga0157376_10541307
2551 Ga0182006_1000015
2552 Ga0182006_1000159
2553 Ga0182006_1000697
2554 Ga0182006_1001331
2555 Ga0182006_1005526
2556 Ga0182006_1005766
2557 Ga0182006_1022598
2558 Ga0182006_1042453
2559 Ga0182006_1115540
2560 Ga0182006_1122512
2561 Ga0182007_10000002
2562 Ga0182007_10046892
2563 Ga0182005_1000131
2564 Ga0183373_1004
2565 Ga0163161_10000055
2566 Ga0163161_10000310
2567 Ga0163161_10000406
2568 Ga0163161_10001060
2569 Ga0163161_10001090
2570 Ga0163161_10002554
2571 Ga0163161_10007129
2572 Ga0163161_10010202
2573 Ga0163161_10012738
2574 Ga0163161_10021681
2575 Ga0163161_10022721
2576 Ga0163161_10032577
2577 Ga0163161_10033164
2578 Ga0163161_10081658
2579 Ga0163161_10084142
2580 Ga0163161_10214407
2581 Ga0163161_10248203
2582 Ga0163161_10271733
2583 Ga0163161_10449633
2584 Ga0206351_10132316
2585 Ga0206350_10385760
2586 Ga0213876_10007839
2587 Ga0213876_10036822
2588 Ga0209436_100821
2589 Ga0209436_102604
2590 Ga0209563_105477
2591 Ga0207427_100210
2592 Ga0209437_100021
2593 Ga0209437_100102
2594 Ga0209258_100219
2595 Ga0207425_1000002
2596 Ga0209646_1000002
2597 Ga0209646_1002231
2598 Ga0209026_1000086
2599 Ga0209148_1000283
2600 Ga0209148_1010575
2601 Ga0209129_1000002
2602 Ga0209129_1014317
2603 Ga0209233_1000035
2604 Ga0209233_1002196
2605 Ga0209233_1019182
2606 Ga0207666_1007757
2607 Ga0209455_1001657
2608 Ga0209673_1000082
2609 Ga0209130_1002528
2610 Ga0209675_1000095
2611 Ga0209676_1000009
2612 Ga0209025_1000004
2613 Ga0209758_1000006
2614 Ga0209758_1014978
2615 Ga0209050_1000094
2616 Ga0209050_1000555
2617 Ga0207426_1000009
2618 Ga0207426_1000493
2619 Ga0207426_1000514
2620 Ga0207426_1000883
2621 Ga0209257_1000001
2622 Ga0209257_1000005
2623 Ga0209257_1004806
2624 Ga0207697_10017058
2625 Ga0207697_10025099
2626 Ga0207656_10001383
2627 Ga0207656_10091912
2628 Ga0207656_10240688
2629 Ga0207696_1021549
2630 Ga0207655_1000038
2631 Ga0207655_1000237
2632 Ga0207713_1029354
2633 Ga0207682_10004258
2634 Ga0207682_10053198
2635 Ga0207682_10081045
2636 Ga0207682_10127847
2637 Ga0207710_10000635
2638 Ga0207710_10020924
2639 Ga0207688_10005632
2640 Ga0207680_10000018
2641 Ga0207680_10147108
2642 Ga0207680_10478007
2643 Ga0207647_10000288
2644 Ga0207647_10001469
2645 Ga0207647_10014633
2646 Ga0207647_10017201
2647 Ga0207647_10175842
2648 Ga0207645_10000355
2649 Ga0207645_10139848
2650 Ga0207643_10001223
2651 Ga0207643_10025323
2652 Ga0207705_10003765
2653 Ga0207705_10005465
2654 Ga0207705_10017645
2655 Ga0207705_10056149
2656 Ga0207705_10090771
2657 Ga0207654_10001745
2658 Ga0207654_10002658
2659 Ga0207654_10010115
2660 Ga0207654_10016563
2661 Ga0207654_10068075
2662 Ga0207654_10135668
2663 Ga0207707_10006917
2664 Ga0207707_10076027
2665 Ga0207707_10110366
2666 Ga0207707_10195532
2667 Ga0207695_10000016
2668 Ga0207695_10000092
2669 Ga0207695_10000127
2670 Ga0207695_10000128
2671 Ga0207695_10001712
2672 Ga0207695_10003683
2673 Ga0207695_10004313
2674 Ga0207695_10007767
2675 Ga0207695_10077327
2676 Ga0207695_10091282
2677 Ga0207695_10102612
2678 Ga0207695_10146167
2679 Ga0207695_10316606
2680 Ga0207671_10000036
2681 Ga0207671_10000254
2682 Ga0207671_10001027
2683 Ga0207671_10002571
2684 Ga0207671_10002688
2685 Ga0207671_10002901
2686 Ga0207671_10004487
2687 Ga0207671_10009249
2688 Ga0207671_10029553
2689 Ga0207671_10030270
2690 Ga0207671_10050334
2691 Ga0207671_10059756
2692 Ga0207671_10134946
2693 Ga0207671_10151150
2694 Ga0207671_10438171
2695 Ga0207660_10010300
2696 Ga0207660_10011293
