F495773
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1814 | 571 | 3628 | 205 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|2824753945|2824763207 |
| Length | 248 |
| Sequence | RLARLLRRLVLLLRRLPRLPPAATRRSNLSKLARGLWPRAERGARRVMRLFVGLGNPGAKYARNRHNIGFMAVDEIARRHGFSPWRRRFQGETSEGALGTERVILLKPTTYMNDSGRSVQEAASFFKIAPGDVTVFHDELELPPGKVRVKIGGGIAGHNGLRSISAHIGNDYRRVRLGIGHPGVKEMVHGHVLSDFAKADNDWVTTLCDAVAEHAALIAKGTDATFANRVHLAMQAKGFLTKDENGKE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300000549 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled | Metagenome | Rhizosphere |
| 2 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 3 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 4 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 5 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 6 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 7 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 8 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 9 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 10 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 11 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 12 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 13 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 14 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 15 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 16 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 17 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 18 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 19 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 24 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 26 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 28 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 30 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 41 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 56 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 57 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 58 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 61 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 62 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 63 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 64 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 65 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 66 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 70 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 71 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 73 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 74 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 75 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 77 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 78 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 79 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 80 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 81 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 82 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 83 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 84 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 85 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 86 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 87 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 88 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 89 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 90 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 91 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 92 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 93 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 94 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 95 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 96 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 97 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 98 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 99 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 100 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 101 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 102 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 103 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 105 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 106 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 107 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 108 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 109 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 110 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 111 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 112 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 113 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300006941 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW | Metagenome | Nodule |
| 115 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 116 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 117 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 118 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 119 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 120 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 135 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 136 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 148 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 150 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 151 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 152 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 153 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 154 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 155 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 156 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 157 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 158 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 159 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 160 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 161 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 162 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 163 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 164 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 165 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 166 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 167 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 168 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 169 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 170 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 171 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 172 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 173 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 174 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 175 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 242 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 243 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 244 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 245 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 247 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 248 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 252 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 253 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 254 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 255 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 256 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 257 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 258 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 259 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 260 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 261 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 262 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 263 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 264 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 265 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 266 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 267 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 268 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 269 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 270 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 271 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 272 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 273 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 274 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 275 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 276 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 277 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 278 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 279 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 280 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 281 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 282 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 283 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 284 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 285 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 286 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 287 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 288 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 289 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 290 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 291 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 292 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 293 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 294 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 295 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 296 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 297 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 298 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 299 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 300 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 301 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 302 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 303 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 304 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 305 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 306 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 307 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 308 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 309 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 310 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 311 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 312 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 313 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 314 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 315 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 316 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 317 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 318 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 319 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 320 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 321 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 322 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 323 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 324 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 325 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 326 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 327 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 328 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 329 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 330 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 331 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 332 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 333 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 334 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 335 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 336 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 337 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 338 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 339 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 340 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 341 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 342 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 343 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 420 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 421 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 422 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 423 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 424 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 425 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 426 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 427 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 428 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 429 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 430 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 431 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 432 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 433 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 434 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 435 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 436 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 437 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 438 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 439 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 440 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 441 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 442 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 443 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 444 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 445 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 446 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 447 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 448 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 449 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 450 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 451 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 452 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 453 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 454 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 455 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 456 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 457 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 458 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 459 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 460 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 461 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 462 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 463 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 464 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 465 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 466 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 467 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 468 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 469 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 470 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 471 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 472 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 473 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 474 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 475 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 476 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 477 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 478 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 479 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 480 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 481 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 482 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 483 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 484 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 485 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 486 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 487 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 488 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 489 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 490 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 491 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 492 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 493 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 494 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 495 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 496 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 497 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 498 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 499 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 500 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 501 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 502 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 503 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 504 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 505 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 506 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 507 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 508 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 509 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 510 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 511 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 512 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 513 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 514 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 515 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 516 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 517 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 518 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 519 | 3300053089 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere | Metagenome | Endosphere |