2697 Ga0207660_10021677
2698 Ga0207660_10240081
2699 Ga0207660_10282647
2700 Ga0207660_10521411
2701 Ga0207662_10004421
2702 Ga0207662_10073050
2703 Ga0207657_10002233
2704 Ga0207657_10005099
2705 Ga0207657_10019043
2706 Ga0207657_10054929
2707 Ga0207649_10123079
2708 Ga0207649_10160254
2709 Ga0207649_10359198
2710 Ga0207652_10000011
2711 Ga0207652_10000944
2712 Ga0207652_10008689
2713 Ga0207652_10009908
2714 Ga0207652_10014810
2715 Ga0207652_10018660
2716 Ga0207652_10097740
2717 Ga0207652_10112230
2718 Ga0207681_10150658
2719 Ga0207681_10200845
2720 Ga0207681_10299959
2721 Ga0207694_10045879
2722 Ga0207694_10055972
2723 Ga0207694_10187288
2724 Ga0207694_10219163
2725 Ga0207694_10359113
2726 Ga0207650_10023493
2727 Ga0207650_10040596
2728 Ga0207650_10054149
2729 Ga0207650_10065515
2730 Ga0207650_10069417
2731 Ga0207650_10124097
2732 Ga0207650_10232201
2733 Ga0207650_10241645
2734 Ga0207650_10302128
2735 Ga0207659_10012489
2736 Ga0207659_10026358
2737 Ga0207659_10109974
2738 Ga0207659_10349521
2739 Ga0207644_10047981
2740 Ga0207644_10233879
2741 Ga0207644_10282928
2742 Ga0207644_10456352
2743 Ga0207644_10459907
2744 Ga0207690_10003894
2745 Ga0207690_10005944
2746 Ga0207690_10023981
2747 Ga0207690_10176607
2748 Ga0207690_10313009
2749 Ga0207690_10364860
2750 Ga0207706_10019177
2751 Ga0207706_10035734
2752 Ga0207706_10443544
2753 Ga0207686_10003017
2754 Ga0207686_10270278
2755 Ga0207686_10310355
2756 Ga0207709_10000008
2757 Ga0207709_10000630
2758 Ga0207670_10118298
2759 Ga0207670_10188460
2760 Ga0207669_10090499
2761 Ga0207669_10218719
2762 Ga0207704_10013711
2763 Ga0207704_10014771
2764 Ga0207704_10050317
2765 Ga0207704_10106009
2766 Ga0207704_10124421
2767 Ga0207691_10000037
2768 Ga0207691_10022194
2769 Ga0207691_10022708
2770 Ga0207691_10049785
2771 Ga0207691_10085689
2772 Ga0207691_10158272
2773 Ga0207691_10357143
2774 Ga0207691_10407618
2775 Ga0207711_10127665
2776 Ga0207689_10019502
2777 Ga0207689_10073408
2778 Ga0207689_10074490
2779 Ga0207689_10076209
2780 Ga0207689_10079142
2781 Ga0207689_10099429
2782 Ga0207689_10128267
2783 Ga0207689_10196597
2784 Ga0207689_10345032
2785 Ga0207661_10002075
2786 Ga0207661_10002267
2787 Ga0207661_10060182
2788 Ga0207661_10369938
2789 Ga0207679_10027794
2790 Ga0207679_10059555
2791 Ga0207679_10072076
2792 Ga0207679_10300394
2793 Ga0207667_10000346
2794 Ga0207667_10000610
2795 Ga0207667_10001317
2796 Ga0207667_10011720
2797 Ga0207667_10013817
2798 Ga0207667_10052499
2799 Ga0207667_10060056
2800 Ga0207667_10067892
2801 Ga0207667_10145050
2802 Ga0207667_10214249
2803 Ga0207667_10258199
2804 Ga0207667_10306862
2805 Ga0207667_10551033
2806 Ga0207651_10001954
2807 Ga0207651_10027337
2808 Ga0207651_10169516
2809 Ga0207651_10273679
2810 Ga0207712_10031385
2811 Ga0207712_10032827
2812 Ga0207712_10033370
2813 Ga0207712_10039674
2814 Ga0207712_10051430
2815 Ga0207712_10054675
2816 Ga0207712_10095338
2817 Ga0207712_10118743
2818 Ga0207668_10001977
2819 Ga0207668_10133778
2820 Ga0207640_10009102
2821 Ga0207640_10278514
2822 Ga0207658_10011529
2823 Ga0207658_10030280
2824 Ga0207658_10079089
2825 Ga0207658_10100570
2826 Ga0207658_10153346
2827 Ga0207658_10156222
2828 Ga0207677_10000485
2829 Ga0207677_10091658
2830 Ga0207703_10016859
2831 Ga0207703_10050789
2832 Ga0207703_10056347
2833 Ga0207703_10152489
2834 Ga0207639_10003745
2835 Ga0207639_10024644
2836 Ga0207639_10054315
2837 Ga0207639_10081189
2838 Ga0207639_10088442
2839 Ga0207639_10175228
2840 Ga0207639_10288358
2841 Ga0207639_10425543