| 520 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 521 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 522 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 523 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 524 | 3300053097 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere | Metagenome | Endosphere |
| 525 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 526 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 527 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 528 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 529 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 530 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 531 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 532 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 533 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 534 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 535 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 536 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 537 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 538 | 3300053126 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere | Metagenome | Endosphere |
| 539 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 540 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 541 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 542 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 543 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 544 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 545 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 546 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 547 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 548 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 549 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 550 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 551 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 552 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 553 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 554 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 555 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 556 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 557 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 558 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 559 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 560 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 561 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 562 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 563 | 3300053733 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere | Metagenome | Endosphere |
| 564 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 565 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 566 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 567 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 568 | 3300059630 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 569 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 570 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 571 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.83 |
| Metatranscriptomes | 0.11 |
| Isolates | 0.06 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 10.36 |
| Nodule | 0.88 |
| Rhizoplane | 5.84 |
| Rhizosphere | 76.07 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | LJQas_1014093 | 3300000549 | Bacteria | 939 |
| 2 | JGI24736J21556_1035744 | 3300001904 | Bacteria | 766 |
| 3 | JGI24740J21852_10072451 | 3300001979 | Bacteria | 919 |
| 4 | JGI24739J22299_10081692 | 3300001989 | Bacteria | 992 |
| 5 | JGI24737J22298_10060946 | 3300001990 | Bacteria | 1135 |
| 6 | JGI24737J22298_10091649 | 3300001990 | Bacteria | 901 |
| 7 | JGI24735J21928_10014119 | 3300002067 | Bacteria | 2502 |
| 8 | JGI24738J21930_10018347 | 3300002075 | Bacteria | 1463 |
| 9 | JGI24738J21930_10019471 | 3300002075 | Bacteria | 1414 |
| 10 | JGI24744J21845_10035441 | 3300002077 | Bacteria | 944 |
| 11 | JGI25406J46586_10000043 | 3300003203 | Bacteria | 55866 |
| 12 | JGI25406J46586_10010825 | 3300003203 | Bacteria | 4024 |
| 13 | JGI25406J46586_10018195 | 3300003203 | Bacteria | 2892 |
| 14 | JGI25406J46586_10085391 | 3300003203 | Bacteria | 960 |
| 15 | JGI25165J46597_1003856 | 3300003214 | Bacteria | 3487 |
| 16 | JGI25153J46596_10072615 | 3300003215 | Bacteria | 885 |
| 17 | rootH1_10028015 | 3300003316 | Bacteria | 1216 |
| 18 | JGI25160J50197_1001494 | 3300003354 | Bacteria | 11616 |
| 19 | JGI25160J50197_1002898 | 3300003354 | Bacteria | 7851 |
| 20 | JGI25160J50197_1032553 | 3300003354 | Bacteria | 1323 |
| 21 | JGI25404J52841_10068100 | 3300003659 | Bacteria | 744 |
| 22 | Ga0055531_10008612 | 3300003794 | Bacteria | 5346 |
| 23 | JGI25405J52794_10055416 | 3300003911 | Bacteria | 853 |
| 24 | Ga0055543_1011814 | 3300004625 | Bacteria | 1775 |
| 25 | Ga0065165_1003257 | 3300005262 | Bacteria | 11740 |
| 26 | Ga0065165_1003499 | 3300005262 | Bacteria | 10933 |
| 27 | Ga0065165_1010766 | 3300005262 | Bacteria | 3904 |
| 28 | Ga0065165_1025431 | 3300005262 | Bacteria | 1969 |
| 29 | Ga0070658_10033745 | 3300005327 | Bacteria | 4118 |
| 30 | Ga0070658_10427597 | 3300005327 | Bacteria | 1139 |
| 31 | Ga0070683_100064413 | 3300005329 | Bacteria | 3412 |
| 32 | Ga0070683_100078373 | 3300005329 | Bacteria | 3091 |
| 33 | Ga0070683_100261695 | 3300005329 | Bacteria | 1646 |
| 34 | Ga0070690_100000828 | 3300005330 | Bacteria | 15680 |
| 35 | Ga0070690_100439083 | 3300005330 | Bacteria | 966 |
| 36 | Ga0070670_100002211 | 3300005331 | Bacteria | 15990 |
| 37 | Ga0070670_100265280 | 3300005331 | Bacteria | 1498 |
| 38 | Ga0068869_100047504 | 3300005334 | Bacteria | 3101 |
| 39 | Ga0068869_100366021 | 3300005334 | Bacteria | 1178 |
| 40 | Ga0070666_10015263 | 3300005335 | Bacteria | 4898 |
| 41 | Ga0070666_10412773 | 3300005335 | Bacteria | 972 |
| 42 | Ga0070680_100047788 | 3300005336 | Bacteria | 3485 |
| 43 | Ga0070680_100119724 | 3300005336 | Bacteria | 2197 |
| 44 | Ga0070680_100212420 | 3300005336 | Bacteria | 1632 |
| 45 | Ga0070680_100221154 | 3300005336 | Bacteria | 1598 |
| 46 | Ga0070682_100039316 | 3300005337 | Bacteria | 2906 |
| 47 | Ga0068868_100006575 | 3300005338 | Bacteria | 8237 |
| 48 | Ga0068868_100624917 | 3300005338 | Bacteria | 957 |
| 49 | Ga0070660_100001272 | 3300005339 | Bacteria | 17201 |
| 50 | Ga0070660_100073011 | 3300005339 | Bacteria | 2682 |
| 51 | Ga0070660_100093768 | 3300005339 | Bacteria | 2371 |
| 52 | Ga0070660_100119358 | 3300005339 | Bacteria | 2103 |
| 53 | Ga0070660_100620570 | 3300005339 | Bacteria | 905 |
| 54 | Ga0070689_100004861 | 3300005340 | Bacteria | 9121 |
| 55 | Ga0070691_10000310 | 3300005341 | Bacteria | 17151 |
| 56 | Ga0070687_100010068 | 3300005343 | Bacteria | 4072 |
| 57 | Ga0070687_100397661 | 3300005343 | Bacteria | 903 |
| 58 | Ga0070661_100001241 | 3300005344 | Bacteria | 17916 |
| 59 | Ga0070692_10000736 | 3300005345 | Bacteria | 10640 |
| 60 | Ga0070668_100000234 | 3300005347 | Bacteria | 36207 |
| 61 | Ga0070668_100122354 | 3300005347 | Bacteria | 2081 |
| 62 | Ga0070668_100196763 | 3300005347 | Bacteria | 1653 |
| 63 | Ga0070669_100021148 | 3300005353 | Bacteria | 4649 |
| 64 | Ga0070669_100571549 | 3300005353 | Bacteria | 944 |
| 65 | Ga0070669_101192093 | 3300005353 | Bacteria | 658 |
| 66 | Ga0070675_100102654 | 3300005354 | Bacteria | 2410 |
| 67 | Ga0070675_100368946 | 3300005354 | Bacteria | 1276 |
| 68 | Ga0070675_101271426 | 3300005354 | Bacteria | 678 |
| 69 | Ga0070671_100004140 | 3300005355 | Bacteria | 11449 |
| 70 | Ga0070671_100134309 | 3300005355 | Bacteria | 2085 |
| 71 | Ga0070671_100434865 | 3300005355 | Bacteria | 1124 |
| 72 | Ga0070674_100120767 | 3300005356 | Bacteria | 1940 |
| 73 | Ga0070673_100000403 | 3300005364 | Bacteria | 22935 |
| 74 | Ga0070673_100272676 | 3300005364 | Bacteria | 1481 |
| 75 | Ga0070673_100412443 | 3300005364 | Bacteria | 1209 |
| 76 | Ga0070673_100499583 | 3300005364 | Bacteria | 1100 |
| 77 | Ga0070688_100001474 | 3300005365 | Bacteria | 11695 |
| 78 | Ga0070659_100008990 | 3300005366 | Bacteria | 7325 |
| 79 | Ga0070659_100054939 | 3300005366 | Bacteria | 3137 |
| 80 | Ga0070659_100225513 | 3300005366 | Bacteria | 1548 |
| 81 | Ga0070667_100003240 | 3300005367 | Bacteria | 13920 |
| 82 | Ga0070667_100052713 | 3300005367 | Bacteria | 3433 |
| 83 | Ga0070709_10006897 | 3300005434 | Bacteria | 6200 |
| 84 | Ga0070709_10007955 | 3300005434 | Bacteria | 5822 |
| 85 | Ga0070709_10029947 | 3300005434 | Bacteria | 3261 |
| 86 | Ga0070714_100012712 | 3300005435 | Bacteria | 6725 |
| 87 | Ga0070714_100016007 | 3300005435 | Bacteria | 6046 |
| 88 | Ga0070714_100028213 | 3300005435 | Bacteria | 4654 |
| 89 | Ga0070714_100085025 | 3300005435 | Bacteria | 2762 |
| 90 | Ga0070714_100119195 | 3300005435 | Bacteria | 2345 |
| 91 | Ga0070714_100125520 | 3300005435 | Bacteria | 2288 |
| 92 | Ga0070713_100007026 | 3300005436 | Bacteria | 7863 |
| 93 | Ga0070713_100193746 | 3300005436 | Bacteria | 1833 |
| 94 | Ga0070713_100234420 | 3300005436 | Bacteria | 1669 |
| 95 | Ga0070713_100836135 | 3300005436 | Bacteria | 884 |
| 96 | Ga0070710_10001642 | 3300005437 | Bacteria | 10578 |
| 97 | Ga0070710_10005669 | 3300005437 | Bacteria | 5945 |
| 98 | Ga0070710_10011317 | 3300005437 | Bacteria | 4407 |
| 99 | Ga0070710_10029302 | 3300005437 | Bacteria | 2953 |
| 100 | Ga0070710_10456972 | 3300005437 | Bacteria | 867 |
| 101 | Ga0070701_10004206 | 3300005438 | Bacteria | 5797 |
| 102 | Ga0070711_100023747 | 3300005439 | Bacteria | 3992 |
| 103 | Ga0070711_100024919 | 3300005439 | Bacteria | 3909 |
| 104 | Ga0070711_100042723 | 3300005439 | Bacteria | 3066 |
| 105 | Ga0070711_100260716 | 3300005439 | Bacteria | 1363 |
| 106 | Ga0070711_100444674 | 3300005439 | Bacteria | 1060 |
| 107 | Ga0070705_100001109 | 3300005440 | Bacteria | 14913 |
| 108 | Ga0070700_100005223 | 3300005441 | Bacteria | 6866 |
| 109 | Ga0070700_100949402 | 3300005441 | Bacteria | 703 |
| 110 | Ga0070694_100002601 | 3300005444 | Bacteria | 10665 |
| 111 | Ga0070663_100001201 | 3300005455 | Bacteria | 14259 |
| 112 | Ga0070663_100007668 | 3300005455 | Bacteria | 6585 |
| 113 | Ga0070663_100009968 | 3300005455 | Bacteria | 5906 |
| 114 | Ga0070663_100147422 | 3300005455 | Bacteria | 1801 |
| 115 | Ga0070663_100184483 | 3300005455 | Bacteria | 1620 |
| 116 | Ga0070663_100275329 | 3300005455 | Bacteria | 1339 |
| 117 | Ga0070663_100384719 | 3300005455 | Bacteria | 1143 |
| 118 | Ga0070678_100002064 | 3300005456 | Bacteria | 10888 |
| 119 | Ga0070678_100234528 | 3300005456 | Bacteria | 1531 |
| 120 | Ga0070678_100249981 | 3300005456 | Bacteria | 1486 |
| 121 | Ga0070678_100250971 | 3300005456 | Bacteria | 1484 |
| 122 | Ga0070678_100454387 | 3300005456 | Bacteria | 1122 |
| 123 | Ga0070678_100731400 | 3300005456 | Bacteria | 894 |
| 124 | Ga0070662_100003035 | 3300005457 | Bacteria | 10432 |
| 125 | Ga0070662_100190550 | 3300005457 | Bacteria | 1621 |
| 126 | Ga0070662_100219111 | 3300005457 | Bacteria | 1518 |
| 127 | Ga0070662_100370175 | 3300005457 | Bacteria | 1177 |
| 128 | Ga0070662_100508879 | 3300005457 | Bacteria | 1005 |
| 129 | Ga0070681_10042162 | 3300005458 | Bacteria | 4574 |
| 130 | Ga0070681_10054507 | 3300005458 | Bacteria | 3985 |
| 131 | Ga0070681_10075815 | 3300005458 | Bacteria | 3323 |
| 132 | Ga0070681_10084466 | 3300005458 | Bacteria | 3127 |
| 133 | Ga0070681_10134876 | 3300005458 | Bacteria | 2399 |
| 134 | Ga0070681_10206855 | 3300005458 | Bacteria | 1879 |
| 135 | Ga0070681_10221463 | 3300005458 | Bacteria | 1807 |
| 136 | Ga0070681_10683442 | 3300005458 | Bacteria | 942 |
| 137 | Ga0068867_100176779 | 3300005459 | Bacteria | 1694 |
| 138 | Ga0068867_100371539 | 3300005459 | Bacteria | 1199 |
| 139 | Ga0068867_100495203 | 3300005459 | Bacteria | 1049 |
| 140 | Ga0070706_100369256 | 3300005467 | Bacteria | 1337 |
| 141 | Ga0070698_100008454 | 3300005471 | Bacteria | 11122 |
| 142 | Ga0070698_100117600 | 3300005471 | Bacteria | 2620 |
| 143 | Ga0070699_100055104 | 3300005518 | Bacteria | 3443 |
| 144 | Ga0070679_100030467 | 3300005530 | Bacteria | 5326 |
| 145 | Ga0070679_100032524 | 3300005530 | Bacteria | 5161 |
| 146 | Ga0070679_100178059 | 3300005530 | Bacteria | 2099 |
| 147 | Ga0070679_100481287 | 3300005530 | Bacteria | 1185 |
| 148 | Ga0070679_100773961 | 3300005530 | Bacteria | 903 |
| 149 | Ga0070684_100002674 | 3300005535 | Bacteria | 13159 |
| 150 | Ga0070684_100011830 | 3300005535 | Bacteria | 6964 |
| 151 | Ga0070684_100289769 | 3300005535 | Bacteria | 1501 |
| 152 | Ga0070684_100385751 | 3300005535 | Bacteria | 1291 |
| 153 | Ga0070697_100004351 | 3300005536 | Bacteria | 10862 |
| 154 | Ga0068853_100002553 | 3300005539 | Bacteria | 13675 |
| 155 | Ga0068853_100011155 | 3300005539 | Bacteria | 7291 |
| 156 | Ga0068853_100062055 | 3300005539 | Bacteria | 3233 |
| 157 | Ga0068853_100509450 | 3300005539 | Bacteria | 1137 |
| 158 | Ga0068853_100552721 | 3300005539 | Bacteria | 1091 |
| 159 | Ga0068853_100814372 | 3300005539 | Bacteria | 895 |
| 160 | Ga0068853_101440628 | 3300005539 | Bacteria | 666 |
| 161 | Ga0070686_100001906 | 3300005544 | Bacteria | 11609 |
| 162 | Ga0070695_100001397 | 3300005545 | Bacteria | 13379 |
| 163 | Ga0070695_100175499 | 3300005545 | Bacteria | 1514 |
| 164 | Ga0070696_100002930 | 3300005546 | Bacteria | 11340 |
| 165 | Ga0070693_100000657 | 3300005547 | Bacteria | 15257 |
| 166 | Ga0070693_100022640 | 3300005547 | Bacteria | 3344 |
| 167 | Ga0070693_100178187 | 3300005547 | Bacteria | 1366 |
| 168 | Ga0070693_100198727 | 3300005547 | Bacteria | 1301 |
| 169 | Ga0070693_100315301 | 3300005547 | Bacteria | 1059 |
| 170 | Ga0070693_100715344 | 3300005547 | Bacteria | 734 |
| 171 | Ga0070665_100010067 | 3300005548 | Bacteria | 9570 |
| 172 | Ga0070665_100188279 | 3300005548 | Bacteria | 2065 |
| 173 | Ga0070665_100207035 | 3300005548 | Bacteria | 1962 |
| 174 | Ga0070665_100505028 | 3300005548 | Bacteria | 1220 |
| 175 | Ga0070665_100698331 | 3300005548 | Bacteria | 1028 |
| 176 | Ga0070665_101086553 | 3300005548 | Bacteria | 811 |
| 177 | Ga0070704_100001520 | 3300005549 | Bacteria | 12505 |
| 178 | Ga0068855_100004506 | 3300005563 | Bacteria | 17017 |
| 179 | Ga0068855_100062579 | 3300005563 | Bacteria | 4344 |
| 180 | Ga0068855_100064363 | 3300005563 | Bacteria | 4276 |
| 181 | Ga0068855_100204887 | 3300005563 | Bacteria | 2219 |
| 182 | Ga0068855_100432807 | 3300005563 | Bacteria | 1438 |
| 183 | Ga0068855_100487242 | 3300005563 | Bacteria | 1341 |
| 184 | Ga0068855_100538215 | 3300005563 | Bacteria | 1266 |
| 185 | Ga0068855_100817629 | 3300005563 | Bacteria | 989 |
| 186 | Ga0070664_100002217 | 3300005564 | Bacteria | 15619 |
| 187 | Ga0070664_100092661 | 3300005564 | Bacteria | 2616 |
| 188 | Ga0070664_100144711 | 3300005564 | Bacteria | 2095 |
| 189 | Ga0068857_100001194 | 3300005577 | Bacteria | 20287 |
| 190 | Ga0068857_100025466 | 3300005577 | Bacteria | 5209 |
| 191 | Ga0068857_100071713 | 3300005577 | Bacteria | 3086 |
| 192 | Ga0068857_100168899 | 3300005577 | Bacteria | 1987 |
| 193 | Ga0068857_100194380 | 3300005577 | Bacteria | 1848 |
| 194 | Ga0068854_100012304 | 3300005578 | Bacteria | 5600 |
| 195 | Ga0068854_100021056 | 3300005578 | Bacteria | 4421 |
| 196 | Ga0068854_100171309 | 3300005578 | Bacteria | 1689 |
| 197 | Ga0068854_100399152 | 3300005578 | Bacteria | 1137 |
| 198 | Ga0068854_100477178 | 3300005578 | Bacteria | 1046 |
| 199 | Ga0068854_100600368 | 3300005578 | Bacteria | 940 |
| 200 | Ga0068856_100012522 | 3300005614 | Bacteria | 8211 |
| 201 | Ga0068856_100414807 | 3300005614 | Bacteria | 1366 |
| 202 | Ga0068856_100736952 | 3300005614 | Bacteria | 1005 |
| 203 | Ga0068856_100835023 | 3300005614 | Bacteria | 941 |
| 204 | Ga0068856_101138052 | 3300005614 | Bacteria | 797 |
| 205 | Ga0070702_100023216 | 3300005615 | Bacteria | 3292 |
| 206 | Ga0068852_100012153 | 3300005616 | Bacteria | 6522 |
| 207 | Ga0068852_100462145 | 3300005616 | Bacteria | 1258 |
| 208 | Ga0068852_100625476 | 3300005616 | Bacteria | 1082 |
| 209 | Ga0068852_100890998 | 3300005616 | Bacteria | 906 |
| 210 | Ga0068852_100929270 | 3300005616 | Bacteria | 887 |
| 211 | Ga0068852_101010237 | 3300005616 | Bacteria | 850 |
| 212 | Ga0068859_100167126 | 3300005617 | Bacteria | 2280 |
| 213 | Ga0068859_100340262 | 3300005617 | Bacteria | 1594 |
| 214 | Ga0068859_100389406 | 3300005617 | Bacteria | 1489 |
| 215 | Ga0068864_100006229 | 3300005618 | Bacteria | 9784 |
| 216 | Ga0068864_100347047 | 3300005618 | Bacteria | 1399 |
| 217 | Ga0068864_100672493 | 3300005618 | Bacteria | 1009 |
| 218 | Ga0068866_10004323 | 3300005718 | Bacteria | 5835 |
| 219 | Ga0068866_10062253 | 3300005718 | Bacteria | 1941 |
| 220 | Ga0068861_100001266 | 3300005719 | Bacteria | 15769 |
| 221 | Ga0068861_100270297 | 3300005719 | Bacteria | 1459 |
| 222 | Ga0068861_100655078 | 3300005719 | Bacteria | 970 |
| 223 | Ga0068861_101155394 | 3300005719 | Bacteria | 746 |
| 224 | Ga0068851_10001389 | 3300005834 | Bacteria | 10579 |
| 225 | Ga0068851_10004887 | 3300005834 | Bacteria | 6070 |
| 226 | Ga0068870_10161975 | 3300005840 | Bacteria | 1327 |
| 227 | Ga0068870_10222287 | 3300005840 | Bacteria | 1157 |
| 228 | Ga0068863_100001254 | 3300005841 | Bacteria | 25284 |
| 229 | Ga0068863_100505382 | 3300005841 | Bacteria | 1190 |
| 230 | Ga0068863_100747692 | 3300005841 | Bacteria | 974 |
| 231 | Ga0068858_100005485 | 3300005842 | Bacteria | 12419 |
| 232 | Ga0068858_100349338 | 3300005842 | Bacteria | 1417 |
| 233 | Ga0068858_100505733 | 3300005842 | Bacteria | 1167 |
| 234 | Ga0068860_100008151 | 3300005843 | Bacteria | 10429 |
| 235 | Ga0068860_100282182 | 3300005843 | Bacteria | 1623 |
| 236 | Ga0068860_100408020 | 3300005843 | Bacteria | 1345 |
| 237 | Ga0068860_100422006 | 3300005843 | Bacteria | 1322 |
| 238 | Ga0068860_100488827 | 3300005843 | Bacteria | 1227 |
| 239 | Ga0068860_100661807 | 3300005843 | Bacteria | 1052 |
| 240 | Ga0068860_100898893 | 3300005843 | Bacteria | 901 |
| 241 | Ga0068862_100007020 | 3300005844 | Bacteria | 9353 |
| 242 | Ga0068862_100173484 | 3300005844 | Bacteria | 1931 |
| 243 | Ga0068862_100358555 | 3300005844 | Bacteria | 1354 |
| 244 | Ga0068862_100619571 | 3300005844 | Bacteria | 1041 |
| 245 | Ga0068862_101003842 | 3300005844 | Bacteria | 825 |
| 246 | Ga0081455_10011644 | 3300005937 | Bacteria | 8824 |
| 247 | Ga0081455_10016227 | 3300005937 | Bacteria | 7198 |
| 248 | Ga0081455_10186981 | 3300005937 | Bacteria | 1564 |
| 249 | Ga0081455_10370851 | 3300005937 | Bacteria | 1003 |
| 250 | Ga0081538_10001959 | 3300005981 | Bacteria | 20612 |
| 251 | Ga0081538_10030040 | 3300005981 | Bacteria | 3698 |
| 252 | Ga0081538_10048294 | 3300005981 | Bacteria | 2597 |
| 253 | Ga0081538_10073588 | 3300005981 | Bacteria | 1866 |
| 254 | Ga0081540_1009974 | 3300005983 | Bacteria | 6476 |
| 255 | Ga0081540_1014075 | 3300005983 | Bacteria | 5153 |
| 256 | Ga0081540_1021553 | 3300005983 | Bacteria | 3831 |
| 257 | Ga0081540_1077329 | 3300005983 | Bacteria | 1513 |
| 258 | Ga0081539_10000324 | 3300005985 | Bacteria | 106549 |
| 259 | Ga0081539_10000349 | 3300005985 | Bacteria | 101264 |
| 260 | Ga0081539_10005758 | 3300005985 | Bacteria | 12368 |
| 261 | Ga0081539_10012594 | 3300005985 | Bacteria | 6492 |
| 262 | Ga0070717_10002984 | 3300006028 | Bacteria | 12044 |
| 263 | Ga0070717_10132481 | 3300006028 | Bacteria | 2145 |
| 264 | Ga0070717_10294459 | 3300006028 | Bacteria | 1441 |
| 265 | Ga0075365_10052227 | 3300006038 | Bacteria | 2702 |
| 266 | Ga0075365_10070247 | 3300006038 | Bacteria | 2355 |
| 267 | Ga0075365_10081154 | 3300006038 | Bacteria | 2197 |
| 268 | Ga0075365_10227407 | 3300006038 | Bacteria | 1309 |
| 269 | Ga0075365_10389247 | 3300006038 | Bacteria | 983 |
| 270 | Ga0075368_10018719 | 3300006042 | Bacteria | 2606 |
| 271 | Ga0075368_10031548 | 3300006042 | Bacteria | 2055 |
| 272 | Ga0075368_10060675 | 3300006042 | Bacteria | 1514 |
| 273 | Ga0075363_100033056 | 3300006048 | Bacteria | 2691 |
| 274 | Ga0075363_100054835 | 3300006048 | Bacteria | 2134 |
| 275 | Ga0075363_100085499 | 3300006048 | Bacteria | 1730 |
| 276 | Ga0075364_10079593 | 3300006051 | Bacteria | 2165 |
| 277 | Ga0075364_10206757 | 3300006051 | Bacteria | 1331 |
| 278 | Ga0070715_10000165 | 3300006163 | Bacteria | 15402 |
| 279 | Ga0070715_10000783 | 3300006163 | Bacteria | 8621 |
| 280 | Ga0070715_10082703 | 3300006163 | Bacteria | 1461 |
| 281 | Ga0070716_100001149 | 3300006173 | Bacteria | 11674 |
| 282 | Ga0070716_100001653 | 3300006173 | Bacteria | 10057 |
| 283 | Ga0070716_100163589 | 3300006173 | Bacteria | 1445 |
| 284 | Ga0070712_100016633 | 3300006175 | Bacteria | 4752 |
| 285 | Ga0070712_100071997 | 3300006175 | Bacteria | 2475 |
| 286 | Ga0070712_100199388 | 3300006175 | Bacteria | 1571 |
| 287 | Ga0075362_10077037 | 3300006177 | Bacteria | 1531 |
| 288 | Ga0075362_10292090 | 3300006177 | Bacteria | 808 |
| 289 | Ga0075367_10027228 | 3300006178 | Bacteria | 3250 |
| 290 | Ga0075367_10110179 | 3300006178 | Bacteria | 1689 |
| 291 | Ga0075367_10118140 | 3300006178 | Bacteria | 1632 |
| 292 | Ga0075367_10149024 | 3300006178 | Bacteria | 1451 |
| 293 | Ga0075367_10218147 | 3300006178 | Bacteria | 1193 |
| 294 | Ga0075369_10003699 | 3300006186 | Bacteria | 5590 |
| 295 | Ga0075369_10099706 | 3300006186 | Bacteria | 1302 |
| 296 | Ga0075369_10187205 | 3300006186 | Bacteria | 953 |
| 297 | Ga0075366_10123286 | 3300006195 | Bacteria | 1562 |
| 298 | Ga0075366_10174625 | 3300006195 | Bacteria | 1304 |
| 299 | Ga0097621_100078770 | 3300006237 | Bacteria | 2738 |
| 300 | Ga0097621_100106743 | 3300006237 | Bacteria | 2362 |
| 301 | Ga0097621_100720444 | 3300006237 | Bacteria | 920 |
| 302 | Ga0097621_100801675 | 3300006237 | Bacteria | 873 |
| 303 | Ga0097621_100858152 | 3300006237 | Bacteria | 844 |
| 304 | Ga0075370_10039450 | 3300006353 | Bacteria | 2660 |
| 305 | Ga0075370_10060808 | 3300006353 | Bacteria | 2152 |
| 306 | Ga0075370_10186526 | 3300006353 | Bacteria | 1221 |
| 307 | Ga0075370_10449321 | 3300006353 | Bacteria | 775 |
| 308 | Ga0075370_10544784 | 3300006353 | Bacteria | 701 |
| 309 | Ga0068871_100044210 | 3300006358 | Bacteria | 3580 |
| 310 | Ga0068871_100098484 | 3300006358 | Bacteria | 2446 |
| 311 | Ga0075428_100065292 | 3300006844 | Bacteria | 3985 |
| 312 | Ga0075428_100282262 | 3300006844 | Bacteria | 1787 |
| 313 | Ga0075431_100084563 | 3300006847 | Bacteria | 3275 |
| 314 | Ga0075431_100142956 | 3300006847 | Bacteria | 2466 |
| 315 | Ga0075433_10010098 | 3300006852 | Bacteria | 7568 |
| 316 | Ga0075433_10369384 | 3300006852 | Bacteria | 1267 |
| 317 | Ga0075434_100042444 | 3300006871 | Bacteria | 4509 |
| 318 | Ga0075434_100048898 | 3300006871 | Bacteria | 4197 |
| 319 | Ga0075434_100066875 | 3300006871 | Bacteria | 3580 |
| 320 | Ga0075429_100143048 | 3300006880 | Bacteria | 2094 |
| 321 | Ga0068865_100117684 | 3300006881 | Bacteria | 1970 |
| 322 | Ga0068865_101065392 | 3300006881 | Bacteria | 711 |
| 323 | Ga0075436_100072899 | 3300006914 | Bacteria | 2376 |
| 324 | Ga0075436_100142703 | 3300006914 | Bacteria | 1684 |
| 325 | Ga0075436_100205435 | 3300006914 | Bacteria | 1396 |
| 326 | Ga0097620_100167123 | 3300006931 | Bacteria | 2280 |
| 327 | Ga0097620_100340270 | 3300006931 | Bacteria | 1594 |
| 328 | Ga0097620_100389390 | 3300006931 | Bacteria | 1489 |
| 329 | Ga0099825_1033603 | 3300006941 | Bacteria | 1976 |
| 330 | Ga0099824_1005683 | 3300006942 | Bacteria | 17478 |
| 331 | Ga0099822_1013793 | 3300006943 | Bacteria | 9407 |
| 332 | Ga0075435_100077392 | 3300007076 | Bacteria | 2727 |
| 333 | Ga0075435_100586075 | 3300007076 | Bacteria | 967 |
| 334 | Ga0099794_10076492 | 3300007265 | Bacteria | 1645 |
| 335 | Ga0099794_10312400 | 3300007265 | Bacteria | 814 |
| 336 | Ga0099795_10060925 | 3300007788 | Bacteria | 1400 |
| 337 | Ga0105251_10015823 | 3300009011 | Bacteria | 4105 |
| 338 | Ga0105251_10149090 | 3300009011 | Bacteria | 1057 |
| 339 | Ga0105251_10209902 | 3300009011 | Bacteria | 877 |
| 340 | Ga0105250_10157669 | 3300009092 | Bacteria | 946 |
| 341 | Ga0105240_10015173 | 3300009093 | Bacteria | 10486 |
| 342 | Ga0105240_10016901 | 3300009093 | Bacteria | 9861 |
| 343 | Ga0105240_10017610 | 3300009093 | Bacteria | 9625 |
| 344 | Ga0105240_10019862 | 3300009093 | Bacteria | 8973 |
| 345 | Ga0105240_10049219 | 3300009093 | Bacteria | 5321 |
| 346 | Ga0105240_10072796 | 3300009093 | Bacteria | 4246 |
| 347 | Ga0105240_10123477 | 3300009093 | Bacteria | 3115 |
| 348 | Ga0105240_10265587 | 3300009093 | Bacteria | 1978 |
| 349 | Ga0105240_10341454 | 3300009093 | Bacteria | 1701 |
| 350 | Ga0105240_10345866 | 3300009093 | Bacteria | 1688 |
| 351 | Ga0105240_11203000 | 3300009093 | Bacteria | 802 |
| 352 | Ga0111539_10244185 | 3300009094 | Bacteria | 2091 |
| 353 | Ga0111539_10534433 | 3300009094 | Bacteria | 1366 |
| 354 | Ga0111539_10802764 | 3300009094 | Bacteria | 1095 |
| 355 | Ga0105245_10302373 | 3300009098 | Bacteria | 1570 |
| 356 | Ga0105245_10313949 | 3300009098 | Bacteria | 1542 |
| 357 | Ga0105245_10384846 | 3300009098 | Bacteria | 1398 |
| 358 | Ga0105245_10472113 | 3300009098 | Bacteria | 1266 |
| 359 | Ga0105245_10692076 | 3300009098 | Bacteria | 1052 |
| 360 | Ga0105245_11015724 | 3300009098 | Bacteria | 874 |
| 361 | Ga0105247_10003046 | 3300009101 | Bacteria | 11095 |
| 362 | Ga0105247_10060680 | 3300009101 | Bacteria | 2344 |
| 363 | Ga0105247_10072474 | 3300009101 | Bacteria | 2156 |
| 364 | Ga0105247_10118791 | 3300009101 | Bacteria | 1711 |
| 365 | Ga0105247_10171901 | 3300009101 | Bacteria | 1441 |
| 366 | Ga0105247_10199851 | 3300009101 | Bacteria | 1342 |
| 367 | Ga0114129_10225224 | 3300009147 | Bacteria | 2528 |
| 368 | Ga0114129_10269761 | 3300009147 | Bacteria | 2277 |
| 369 | Ga0105243_10007575 | 3300009148 | Bacteria | 8341 |
| 370 | Ga0105243_10310621 | 3300009148 | Bacteria | 1432 |
| 371 | Ga0105243_10537457 | 3300009148 | Bacteria | 1114 |
| 372 | Ga0105243_10695000 | 3300009148 | Bacteria | 991 |
| 373 | Ga0105243_11393614 | 3300009148 | Bacteria | 721 |
| 374 | Ga0105241_10001143 | 3300009174 | Bacteria | 20210 |
| 375 | Ga0105241_10013826 | 3300009174 | Bacteria | 5912 |
| 376 | Ga0105241_10328334 | 3300009174 | Bacteria | 1321 |
| 377 | Ga0105241_10509531 | 3300009174 | Bacteria | 1074 |
| 378 | Ga0105242_10007065 | 3300009176 | Bacteria | 8672 |
| 379 | Ga0105248_10002357 | 3300009177 | Bacteria | 20976 |
| 380 | Ga0105248_10032818 | 3300009177 | Bacteria | 5801 |
| 381 | Ga0105248_10178376 | 3300009177 | Bacteria | 2394 |
| 382 | Ga0105248_10828473 | 3300009177 | Bacteria | 1044 |
| 383 | Ga0105248_10855381 | 3300009177 | Bacteria | 1027 |
| 384 | Ga0105248_11035806 | 3300009177 | Bacteria | 927 |
| 385 | Ga0105237_10001334 | 3300009545 | Bacteria | 32733 |
| 386 | Ga0105237_10026647 | 3300009545 | Bacteria | 5908 |
| 387 | Ga0105237_10100286 | 3300009545 | Bacteria | 2887 |
| 388 | Ga0105237_10103552 | 3300009545 | Bacteria | 2838 |
| 389 | Ga0105237_10457944 | 3300009545 | Bacteria | 1281 |
| 390 | Ga0105237_10536359 | 3300009545 | Bacteria | 1177 |
| 391 | Ga0105237_10547600 | 3300009545 | Bacteria | 1164 |
| 392 | Ga0105237_11176851 | 3300009545 | Bacteria | 773 |
| 393 | Ga0105238_10011329 | 3300009551 | Bacteria | 8971 |
| 394 | Ga0105238_10012083 | 3300009551 | Bacteria | 8702 |
| 395 | Ga0105238_10032652 | 3300009551 | Bacteria | 5297 |
| 396 | Ga0105238_10046062 | 3300009551 | Bacteria | 4403 |
| 397 | Ga0105238_10102208 | 3300009551 | Bacteria | 2848 |
| 398 | Ga0105238_10407505 | 3300009551 | Bacteria | 1353 |
| 399 | Ga0105238_10639926 | 3300009551 | Bacteria | 1073 |
| 400 | Ga0105238_10677922 | 3300009551 | Bacteria | 1042 |
| 401 | Ga0105238_10705670 | 3300009551 | Bacteria | 1021 |
| 402 | Ga0105238_10797032 | 3300009551 | Bacteria | 960 |
| 403 | Ga0105238_11542459 | 3300009551 | Bacteria | 694 |
| 404 | Ga0105249_10926303 | 3300009553 | Bacteria | 939 |
| 405 | Ga0105249_11081794 | 3300009553 | Bacteria | 872 |
| 406 | Ga0105249_11313091 | 3300009553 | Bacteria | 795 |
| 407 | Ga0105249_11444651 | 3300009553 | Bacteria | 760 |
| 408 | Ga0105239_10016313 | 3300010375 | Bacteria | 8213 |
| 409 | Ga0105239_10017529 | 3300010375 | Bacteria | 7920 |
| 410 | Ga0105239_10115903 | 3300010375 | Bacteria | 2972 |
| 411 | Ga0105239_10741515 | 3300010375 | Bacteria | 1124 |
| 412 | Ga0105239_10765029 | 3300010375 | Bacteria | 1106 |
| 413 | Ga0105239_10804435 | 3300010375 | Bacteria | 1077 |
| 414 | Ga0105246_10001629 | 3300011119 | Bacteria | 13361 |
| 415 | Ga0105246_10042500 | 3300011119 | Bacteria | 3079 |
| 416 | Ga0105246_10212883 | 3300011119 | Bacteria | 1510 |
| 417 | Ga0105246_10227291 | 3300011119 | Bacteria | 1467 |
| 418 | Ga0157373_10011907 | 3300013100 | Bacteria | 6390 |
| 419 | Ga0157373_10025406 | 3300013100 | Bacteria | 4285 |
| 420 | Ga0157373_10169117 | 3300013100 | Bacteria | 1538 |
| 421 | Ga0157371_10035502 | 3300013102 | Bacteria | 3572 |
| 422 | Ga0157371_10057815 | 3300013102 | Bacteria | 2750 |
| 423 | Ga0157370_10136894 | 3300013104 | Bacteria | 2282 |
| 424 | Ga0157370_10792600 | 3300013104 | Bacteria | 862 |
| 425 | Ga0157370_11081769 | 3300013104 | Bacteria | 725 |
| 426 | Ga0157369_10047474 | 3300013105 | Bacteria | 4661 |
| 427 | Ga0157369_10898916 | 3300013105 | Bacteria | 908 |
| 428 | Ga0157374_10011043 | 3300013296 | Bacteria | 7801 |
| 429 | Ga0157374_10083007 | 3300013296 | Bacteria | 3044 |
| 430 | Ga0157374_10158941 | 3300013296 | Bacteria | 2201 |
| 431 | Ga0157374_10875427 | 3300013296 | Bacteria | 915 |
| 432 | Ga0157374_11003444 | 3300013296 | Bacteria | 854 |
| 433 | Ga0157378_10007996 | 3300013297 | Bacteria | 9232 |
| 434 | Ga0157378_10016489 | 3300013297 | Bacteria | 6472 |