2842 Ga0207678_10007004
2843 Ga0207678_10075827
2844 Ga0207678_10147956
2845 Ga0207708_10031319
2846 Ga0207708_10520691
2847 Ga0207702_10000023
2848 Ga0207702_10005843
2849 Ga0207702_10028006
2850 Ga0207702_10131836
2851 Ga0207702_10209080
2852 Ga0207702_10535252
2853 Ga0207702_10693516
2854 Ga0207641_10000053
2855 Ga0207641_10004287
2856 Ga0207641_10015125
2857 Ga0207641_10031185
2858 Ga0207641_10158912
2859 Ga0207641_10282833
2860 Ga0207641_10324899
2861 Ga0207641_10584342
2862 Ga0207648_10002745
2863 Ga0207648_10002984
2864 Ga0207648_10021518
2865 Ga0207648_10080806
2866 Ga0207648_10152433
2867 Ga0207648_10284895
2868 Ga0207648_10292234
2869 Ga0207648_10302914
2870 Ga0207676_10007338
2871 Ga0207676_10012031
2872 Ga0207676_10051922
2873 Ga0207676_10069872
2874 Ga0207676_10142200
2875 Ga0207676_10166047
2876 Ga0207676_10543079
2877 Ga0207674_10021221
2878 Ga0207674_10027137
2879 Ga0207674_10035346
2880 Ga0207674_10059552
2881 Ga0207674_10092507
2882 Ga0207674_10105539
2883 Ga0207674_10155308
2884 Ga0207674_10212088
2885 Ga0207674_10249006
2886 Ga0207674_10311501
2887 Ga0207675_100000124
2888 Ga0207675_100040463
2889 Ga0207675_100169354
2890 Ga0207675_100190769
2891 Ga0207675_100372489
2892 Ga0207675_100473959
2893 Ga0207683_10086170
2894 Ga0207683_10170844
2895 Ga0207683_10279996
2896 Ga0207683_10386350
2897 Ga0207698_10001211
2898 Ga0207698_10003545
2899 Ga0207698_10011425
2900 Ga0207698_10033954
2901 Ga0207698_10046171
2902 Ga0207698_10054931
2903 Ga0207698_10065450
2904 Ga0207698_10205936
2905 Ga0207698_10287448
2906 Ga0207698_10287458
2907 Ga0209281_1000311
2908 Ga0209489_112096
2909 Ga0209995_1013121
2910 Ga0268266_10000014
2911 Ga0268266_10016598
2912 Ga0268266_10162530
2913 Ga0268266_10545080
2914 Ga0268265_10021116
2915 Ga0268265_10052714
2916 Ga0268264_10000013
2917 Ga0268264_10004442
2918 Ga0268264_10007626
2919 Ga0268264_10014664
2920 Ga0268264_10024660
2921 Ga0268264_10047358
2922 Ga0268264_10062030
2923 Ga0268264_10116919
2924 Ga0268264_10324998
2925 Ga0268264_10394012
2926 Ga0307517_10009441
2927 Ga0307515_10000002
2928 Ga0307515_10000061
2929 Ga0307515_10000676
2930 Ga0307515_10001796
2931 Ga0307515_10228549
2932 Ga0307515_10364670
2933 Ga0265338_10000658
2934 Ga0265324_10046281
2935 Ga0307511_10001218
2936 Ga0316177_1046651
2937 Ga0316176_1106664
2938 Ga0316183_1171692
2939 Ga0316181_1177553
2940 Ga0316182_1148280
2941 Ga0265327_10000093
2942 Ga0265327_10000148
2943 Ga0265327_10003750
2944 Ga0265327_10022676
2945 Ga0265327_10024944
2946 Ga0265327_10089072
2947 Ga0265327_10101452
2948 Ga0265316_10201971
2949 Ga0307513_10072311
2950 Ga0307513_10139618
2951 Ga0307509_10034640
2952 Ga0307509_10039603
2953 Ga0307509_10060843
2954 Ga0307509_10193809
2955 Ga0307408_100000566
2956 Ga0307408_100000736
2957 Ga0307408_100000824
2958 Ga0307508_10001800
2959 Ga0307508_10209485
2960 Ga0316579_10062502
2961 Ga0265314_10028286
2962 Ga0316576_10004240
2963 Ga0316576_10030922
2964 Ga0316576_10054422
2965 Ga0316576_10092344
2966 Ga0316576_10103933
2967 Ga0316576_10325775
2968 Ga0316578_10016865
2969 Ga0316578_10069316
2970 Ga0316578_10107827
2971 Ga0307516_10004774
2972 Ga0307516_10220891
2973 Ga0307516_10295557
2974 Ga0307405_10000001
2975 Ga0307405_10000006
2976 Ga0316577_10013852
2977 Ga0307413_10000039
2978 Ga0307410_10000363
2979 Ga0307406_10000950
2980 Ga0307406_10065077
2981 Ga0307407_10000031
2982 Ga0307407_10033702
2983 Ga0307412_10000019
2984 Ga0307412_10000043
2985 Ga0307412_10002048
2986 Ga0307412_10035298