| 435 | Ga0157378_10408742 | 3300013297 | Bacteria | 1339 |
| 436 | Ga0157378_10519232 | 3300013297 | Bacteria | 1192 |
| 437 | Ga0157378_10673291 | 3300013297 | Bacteria | 1052 |
| 438 | Ga0157378_11455185 | 3300013297 | Bacteria | 729 |
| 439 | Ga0163162_10013742 | 3300013306 | Bacteria | 7906 |
| 440 | Ga0163162_10015427 | 3300013306 | Bacteria | 7466 |
| 441 | Ga0163162_10188128 | 3300013306 | Bacteria | 2192 |
| 442 | Ga0163162_10688856 | 3300013306 | Bacteria | 1144 |
| 443 | Ga0163162_10690929 | 3300013306 | Bacteria | 1142 |
| 444 | Ga0163162_10712948 | 3300013306 | Bacteria | 1124 |
| 445 | Ga0163162_11058342 | 3300013306 | Bacteria | 918 |
| 446 | Ga0157372_10007909 | 3300013307 | Bacteria | 11302 |
| 447 | Ga0157372_10048129 | 3300013307 | Bacteria | 4739 |
| 448 | Ga0157372_10415726 | 3300013307 | Bacteria | 1567 |
| 449 | Ga0157372_10619947 | 3300013307 | Bacteria | 1261 |
| 450 | Ga0157372_11449267 | 3300013307 | Bacteria | 791 |
| 451 | Ga0157375_10005712 | 3300013308 | Bacteria | 10823 |
| 452 | Ga0157375_10042423 | 3300013308 | Bacteria | 4404 |
| 453 | Ga0157375_10180966 | 3300013308 | Bacteria | 2259 |
| 454 | Ga0157375_10631181 | 3300013308 | Bacteria | 1229 |
| 455 | Ga0157375_10951432 | 3300013308 | Bacteria | 1001 |
| 456 | Ga0157375_11165823 | 3300013308 | Bacteria | 903 |
| 457 | Ga0157375_11582129 | 3300013308 | Bacteria | 775 |
| 458 | Ga0163163_10027564 | 3300014325 | Bacteria | 5443 |
| 459 | Ga0163163_10379302 | 3300014325 | Bacteria | 1471 |
| 460 | Ga0163163_10426741 | 3300014325 | Bacteria | 1385 |
| 461 | Ga0163163_10479102 | 3300014325 | Bacteria | 1305 |
| 462 | Ga0157380_10002785 | 3300014326 | Bacteria | 11881 |
| 463 | Ga0157380_10905341 | 3300014326 | Bacteria | 909 |
| 464 | Ga0157380_11436177 | 3300014326 | Bacteria | 741 |
| 465 | Ga0157380_11437975 | 3300014326 | Bacteria | 741 |
| 466 | Ga0182008_10050394 | 3300014497 | Bacteria | 2067 |
| 467 | Ga0182008_10216401 | 3300014497 | Bacteria | 979 |
| 468 | Ga0157377_10019216 | 3300014745 | Bacteria | 3567 |
| 469 | Ga0157377_10260049 | 3300014745 | Bacteria | 1129 |
| 470 | Ga0157377_10382545 | 3300014745 | Bacteria | 953 |
| 471 | Ga0157379_10005941 | 3300014968 | Bacteria | 10513 |
| 472 | Ga0157379_10387892 | 3300014968 | Bacteria | 1282 |
| 473 | Ga0157379_10790933 | 3300014968 | Bacteria | 895 |
| 474 | Ga0157379_10883197 | 3300014968 | Bacteria | 847 |
| 475 | Ga0157376_10001343 | 3300014969 | Bacteria | 16214 |
| 476 | Ga0157376_10065591 | 3300014969 | Bacteria | 3067 |
| 477 | Ga0157376_10069593 | 3300014969 | Bacteria | 2984 |
| 478 | Ga0157376_10304886 | 3300014969 | Bacteria | 1509 |
| 479 | Ga0157376_10795479 | 3300014969 | Bacteria | 958 |
| 480 | Ga0182006_1122416 | 3300015261 | Bacteria | 902 |
| 481 | Ga0182007_10055674 | 3300015262 | Bacteria | 1300 |
| 482 | Ga0163161_10002609 | 3300017792 | Bacteria | 12840 |
| 483 | Ga0163161_10346132 | 3300017792 | Bacteria | 1180 |
| 484 | Ga0163161_10569256 | 3300017792 | Bacteria | 931 |
| 485 | Ga0206353_11667404 | 3300020082 | Bacteria | 838 |
| 486 | Ga0214544_1015907 | 3300021320 | Bacteria | 7560 |
| 487 | Ga0214542_1014952 | 3300021321 | Bacteria | 8377 |
| 488 | Ga0214545_1015411 | 3300021324 | Bacteria | 8377 |
| 489 | Ga0214543_1018060 | 3300021327 | Bacteria | 6645 |
| 490 | Ga0213873_10003651 | 3300021358 | Bacteria | 2797 |
| 491 | Ga0213872_10204589 | 3300021361 | Bacteria | 845 |
| 492 | Ga0213872_10297516 | 3300021361 | Bacteria | 671 |
| 493 | Ga0213874_10024702 | 3300021377 | Bacteria | 1688 |
| 494 | Ga0213876_10004166 | 3300021384 | Bacteria | 8112 |
| 495 | Ga0213876_10024133 | 3300021384 | Bacteria | 3210 |
| 496 | Ga0213876_10057134 | 3300021384 | Bacteria | 2060 |
| 497 | Ga0213875_10093645 | 3300021388 | Bacteria | 1401 |
| 498 | Ga0213875_10129808 | 3300021388 | Bacteria | 1178 |
| 499 | Ga0209563_101182 | 3300025230 | Bacteria | 7329 |
| 500 | Ga0209677_100506 | 3300025253 | Bacteria | 21824 |
| 501 | Ga0209148_1000232 | 3300025254 | Bacteria | 90923 |
| 502 | Ga0209233_1000632 | 3300025261 | Bacteria | 17550 |
| 503 | Ga0209233_1025487 | 3300025261 | Bacteria | 1462 |
| 504 | Ga0209455_1005172 | 3300025272 | Bacteria | 4096 |
| 505 | Ga0209455_1009071 | 3300025272 | Bacteria | 2641 |
| 506 | Ga0209455_1017417 | 3300025272 | Bacteria | 1507 |
| 507 | Ga0209455_1022868 | 3300025272 | Bacteria | 1182 |
| 508 | Ga0209673_1022256 | 3300025273 | Bacteria | 2191 |
| 509 | Ga0209564_1005236 | 3300025295 | Bacteria | 7502 |
| 510 | Ga0209564_1009874 | 3300025295 | Bacteria | 4475 |
| 511 | Ga0209564_1011022 | 3300025295 | Bacteria | 4093 |
| 512 | Ga0209758_1000767 | 3300025297 | Bacteria | 46198 |
| 513 | Ga0209758_1001616 | 3300025297 | Bacteria | 25709 |
| 514 | Ga0209758_1002758 | 3300025297 | Bacteria | 17211 |
| 515 | Ga0209758_1005920 | 3300025297 | Bacteria | 9092 |
| 516 | Ga0209758_1017084 | 3300025297 | Bacteria | 3640 |
| 517 | Ga0209256_1001558 | 3300025299 | Bacteria | 22669 |
| 518 | Ga0207426_1000857 | 3300025302 | Bacteria | 31897 |
| 519 | Ga0207426_1002486 | 3300025302 | Bacteria | 11695 |
| 520 | Ga0207426_1031375 | 3300025302 | Bacteria | 1734 |
| 521 | Ga0207426_1107434 | 3300025302 | Bacteria | 709 |
| 522 | Ga0209257_1025491 | 3300025304 | Bacteria | 2019 |
| 523 | Ga0207697_10022765 | 3300025315 | Bacteria | 2566 |
| 524 | Ga0207656_10001686 | 3300025321 | Bacteria | 7343 |
| 525 | Ga0207656_10097849 | 3300025321 | Bacteria | 1341 |
| 526 | Ga0207653_10012247 | 3300025885 | Bacteria | 2677 |
| 527 | Ga0207682_10076659 | 3300025893 | Bacteria | 1425 |
| 528 | Ga0207692_10000223 | 3300025898 | Bacteria | 19217 |
| 529 | Ga0207692_10001143 | 3300025898 | Bacteria | 9776 |
| 530 | Ga0207692_10034968 | 3300025898 | Bacteria | 2437 |
| 531 | Ga0207692_10055808 | 3300025898 | Bacteria | 2024 |
| 532 | Ga0207692_10384177 | 3300025898 | Bacteria | 872 |
| 533 | Ga0207692_10424076 | 3300025898 | Bacteria | 833 |
| 534 | Ga0207642_10147707 | 3300025899 | Bacteria | 1247 |
| 535 | Ga0207710_10036155 | 3300025900 | Bacteria | 2176 |
| 536 | Ga0207710_10047017 | 3300025900 | Bacteria | 1928 |
| 537 | Ga0207710_10109102 | 3300025900 | Bacteria | 1313 |
| 538 | Ga0207710_10180346 | 3300025900 | Bacteria | 1036 |
| 539 | Ga0207688_10101169 | 3300025901 | Bacteria | 1664 |
| 540 | Ga0207688_10119246 | 3300025901 | Bacteria | 1538 |
| 541 | Ga0207688_10177490 | 3300025901 | Bacteria | 1269 |
| 542 | Ga0207688_10204329 | 3300025901 | Bacteria | 1185 |
| 543 | Ga0207647_10001818 | 3300025904 | Bacteria | 16371 |
| 544 | Ga0207647_10224257 | 3300025904 | Bacteria | 1082 |
| 545 | Ga0207647_10385368 | 3300025904 | Bacteria | 791 |
| 546 | Ga0207685_10016503 | 3300025905 | Bacteria | 2366 |
| 547 | Ga0207685_10128218 | 3300025905 | Bacteria | 1123 |
| 548 | Ga0207699_10001787 | 3300025906 | Bacteria | 10119 |
| 549 | Ga0207699_10006491 | 3300025906 | Bacteria | 5669 |
| 550 | Ga0207699_10012972 | 3300025906 | Bacteria | 4250 |
| 551 | Ga0207699_10067557 | 3300025906 | Bacteria | 2173 |
| 552 | Ga0207699_10272797 | 3300025906 | Bacteria | 1173 |
| 553 | Ga0207699_10424397 | 3300025906 | Bacteria | 950 |
| 554 | Ga0207699_10500916 | 3300025906 | Bacteria | 877 |
| 555 | Ga0207645_10016248 | 3300025907 | Bacteria | 4929 |
| 556 | Ga0207645_10265697 | 3300025907 | Bacteria | 1137 |
| 557 | Ga0207645_10324107 | 3300025907 | Bacteria | 1028 |
| 558 | Ga0207643_10049899 | 3300025908 | Bacteria | 2372 |
| 559 | Ga0207705_10032338 | 3300025909 | Bacteria | 3738 |
| 560 | Ga0207705_10131136 | 3300025909 | Bacteria | 1866 |
| 561 | Ga0207705_10275307 | 3300025909 | Bacteria | 1287 |
| 562 | Ga0207705_10389925 | 3300025909 | Bacteria | 1076 |
| 563 | Ga0207684_10225898 | 3300025910 | Bacteria | 1616 |
| 564 | Ga0207654_10000510 | 3300025911 | Bacteria | 22226 |
| 565 | Ga0207654_10004655 | 3300025911 | Bacteria | 6936 |
| 566 | Ga0207654_10275945 | 3300025911 | Bacteria | 1136 |
| 567 | Ga0207654_10350079 | 3300025911 | Bacteria | 1017 |
| 568 | Ga0207707_10001868 | 3300025912 | Bacteria | 19245 |
| 569 | Ga0207707_10034179 | 3300025912 | Bacteria | 4448 |
| 570 | Ga0207707_10044573 | 3300025912 | Bacteria | 3867 |
| 571 | Ga0207707_10108163 | 3300025912 | Bacteria | 2431 |
| 572 | Ga0207707_10253676 | 3300025912 | Bacteria | 1528 |
| 573 | Ga0207707_10393532 | 3300025912 | Bacteria | 1190 |
| 574 | Ga0207695_10000123 | 3300025913 | Bacteria | 232059 |
| 575 | Ga0207695_10000579 | 3300025913 | Bacteria | 74637 |
| 576 | Ga0207695_10019584 | 3300025913 | Bacteria | 7787 |
| 577 | Ga0207695_10037202 | 3300025913 | Bacteria | 5253 |
| 578 | Ga0207695_10101893 | 3300025913 | Bacteria | 2865 |
| 579 | Ga0207695_10111316 | 3300025913 | Bacteria | 2717 |
| 580 | Ga0207695_10166164 | 3300025913 | Bacteria | 2135 |
| 581 | Ga0207695_10357479 | 3300025913 | Bacteria | 1347 |
| 582 | Ga0207695_10372640 | 3300025913 | Bacteria | 1314 |
| 583 | Ga0207671_10003497 | 3300025914 | Bacteria | 15609 |
| 584 | Ga0207671_10044835 | 3300025914 | Bacteria | 3270 |
| 585 | Ga0207671_10055354 | 3300025914 | Bacteria | 2939 |
| 586 | Ga0207671_10154406 | 3300025914 | Bacteria | 1775 |
| 587 | Ga0207671_10190013 | 3300025914 | Bacteria | 1601 |
| 588 | Ga0207671_10197839 | 3300025914 | Bacteria | 1569 |
| 589 | Ga0207671_10240482 | 3300025914 | Bacteria | 1422 |
| 590 | Ga0207671_10292388 | 3300025914 | Bacteria | 1286 |
| 591 | Ga0207671_10625174 | 3300025914 | Bacteria | 858 |
| 592 | Ga0207693_10002297 | 3300025915 | Bacteria | 16613 |
| 593 | Ga0207693_10015263 | 3300025915 | Bacteria | 6165 |
| 594 | Ga0207693_10046312 | 3300025915 | Bacteria | 3416 |
| 595 | Ga0207693_10212343 | 3300025915 | Bacteria | 1521 |
| 596 | Ga0207693_10344040 | 3300025915 | Bacteria | 1167 |
| 597 | Ga0207693_10555593 | 3300025915 | Bacteria | 895 |
| 598 | Ga0207663_10000540 | 3300025916 | Bacteria | 16619 |
| 599 | Ga0207663_10002303 | 3300025916 | Bacteria | 9149 |
| 600 | Ga0207663_10004575 | 3300025916 | Bacteria | 6895 |
| 601 | Ga0207663_10073312 | 3300025916 | Bacteria | 2215 |
| 602 | Ga0207663_10089460 | 3300025916 | Bacteria | 2039 |
| 603 | Ga0207663_10553801 | 3300025916 | Bacteria | 899 |
| 604 | Ga0207660_10028347 | 3300025917 | Bacteria | 3829 |
| 605 | Ga0207660_10206895 | 3300025917 | Bacteria | 1535 |
| 606 | Ga0207660_10502474 | 3300025917 | Bacteria | 984 |
| 607 | Ga0207662_10009750 | 3300025918 | Bacteria | 5296 |
| 608 | Ga0207657_10000793 | 3300025919 | Bacteria | 33507 |
| 609 | Ga0207657_10005801 | 3300025919 | Bacteria | 12866 |
| 610 | Ga0207657_10198897 | 3300025919 | Bacteria | 1613 |
| 611 | Ga0207657_10250812 | 3300025919 | Bacteria | 1411 |
| 612 | Ga0207657_10319814 | 3300025919 | Bacteria | 1227 |
| 613 | Ga0207657_10367847 | 3300025919 | Bacteria | 1133 |
| 614 | Ga0207649_10002671 | 3300025920 | Bacteria | 9889 |
| 615 | Ga0207649_10136312 | 3300025920 | Bacteria | 1674 |
| 616 | Ga0207649_10644762 | 3300025920 | Bacteria | 818 |
| 617 | Ga0207652_10025143 | 3300025921 | Bacteria | 4948 |
| 618 | Ga0207652_10319679 | 3300025921 | Bacteria | 1401 |
| 619 | Ga0207652_10536186 | 3300025921 | Bacteria | 1052 |
| 620 | Ga0207681_10024728 | 3300025923 | Bacteria | 3856 |
| 621 | Ga0207681_10370397 | 3300025923 | Bacteria | 1151 |
| 622 | Ga0207694_10000263 | 3300025924 | Bacteria | 50099 |
| 623 | Ga0207694_10036200 | 3300025924 | Bacteria | 3787 |
| 624 | Ga0207694_10088782 | 3300025924 | Bacteria | 2437 |
| 625 | Ga0207694_10164360 | 3300025924 | Bacteria | 1794 |
| 626 | Ga0207694_10190392 | 3300025924 | Bacteria | 1666 |
| 627 | Ga0207694_10213078 | 3300025924 | Bacteria | 1574 |
| 628 | Ga0207694_10236169 | 3300025924 | Bacteria | 1493 |
| 629 | Ga0207650_10027650 | 3300025925 | Bacteria | 4061 |
| 630 | Ga0207650_10222592 | 3300025925 | Bacteria | 1519 |
| 631 | Ga0207650_10232090 | 3300025925 | Bacteria | 1489 |
| 632 | Ga0207650_10572214 | 3300025925 | Bacteria | 948 |
| 633 | Ga0207659_10748400 | 3300025926 | Bacteria | 838 |
| 634 | Ga0207687_10023005 | 3300025927 | Bacteria | 4150 |
| 635 | Ga0207687_10045852 | 3300025927 | Bacteria | 3024 |
| 636 | Ga0207687_10055506 | 3300025927 | Bacteria | 2776 |
| 637 | Ga0207687_10147432 | 3300025927 | Bacteria | 1792 |
| 638 | Ga0207687_10389201 | 3300025927 | Bacteria | 1144 |
| 639 | Ga0207700_10078973 | 3300025928 | Bacteria | 2561 |
| 640 | Ga0207700_10096260 | 3300025928 | Bacteria | 2350 |
| 641 | Ga0207700_10226285 | 3300025928 | Bacteria | 1588 |
| 642 | Ga0207700_10301453 | 3300025928 | Bacteria | 1384 |
| 643 | Ga0207700_10614852 | 3300025928 | Bacteria | 967 |
| 644 | Ga0207664_10017743 | 3300025929 | Bacteria | 5226 |
| 645 | Ga0207664_10026417 | 3300025929 | Bacteria | 4388 |
| 646 | Ga0207664_10031016 | 3300025929 | Bacteria | 4086 |
| 647 | Ga0207664_10060987 | 3300025929 | Bacteria | 3008 |
| 648 | Ga0207664_10131568 | 3300025929 | Bacteria | 2106 |
| 649 | Ga0207664_10269169 | 3300025929 | Bacteria | 1492 |
| 650 | Ga0207664_10289038 | 3300025929 | Bacteria | 1440 |
| 651 | Ga0207664_10338309 | 3300025929 | Bacteria | 1330 |
| 652 | Ga0207664_10718540 | 3300025929 | Bacteria | 898 |
| 653 | Ga0207644_10056924 | 3300025931 | Bacteria | 2822 |
| 654 | Ga0207644_10192660 | 3300025931 | Bacteria | 1603 |
| 655 | Ga0207644_10385623 | 3300025931 | Bacteria | 1143 |
| 656 | Ga0207690_10006770 | 3300025932 | Bacteria | 6793 |
| 657 | Ga0207690_10114952 | 3300025932 | Bacteria | 1944 |
| 658 | Ga0207690_10338158 | 3300025932 | Bacteria | 1187 |
| 659 | Ga0207706_10000771 | 3300025933 | Bacteria | 33246 |
| 660 | Ga0207706_10224825 | 3300025933 | Bacteria | 1643 |
| 661 | Ga0207706_10257539 | 3300025933 | Bacteria | 1523 |
| 662 | Ga0207706_10704925 | 3300025933 | Bacteria | 862 |
| 663 | Ga0207686_10008730 | 3300025934 | Bacteria | 5474 |
| 664 | Ga0207686_10322178 | 3300025934 | Bacteria | 1155 |
| 665 | Ga0207686_10583954 | 3300025934 | Bacteria | 877 |
| 666 | Ga0207709_10012176 | 3300025935 | Bacteria | 4740 |
| 667 | Ga0207709_10199369 | 3300025935 | Bacteria | 1428 |
| 668 | Ga0207709_10214117 | 3300025935 | Bacteria | 1385 |
| 669 | Ga0207709_10286329 | 3300025935 | Bacteria | 1219 |
| 670 | Ga0207709_10786311 | 3300025935 | Bacteria | 767 |
| 671 | Ga0207709_10828057 | 3300025935 | Bacteria | 749 |
| 672 | Ga0207670_10008051 | 3300025936 | Bacteria | 5926 |
| 673 | Ga0207669_10006537 | 3300025937 | Bacteria | 5338 |
| 674 | Ga0207669_10172996 | 3300025937 | Bacteria | 1539 |
| 675 | Ga0207704_10005473 | 3300025938 | Bacteria | 5855 |
| 676 | Ga0207704_10400111 | 3300025938 | Bacteria | 1083 |
| 677 | Ga0207665_10002391 | 3300025939 | Bacteria | 12680 |
| 678 | Ga0207665_10003603 | 3300025939 | Bacteria | 10343 |
| 679 | Ga0207665_10006864 | 3300025939 | Bacteria | 7536 |
| 680 | Ga0207665_10163384 | 3300025939 | Bacteria | 1603 |
| 681 | Ga0207665_10220260 | 3300025939 | Bacteria | 1390 |
| 682 | Ga0207665_10244178 | 3300025939 | Bacteria | 1324 |
| 683 | Ga0207665_10551696 | 3300025939 | Bacteria | 895 |
| 684 | Ga0207691_10318069 | 3300025940 | Bacteria | 1335 |
| 685 | Ga0207691_10367091 | 3300025940 | Bacteria | 1230 |
| 686 | Ga0207691_10660466 | 3300025940 | Bacteria | 883 |
| 687 | Ga0207711_10021306 | 3300025941 | Bacteria | 5415 |
| 688 | Ga0207711_10083708 | 3300025941 | Bacteria | 2791 |
| 689 | Ga0207711_10177204 | 3300025941 | Bacteria | 1937 |
| 690 | Ga0207711_10392520 | 3300025941 | Bacteria | 1289 |
| 691 | Ga0207711_10464151 | 3300025941 | Bacteria | 1179 |
| 692 | Ga0207711_11048096 | 3300025941 | Bacteria | 756 |
| 693 | Ga0207689_10050310 | 3300025942 | Bacteria | 3436 |
| 694 | Ga0207689_10202619 | 3300025942 | Bacteria | 1638 |
| 695 | Ga0207689_10209708 | 3300025942 | Bacteria | 1609 |
| 696 | Ga0207661_10002076 | 3300025944 | Bacteria | 13777 |
| 697 | Ga0207661_10127222 | 3300025944 | Bacteria | 2177 |
| 698 | Ga0207661_10203894 | 3300025944 | Bacteria | 1740 |
| 699 | Ga0207661_10234839 | 3300025944 | Bacteria | 1625 |
| 700 | Ga0207679_10022137 | 3300025945 | Bacteria | 4323 |
| 701 | Ga0207679_10192661 | 3300025945 | Bacteria | 1696 |
| 702 | Ga0207679_10237151 | 3300025945 | Bacteria | 1543 |
| 703 | Ga0207679_10736037 | 3300025945 | Bacteria | 896 |
| 704 | Ga0207667_10023490 | 3300025949 | Bacteria | 6789 |
| 705 | Ga0207667_10033130 | 3300025949 | Bacteria | 5558 |
| 706 | Ga0207667_10118343 | 3300025949 | Bacteria | 2730 |
| 707 | Ga0207667_10323347 | 3300025949 | Bacteria | 1575 |
| 708 | Ga0207667_10852603 | 3300025949 | Bacteria | 905 |
| 709 | Ga0207651_10198212 | 3300025960 | Bacteria | 1607 |
| 710 | Ga0207651_10334754 | 3300025960 | Bacteria | 1270 |
| 711 | Ga0207651_10401506 | 3300025960 | Bacteria | 1166 |
| 712 | Ga0207651_10409528 | 3300025960 | Bacteria | 1155 |
| 713 | Ga0207651_10580972 | 3300025960 | Bacteria | 977 |
| 714 | Ga0207712_10007876 | 3300025961 | Bacteria | 6735 |
| 715 | Ga0207712_10310748 | 3300025961 | Bacteria | 1297 |
| 716 | Ga0207712_10401138 | 3300025961 | Bacteria | 1153 |
| 717 | Ga0207712_10689005 | 3300025961 | Bacteria | 891 |
| 718 | Ga0207712_10932602 | 3300025961 | Bacteria | 768 |
| 719 | Ga0207668_10023245 | 3300025972 | Bacteria | 3980 |
| 720 | Ga0207668_10108421 | 3300025972 | Bacteria | 2078 |
| 721 | Ga0207668_10130765 | 3300025972 | Bacteria | 1916 |
| 722 | Ga0207668_10416243 | 3300025972 | Bacteria | 1140 |
| 723 | Ga0207640_10003248 | 3300025981 | Bacteria | 8759 |
| 724 | Ga0207640_10040096 | 3300025981 | Bacteria | 2968 |
| 725 | Ga0207640_10176417 | 3300025981 | Bacteria | 1598 |
| 726 | Ga0207658_10106963 | 3300025986 | Bacteria | 2203 |
| 727 | Ga0207677_10096293 | 3300026023 | Bacteria | 2165 |
| 728 | Ga0207677_10330580 | 3300026023 | Bacteria | 1270 |
| 729 | Ga0207677_10393546 | 3300026023 | Bacteria | 1173 |
| 730 | Ga0207677_10592288 | 3300026023 | Bacteria | 972 |
| 731 | Ga0207677_10809288 | 3300026023 | Bacteria | 839 |
| 732 | Ga0207703_10129122 | 3300026035 | Bacteria | 2180 |
| 733 | Ga0207703_10543739 | 3300026035 | Bacteria | 1095 |
| 734 | Ga0207703_10651135 | 3300026035 | Bacteria | 999 |
| 735 | Ga0207639_10043322 | 3300026041 | Bacteria | 3378 |
| 736 | Ga0207639_10063940 | 3300026041 | Bacteria | 2851 |
| 737 | Ga0207639_10239221 | 3300026041 | Bacteria | 1577 |
| 738 | Ga0207639_10496628 | 3300026041 | Bacteria | 1114 |
| 739 | Ga0207639_10509563 | 3300026041 | Bacteria | 1101 |
| 740 | Ga0207639_10751207 | 3300026041 | Bacteria | 907 |
| 741 | Ga0207678_10001022 | 3300026067 | Bacteria | 25519 |
| 742 | Ga0207678_10015763 | 3300026067 | Bacteria | 6643 |
| 743 | Ga0207678_10027423 | 3300026067 | Bacteria | 4968 |
| 744 | Ga0207678_10057664 | 3300026067 | Bacteria | 3342 |
| 745 | Ga0207678_10143956 | 3300026067 | Bacteria | 2034 |
| 746 | Ga0207678_10178387 | 3300026067 | Bacteria | 1814 |
| 747 | Ga0207678_10281286 | 3300026067 | Bacteria | 1428 |
| 748 | Ga0207678_10503264 | 3300026067 | Bacteria | 1056 |
| 749 | Ga0207678_10571664 | 3300026067 | Bacteria | 990 |
| 750 | Ga0207708_10004422 | 3300026075 | Bacteria | 10360 |
| 751 | Ga0207708_10147045 | 3300026075 | Bacteria | 1853 |
| 752 | Ga0207708_10177210 | 3300026075 | Bacteria | 1691 |
| 753 | Ga0207708_10281993 | 3300026075 | Bacteria | 1347 |
| 754 | Ga0207708_10548000 | 3300026075 | Bacteria | 975 |
| 755 | Ga0207708_10550264 | 3300026075 | Bacteria | 973 |
| 756 | Ga0207702_10000003 | 3300026078 | Bacteria | 434196 |
| 757 | Ga0207702_10000014 | 3300026078 | Bacteria | 253304 |
| 758 | Ga0207702_10188227 | 3300026078 | Bacteria | 1905 |
| 759 | Ga0207702_10283384 | 3300026078 | Bacteria | 1567 |
| 760 | Ga0207702_10791535 | 3300026078 | Bacteria | 937 |
| 761 | Ga0207702_11079307 | 3300026078 | Bacteria | 797 |
| 762 | Ga0207641_10036007 | 3300026088 | Bacteria | 4129 |
| 763 | Ga0207641_10157037 | 3300026088 | Bacteria | 2065 |
| 764 | Ga0207641_10249677 | 3300026088 | Bacteria | 1656 |
| 765 | Ga0207641_11091183 | 3300026088 | Bacteria | 796 |
| 766 | Ga0207648_10271011 | 3300026089 | Bacteria | 1516 |
| 767 | Ga0207648_10854767 | 3300026089 | Bacteria | 849 |
| 768 | Ga0207648_10986344 | 3300026089 | Bacteria | 789 |
| 769 | Ga0207648_11118208 | 3300026089 | Bacteria | 739 |
| 770 | Ga0207676_10011184 | 3300026095 | Bacteria | 6407 |
| 771 | Ga0207676_10345408 | 3300026095 | Bacteria | 1374 |
| 772 | Ga0207674_10004073 | 3300026116 | Bacteria | 17710 |
| 773 | Ga0207674_10043484 | 3300026116 | Bacteria | 4632 |
| 774 | Ga0207674_10102019 | 3300026116 | Bacteria | 2849 |
| 775 | Ga0207674_10159346 | 3300026116 | Bacteria | 2212 |
| 776 | Ga0207674_10175795 | 3300026116 | Bacteria | 2093 |
| 777 | Ga0207674_10244427 | 3300026116 | Bacteria | 1742 |
| 778 | Ga0207674_10279899 | 3300026116 | Bacteria | 1616 |
| 779 | Ga0207674_10430329 | 3300026116 | Bacteria | 1275 |
| 780 | Ga0207675_100000706 | 3300026118 | Bacteria | 33090 |
| 781 | Ga0207675_100100025 | 3300026118 | Bacteria | 2731 |
| 782 | Ga0207675_100182572 | 3300026118 | Bacteria | 2009 |
| 783 | Ga0207675_100317133 | 3300026118 | Bacteria | 1521 |
| 784 | Ga0207675_100527653 | 3300026118 | Bacteria | 1178 |
| 785 | Ga0207675_100618036 | 3300026118 | Bacteria | 1088 |
| 786 | Ga0207683_10001159 | 3300026121 | Bacteria | 23967 |
| 787 | Ga0207683_10211625 | 3300026121 | Bacteria | 1765 |
| 788 | Ga0207683_10235957 | 3300026121 | Bacteria | 1668 |
| 789 | Ga0207683_10282561 | 3300026121 | Bacteria | 1517 |
| 790 | Ga0207683_10282620 | 3300026121 | Bacteria | 1516 |
| 791 | Ga0207683_11108069 | 3300026121 | Bacteria | 734 |
| 792 | Ga0207698_10010360 | 3300026142 | Bacteria | 5983 |
| 793 | Ga0207698_10010611 | 3300026142 | Bacteria | 5933 |
| 794 | Ga0207698_10082749 | 3300026142 | Bacteria | 2595 |
| 795 | Ga0207698_10180046 | 3300026142 | Bacteria | 1871 |
| 796 | Ga0207698_10292703 | 3300026142 | Bacteria | 1512 |
| 797 | Ga0207698_10901048 | 3300026142 | Bacteria | 892 |
| 798 | Ga0207698_11043676 | 3300026142 | Bacteria | 829 |
| 799 | Ga0207698_11131066 | 3300026142 | Bacteria | 796 |
| 800 | Ga0209389_1000019 | 3300027296 | Bacteria | 172067 |
| 801 | Ga0209389_1000070 | 3300027296 | Bacteria | 97498 |
| 802 | Ga0209589_1000007 | 3300027357 | Bacteria | 425699 |
| 803 | Ga0209589_1000420 | 3300027357 | Bacteria | 58471 |
| 804 | Ga0209489_100008 | 3300027361 | Bacteria | 425699 |
| 805 | Ga0209489_100033 | 3300027361 | Bacteria | 172166 |
| 806 | Ga0209489_100196 | 3300027361 | Bacteria | 97498 |
| 807 | Ga0209700_100009 | 3300027363 | Bacteria | 425699 |
| 808 | Ga0209700_100012 | 3300027363 | Bacteria | 357892 |
| 809 | Ga0209179_1002798 | 3300027512 | Bacteria | 2419 |
| 810 | Ga0209813_10008076 | 3300027866 | Bacteria | 2648 |
| 811 | Ga0209813_10062842 | 3300027866 | Bacteria | 1189 |
| 812 | Ga0209813_10063564 | 3300027866 | Bacteria | 1184 |
| 813 | Ga0207428_10027694 | 3300027907 | Bacteria | 4717 |
| 814 | Ga0207428_10112328 | 3300027907 | Bacteria | 2096 |
| 815 | Ga0268266_10041188 | 3300028379 | Bacteria | 3939 |
| 816 | Ga0268266_10047340 | 3300028379 | Bacteria | 3683 |
| 817 | Ga0268266_10109096 | 3300028379 | Bacteria | 2450 |
| 818 | Ga0268266_10130708 | 3300028379 | Bacteria | 2245 |
| 819 | Ga0268266_10204902 | 3300028379 | Bacteria | 1807 |
| 820 | Ga0268266_10270663 | 3300028379 | Bacteria | 1577 |
| 821 | Ga0268266_10273924 | 3300028379 | Bacteria | 1567 |
| 822 | Ga0268266_10825403 | 3300028379 | Bacteria | 896 |
| 823 | Ga0268266_10842950 | 3300028379 | Bacteria | 886 |
| 824 | Ga0268265_10005729 | 3300028380 | Bacteria | 8482 |
| 825 | Ga0268265_10061049 | 3300028380 | Bacteria | 2891 |
| 826 | Ga0268265_10362921 | 3300028380 | Bacteria | 1326 |
| 827 | Ga0268265_10429922 | 3300028380 | Bacteria | 1228 |
| 828 | Ga0268264_10000042 | 3300028381 | Bacteria | 372069 |
| 829 | Ga0268264_10007308 | 3300028381 | Bacteria | 9237 |
| 830 | Ga0268264_10174382 | 3300028381 | Bacteria | 1947 |
| 831 | Ga0268264_10340079 | 3300028381 | Bacteria | 1425 |
| 832 | Ga0268264_10480808 | 3300028381 | Bacteria | 1208 |
| 833 | Ga0268264_10585161 | 3300028381 | Bacteria | 1098 |
| 834 | Ga0265337_1031653 | 3300028556 | Bacteria | 1569 |
| 835 | Ga0265326_10007650 | 3300028558 | Bacteria | 3300 |
| 836 | Ga0265319_1007216 | 3300028563 | Bacteria | 5030 |
| 837 | Ga0265334_10014698 | 3300028573 | Bacteria | 3260 |
| 838 | Ga0265334_10053228 | 3300028573 | Bacteria | 1546 |
| 839 | Ga0265318_10041862 | 3300028577 | Bacteria | 1739 |
| 840 | Ga0265336_10000955 | 3300028666 | Bacteria | 14518 |
| 841 | Ga0307517_10000859 | 3300028786 | Bacteria | 51881 |
| 842 | Ga0307517_10173665 | 3300028786 | Bacteria | 1410 |
| 843 | Ga0307515_10228857 | 3300028794 | Bacteria | 1657 |
| 844 | Ga0265338_10000271 | 3300028800 | Bacteria | 94819 |
| 845 | Ga0265324_10026824 | 3300029957 | Bacteria | 2037 |
| 846 | Ga0307511_10105551 | 3300030521 | Bacteria | 1822 |
| 847 | Ga0307512_10259945 | 3300030522 | Bacteria | 854 |
| 848 | Ga0265330_10033612 | 3300031235 | Bacteria | 2292 |
| 849 | Ga0265330_10035098 | 3300031235 | Bacteria | 2239 |
| 850 | Ga0265330_10058426 | 3300031235 | Bacteria | 1681 |
| 851 | Ga0265330_10101385 | 3300031235 | Bacteria | 1232 |
| 852 | Ga0265332_10153119 | 3300031238 | Bacteria | 964 |
| 853 | Ga0265328_10019645 | 3300031239 | Bacteria | 2593 |
| 854 | Ga0265325_10003254 | 3300031241 | Bacteria | 10688 |
| 855 | Ga0265340_10009546 | 3300031247 | Bacteria | 5203 |
| 856 | Ga0265339_10048328 | 3300031249 | Bacteria | 2333 |
| 857 | Ga0265331_10092909 | 3300031250 | Bacteria | 1393 |
| 858 | Ga0307509_10383663 | 3300031507 | Bacteria | 1117 |
| 859 | Ga0307408_100652976 | 3300031548 | Bacteria | 941 |
| 860 | Ga0265313_10044293 | 3300031595 | Bacteria | 2173 |
| 861 | Ga0307508_10054997 | 3300031616 | Bacteria | 3526 |
| 862 | Ga0307508_10119474 | 3300031616 | Bacteria | 2238 |
| 863 | Ga0307508_10282200 | 3300031616 | Bacteria | 1254 |
| 864 | Ga0265314_10009643 | 3300031711 | Bacteria | 8132 |
| 865 | Ga0265314_10064721 | 3300031711 | Bacteria | 2474 |
| 866 | Ga0265314_10075437 | 3300031711 | Bacteria | 2243 |
| 867 | Ga0265342_10037952 | 3300031712 | Bacteria | 2936 |
| 868 | Ga0265342_10082285 | 3300031712 | Bacteria | 1857 |
| 869 | Ga0307516_10087890 | 3300031730 | Bacteria | 2941 |
| 870 | Ga0307516_10122100 | 3300031730 | Bacteria | 2393 |
| 871 | Ga0307405_10791720 | 3300031731 | Bacteria | 793 |
| 872 | Ga0307413_10111893 | 3300031824 | Bacteria | 1829 |
| 873 | Ga0307518_10300633 | 3300031838 | Bacteria | 976 |
| 874 | Ga0307406_10102265 | 3300031901 | Bacteria | 1954 |
| 875 | Ga0307406_10719037 | 3300031901 | Bacteria | 835 |
| 876 | Ga0307409_100460083 | 3300031995 | Bacteria | 1230 |
| 877 | Ga0307416_101236979 | 3300032002 | Bacteria | 852 |
| 878 | Ga0307416_101749411 | 3300032002 | Bacteria | 726 |
| 879 | Ga0307414_10562450 | 3300032004 | Bacteria | 1018 |
| 880 | Ga0307411_10170814 | 3300032005 | Bacteria | 1639 |
| 881 | Ga0307411_10697252 | 3300032005 | Bacteria | 884 |
| 882 | Ga0307415_100036915 | 3300032126 | Bacteria | 3207 |
| 883 | Ga0307415_100564787 | 3300032126 | Bacteria | 1006 |
| 884 | Ga0307507_10008161 | 3300033179 | Bacteria | 14687 |
| 885 | Ga0307510_10052034 | 3300033180 | Bacteria | 4324 |
| 886 | Ga0307510_10317707 | 3300033180 | Bacteria | 1015 |
| 887 | Ga0373926_0054856 | 3300035083 | Bacteria | 1444 |
| 888 | Ga0373929_0043970 | 3300035085 | Bacteria | 1001 |
| 889 | Ga0373934_0010871 | 3300035086 | Bacteria | 3421 |
| 890 | Ga0373934_0023427 | 3300035086 | Bacteria | 2386 |
| 891 | Ga0373944_0005274 | 3300035089 | Bacteria | 3400 |
| 892 | Ga0373923_0016142 | 3300035111 | Bacteria | 2830 |
| 893 | Ga0373923_0026747 | 3300035111 | Bacteria | 2297 |
| 894 | Ga0373923_0038880 | 3300035111 | Bacteria | 1951 |
| 895 | Ga0373923_0179038 | 3300035111 | Bacteria | 973 |
| 896 | Ga0373936_0004114 | 3300035113 | Bacteria | 5482 |
| 897 | Ga0373936_0029726 | 3300035113 | Bacteria | 2152 |
| 898 | Ga0373936_0056647 | 3300035113 | Bacteria | 1593 |
| 899 | Ga0373936_0103635 | 3300035113 | Bacteria | 1202 |
| 900 | Ga0373939_0032006 | 3300035114 | Bacteria | 1525 |
| 901 | Ga0373941_0018567 | 3300035115 | Bacteria | 1923 |
| 902 | Ga0373941_0030648 | 3300035115 | Bacteria | 1596 |
| 903 | Ga0373945_0000395 | 3300035116 | Bacteria | 12509 |
| 904 | Ga0373953_0012063 | 3300035117 | Bacteria | 3051 |
| 905 | Ga0373953_0175082 | 3300035117 | Bacteria | 924 |
| 906 | Ga0373954_0014441 | 3300035118 | Bacteria | 3520 |
| 907 | Ga0373954_0017590 | 3300035118 | Bacteria | 3212 |
| 908 | Ga0373954_0093392 | 3300035118 | Bacteria | 1447 |
| 909 | Ga0373956_0004238 | 3300035119 | Bacteria | 5758 |
| 910 | Ga0373956_0057666 | 3300035119 | Bacteria | 1755 |
| 911 | Ga0373956_0166894 | 3300035119 | Bacteria | 1038 |
| 912 | Ga0373956_0207018 | 3300035119 | Bacteria | 930 |
| 913 | Ga0373956_0241703 | 3300035119 | Bacteria | 858 |
| 914 | Ga0373957_0057417 | 3300035120 | Bacteria | 1501 |
| 915 | Ga0373960_0014317 | 3300035121 | Bacteria | 2007 |
| 916 | Ga0373960_0066853 | 3300035121 | Bacteria | 1103 |
| 917 | Ga0373943_0024548 | 3300035170 | Bacteria | 2811 |
| 918 | Ga0373943_0273010 | 3300035170 | Bacteria | 954 |
| 919 | Ga0373946_0023533 | 3300035171 | Bacteria | 2407 |
| 920 | Ga0373946_0035404 | 3300035171 | Bacteria | 2020 |
| 921 | Ga0373946_0102613 | 3300035171 | Bacteria | 1284 |
| 922 | Ga0373946_0211691 | 3300035171 | Bacteria | 933 |
| 923 | Ga0373955_0000678 | 3300035172 | Bacteria | 14552 |
| 924 | Ga0373955_0051059 | 3300035172 | Bacteria | 2251 |
| 925 | Ga0373955_0101614 | 3300035172 | Bacteria | 1651 |
| 926 | Ga0373955_0186617 | 3300035172 | Bacteria | 1231 |
| 927 | Ga0373955_0283761 | 3300035172 | Bacteria | 996 |
| 928 | Ga0373962_0085587 | 3300035242 | Bacteria | 964 |
| 929 | Ga0373924_0010590 | 3300035410 | Bacteria | 3407 |
| 930 | Ga0373924_0013149 | 3300035410 | Bacteria | 3105 |
| 931 | Ga0373924_0014176 | 3300035410 | Bacteria | 3009 |
| 932 | Ga0373924_0173974 | 3300035410 | Bacteria | 947 |
| 933 | Ga0373931_0211514 | 3300035691 | Bacteria | 1163 |
| 934 | Ga0373931_0275267 | 3300035691 | Bacteria | 1032 |
| 935 | Ga0373931_0455270 | 3300035691 | Bacteria | 819 |
| 936 | Ga0373935_0005649 | 3300035692 | Bacteria | 7381 |
| 937 | Ga0373935_0048165 | 3300035692 | Bacteria | 2698 |
| 938 | Ga0373935_0091752 | 3300035692 | Bacteria | 1989 |
| 939 | Ga0373935_0136237 | 3300035692 | Bacteria | 1654 |
| 940 | Ga0373927_0001392 | 3300035695 | Bacteria | 18221 |
| 941 | Ga0373927_0011983 | 3300035695 | Bacteria | 5768 |
| 942 | Ga0373927_0048986 | 3300035695 | Bacteria | 2732 |
| 943 | Ga0373927_0119662 | 3300035695 | Bacteria | 1718 |
| 944 | Ga0373927_0239834 | 3300035695 | Bacteria | 1191 |
| 945 | Ga0373933_0006110 | 3300035724 | Bacteria | 6553 |
| 946 | Ga0373933_0009814 | 3300035724 | Bacteria | 5238 |
| 947 | Ga0373933_0037854 | 3300035724 | Bacteria | 2832 |
| 948 | Ga0373933_0039721 | 3300035724 | Bacteria | 2769 |
| 949 | Ga0373933_0215151 | 3300035724 | Bacteria | 1232 |
| 950 | Ga0373933_0509724 | 3300035724 | Bacteria | 788 |
| 951 | Ga0373947_0002951 | 3300035725 | Bacteria | 10153 |
| 952 | Ga0373947_0045327 | 3300035725 | Bacteria | 2631 |
| 953 | Ga0373947_0063714 | 3300035725 | Bacteria | 2246 |
| 954 | Ga0373947_0121182 | 3300035725 | Bacteria | 1661 |
| 955 | Ga0373937_0050834 | 3300036401 | Bacteria | 3798 |
| 956 | Ga0373937_0098011 | 3300036401 | Bacteria | 2719 |
| 957 | Ga0373937_0100171 | 3300036401 | Bacteria | 2688 |
| 958 | Ga0373937_0124163 | 3300036401 | Bacteria | 2407 |
| 959 | Ga0373937_0149495 | 3300036401 | Bacteria | 2187 |
| 960 | Ga0373937_0463752 | 3300036401 | Bacteria | 1203 |
| 961 | Ga0373925_0004635 | 3300037068 | Bacteria | 10377 |
| 962 | Ga0373925_0010628 | 3300037068 | Bacteria | 6675 |
| 963 | Ga0373925_0014677 | 3300037068 | Bacteria | 5659 |
| 964 | Ga0373925_0087558 | 3300037068 | Bacteria | 2377 |
| 965 | Ga0373925_0372724 | 3300037068 | Bacteria | 1162 |
| 966 | Ga0395899_0071950 | 3300037312 | Bacteria | 2530 |
| 967 | Ga0395899_0191292 | 3300037312 | Bacteria | 1432 |
| 968 | Ga0395900_0001526 | 3300037418 | Bacteria | 27536 |
| 969 | Ga0395900_0005676 | 3300037418 | Bacteria | 13049 |
| 970 | Ga0395900_0026147 | 3300037418 | Bacteria | 5976 |