2987 Ga0307412_10323767
2988 Ga0307409_100057513
2989 Ga0307416_100000002
2990 Ga0307416_100000004
2991 Ga0307416_100000179
2992 Ga0307416_100263485
2993 Ga0307414_10000010
2994 Ga0307414_10000011
2995 Ga0307414_10000713
2996 Ga0307414_10003845
2997 Ga0307414_10010702
2998 Ga0307414_10018546
2999 Ga0307414_10038767
3000 Ga0307414_10076998
3001 Ga0307414_10079616
3002 Ga0307414_10128456
3003 Ga0307414_10166483
3004 Ga0307414_10205639
3005 Ga0307414_10253395
3006 Ga0307414_10387745
3007 Ga0307411_10000004
3008 Ga0307411_10038743
3009 Ga0307411_10070585
3010 Ga0307411_10219368
3011 Ga0307415_100228926
3012 Ga0316583_10063105
3013 Ga0316580_10055265
3014 Ga0307507_10000099
3015 Ga0307510_10000299
3016 Ga0373944_0124646
3017 Ga0373955_0088969
3018 Ga0373955_0258306
3019 Ga0316574_0050496
3020 Ga0316574_0098149
3021 Ga0373935_0500638
3022 Ga0373937_0048314
3023 Ga0373937_0123286
3024 Ga0373937_0487459
3025 Ga0316582_0009025
3026 Ga0316582_0017395
3027 Ga0316582_0086359
3028 Ga0316582_0254760
3029 Ga0316584_0006014
3030 Ga0316584_0008100
3031 Ga0316584_0042576
3032 Ga0316584_0252682
3033 Ga0373925_0115794
3034 Ga0395899_0000177
3035 Ga0395899_0002106
3036 Ga0395899_0025305
3037 Ga0395899_0156961
3038 Ga0395900_0001729
3039 Ga0395900_0013551
3040 Ga0395900_0081265
3041 Ga0395900_0232663
3042 Ga0395900_0234292
3043 Ga0395898_0003753
3044 Ga0395898_0012532
3045 Ga0395898_0019133
3046 Ga0395898_0076279
3047 Ga0395898_0205045
3048 Ga0395898_0503099
3049 Ga0395905_0000003
3050 Ga0395905_0001826
3051 Ga0395905_0073567
3052 Ga0395905_0208421
3053 Ga0395905_0293382
3054 Ga0395901_0006688
3055 Ga0395901_0007184
3056 Ga0395901_0012926
3057 Ga0395901_0021023
3058 Ga0395901_0244529
3059 Ga0400483_183977
3060 Ga0400483_219275
3061 Ga0400489_11482
3062 Ga0400489_54591
3063 Ga0436365_0480954
3064 Ga0436365_1569731
3065 Ga0436365_1768392
3066 Ga0436361_0728698
3067 Ga0439436_0012671
3068 Ga0439447_000262
3069 Ga0439466_0014367
3070 Ga0439465_0002739
3071 Ga0451791_1824324
3072 Ga0451807_1357051
3073 Ga0451841_0372109
3074 Ga0451855_0667465
3075 Ga0451855_1514386
3076 Ga0451853_1013762
3077 Ga0439431_0000810
3078 Ga0439431_0042653
3079 Ga0439442_006092
3080 Ga0439445_0000001
3081 Ga0439445_0000088
3082 Ga0439445_0004839
3083 Ga0439449_0005652
3084 Ga0439449_0057959
3085 Ga0439457_000014
3086 Ga0439457_026821
3087 Ga0450923_004999
3088 Ga0450898_000638
3089 Ga0450899_001082
3090 Ga0439434_0008135
3091 Ga0451577_0000250
3092 Ga0451577_0000756
3093 Ga0451577_0023282
3094 Ga0451577_0033500
3095 Ga0451577_0058443
3096 Ga0451577_0059945
3097 Ga0451577_0070738
3098 Ga0451577_0073923
3099 Ga0451577_0276851
3100 Ga0466969_0000137
3101 Ga0466969_0056886
3102 Ga0466972_0000023
3103 Ga0466972_0000064
3104 Ga0466972_0000661
3105 Ga0466972_0015911
3106 Ga0466972_0192733
3107 Ga0453683_0000031
3108 Ga0453683_0000209
3109 Ga0453683_0002457
3110 Ga0453683_0014335
3111 Ga0453683_0025049
3112 Ga0453683_0042349
3113 Ga0453683_0129232
3114 Ga0453683_0172023
3115 Ga0453683_0194507
3116 Ga0466966_0000099
3117 Ga0466964_0189800
3118 Ga0466964_0263090
3119 Ga0453684_0001523
3120 Ga0453684_0001816
3121 Ga0453684_0002641
3122 Ga0453684_0006066
3123 Ga0453684_0010591
3124 Ga0453684_0012880
3125 Ga0453684_0014054
3126 Ga0453684_0016267
3127 Ga0453684_0018038
3128 Ga0453684_0018478
3129 Ga0453684_0031266
3130 Ga0453684_0040412
3131 Ga0453684_0044676
3132 Ga0453684_0060293
3133 Ga0453684_0061696
3134 Ga0453684_0063629
3135 Ga0453684_0066188