| 971 | Ga0395900_0116784 | 3300037418 | Bacteria | 2738 |
| 972 | Ga0395900_0268963 | 3300037418 | Bacteria | 1700 |
| 973 | Ga0395898_0026979 | 3300037466 | Bacteria | 5771 |
| 974 | Ga0395898_0041517 | 3300037466 | Bacteria | 4544 |
| 975 | Ga0395898_0173644 | 3300037466 | Bacteria | 2060 |
| 976 | Ga0395898_0177718 | 3300037466 | Bacteria | 2034 |
| 977 | Ga0395905_0050159 | 3300037471 | Bacteria | 3911 |
| 978 | Ga0395905_0130606 | 3300037471 | Bacteria | 2362 |
| 979 | Ga0395905_0160500 | 3300037471 | Bacteria | 2113 |
| 980 | Ga0395905_0884646 | 3300037471 | Bacteria | 796 |
| 981 | Ga0436364_0168836 | 3300037853 | Bacteria | 2252 |
| 982 | Ga0436364_0305434 | 3300037853 | Bacteria | 2381 |
| 983 | Ga0436364_1198463 | 3300037853 | Bacteria | 1296 |
| 984 | Ga0436364_1239073 | 3300037853 | Bacteria | 1231 |
| 985 | Ga0436364_1527050 | 3300037853 | Bacteria | 2481 |
| 986 | Ga0395901_0011004 | 3300038443 | Bacteria | 9165 |
| 987 | Ga0395901_0011455 | 3300038443 | Bacteria | 8987 |
| 988 | Ga0395901_0015205 | 3300038443 | Bacteria | 7830 |
| 989 | Ga0395901_0068693 | 3300038443 | Bacteria | 3691 |
| 990 | Ga0395901_0192976 | 3300038443 | Bacteria | 2136 |
| 991 | Ga0395901_0764367 | 3300038443 | Bacteria | 958 |
| 992 | Ga0436365_0147099 | 3300039437 | Bacteria | 1461 |
| 993 | Ga0436365_0217873 | 3300039437 | Bacteria | 10267 |
| 994 | Ga0436365_0418339 | 3300039437 | Bacteria | 1359 |
| 995 | Ga0436365_0447822 | 3300039437 | Bacteria | 2084 |
| 996 | Ga0436365_0543732 | 3300039437 | Bacteria | 5982 |
| 997 | Ga0436365_0662047 | 3300039437 | Bacteria | 3594 |
| 998 | Ga0436365_0717665 | 3300039437 | Bacteria | 1903 |
| 999 | Ga0436365_0760445 | 3300039437 | Bacteria | 789 |
| 1000 | Ga0436365_1099091 | 3300039437 | Bacteria | 2101 |
| 1001 | Ga0436365_1334356 | 3300039437 | Bacteria | 2891 |
| 1002 | Ga0436360_0740992 | 3300039438 | Bacteria | 1449 |
| 1003 | Ga0436361_0222158 | 3300039447 | Bacteria | 936 |
| 1004 | Ga0436361_0671770 | 3300039447 | Bacteria | 1114 |
| 1005 | Ga0436363_0036150 | 3300039450 | Bacteria | 9004 |
| 1006 | Ga0436363_0067190 | 3300039450 | Bacteria | 784 |
| 1007 | Ga0436363_0769259 | 3300039450 | Bacteria | 1641 |
| 1008 | Ga0436363_1419967 | 3300039450 | Bacteria | 1338 |
| 1009 | Ga0436362_0062599 | 3300039453 | Bacteria | 1707 |
| 1010 | Ga0436362_0291034 | 3300039453 | Bacteria | 1104 |
| 1011 | Ga0439465_0088485 | 3300041413 | Bacteria | 1057 |
| 1012 | Ga0439465_0098986 | 3300041413 | Bacteria | 1005 |
| 1013 | Ga0451797_0120081 | 3300041453 | Bacteria | 1494 |
| 1014 | Ga0451802_1537279 | 3300041460 | Bacteria | 675 |
| 1015 | Ga0451841_0002079 | 3300041498 | Bacteria | 990 |
| 1016 | Ga0451841_0425213 | 3300041498 | Bacteria | 741 |
| 1017 | Ga0451853_2705975 | 3300041512 | Bacteria | 771 |
| 1018 | Ga0466969_0055578 | 3300044656 | Bacteria | 1936 |
| 1019 | Ga0466969_0313822 | 3300044656 | Bacteria | 709 |
| 1020 | Ga0466972_0000126 | 3300044658 | Bacteria | 64766 |
| 1021 | Ga0466972_0006027 | 3300044658 | Bacteria | 6091 |
| 1022 | Ga0466966_0001699 | 3300044684 | Bacteria | 14211 |
| 1023 | Ga0466961_0000095 | 3300044693 | Bacteria | 56814 |
| 1024 | Ga0466963_0051455 | 3300044694 | Bacteria | 2731 |
| 1025 | Ga0466964_0007963 | 3300044706 | Bacteria | 3968 |
| 1026 | Ga0466964_0105720 | 3300044706 | Bacteria | 1248 |
| 1027 | Ga0466971_0091570 | 3300044719 | Bacteria | 1393 |
| 1028 | Ga0466968_0009584 | 3300044735 | Bacteria | 3728 |
| 1029 | Ga0466968_0104471 | 3300044735 | Bacteria | 1268 |
| 1030 | Ga0466970_0068686 | 3300044765 | Bacteria | 1904 |
| 1031 | Ga0466957_0089296 | 3300044842 | Bacteria | 1929 |
| 1032 | Ga0466957_0159728 | 3300044842 | Bacteria | 1463 |
| 1033 | Ga0466957_0159819 | 3300044842 | Bacteria | 1463 |
| 1034 | Ga0466957_0558333 | 3300044842 | Bacteria | 798 |
| 1035 | Ga0466959_0034600 | 3300045049 | Bacteria | 3737 |
| 1036 | Ga0466959_0236093 | 3300045049 | Bacteria | 1264 |
| 1037 | Ga0466959_0478501 | 3300045049 | Bacteria | 843 |
| 1038 | Ga0466958_0610171 | 3300045836 | Bacteria | 710 |
| 1039 | Ga0466958_0698380 | 3300045836 | Bacteria | 661 |
| 1040 | Ga0466967_0037921 | 3300045976 | Bacteria | 4129 |
| 1041 | Ga0466967_0179708 | 3300045976 | Bacteria | 1995 |
| 1042 | Ga0466967_0365063 | 3300045976 | Bacteria | 1399 |
| 1043 | Ga0466967_0988657 | 3300045976 | Bacteria | 838 |
| 1044 | Ga0495617_058430 | 3300046452 | Bacteria | 1278 |
| 1045 | Ga0495592_0009935 | 3300046454 | Bacteria | 7166 |
| 1046 | Ga0495592_0033511 | 3300046454 | Bacteria | 3873 |
| 1047 | Ga0495592_0090419 | 3300046454 | Bacteria | 2196 |
| 1048 | Ga0495592_0098193 | 3300046454 | Bacteria | 2090 |
| 1049 | Ga0495592_0589040 | 3300046454 | Bacteria | 679 |
| 1050 | Ga0495603_0001272 | 3300046455 | Bacteria | 14676 |
| 1051 | Ga0495603_0004214 | 3300046455 | Bacteria | 8566 |
| 1052 | Ga0495603_0013633 | 3300046455 | Bacteria | 4918 |
| 1053 | Ga0495603_0048593 | 3300046455 | Bacteria | 2526 |
| 1054 | Ga0495603_0066820 | 3300046455 | Bacteria | 2117 |
| 1055 | Ga0495603_0436548 | 3300046455 | Bacteria | 750 |
| 1056 | Ga0495590_0122408 | 3300046457 | Bacteria | 932 |
| 1057 | Ga0495629_0000333 | 3300046459 | Bacteria | 40364 |
| 1058 | Ga0495629_0003378 | 3300046459 | Bacteria | 12064 |
| 1059 | Ga0495629_0009814 | 3300046459 | Bacteria | 6985 |
| 1060 | Ga0495629_0015488 | 3300046459 | Bacteria | 5474 |
| 1061 | Ga0495629_0051684 | 3300046459 | Bacteria | 2876 |
| 1062 | Ga0495629_0057330 | 3300046459 | Bacteria | 2724 |
| 1063 | Ga0495629_0269864 | 3300046459 | Bacteria | 1169 |
| 1064 | Ga0495629_0426630 | 3300046459 | Bacteria | 899 |
| 1065 | Ga0495638_0154696 | 3300046460 | Bacteria | 1327 |
| 1066 | Ga0495638_0250451 | 3300046460 | Bacteria | 976 |
| 1067 | Ga0495638_0331045 | 3300046460 | Bacteria | 810 |
| 1068 | Ga0495641_0018469 | 3300046461 | Bacteria | 3597 |
| 1069 | Ga0495651_0010321 | 3300046462 | Bacteria | 7176 |
| 1070 | Ga0495651_0017093 | 3300046462 | Bacteria | 5621 |
| 1071 | Ga0495651_0135646 | 3300046462 | Bacteria | 1791 |
| 1072 | Ga0495653_0000367 | 3300046463 | Bacteria | 36475 |
| 1073 | Ga0495653_0159437 | 3300046463 | Bacteria | 1567 |
| 1074 | Ga0495653_0169822 | 3300046463 | Bacteria | 1506 |
| 1075 | Ga0495580_0001991 | 3300046472 | Bacteria | 17967 |
| 1076 | Ga0495580_0013840 | 3300046472 | Bacteria | 6142 |
| 1077 | Ga0495582_0000581 | 3300046473 | Bacteria | 20224 |
| 1078 | Ga0495582_0014383 | 3300046473 | Bacteria | 4350 |
| 1079 | Ga0495582_0036160 | 3300046473 | Bacteria | 2716 |
| 1080 | Ga0495582_0080212 | 3300046473 | Bacteria | 1812 |
| 1081 | Ga0495582_0119898 | 3300046473 | Bacteria | 1482 |
| 1082 | Ga0495605_0043685 | 3300046474 | Bacteria | 2220 |
| 1083 | Ga0495639_0000585 | 3300046475 | Bacteria | 16976 |
| 1084 | Ga0495639_0006240 | 3300046475 | Bacteria | 5120 |
| 1085 | Ga0495639_0056572 | 3300046475 | Bacteria | 1791 |
| 1086 | Ga0495639_0208209 | 3300046475 | Bacteria | 959 |
| 1087 | Ga0495662_0000101 | 3300046476 | Bacteria | 31160 |
| 1088 | Ga0495662_0024402 | 3300046476 | Bacteria | 2917 |
| 1089 | Ga0495662_0026132 | 3300046476 | Bacteria | 2820 |
| 1090 | Ga0495662_0061536 | 3300046476 | Bacteria | 1814 |
| 1091 | Ga0495664_0002862 | 3300046477 | Bacteria | 9299 |
| 1092 | Ga0495664_0003595 | 3300046477 | Bacteria | 8454 |
| 1093 | Ga0495664_0027264 | 3300046477 | Bacteria | 3329 |
| 1094 | Ga0495664_0027670 | 3300046477 | Bacteria | 3307 |
| 1095 | Ga0495664_0142534 | 3300046477 | Bacteria | 1453 |
| 1096 | Ga0495664_0155619 | 3300046477 | Bacteria | 1387 |
| 1097 | Ga0495664_0167881 | 3300046477 | Bacteria | 1331 |
| 1098 | Ga0495584_0072425 | 3300046491 | Bacteria | 1732 |
| 1099 | Ga0495584_0105922 | 3300046491 | Bacteria | 1421 |
| 1100 | Ga0495585_0002078 | 3300046492 | Bacteria | 14696 |
| 1101 | Ga0495585_0148570 | 3300046492 | Bacteria | 1223 |
| 1102 | Ga0495594_0001601 | 3300046499 | Bacteria | 11777 |
| 1103 | Ga0495594_0056783 | 3300046499 | Bacteria | 2161 |
| 1104 | Ga0495594_0339832 | 3300046499 | Bacteria | 855 |
| 1105 | Ga0495607_0004674 | 3300046501 | Bacteria | 10022 |
| 1106 | Ga0495607_0221647 | 3300046501 | Bacteria | 924 |
| 1107 | Ga0495583_0138895 | 3300046506 | Bacteria | 1013 |
| 1108 | Ga0495606_0060698 | 3300046507 | Bacteria | 2421 |
| 1109 | Ga0495606_0078463 | 3300046507 | Bacteria | 2059 |
| 1110 | Ga0495606_0091062 | 3300046507 | Bacteria | 1876 |
| 1111 | Ga0495606_0402973 | 3300046507 | Bacteria | 712 |
| 1112 | Ga0495608_0041050 | 3300046511 | Bacteria | 3098 |
| 1113 | Ga0495608_0056482 | 3300046511 | Bacteria | 2592 |
| 1114 | Ga0495608_0081395 | 3300046511 | Bacteria | 2104 |
| 1115 | Ga0495608_0110124 | 3300046511 | Bacteria | 1770 |
| 1116 | Ga0495610_0137438 | 3300046512 | Bacteria | 1055 |
| 1117 | Ga0495610_0190304 | 3300046512 | Bacteria | 847 |
| 1118 | Ga0495616_0037865 | 3300046513 | Bacteria | 2478 |
| 1119 | Ga0495616_0053890 | 3300046513 | Bacteria | 1997 |
| 1120 | Ga0495616_0215604 | 3300046513 | Bacteria | 838 |
| 1121 | Ga0495618_0015090 | 3300046514 | Bacteria | 4712 |
| 1122 | Ga0495618_0087161 | 3300046514 | Bacteria | 1996 |
| 1123 | Ga0495618_0182344 | 3300046514 | Bacteria | 1334 |
| 1124 | Ga0495618_0211331 | 3300046514 | Bacteria | 1226 |
| 1125 | Ga0495620_0139470 | 3300046515 | Bacteria | 948 |
| 1126 | Ga0495628_0009952 | 3300046516 | Bacteria | 8093 |
| 1127 | Ga0495628_0010205 | 3300046516 | Bacteria | 7991 |
| 1128 | Ga0495628_0032131 | 3300046516 | Bacteria | 4240 |
| 1129 | Ga0495628_0073293 | 3300046516 | Bacteria | 2668 |
| 1130 | Ga0495628_0090285 | 3300046516 | Bacteria | 2372 |
| 1131 | Ga0495628_0390296 | 3300046516 | Bacteria | 1018 |
| 1132 | Ga0495628_0455444 | 3300046516 | Bacteria | 929 |
| 1133 | Ga0495630_0010453 | 3300046517 | Bacteria | 6703 |
| 1134 | Ga0495630_0026726 | 3300046517 | Bacteria | 4275 |
| 1135 | Ga0495630_0027607 | 3300046517 | Bacteria | 4213 |
| 1136 | Ga0495630_0048627 | 3300046517 | Bacteria | 3174 |
| 1137 | Ga0495631_0020085 | 3300046518 | Bacteria | 3125 |
| 1138 | Ga0495631_0173436 | 3300046518 | Bacteria | 924 |
| 1139 | Ga0495632_0098026 | 3300046519 | Bacteria | 1383 |
| 1140 | Ga0495643_0011352 | 3300046522 | Bacteria | 5429 |
| 1141 | Ga0495643_0043785 | 3300046522 | Bacteria | 2434 |
| 1142 | Ga0495643_0078440 | 3300046522 | Bacteria | 1724 |
| 1143 | Ga0495643_0143778 | 3300046522 | Bacteria | 1187 |
| 1144 | Ga0495644_0000312 | 3300046523 | Bacteria | 22452 |
| 1145 | Ga0495644_0116576 | 3300046523 | Bacteria | 1015 |
| 1146 | Ga0495648_0027010 | 3300046524 | Bacteria | 3852 |
| 1147 | Ga0495648_0057268 | 3300046524 | Bacteria | 2339 |
| 1148 | Ga0495666_0001337 | 3300046526 | Bacteria | 11947 |
| 1149 | Ga0495652_0009044 | 3300046529 | Bacteria | 9062 |
| 1150 | Ga0495652_0022671 | 3300046529 | Bacteria | 5571 |
| 1151 | Ga0495652_0026811 | 3300046529 | Bacteria | 5084 |
| 1152 | Ga0495652_0043388 | 3300046529 | Bacteria | 3874 |
| 1153 | Ga0495652_0107567 | 3300046529 | Bacteria | 2250 |
| 1154 | Ga0495652_0406589 | 3300046529 | Bacteria | 962 |
| 1155 | Ga0495654_0005815 | 3300046530 | Bacteria | 7107 |
| 1156 | Ga0495654_0099437 | 3300046530 | Bacteria | 1341 |
| 1157 | Ga0495665_0003505 | 3300046531 | Bacteria | 8515 |
| 1158 | Ga0495665_0006056 | 3300046531 | Bacteria | 6524 |
| 1159 | Ga0495665_0024104 | 3300046531 | Bacteria | 3268 |
| 1160 | Ga0495640_0003357 | 3300046533 | Bacteria | 12887 |
| 1161 | Ga0495640_0023394 | 3300046533 | Bacteria | 4501 |
| 1162 | Ga0495640_0042537 | 3300046533 | Bacteria | 3168 |
| 1163 | Ga0495640_0060880 | 3300046533 | Bacteria | 2566 |
| 1164 | Ga0495640_0148117 | 3300046533 | Bacteria | 1509 |
| 1165 | Ga0495586_0008435 | 3300046535 | Bacteria | 5484 |
| 1166 | Ga0495586_0150801 | 3300046535 | Bacteria | 1308 |
| 1167 | Ga0495587_0002119 | 3300046536 | Bacteria | 13266 |
| 1168 | Ga0495587_0014439 | 3300046536 | Bacteria | 4954 |
| 1169 | Ga0495587_0089088 | 3300046536 | Bacteria | 1784 |
| 1170 | Ga0495587_0173840 | 3300046536 | Bacteria | 1223 |
| 1171 | Ga0495587_0471444 | 3300046536 | Bacteria | 695 |
| 1172 | Ga0495598_0099710 | 3300046537 | Bacteria | 959 |
| 1173 | Ga0495609_0019460 | 3300046538 | Bacteria | 3141 |
| 1174 | Ga0495609_0020209 | 3300046538 | Bacteria | 3078 |
| 1175 | Ga0495609_0130212 | 3300046538 | Bacteria | 1078 |
| 1176 | Ga0495609_0149926 | 3300046538 | Bacteria | 992 |
| 1177 | Ga0495621_0031173 | 3300046539 | Bacteria | 1827 |
| 1178 | Ga0495621_0132310 | 3300046539 | Bacteria | 971 |
| 1179 | Ga0495597_0021036 | 3300046542 | Bacteria | 3034 |
| 1180 | Ga0495597_0081019 | 3300046542 | Bacteria | 1388 |
| 1181 | Ga0495645_0010574 | 3300046543 | Bacteria | 6477 |
| 1182 | Ga0495645_0036325 | 3300046543 | Bacteria | 3591 |
| 1183 | Ga0495645_0254415 | 3300046543 | Bacteria | 1166 |
| 1184 | Ga0495622_0007994 | 3300046557 | Bacteria | 4903 |
| 1185 | Ga0495622_0009473 | 3300046557 | Bacteria | 4504 |
| 1186 | Ga0495622_0016292 | 3300046557 | Bacteria | 3459 |
| 1187 | Ga0495622_0054858 | 3300046557 | Bacteria | 1848 |
| 1188 | Ga0495622_0082331 | 3300046557 | Bacteria | 1481 |
| 1189 | Ga0495633_0045186 | 3300046558 | Bacteria | 2086 |
| 1190 | Ga0495633_0072140 | 3300046558 | Bacteria | 1610 |
| 1191 | Ga0495667_0003431 | 3300046559 | Bacteria | 10630 |
| 1192 | Ga0495667_0012919 | 3300046559 | Bacteria | 5659 |
| 1193 | Ga0495667_0081581 | 3300046559 | Bacteria | 2102 |
| 1194 | Ga0495667_0347047 | 3300046559 | Bacteria | 938 |
| 1195 | Ga0495667_0451570 | 3300046559 | Bacteria | 807 |
| 1196 | Ga0495656_0000338 | 3300046615 | Bacteria | 16110 |
| 1197 | Ga0495656_0033902 | 3300046615 | Bacteria | 2087 |
| 1198 | Ga0495656_0087544 | 3300046615 | Bacteria | 1418 |
| 1199 | Ga0495656_0260122 | 3300046615 | Bacteria | 879 |
| 1200 | Ga0495668_0032729 | 3300046616 | Bacteria | 2923 |
| 1201 | Ga0495668_0091552 | 3300046616 | Bacteria | 1666 |
| 1202 | Ga0495668_0124630 | 3300046616 | Bacteria | 1410 |
| 1203 | Ga0495668_0131926 | 3300046616 | Bacteria | 1367 |
| 1204 | Ga0495668_0275479 | 3300046616 | Bacteria | 922 |
| 1205 | Ga0495634_0000633 | 3300046642 | Bacteria | 34239 |
| 1206 | Ga0495634_0007068 | 3300046642 | Bacteria | 8470 |
| 1207 | Ga0495634_0017810 | 3300046642 | Bacteria | 5065 |
| 1208 | Ga0495634_0056949 | 3300046642 | Bacteria | 2610 |
| 1209 | Ga0495634_0183386 | 3300046642 | Bacteria | 1309 |
| 1210 | Ga0495634_0245498 | 3300046642 | Bacteria | 1097 |
| 1211 | Ga0495611_0117023 | 3300046648 | Bacteria | 1242 |
| 1212 | Ga0495611_0247226 | 3300046648 | Bacteria | 827 |
| 1213 | Ga0495611_0278965 | 3300046648 | Bacteria | 772 |
| 1214 | Ga0495625_0312789 | 3300046660 | Bacteria | 1002 |
| 1215 | Ga0495635_0001089 | 3300046663 | Bacteria | 18033 |
| 1216 | Ga0495635_0019171 | 3300046663 | Bacteria | 4773 |
| 1217 | Ga0495635_0034059 | 3300046663 | Bacteria | 3533 |
| 1218 | Ga0495635_0048853 | 3300046663 | Bacteria | 2916 |
| 1219 | Ga0495635_0118183 | 3300046663 | Bacteria | 1809 |
| 1220 | Ga0495635_0477749 | 3300046663 | Bacteria | 822 |
| 1221 | Ga0495635_0654401 | 3300046663 | Bacteria | 683 |
| 1222 | Ga0495659_0015030 | 3300046664 | Bacteria | 2541 |
| 1223 | Ga0495661_0082564 | 3300046665 | Bacteria | 1849 |
| 1224 | Ga0495588_0015218 | 3300046674 | Bacteria | 3697 |
| 1225 | Ga0495588_0015938 | 3300046674 | Bacteria | 3625 |
| 1226 | Ga0495588_0025596 | 3300046674 | Bacteria | 2941 |
| 1227 | Ga0495588_0250324 | 3300046674 | Bacteria | 934 |
| 1228 | Ga0495657_0023571 | 3300046675 | Bacteria | 4395 |
| 1229 | Ga0495657_0034109 | 3300046675 | Bacteria | 3537 |
| 1230 | Ga0495657_0078286 | 3300046675 | Bacteria | 2143 |
| 1231 | Ga0495657_0145889 | 3300046675 | Bacteria | 1472 |
| 1232 | Ga0495599_0001176 | 3300046678 | Bacteria | 14830 |
| 1233 | Ga0495599_0115491 | 3300046678 | Bacteria | 1670 |
| 1234 | Ga0495599_0191132 | 3300046678 | Bacteria | 1259 |
| 1235 | Ga0495599_0305678 | 3300046678 | Bacteria | 959 |
| 1236 | Ga0495623_0044749 | 3300046679 | Bacteria | 2812 |
| 1237 | Ga0495646_0002685 | 3300046680 | Bacteria | 11010 |
| 1238 | Ga0495646_0004437 | 3300046680 | Bacteria | 8836 |
| 1239 | Ga0495646_0015905 | 3300046680 | Bacteria | 4775 |
| 1240 | Ga0495646_0049766 | 3300046680 | Bacteria | 2542 |
| 1241 | Ga0495647_0005918 | 3300046681 | Bacteria | 4025 |
| 1242 | Ga0495647_0063440 | 3300046681 | Bacteria | 1463 |
| 1243 | Ga0495658_0000485 | 3300046683 | Bacteria | 21791 |
| 1244 | Ga0495658_0087126 | 3300046683 | Bacteria | 1843 |
| 1245 | Ga0495658_0162202 | 3300046683 | Bacteria | 1379 |
| 1246 | Ga0495669_0041667 | 3300046684 | Bacteria | 2039 |
| 1247 | Ga0495669_0077634 | 3300046684 | Bacteria | 1521 |
| 1248 | Ga0495613_0011737 | 3300046689 | Bacteria | 6510 |
| 1249 | Ga0495613_0050741 | 3300046689 | Bacteria | 3060 |
| 1250 | Ga0495613_0088905 | 3300046689 | Bacteria | 2238 |
| 1251 | Ga0495613_0125461 | 3300046689 | Bacteria | 1841 |
| 1252 | Ga0495613_0217113 | 3300046689 | Bacteria | 1343 |
| 1253 | Ga0495613_0535599 | 3300046689 | Bacteria | 785 |
| 1254 | Ga0495624_0002728 | 3300046690 | Bacteria | 13271 |
| 1255 | Ga0495624_0038263 | 3300046690 | Bacteria | 3082 |
| 1256 | Ga0495624_0090428 | 3300046690 | Bacteria | 1888 |
| 1257 | Ga0495624_0330436 | 3300046690 | Bacteria | 918 |
| 1258 | Ga0495670_0000232 | 3300046691 | Bacteria | 25466 |
| 1259 | Ga0495649_0031195 | 3300046694 | Bacteria | 2940 |
| 1260 | Ga0495589_0077488 | 3300046794 | Bacteria | 1620 |
| 1261 | Ga0495589_0114719 | 3300046794 | Bacteria | 1299 |
| 1262 | Ga0495589_0130170 | 3300046794 | Bacteria | 1209 |
| 1263 | Ga0495589_0209375 | 3300046794 | Bacteria | 918 |
| 1264 | Ga0495600_0006096 | 3300046809 | Bacteria | 7304 |
| 1265 | Ga0495600_0014421 | 3300046809 | Bacteria | 4981 |
| 1266 | Ga0495600_0047963 | 3300046809 | Bacteria | 2786 |
| 1267 | Ga0495600_0147325 | 3300046809 | Bacteria | 1525 |
| 1268 | Ga0495660_0251295 | 3300046810 | Bacteria | 820 |
| 1269 | Ga0495581_0004200 | 3300047315 | Bacteria | 8302 |
| 1270 | Ga0495581_0021531 | 3300047315 | Bacteria | 3735 |
| 1271 | Ga0495581_0099047 | 3300047315 | Bacteria | 1693 |
| 1272 | Ga0495581_0478194 | 3300047315 | Bacteria | 725 |
| 1273 | Ga0495604_0007154 | 3300047317 | Bacteria | 8837 |
| 1274 | Ga0495604_0009413 | 3300047317 | Bacteria | 7727 |
| 1275 | Ga0495604_0010035 | 3300047317 | Bacteria | 7498 |
| 1276 | Ga0495604_0021471 | 3300047317 | Bacteria | 5154 |
| 1277 | Ga0495604_0032634 | 3300047317 | Bacteria | 4126 |
| 1278 | Ga0495604_0137932 | 3300047317 | Bacteria | 1746 |
| 1279 | Ga0495604_0222748 | 3300047317 | Bacteria | 1298 |
| 1280 | Ga0495674_0004552 | 3300047319 | Bacteria | 13338 |
| 1281 | Ga0495674_0006956 | 3300047319 | Bacteria | 10822 |
| 1282 | Ga0495674_0015538 | 3300047319 | Bacteria | 7114 |
| 1283 | Ga0495674_0019348 | 3300047319 | Bacteria | 6318 |
| 1284 | Ga0495674_0109833 | 3300047319 | Bacteria | 2339 |
| 1285 | Ga0495674_0170596 | 3300047319 | Bacteria | 1816 |
| 1286 | Ga0495674_0582033 | 3300047319 | Bacteria | 888 |
| 1287 | Ga0495672_0055254 | 3300047320 | Bacteria | 2318 |
| 1288 | Ga0495672_0056212 | 3300047320 | Bacteria | 2291 |
| 1289 | Ga0495676_0042489 | 3300047321 | Bacteria | 3731 |
| 1290 | Ga0495676_0077595 | 3300047321 | Bacteria | 2532 |
| 1291 | Ga0495676_0582959 | 3300047321 | Bacteria | 729 |
| 1292 | Ga0495680_0009493 | 3300047322 | Bacteria | 8743 |
| 1293 | Ga0495680_0015757 | 3300047322 | Bacteria | 6508 |
| 1294 | Ga0495680_0061335 | 3300047322 | Bacteria | 2893 |
| 1295 | Ga0495680_0231419 | 3300047322 | Bacteria | 1316 |
| 1296 | Ga0495683_0043754 | 3300047323 | Bacteria | 2254 |
| 1297 | Ga0495687_007651 | 3300047443 | Bacteria | 6323 |
| 1298 | Ga0495675_0004613 | 3300047444 | Bacteria | 8364 |
| 1299 | Ga0495675_0058767 | 3300047444 | Bacteria | 2438 |
| 1300 | Ga0495675_0216014 | 3300047444 | Bacteria | 1162 |
| 1301 | Ga0495677_0024863 | 3300047445 | Bacteria | 2173 |
| 1302 | Ga0495677_0235725 | 3300047445 | Bacteria | 714 |
| 1303 | Ga0495685_087380 | 3300047447 | Bacteria | 1035 |
| 1304 | Ga0495673_0210858 | 3300047469 | Bacteria | 723 |
| 1305 | Ga0495681_0097528 | 3300047470 | Bacteria | 1289 |
| 1306 | Ga0495681_0125161 | 3300047470 | Bacteria | 1099 |
| 1307 | Ga0495681_0191125 | 3300047470 | Bacteria | 836 |
| 1308 | Ga0495684_0004994 | 3300047471 | Bacteria | 10354 |
| 1309 | Ga0495684_0028649 | 3300047471 | Bacteria | 4275 |
| 1310 | Ga0495684_0140471 | 3300047471 | Bacteria | 1811 |
| 1311 | Ga0495686_0068506 | 3300047472 | Bacteria | 2189 |
| 1312 | Ga0495686_0344638 | 3300047472 | Bacteria | 811 |
| 1313 | Ga0495593_0000679 | 3300047673 | Bacteria | 19632 |
| 1314 | Ga0495593_0003433 | 3300047673 | Bacteria | 9484 |
| 1315 | Ga0495593_0120964 | 3300047673 | Bacteria | 1332 |
| 1316 | Ga0495593_0260074 | 3300047673 | Bacteria | 869 |
| 1317 | Ga0495602_0005817 | 3300048088 | Bacteria | 12942 |
| 1318 | Ga0495602_0065563 | 3300048088 | Bacteria | 3134 |
| 1319 | Ga0495602_0154738 | 3300048088 | Bacteria | 1797 |
| 1320 | Ga0495614_0004306 | 3300048089 | Bacteria | 6411 |
| 1321 | Ga0495614_0014718 | 3300048089 | Bacteria | 3422 |
| 1322 | Ga0496100_0012284 | 3300048903 | Bacteria | 4905 |
| 1323 | Ga0496100_0324548 | 3300048903 | Bacteria | 1157 |
| 1324 | Ga0496100_0672805 | 3300048903 | Bacteria | 807 |
| 1325 | Ga0496100_0689141 | 3300048903 | Bacteria | 797 |
| 1326 | Ga0496101_0004662 | 3300048904 | Bacteria | 8674 |
| 1327 | Ga0496101_0283130 | 3300048904 | Bacteria | 1296 |
| 1328 | Ga0496101_0332561 | 3300048904 | Bacteria | 1192 |
| 1329 | Ga0496101_0358041 | 3300048904 | Bacteria | 1147 |
| 1330 | Ga0496101_0394731 | 3300048904 | Bacteria | 1089 |
| 1331 | Ga0496101_0549379 | 3300048904 | Bacteria | 913 |
| 1332 | Ga0496102_0047801 | 3300048905 | Bacteria | 3889 |
| 1333 | Ga0496102_0062740 | 3300048905 | Bacteria | 3403 |
| 1334 | Ga0496102_0238564 | 3300048905 | Bacteria | 1715 |
| 1335 | Ga0496102_0485723 | 3300048905 | Bacteria | 1157 |
| 1336 | Ga0496102_0495046 | 3300048905 | Bacteria | 1144 |
| 1337 | Ga0496102_0665053 | 3300048905 | Bacteria | 965 |
| 1338 | Ga0496102_0950128 | 3300048905 | Bacteria | 781 |
| 1339 | Ga0496102_1121632 | 3300048905 | Bacteria | 706 |
| 1340 | Ga0496103_0006185 | 3300048906 | Bacteria | 7154 |
| 1341 | Ga0496103_0008894 | 3300048906 | Bacteria | 5955 |
| 1342 | Ga0496103_0015621 | 3300048906 | Bacteria | 4523 |
| 1343 | Ga0496103_0037996 | 3300048906 | Bacteria | 2952 |
| 1344 | Ga0496103_0527669 | 3300048906 | Bacteria | 754 |
| 1345 | Ga0496103_0539607 | 3300048906 | Bacteria | 745 |
| 1346 | Ga0496104_0010719 | 3300048907 | Bacteria | 8197 |
| 1347 | Ga0496104_0059060 | 3300048907 | Bacteria | 3630 |
| 1348 | Ga0496104_0210504 | 3300048907 | Bacteria | 1856 |
| 1349 | Ga0496104_0210756 | 3300048907 | Bacteria | 1854 |
| 1350 | Ga0496104_0263367 | 3300048907 | Bacteria | 1636 |
| 1351 | Ga0496104_0312094 | 3300048907 | Bacteria | 1485 |
| 1352 | Ga0496104_0360865 | 3300048907 | Bacteria | 1365 |
| 1353 | Ga0496104_0423961 | 3300048907 | Bacteria | 1242 |
| 1354 | Ga0496105_0019738 | 3300048908 | Bacteria | 5438 |
| 1355 | Ga0496105_0079466 | 3300048908 | Bacteria | 2708 |
| 1356 | Ga0496105_0081795 | 3300048908 | Bacteria | 2667 |
| 1357 | Ga0496105_0121851 | 3300048908 | Bacteria | 2150 |
| 1358 | Ga0496105_0161651 | 3300048908 | Bacteria | 1838 |
| 1359 | Ga0496105_0272126 | 3300048908 | Bacteria | 1367 |
| 1360 | Ga0496105_0471731 | 3300048908 | Bacteria | 988 |
| 1361 | Ga0496105_0854905 | 3300048908 | Bacteria | 688 |
| 1362 | Ga0496106_0000714 | 3300048909 | Bacteria | 23911 |
| 1363 | Ga0496106_0001507 | 3300048909 | Bacteria | 17506 |
| 1364 | Ga0496106_0063296 | 3300048909 | Bacteria | 2811 |
| 1365 | Ga0496106_0123148 | 3300048909 | Bacteria | 2028 |
| 1366 | Ga0496106_0198249 | 3300048909 | Bacteria | 1597 |
| 1367 | Ga0496106_0249330 | 3300048909 | Bacteria | 1419 |
| 1368 | Ga0496106_0254150 | 3300048909 | Bacteria | 1405 |
| 1369 | Ga0496106_0275869 | 3300048909 | Bacteria | 1346 |
| 1370 | Ga0496107_0013027 | 3300048910 | Bacteria | 5809 |
| 1371 | Ga0496107_0034503 | 3300048910 | Bacteria | 3624 |
| 1372 | Ga0496107_0070218 | 3300048910 | Bacteria | 2542 |
| 1373 | Ga0496107_0259257 | 3300048910 | Bacteria | 1294 |
| 1374 | Ga0496108_0000467 | 3300048911 | Bacteria | 32329 |
| 1375 | Ga0496108_0008923 | 3300048911 | Bacteria | 8125 |
| 1376 | Ga0496108_0024693 | 3300048911 | Bacteria | 4950 |
| 1377 | Ga0496108_0068526 | 3300048911 | Bacteria | 2993 |
| 1378 | Ga0496108_0112328 | 3300048911 | Bacteria | 2331 |
| 1379 | Ga0496108_0398780 | 3300048911 | Bacteria | 1201 |
| 1380 | Ga0496108_0717461 | 3300048911 | Bacteria | 866 |
| 1381 | Ga0496109_0000919 | 3300048912 | Bacteria | 24515 |
| 1382 | Ga0496109_0004359 | 3300048912 | Bacteria | 11826 |
| 1383 | Ga0496109_0006181 | 3300048912 | Bacteria | 10064 |
| 1384 | Ga0496109_0032499 | 3300048912 | Bacteria | 4691 |
| 1385 | Ga0496109_0051358 | 3300048912 | Bacteria | 3755 |
| 1386 | Ga0496109_0283841 | 3300048912 | Bacteria | 1560 |
| 1387 | Ga0496109_0361076 | 3300048912 | Bacteria | 1372 |
| 1388 | Ga0496109_0545486 | 3300048912 | Bacteria | 1094 |
| 1389 | Ga0496110_0005112 | 3300048913 | Bacteria | 10250 |
| 1390 | Ga0496110_0027117 | 3300048913 | Bacteria | 4908 |
| 1391 | Ga0496110_0119628 | 3300048913 | Bacteria | 2372 |
| 1392 | Ga0496110_0269128 | 3300048913 | Bacteria | 1551 |
| 1393 | Ga0496110_0652424 | 3300048913 | Bacteria | 952 |
| 1394 | Ga0496111_0015259 | 3300048914 | Bacteria | 5269 |
| 1395 | Ga0496111_0021221 | 3300048914 | Bacteria | 4532 |
| 1396 | Ga0496111_0071906 | 3300048914 | Bacteria | 2517 |
| 1397 | Ga0496111_0123592 | 3300048914 | Bacteria | 1912 |
| 1398 | Ga0496111_0507797 | 3300048914 | Bacteria | 887 |
| 1399 | Ga0496112_0000023 | 3300048915 | Bacteria | 156144 |
| 1400 | Ga0496112_0021640 | 3300048915 | Bacteria | 6117 |
| 1401 | Ga0496112_0028400 | 3300048915 | Bacteria | 5400 |
| 1402 | Ga0496112_0031782 | 3300048915 | Bacteria | 5121 |
| 1403 | Ga0496112_0041638 | 3300048915 | Bacteria | 4494 |
| 1404 | Ga0496112_0055881 | 3300048915 | Bacteria | 3883 |
| 1405 | Ga0496112_0180223 | 3300048915 | Bacteria | 2076 |
| 1406 | Ga0496112_0345617 | 3300048915 | Bacteria | 1430 |
| 1407 | Ga0496113_0015295 | 3300048916 | Bacteria | 5269 |
| 1408 | Ga0496113_0024655 | 3300048916 | Bacteria | 4278 |
| 1409 | Ga0496113_0025557 | 3300048916 | Bacteria | 4211 |
| 1410 | Ga0496113_0188175 | 3300048916 | Bacteria | 1638 |
| 1411 | Ga0496113_0250665 | 3300048916 | Bacteria | 1413 |
| 1412 | Ga0496114_0007710 | 3300048917 | Bacteria | 8514 |
| 1413 | Ga0496114_0045487 | 3300048917 | Bacteria | 3646 |
| 1414 | Ga0496114_0078470 | 3300048917 | Bacteria | 2786 |
| 1415 | Ga0496114_0100495 | 3300048917 | Bacteria | 2468 |
| 1416 | Ga0496114_0306974 | 3300048917 | Bacteria | 1401 |
| 1417 | Ga0496114_0438094 | 3300048917 | Bacteria | 1157 |
| 1418 | Ga0496115_0004655 | 3300048918 | Bacteria | 9934 |
| 1419 | Ga0496115_0007641 | 3300048918 | Bacteria | 7965 |
| 1420 | Ga0496115_0041793 | 3300048918 | Bacteria | 3650 |
| 1421 | Ga0496115_0104793 | 3300048918 | Bacteria | 2321 |
| 1422 | Ga0496115_0144949 | 3300048918 | Bacteria | 1960 |
| 1423 | Ga0496115_0157371 | 3300048918 | Bacteria | 1877 |
| 1424 | Ga0496115_0179701 | 3300048918 | Bacteria | 1749 |
| 1425 | Ga0496115_0809883 | 3300048918 | Bacteria | 728 |
| 1426 | Ga0496116_0001929 | 3300048919 | Bacteria | 22341 |
| 1427 | Ga0496116_0060694 | 3300048919 | Bacteria | 2451 |
| 1428 | Ga0496116_0075862 | 3300048919 | Bacteria | 2108 |
| 1429 | Ga0496116_0138668 | 3300048919 | Bacteria | 1372 |
| 1430 | Ga0496116_0259699 | 3300048919 | Bacteria | 858 |
| 1431 | Ga0496117_0037055 | 3300048920 | Bacteria | 3638 |
| 1432 | Ga0496117_0108104 | 3300048920 | Bacteria | 1740 |
| 1433 | Ga0496117_0229465 | 3300048920 | Bacteria | 1027 |
| 1434 | Ga0496118_0002645 | 3300048921 | Bacteria | 23738 |
| 1435 | Ga0496118_0042077 | 3300048921 | Bacteria | 3609 |
| 1436 | Ga0496118_0050486 | 3300048921 | Bacteria | 3191 |
| 1437 | Ga0496118_0050606 | 3300048921 | Bacteria | 3186 |
| 1438 | Ga0496118_0082338 | 3300048921 | Bacteria | 2255 |
| 1439 | Ga0496119_0046967 | 3300048922 | Bacteria | 2690 |
| 1440 | Ga0496119_0136521 | 3300048922 | Bacteria | 1329 |
| 1441 | Ga0496120_0041581 | 3300048923 | Bacteria | 2691 |
| 1442 | Ga0496120_0093898 | 3300048923 | Bacteria | 1598 |
| 1443 | Ga0496120_0094161 | 3300048923 | Bacteria | 1595 |
| 1444 | Ga0496121_0000418 | 3300048924 | Bacteria | 84182 |
| 1445 | Ga0496121_0001793 | 3300048924 | Bacteria | 34696 |
| 1446 | Ga0496121_0009034 | 3300048924 | Bacteria | 11548 |
| 1447 | Ga0496121_0027543 | 3300048924 | Bacteria | 5316 |
| 1448 | Ga0496121_0037923 | 3300048924 | Bacteria | 4275 |
| 1449 | Ga0496121_0039233 | 3300048924 | Bacteria | 4178 |
| 1450 | Ga0496121_0041124 | 3300048924 | Bacteria | 4045 |
| 1451 | Ga0496121_0053458 | 3300048924 | Bacteria | 3383 |
| 1452 | Ga0496121_0058984 | 3300048924 | Bacteria | 3168 |
| 1453 | Ga0496121_0062764 | 3300048924 | Bacteria | 3040 |
| 1454 | Ga0496121_0069465 | 3300048924 | Bacteria | 2842 |
| 1455 | Ga0496121_0089604 | 3300048924 | Bacteria | 2407 |
| 1456 | Ga0496121_0141111 | 3300048924 | Bacteria | 1787 |
| 1457 | Ga0496121_0429561 | 3300048924 | Bacteria | 857 |
| 1458 | Ga0496121_0614354 | 3300048924 | Bacteria | 668 |
| 1459 | Ga0496122_0017800 | 3300048925 | Bacteria | 6608 |
| 1460 | Ga0496122_0046458 | 3300048925 | Bacteria | 3362 |
| 1461 | Ga0496122_0107440 | 3300048925 | Bacteria | 1844 |
| 1462 | Ga0496122_0113567 | 3300048925 | Bacteria | 1769 |
| 1463 | Ga0496123_0031532 | 3300048926 | Bacteria | 3854 |
| 1464 | Ga0496123_0051676 | 3300048926 | Bacteria | 2735 |
| 1465 | Ga0496123_0255826 | 3300048926 | Bacteria | 861 |
| 1466 | Ga0496124_0002424 | 3300048927 | Bacteria | 24471 |
| 1467 | Ga0496124_0100219 | 3300048927 | Bacteria | 2348 |
| 1468 | Ga0496124_0125808 | 3300048927 | Bacteria | 2042 |
| 1469 | Ga0496124_0147591 | 3300048927 | Bacteria | 1849 |
| 1470 | Ga0496124_0162569 | 3300048927 | Bacteria | 1739 |
| 1471 | Ga0496124_0169448 | 3300048927 | Bacteria | 1693 |
| 1472 | Ga0496124_0205903 | 3300048927 | Bacteria | 1492 |
| 1473 | Ga0496124_0477137 | 3300048927 | Bacteria | 843 |
| 1474 | Ga0496124_0646596 | 3300048927 | Bacteria | 679 |
| 1475 | Ga0496125_0000158 | 3300048928 | Bacteria | 151273 |
| 1476 | Ga0496125_0004941 | 3300048928 | Bacteria | 15084 |
| 1477 | Ga0496125_0016540 | 3300048928 | Bacteria | 7078 |
| 1478 | Ga0496125_0025957 | 3300048928 | Bacteria | 5352 |
| 1479 | Ga0496125_0035736 | 3300048928 | Bacteria | 4352 |
| 1480 | Ga0496125_0047195 | 3300048928 | Bacteria | 3605 |
| 1481 | Ga0496125_0073349 | 3300048928 | Bacteria | 2661 |
| 1482 | Ga0496125_0292789 | 3300048928 | Bacteria | 1001 |
| 1483 | Ga0496126_0006284 | 3300048929 | Bacteria | 13262 |
| 1484 | Ga0496126_0010261 | 3300048929 | Bacteria | 9843 |
| 1485 | Ga0496126_0019358 | 3300048929 | Bacteria | 6704 |
| 1486 | Ga0496126_0021246 | 3300048929 | Bacteria | 6344 |
| 1487 | Ga0496126_0026831 | 3300048929 | Bacteria | 5515 |
| 1488 | Ga0496126_0028328 | 3300048929 | Bacteria | 5340 |
| 1489 | Ga0496126_0044951 | 3300048929 | Bacteria | 4062 |
| 1490 | Ga0496126_0062639 | 3300048929 | Bacteria | 3336 |
| 1491 | Ga0496126_0068498 | 3300048929 | Bacteria | 3168 |
| 1492 | Ga0496126_0100099 | 3300048929 | Bacteria | 2537 |
| 1493 | Ga0496126_0130795 | 3300048929 | Bacteria | 2169 |
| 1494 | Ga0496126_0207432 | 3300048929 | Bacteria | 1651 |
| 1495 | Ga0496126_0208690 | 3300048929 | Bacteria | 1645 |
| 1496 | Ga0496126_0225436 | 3300048929 | Bacteria | 1572 |
| 1497 | Ga0496126_0277785 | 3300048929 | Bacteria | 1388 |
| 1498 | Ga0496126_0312298 | 3300048929 | Bacteria | 1294 |
| 1499 | Ga0496126_0361231 | 3300048929 | Bacteria | 1186 |
| 1500 | Ga0496126_0363217 | 3300048929 | Bacteria | 1182 |
| 1501 | Ga0496126_0512357 | 3300048929 | Bacteria | 957 |
| 1502 | Ga0496126_0565216 | 3300048929 | Bacteria | 900 |
| 1503 | Ga0496126_0734024 | 3300048929 | Bacteria | 764 |
| 1504 | Ga0496126_0905897 | 3300048929 | Bacteria | 668 |