3136 Ga0453684_0074832
3137 Ga0453684_0077606
3138 Ga0453684_0094645
3139 Ga0453684_0199148
3140 Ga0453684_0235620
3141 Ga0453684_0483707
3142 Ga0453684_0676626
3143 Ga0466971_0007196
3144 Ga0466968_0024252
3145 Ga0466968_0082946
3146 Ga0466970_0000094
3147 Ga0466970_0047720
3148 Ga0466957_0002083
3149 Ga0466957_0009316
3150 Ga0466959_0000074
3151 Ga0466959_0014265
3152 Ga0451576_0000539
3153 Ga0451576_0002019
3154 Ga0451576_0003414
3155 Ga0451576_0022076
3156 Ga0451576_0035160
3157 Ga0451576_0043706
3158 Ga0451576_0085197
3159 Ga0451576_0096200
3160 Ga0451576_0112249
3161 Ga0451576_0169071
3162 Ga0451576_0234149
3163 Ga0451576_0253156
3164 Ga0451576_0411419
3165 Ga0451576_0595790
3166 Ga0451576_0936526
3167 Ga0466967_0091301
3168 Ga0495627_000025
3169 Ga0495627_001544
3170 Ga0495627_004116
3171 Ga0495627_024362
3172 Ga0495590_0004963
3173 Ga0495629_0058077
3174 Ga0495638_0067278
3175 Ga0495638_0083484
3176 Ga0495651_0168704
3177 Ga0495651_0173285
3178 Ga0495650_0000107
3179 Ga0495582_0007561
3180 Ga0495639_0117227
3181 Ga0495585_0000116
3182 Ga0495585_0000170
3183 Ga0495607_0087145
3184 Ga0495583_0129701
3185 Ga0495583_0150615
3186 Ga0495606_0002103
3187 Ga0495606_0009259
3188 Ga0495606_0011835
3189 Ga0495606_0012971
3190 Ga0495606_0020567
3191 Ga0495606_0037648
3192 Ga0495608_0229760
3193 Ga0495610_0000001
3194 Ga0495610_0000724
3195 Ga0495610_0000784
3196 Ga0495610_0033625
3197 Ga0495610_0110737
3198 Ga0495616_0000882
3199 Ga0495616_0006658
3200 Ga0495618_0263834
3201 Ga0495628_0330916
3202 Ga0495632_0046723
3203 Ga0495637_0091612
3204 Ga0495643_0002717
3205 Ga0495643_0047543
3206 Ga0495643_0194823
3207 Ga0495648_0016029
3208 Ga0495648_0023598
3209 Ga0495648_0045048
3210 Ga0495663_0000022
3211 Ga0495652_0122798
3212 Ga0495652_0170986
3213 Ga0495654_0000242
3214 Ga0495654_0044400
3215 Ga0495665_0084426
3216 Ga0495609_0000113
3217 Ga0495609_0001895
3218 Ga0495609_0074096
3219 Ga0495645_0084246
3220 Ga0495633_0000006
3221 Ga0495633_0000154
3222 Ga0495633_0000341
3223 Ga0495633_0014208
3224 Ga0495633_0020413
3225 Ga0495668_0000011
3226 Ga0495668_0000191
3227 Ga0495611_0001405
3228 Ga0495625_0000021
3229 Ga0495625_0000344
3230 Ga0495625_0003152
3231 Ga0495625_0014051
3232 Ga0495625_0014342
3233 Ga0495625_0069980
3234 Ga0495635_0356889
3235 Ga0495661_0011479
3236 Ga0495647_0089909
3237 Ga0495658_0108891
3238 Ga0495671_0028196
3239 Ga0495649_0000009
3240 Ga0495660_0001836
3241 Ga0495660_0066210
3242 Ga0495581_0067456
3243 Ga0495636_0000077
3244 Ga0495674_0029758
3245 Ga0495672_0058796
3246 Ga0495672_0075978
3247 Ga0495687_000106
3248 Ga0495687_000356
3249 Ga0495673_0009304
3250 Ga0495686_0000016
3251 Ga0495686_0000107
3252 Ga0495686_0000324
3253 Ga0495686_0000485
3254 Ga0495686_0000673
3255 Ga0495686_0010011
3256 Ga0495686_0021685
3257 Ga0495686_0034708
3258 Ga0495686_0058484
3259 Ga0495686_0066119
3260 Ga0495614_0019698
3261 Ga0496100_0087754
3262 Ga0496101_0056828
3263 Ga0496101_0067770
3264 Ga0496102_0037210
3265 Ga0496104_0000005
3266 Ga0496105_0000018
3267 Ga0496108_0643425
3268 Ga0496109_0023654
3269 Ga0496110_0069554
3270 Ga0496113_0121908
3271 Ga0496114_0006504
3272 Ga0496114_0344865
3273 Ga0496115_0067946
3274 Ga0496115_0341431
3275 Ga0496115_0427269
3276 Ga0496116_0000024
3277 Ga0496116_0000919
3278 Ga0496117_0000285
3279 Ga0496117_0042858
3280 Ga0496118_0003532
3281 Ga0496119_0000004
3282 Ga0496121_0000020
3283 Ga0496121_0215393
3284 Ga0496122_0000856
3285 Ga0496122_0001202
3286 Ga0496122_0001336
3287 Ga0496122_0003258
3288 Ga0496122_0016975
3289 Ga0496122_0106068
3290 Ga0496123_0002339
3291 Ga0496123_0008431
3292 Ga0496123_0010972
3293 Ga0496123_0032984
3294 Ga0496124_0001868
3295 Ga0496124_0170598
3296 Ga0496124_0443072
3297 Ga0496125_0000018
3298 Ga0496125_0000552
3299 Ga0496125_0050649
3300 Ga0496125_0065533
3301 Ga0496126_0003667
3302 Ga0496126_0007711
3303 Ga0496126_0029217
3304 Ga0501309_000358
3305 Ga0495678_015057
3306 Ga0501298_012944
3307 Ga0501323_011008
3308 Ga0501323_013125
3309 Ga0501031_0000669
3310 Ga0501032_0006377
3311 Ga0501032_0006744
3312 Ga0501032_0011511
3313 Ga0501033_0000005
3314 Ga0501033_0045896
3315 Ga0501033_0082718
3316 Ga0501033_0116037
3317 Ga0501033_0218382
3318 Ga0501034_0000052
3319 Ga0501034_0000399
3320 Ga0501034_0007132
3321 Ga0501034_0013607
3322 Ga0501034_0048621
3323 Ga0501034_0057277
3324 Ga0501034_0082328
3325 Ga0501034_0174368
3326 Ga0501034_0204855
3327 Ga0501034_0372380
3328 Ga0501036_0005324
3329 Ga0501036_0038538
3330 Ga0501036_0226812
3331 Ga0501037_0004614
3332 Ga0501037_0028996
3333 Ga0501037_0048842
3334 Ga0501037_0154742
3335 Ga0501038_0008621
3336 Ga0501038_0013871
3337 Ga0501038_0269014
3338 Ga0501038_0315654
3339 Ga0501039_0010156
3340 Ga0501043_0009194
3341 Ga0501043_0097363
3342 Ga0501043_0179804
3343 Ga0501043_0223723
3344 Ga0501043_0326014
3345 Ga0501046_0161429
3346 Ga0501047_0008976
3347 Ga0501047_0028283
3348 Ga0501047_0056150
3349 Ga0501047_0082702
3350 Ga0501047_0375654
3351 Ga0501069_0028314
3352 Ga0501069_0047967
3353 Ga0501069_0064019
3354 Ga0501069_0249186
3355 Ga0501070_0065524
3356 Ga0501070_0066256
3357 Ga0501071_0319494
3358 Ga0501073_0033311
3359 Ga0501073_0232854
3360 Ga0501076_0198496
3361 Ga0501198_012863
3362 Ga0501201_000710
3363 Ga0501202_003897
3364 Ga0501217_000991
3365 Ga0501217_002907
3366 Ga0501222_001667
3367 Ga0501223_001698
3368 Ga0501223_006800
3369 Ga0501224_008900
3370 Ga0501233_060068
3371 Ga0501235_003004
3372 Ga0501240_009534
3373 Ga0501243_017198
3374 Ga0501249_000012
3375 Ga0501249_001078
3376 Ga0501252_002797
3377 Ga0501257_001003
3378 Ga0501259_001336
3379 Ga0501261_000935
3380 Ga0501219_000072
3381 Ga0501221_001193
3382 Ga0501225_0002937
3383 Ga0501234_002922
3384 Ga0501245_000792
3385 Ga0501079_0074461
3386 Ga0501080_0046050
3387 Ga0501080_0095038
3388 Ga0501083_0104398
3389 Ga0501241_000014
3390 Ga0501241_007126
3391 Ga0501241_007683
3392 Ga0501241_010614
3393 Ga0501241_029215
3394 Ga0501264_001446
3395 Ga0501264_006301
3396 Ga0501266_000002
3397 Ga0501266_001794
3398 Ga0501269_000413
3399 Ga0501269_004616
3400 Ga0501280_004064
3401 Ga0501282_005718
3402 Ga0501035_0008311
3403 Ga0501035_0012497
3404 Ga0501035_0013123
3405 Ga0501035_0058067
3406 Ga0501035_0087075
3407 Ga0501035_0107483
3408 Ga0501044_0001723
3409 Ga0501044_0008687
3410 Ga0501044_0011700
3411 Ga0501044_0015635
3412 Ga0501044_0072142
3413 Ga0501044_0100915
3414 Ga0501044_0121383
3415 Ga0501044_0222442
3416 Ga0501044_0243374
3417 Ga0501044_0332706
3418 Ga0501045_0003565
3419 Ga0501212_000685
3420 Ga0501284_00059
3421 nmdc:mga0k408_10235_c1
3422 nmdc:mga0k408_102649_c1
3423 nmdc:mga0k408_2012_c1
3424 nmdc:mga0k408_96192_c1
3425 nmdc:mga05p37_375315_c1
3426 nmdc:mga09592_37236_c1
3427 nmdc:mga09592_45525_c1
3428 nmdc:mga0qj67_91800_c1
3429 nmdc:mga06r32_36325_c1
3430 nmdc:mga06r32_90944_c1
3431 nmdc:mga08y16_149587_c1
3432 nmdc:mga08y16_154457_c1
3433 nmdc:mga08y16_17977_c1
3434 nmdc:mga08y16_631759_c1
3435 Ga0500635_0000417
3436 Ga0495595_0171146
3437 Ga0500578_0000144
3438 Ga0500578_0014501
3439 Ga0500644_0000600
3440 Ga0500644_0037786
3441 Ga0500644_0078404
3442 Ga0500646_0000818
3443 Ga0500646_0002249
3444 Ga0500646_0003070
3445 Ga0500646_0016363
3446 Ga0500583_0000060
3447 Ga0500583_0002372
3448 Ga0500583_0012962
3449 Ga0500583_0050778
3450 Ga0500583_0067379
3451 Ga0500651_0001777
3452 Ga0500651_0313237
3453 Ga0500566_0204195
3454 Ga0500641_0000010
3455 Ga0500641_0000275
3456 Ga0500641_0001720
3457 Ga0500641_0037152
3458 Ga0500660_078635
3459 Ga0500555_009160
3460 Ga0500556_0023972
3461 Ga0500562_014455
3462 Ga0500569_000226
3463 Ga0500594_0005313
3464 Ga0500594_0012961
3465 Ga0500607_020375
3466 Ga0500618_000016
3467 Ga0500652_005154
3468 Ga0500658_0000002
3469 Ga0500658_0021484
3470 Ga0500559_0023756
3471 Ga0500568_0005710
3472 Ga0500568_0013071
3473 Ga0500568_0019967
3474 Ga0500573_0131722
3475 Ga0500577_0000468
3476 Ga0500579_133212
3477 Ga0500588_0014453
3478 Ga0500588_0059154
3479 Ga0500589_030117
3480 Ga0500590_010437
3481 Ga0500604_0025190
3482 Ga0500616_0002790
3483 Ga0500616_0014086
3484 Ga0500622_0000077
3485 Ga0500622_0000304
3486 Ga0500622_0005426
3487 Ga0500622_0022534
3488 Ga0500622_0069802
3489 Ga0500622_0089259
3490 Ga0500624_000265
3491 Ga0500627_0029600
3492 Ga0500634_0015358
3493 Ga0500636_0039586
3494 Ga0500636_0052137
3495 Ga0500584_048657
3496 Ga0500611_000033
3497 Ga0500645_046972
3498 Ga0501084_0138796
3499 Ga0466962_0003757
3500 Ga0466962_0035580
3501 2511232051
3502 2513232560
3503 2520879713
3504 2524004576
3505 2585145599
3506 2585156007
3507 2585160069
3508 2585426560
3509 2586210867
3510 2587678078
3511 2587749991
3512 2587753825
3513 2587867678
3514 2587942171
3515 2588209301
3516 2588216000
3517 2588217460
3518 2588222207
3519 2588234867
3520 2588445244
3521 2590600104
3522 2590610941
3523 2599479453
3524 2644009376
3525 2644374120
3526 2644643759
3527 2644681649
3528 2729202928
3529 2738700581
3530 2738731759
3531 2738732874
3532 2738756715
3533 2738765412
3534 2738855406
3535 2739214455
3536 2739254330
3537 2739305244
3538 2739588166
3539 2739614061
3540 2739647036
3541 2740003037
3542 2740007854
3543 2740031102
3544 2740061087
3545 2753671631
3546 2765576406
3547 2772606804
3548 2775673732
3549 2802654724
3550 2816871846
3551 2817413356
3552 2819546116
3553 2819573826
3554 2819588694
3555 2819680443
3556 2821137160
3557 2833642520
3558 2839991201
3559 2840677533
3560 2842085640
3561 2842724027
3562 2842907998
3563 2842912240
3564 2849282669
3565 2852625813
3566 2852630938
3567 2857617230
3568 2857619920
3569 2857629412
3570 2871721218
3571 2881360159
3572 2883072915
3573 2884636827
3574 2884798177
3575 2884935661
3576 2889293087
3577 2890740207
3578 2896085351
3579 2896115250
3580 2902052209
3581 2903898841
3582 2904423125
3583 2904446403
3584 2904468098
3585 2904558687
3586 2906001720
3587 2914759776
3588 2919097838
3589 2919189265
3590 2919194410
3591 2919401171
3592 2919440243
3593 2919512835
3594 2919684418
3595 2919694159
3596 2928082241
3597 2928149182
3598 2929150428
3599 2929157621
3600 2929182742
3601 2929241443
3602 2929923474
3603 2932084958
3604 2939666580
3605 2945926374
3606 2945978695
3607 2945999213
3608 2946015437
3609 2946020296
3610 2954021608
3611 2958463145
3612 2958515963
3613 2977234174
3614 2977247079
3615 2977271890
3616 2984572956
3617 2984610405
3618 2993372618
3619 2993483382
3620 8003152876
3621 8036737695
3622 8054311607
3623 8055423387
3624 8055589977
3625 8055595249
3626 8056443334

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13614

AAA_31

AAA domain

36

212

0.99

PF01656

CbiA

CobQ/CobB/MinD/ParA nucleotide binding domain

39

263

0.95

PF02374

ArsA_ATPase

Anion-transporting ATPase

37

104

0.91

PF06564

CBP_BcsQ

Cellulose biosynthesis protein BcsQ

35

284

0.78

PF10609

ParA

NUBPL iron-transfer P-loop NTPase

34

284

0.72

PF09140

MipZ

ATPase MipZ

37

214

0.69

Structural Annotation

Top 5 Hits

ID Description Score Start End
6iud-assembly1.cif.gz_A structure of helicobacter pylori soj-adp complex bound to dna 0.9678 1 251
5ihp-assembly1.cif.gz_A crystal structure of cobyrinic acid a,c-diamide synthase from mycobacterium smegmatis with bound adp and magnesium 0.9622 1 254
5if9-assembly2.cif.gz_B crystal structure of cobyrinic acid a,c-diamide synthase from mycobacterium smegmatis with bound atp analog and magnesium 0.9621 1 254
5ihp-assembly2.cif.gz_B crystal structure of cobyrinic acid a,c-diamide synthase from mycobacterium smegmatis with bound adp and magnesium 0.962 1 254
4pfs-assembly1.cif.gz_A crystal structure of cobyrinic acid a,c-diamide synthase from mycobacterium smegmatis 0.9593 1 251
ID Description Score Start End Superfamily
af_P9WLT1_58_317_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9805 2 252 3.40.50.300
6iudB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9675 1 251 3.40.50.300
5ihpA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9622 1 254 3.40.50.300
af_Q1LVD4_80_340_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9518 1 252 3.40.50.300
2bekD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9464 1 252 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A537KQI0-F1-model_v4 ParA family protein 0.994 1 254
AF-M7Y3U8-F1-model_v4 Sporulation initiation inhibitor protein Soj 0.994 1 258
AF-A0A1V6B998-F1-model_v4 Sporulation initiation inhibitor protein Soj (EC 3.6.-.-) 0.9939 1 254 GO:0016787
AF-A0A519X162-F1-model_v4 AAA domain-containing protein 0.9936 1 253 GO:0016787
GO:0046872
AF-A0A7X8GXZ2-F1-model_v4 ParA family protein 0.9934 1 252

Map