| 1505 | Ga0495678_144482 | 3300049459 | Bacteria | 775 |
| 1506 | Ga0495682_0003462 | 3300049460 | Bacteria | 7014 |
| 1507 | Ga0495682_0060395 | 3300049460 | Bacteria | 1369 |
| 1508 | Ga0501031_0000946 | 3300049568 | Bacteria | 17557 |
| 1509 | Ga0501031_0005295 | 3300049568 | Bacteria | 8400 |
| 1510 | Ga0501031_0032191 | 3300049568 | Bacteria | 3419 |
| 1511 | Ga0501032_0000329 | 3300049569 | Bacteria | 39691 |
| 1512 | Ga0501032_0010457 | 3300049569 | Bacteria | 6693 |
| 1513 | Ga0501032_0026506 | 3300049569 | Bacteria | 3984 |
| 1514 | Ga0501032_0069586 | 3300049569 | Bacteria | 2348 |
| 1515 | Ga0501032_0194723 | 3300049569 | Bacteria | 1324 |
| 1516 | Ga0501032_0365845 | 3300049569 | Bacteria | 928 |
| 1517 | Ga0501032_0438956 | 3300049569 | Bacteria | 837 |
| 1518 | Ga0501033_0000140 | 3300049570 | Bacteria | 70162 |
| 1519 | Ga0501033_0001234 | 3300049570 | Bacteria | 22939 |
| 1520 | Ga0501033_0027357 | 3300049570 | Bacteria | 4287 |
| 1521 | Ga0501033_0043768 | 3300049570 | Bacteria | 3333 |
| 1522 | Ga0501033_0273162 | 3300049570 | Bacteria | 1194 |
| 1523 | Ga0501034_0000072 | 3300049571 | Bacteria | 179824 |
| 1524 | Ga0501034_0001020 | 3300049571 | Bacteria | 40131 |
| 1525 | Ga0501034_0068138 | 3300049571 | Bacteria | 3570 |
| 1526 | Ga0501034_0097128 | 3300049571 | Bacteria | 2942 |
| 1527 | Ga0501034_0110745 | 3300049571 | Bacteria | 2736 |
| 1528 | Ga0501034_0221349 | 3300049571 | Bacteria | 1845 |
| 1529 | Ga0501034_0276062 | 3300049571 | Bacteria | 1620 |
| 1530 | Ga0501034_0644797 | 3300049571 | Bacteria | 961 |
| 1531 | Ga0501036_0000050 | 3300049572 | Bacteria | 75340 |
| 1532 | Ga0501036_0018274 | 3300049572 | Bacteria | 5871 |
| 1533 | Ga0501036_0053063 | 3300049572 | Bacteria | 3434 |
| 1534 | Ga0501036_0303755 | 3300049572 | Bacteria | 1334 |
| 1535 | Ga0501036_0328208 | 3300049572 | Bacteria | 1278 |
| 1536 | Ga0501036_0341412 | 3300049572 | Bacteria | 1251 |
| 1537 | Ga0501036_0738254 | 3300049572 | Bacteria | 812 |
| 1538 | Ga0501037_0000030 | 3300049573 | Bacteria | 136148 |
| 1539 | Ga0501037_0000580 | 3300049573 | Bacteria | 28773 |
| 1540 | Ga0501037_0151612 | 3300049573 | Bacteria | 1656 |
| 1541 | Ga0501037_0182547 | 3300049573 | Bacteria | 1488 |
| 1542 | Ga0501037_0270237 | 3300049573 | Bacteria | 1186 |
| 1543 | Ga0501037_0469317 | 3300049573 | Bacteria | 857 |
| 1544 | Ga0501038_0000039 | 3300049574 | Bacteria | 122904 |
| 1545 | Ga0501038_0007292 | 3300049574 | Bacteria | 10206 |
| 1546 | Ga0501038_0028303 | 3300049574 | Bacteria | 4979 |
| 1547 | Ga0501038_0038610 | 3300049574 | Bacteria | 4180 |
| 1548 | Ga0501038_0433522 | 3300049574 | Bacteria | 1013 |
| 1549 | Ga0501039_0000060 | 3300049575 | Bacteria | 85528 |
| 1550 | Ga0501039_0032111 | 3300049575 | Bacteria | 4047 |
| 1551 | Ga0501039_0127856 | 3300049575 | Bacteria | 1993 |
| 1552 | Ga0501039_0159198 | 3300049575 | Bacteria | 1774 |
| 1553 | Ga0501039_0239165 | 3300049575 | Bacteria | 1428 |
| 1554 | Ga0501039_0248133 | 3300049575 | Bacteria | 1400 |
| 1555 | Ga0501039_0560394 | 3300049575 | Bacteria | 896 |
| 1556 | Ga0501040_0006065 | 3300049576 | Bacteria | 7832 |
| 1557 | Ga0501041_0379512 | 3300049577 | Bacteria | 894 |
| 1558 | Ga0501042_0005278 | 3300049578 | Bacteria | 8304 |
| 1559 | Ga0501042_0010958 | 3300049578 | Bacteria | 6103 |
| 1560 | Ga0501042_0030827 | 3300049578 | Bacteria | 3791 |
| 1561 | Ga0501042_0527459 | 3300049578 | Bacteria | 858 |
| 1562 | Ga0501043_0009259 | 3300049579 | Bacteria | 7738 |
| 1563 | Ga0501043_0035883 | 3300049579 | Bacteria | 3901 |
| 1564 | Ga0501043_0042113 | 3300049579 | Bacteria | 3587 |
| 1565 | Ga0501043_0045148 | 3300049579 | Bacteria | 3465 |
| 1566 | Ga0501043_0251366 | 3300049579 | Bacteria | 1361 |
| 1567 | Ga0501046_0000419 | 3300049580 | Bacteria | 42326 |
| 1568 | Ga0501046_0011289 | 3300049580 | Bacteria | 7644 |
| 1569 | Ga0501046_0091782 | 3300049580 | Bacteria | 2335 |
| 1570 | Ga0501046_0173125 | 3300049580 | Bacteria | 1618 |
| 1571 | Ga0501046_0372165 | 3300049580 | Bacteria | 1035 |
| 1572 | Ga0501047_0000174 | 3300049581 | Bacteria | 79021 |
| 1573 | Ga0501047_0038683 | 3300049581 | Bacteria | 4615 |
| 1574 | Ga0501047_0185687 | 3300049581 | Bacteria | 1944 |
| 1575 | Ga0501047_0428033 | 3300049581 | Bacteria | 1154 |
| 1576 | Ga0501047_0510880 | 3300049581 | Bacteria | 1028 |
| 1577 | Ga0501047_0811252 | 3300049581 | Bacteria | 750 |
| 1578 | Ga0501048_0000068 | 3300049582 | Bacteria | 53016 |
| 1579 | Ga0501048_0005561 | 3300049582 | Bacteria | 9585 |
| 1580 | Ga0501048_0033997 | 3300049582 | Bacteria | 3681 |
| 1581 | Ga0501048_0130953 | 3300049582 | Bacteria | 1773 |
| 1582 | Ga0501067_0000239 | 3300049583 | Bacteria | 30445 |
| 1583 | Ga0501067_0018480 | 3300049583 | Bacteria | 3861 |
| 1584 | Ga0501067_0043286 | 3300049583 | Bacteria | 2500 |
| 1585 | Ga0501067_0275596 | 3300049583 | Bacteria | 937 |
| 1586 | Ga0501068_0000227 | 3300049584 | Bacteria | 27306 |
| 1587 | Ga0501068_0005447 | 3300049584 | Bacteria | 6964 |
| 1588 | Ga0501068_0148656 | 3300049584 | Bacteria | 1471 |
| 1589 | Ga0501068_0392281 | 3300049584 | Bacteria | 895 |
| 1590 | Ga0501068_0625810 | 3300049584 | Bacteria | 702 |
| 1591 | Ga0501068_0683633 | 3300049584 | Bacteria | 671 |
| 1592 | Ga0501069_0015919 | 3300049585 | Bacteria | 4032 |
| 1593 | Ga0501069_0194362 | 3300049585 | Bacteria | 1174 |
| 1594 | Ga0501070_0013633 | 3300049586 | Bacteria | 6850 |
| 1595 | Ga0501070_0019317 | 3300049586 | Bacteria | 5715 |
| 1596 | Ga0501070_0111360 | 3300049586 | Bacteria | 2262 |
| 1597 | Ga0501070_0131274 | 3300049586 | Bacteria | 2069 |
| 1598 | Ga0501070_0137291 | 3300049586 | Bacteria | 2019 |
| 1599 | Ga0501070_0145913 | 3300049586 | Bacteria | 1953 |
| 1600 | Ga0501070_0428653 | 3300049586 | Bacteria | 1067 |
| 1601 | Ga0501071_0015009 | 3300049587 | Bacteria | 5309 |
| 1602 | Ga0501071_0503427 | 3300049587 | Bacteria | 929 |
| 1603 | Ga0501071_0519834 | 3300049587 | Bacteria | 913 |
| 1604 | Ga0501072_0065634 | 3300049588 | Bacteria | 2862 |
| 1605 | Ga0501072_0067565 | 3300049588 | Bacteria | 2820 |
| 1606 | Ga0501072_0635447 | 3300049588 | Bacteria | 841 |
| 1607 | Ga0501073_0000009 | 3300049589 | Bacteria | 195649 |
| 1608 | Ga0501073_0009574 | 3300049589 | Bacteria | 7145 |
| 1609 | Ga0501073_0041581 | 3300049589 | Bacteria | 3248 |
| 1610 | Ga0501074_0000049 | 3300049590 | Bacteria | 56854 |
| 1611 | Ga0501074_0006029 | 3300049590 | Bacteria | 8747 |
| 1612 | Ga0501074_0129548 | 3300049590 | Bacteria | 1805 |
| 1613 | Ga0501074_0515052 | 3300049590 | Bacteria | 847 |
| 1614 | Ga0501075_0097959 | 3300049591 | Bacteria | 2226 |
| 1615 | Ga0501076_0016565 | 3300049592 | Bacteria | 5588 |
| 1616 | Ga0501076_0103098 | 3300049592 | Bacteria | 2301 |
| 1617 | Ga0501076_0130960 | 3300049592 | Bacteria | 2034 |
| 1618 | Ga0501077_0101337 | 3300049593 | Bacteria | 1825 |
| 1619 | Ga0501077_0114788 | 3300049593 | Bacteria | 1707 |
| 1620 | Ga0501077_0337825 | 3300049593 | Bacteria | 961 |
| 1621 | Ga0501079_0030777 | 3300049741 | Bacteria | 4124 |
| 1622 | Ga0501079_0129494 | 3300049741 | Bacteria | 1963 |
| 1623 | Ga0501079_0185439 | 3300049741 | Bacteria | 1624 |
| 1624 | Ga0501079_0435831 | 3300049741 | Bacteria | 1029 |
| 1625 | Ga0501079_0479178 | 3300049741 | Bacteria | 978 |
| 1626 | Ga0501080_0009583 | 3300049742 | Bacteria | 8842 |
| 1627 | Ga0501080_0011921 | 3300049742 | Bacteria | 7961 |
| 1628 | Ga0501080_0027522 | 3300049742 | Bacteria | 5287 |
| 1629 | Ga0501080_0039570 | 3300049742 | Bacteria | 4400 |
| 1630 | Ga0501080_0455452 | 3300049742 | Bacteria | 1147 |
| 1631 | Ga0501081_0175569 | 3300049743 | Bacteria | 1548 |
| 1632 | Ga0501083_0000251 | 3300049744 | Bacteria | 34183 |
| 1633 | Ga0501083_0022825 | 3300049744 | Bacteria | 4341 |
| 1634 | Ga0501035_0000067 | 3300049822 | Bacteria | 129204 |
| 1635 | Ga0501035_0029907 | 3300049822 | Bacteria | 4967 |
| 1636 | Ga0501035_0251266 | 3300049822 | Bacteria | 1501 |
| 1637 | Ga0501035_0398985 | 3300049822 | Bacteria | 1144 |
| 1638 | Ga0501035_0410605 | 3300049822 | Bacteria | 1125 |
| 1639 | Ga0501035_0528315 | 3300049822 | Bacteria | 968 |
| 1640 | Ga0501035_0794665 | 3300049822 | Bacteria | 756 |
| 1641 | Ga0501044_0000258 | 3300049823 | Bacteria | 67161 |
| 1642 | Ga0501044_0028375 | 3300049823 | Bacteria | 5907 |
| 1643 | Ga0501044_0032575 | 3300049823 | Bacteria | 5477 |
| 1644 | Ga0501044_0044657 | 3300049823 | Bacteria | 4597 |
| 1645 | Ga0501044_0082260 | 3300049823 | Bacteria | 3258 |
| 1646 | Ga0501044_0144020 | 3300049823 | Bacteria | 2370 |
| 1647 | Ga0501044_0247622 | 3300049823 | Bacteria | 1724 |
| 1648 | Ga0501044_0390598 | 3300049823 | Bacteria | 1305 |
| 1649 | Ga0501044_0437253 | 3300049823 | Bacteria | 1216 |
| 1650 | Ga0501044_0451905 | 3300049823 | Bacteria | 1191 |
| 1651 | Ga0501045_0015738 | 3300049824 | Bacteria | 5366 |
| 1652 | Ga0501045_0022830 | 3300049824 | Bacteria | 4481 |
| 1653 | nmdc:mga03683_42818_c1 | 3300050489 | Bacteria | 1865 |
| 1654 | nmdc:mga03n38_10359_c1 | 3300050490 | Bacteria | 3425 |
| 1655 | nmdc:mga03n38_70977_c1 | 3300050490 | Bacteria | 1612 |
| 1656 | nmdc:mga00v17_179408_c1 | 3300050491 | Bacteria | 1366 |
| 1657 | nmdc:mga00v17_294550_c1 | 3300050491 | Bacteria | 1054 |
| 1658 | nmdc:mga00v17_76067_c1 | 3300050491 | Bacteria | 2088 |
| 1659 | nmdc:mga00v17_98756_c1 | 3300050491 | Bacteria | 1841 |
| 1660 | nmdc:mga0yw44_239785_c1 | 3300050492 | Bacteria | 1205 |
| 1661 | nmdc:mga0yw44_514038_c1 | 3300050492 | Bacteria | 813 |
| 1662 | nmdc:mga0k408_103724_c1 | 3300050493 | Bacteria | 1678 |
| 1663 | nmdc:mga06z11_149339_c1 | 3300050494 | Bacteria | 1327 |
| 1664 | nmdc:mga06z11_29780_c1 | 3300050494 | Bacteria | 2634 |
| 1665 | nmdc:mga06z11_299517_c1 | 3300050494 | Bacteria | 956 |
| 1666 | nmdc:mga06z11_40821_c1 | 3300050494 | Bacteria | 2318 |
| 1667 | nmdc:mga06z11_53027_c1 | 3300050494 | Bacteria | 2084 |
| 1668 | nmdc:mga06z11_544520_c1 | 3300050494 | Bacteria | 705 |
| 1669 | nmdc:mga04h51_100979_c1 | 3300050495 | Bacteria | 1051 |
| 1670 | nmdc:mga04h51_177382_c1 | 3300050495 | Bacteria | 828 |
| 1671 | nmdc:mga04h51_27367_c1 | 3300050495 | Bacteria | 1771 |
| 1672 | nmdc:mga04h51_75880_c1 | 3300050495 | Bacteria | 1183 |
| 1673 | nmdc:mga07m45_135203_c1 | 3300050496 | Bacteria | 1427 |
| 1674 | nmdc:mga07m45_140890_c1 | 3300050496 | Bacteria | 1397 |
| 1675 | nmdc:mga07m45_395047_c1 | 3300050496 | Bacteria | 803 |
| 1676 | nmdc:mga09592_294600_c1 | 3300050508 | Bacteria | 1407 |
| 1677 | nmdc:mga09592_528540_c1 | 3300050508 | Bacteria | 1014 |
| 1678 | nmdc:mga0qj67_657461_c1 | 3300050509 | Bacteria | 836 |
| 1679 | nmdc:mga06r32_119899_c1 | 3300050510 | Bacteria | 2594 |
| 1680 | nmdc:mga06r32_301476_c1 | 3300050510 | Bacteria | 1588 |
| 1681 | nmdc:mga06r32_785428_c1 | 3300050510 | Bacteria | 914 |
| 1682 | nmdc:mga08y16_138351_c1 | 3300050511 | Bacteria | 2532 |
| 1683 | nmdc:mga08y16_140320_c1 | 3300050511 | Bacteria | 2512 |
| 1684 | nmdc:mga08y16_616682_c1 | 3300050511 | Bacteria | 1092 |
| 1685 | nmdc:mga0n895_522168_c1 | 3300050512 | Bacteria | 1195 |
| 1686 | nmdc:mga0n895_650660_c1 | 3300050512 | Bacteria | 1053 |
| 1687 | nmdc:mga0n895_82387_c1 | 3300050512 | Bacteria | 3207 |
| 1688 | nmdc:mga0rr50_108376_c1 | 3300050513 | Bacteria | 2194 |
| 1689 | nmdc:mga0rr50_29681_c1 | 3300050513 | Bacteria | 3861 |
| 1690 | nmdc:mga08x19_200664_c1 | 3300050514 | Bacteria | 1367 |
| 1691 | nmdc:mga0a205_369212_c1 | 3300050515 | Bacteria | 1301 |
| 1692 | nmdc:mga0a205_5596_c1 | 3300050515 | Bacteria | 11322 |
| 1693 | nmdc:mga0sz30_10467_c1 | 3300050516 | Bacteria | 3558 |
| 1694 | nmdc:mga0sz30_17818_c1 | 3300050516 | Bacteria | 2836 |
| 1695 | nmdc:mga0sz30_199290_c1 | 3300050516 | Bacteria | 889 |
| 1696 | nmdc:mga0sz30_34515_c1 | 3300050516 | Bacteria | 2107 |
| 1697 | Ga0495601_0052538 | 3300053077 | Bacteria | 2573 |
| 1698 | Ga0495601_0153803 | 3300053077 | Bacteria | 1502 |
| 1699 | Ga0495601_0181861 | 3300053077 | Bacteria | 1374 |
| 1700 | Ga0495601_0307767 | 3300053077 | Bacteria | 1032 |
| 1701 | Ga0495601_0397807 | 3300053077 | Bacteria | 893 |
| 1702 | Ga0495612_0030896 | 3300053078 | Bacteria | 2158 |
| 1703 | Ga0500610_0181776 | 3300053079 | Bacteria | 1029 |
| 1704 | Ga0495655_0009530 | 3300053083 | Bacteria | 1887 |
| 1705 | Ga0495655_0054531 | 3300053083 | Bacteria | 1070 |
| 1706 | Ga0495655_0127642 | 3300053083 | Bacteria | 780 |
| 1707 | Ga0495595_0002393 | 3300053084 | Bacteria | 7324 |
| 1708 | Ga0495595_0012856 | 3300053084 | Bacteria | 3529 |
| 1709 | Ga0495619_0000630 | 3300053085 | Bacteria | 23277 |
| 1710 | Ga0495619_0004668 | 3300053085 | Bacteria | 8728 |
| 1711 | Ga0495619_0023019 | 3300053085 | Bacteria | 3990 |
| 1712 | Ga0495619_0095094 | 3300053085 | Bacteria | 2021 |
| 1713 | Ga0495619_0134172 | 3300053085 | Bacteria | 1702 |
| 1714 | Ga0495619_0313676 | 3300053085 | Bacteria | 1086 |
| 1715 | Ga0500643_000013 | 3300053087 | Bacteria | 324296 |
| 1716 | Ga0500644_0014340 | 3300053088 | Bacteria | 2235 |
| 1717 | Ga0500644_0167880 | 3300053088 | Bacteria | 891 |
| 1718 | Ga0500581_032588 | 3300053089 | Bacteria | 2666 |
| 1719 | Ga0500581_158955 | 3300053089 | Bacteria | 1052 |
| 1720 | Ga0500647_0030491 | 3300053091 | Bacteria | 2562 |
| 1721 | Ga0500647_0062056 | 3300053091 | Bacteria | 1799 |
| 1722 | Ga0500651_0173478 | 3300053093 | Bacteria | 1284 |
| 1723 | Ga0500651_0357220 | 3300053093 | Bacteria | 828 |
| 1724 | Ga0500566_0000368 | 3300053094 | Bacteria | 24650 |
| 1725 | Ga0500566_0001157 | 3300053094 | Bacteria | 15353 |
| 1726 | Ga0500566_0049191 | 3300053094 | Bacteria | 2415 |
| 1727 | Ga0500566_0088650 | 3300053094 | Bacteria | 1712 |
| 1728 | Ga0500566_0198014 | 3300053094 | Bacteria | 1017 |
| 1729 | Ga0500641_0013287 | 3300053096 | Bacteria | 3022 |
| 1730 | Ga0500641_0035646 | 3300053096 | Bacteria | 1986 |
| 1731 | Ga0500641_0106243 | 3300053096 | Bacteria | 1206 |
| 1732 | Ga0500648_182017 | 3300053097 | Bacteria | 1080 |
| 1733 | Ga0500650_0132863 | 3300053098 | Bacteria | 1156 |
| 1734 | Ga0500554_137689 | 3300053102 | Bacteria | 825 |
| 1735 | Ga0500555_020600 | 3300053103 | Bacteria | 1900 |
| 1736 | Ga0500556_0000029 | 3300053104 | Bacteria | 165326 |
| 1737 | Ga0500557_000077 | 3300053105 | Bacteria | 36950 |
| 1738 | Ga0500562_027619 | 3300053108 | Bacteria | 1489 |
| 1739 | Ga0500572_007440 | 3300053111 | Bacteria | 2535 |
| 1740 | Ga0500592_001314 | 3300053116 | Bacteria | 4043 |
| 1741 | Ga0500592_029342 | 3300053116 | Bacteria | 887 |
| 1742 | Ga0500594_0017938 | 3300053118 | Bacteria | 1738 |
| 1743 | Ga0500594_0162243 | 3300053118 | Bacteria | 723 |
| 1744 | Ga0500595_000413 | 3300053119 | Bacteria | 27218 |
| 1745 | Ga0500595_004232 | 3300053119 | Bacteria | 6488 |
| 1746 | Ga0500595_004585 | 3300053119 | Bacteria | 6164 |
| 1747 | Ga0500595_006515 | 3300053119 | Bacteria | 4943 |
| 1748 | Ga0500595_017562 | 3300053119 | Bacteria | 2638 |
| 1749 | Ga0500595_060464 | 3300053119 | Bacteria | 1146 |
| 1750 | Ga0500607_087275 | 3300053121 | Bacteria | 1577 |
| 1751 | Ga0500607_089952 | 3300053121 | Bacteria | 1546 |
| 1752 | Ga0500608_035959 | 3300053122 | Bacteria | 2363 |
| 1753 | Ga0500614_094925 | 3300053123 | Bacteria | 852 |
| 1754 | Ga0500621_191913 | 3300053126 | Bacteria | 731 |
| 1755 | Ga0500642_0000020 | 3300053130 | Bacteria | 159498 |
| 1756 | Ga0500642_0000155 | 3300053130 | Bacteria | 28326 |
| 1757 | Ga0500642_0030053 | 3300053130 | Bacteria | 2257 |
| 1758 | Ga0500642_0090877 | 3300053130 | Bacteria | 1411 |
| 1759 | Ga0500652_000109 | 3300053131 | Bacteria | 32551 |
| 1760 | Ga0500655_011853 | 3300053133 | Bacteria | 1583 |
| 1761 | Ga0500658_0108476 | 3300053134 | Bacteria | 1219 |
| 1762 | Ga0500559_0000517 | 3300053136 | Bacteria | 27108 |
| 1763 | Ga0500559_0094840 | 3300053136 | Bacteria | 1369 |
| 1764 | Ga0500559_0103024 | 3300053136 | Bacteria | 1316 |
| 1765 | Ga0500559_0197217 | 3300053136 | Bacteria | 949 |
| 1766 | Ga0500561_0149560 | 3300053137 | Bacteria | 726 |
| 1767 | Ga0500564_065616 | 3300053138 | Bacteria | 1642 |
| 1768 | Ga0500568_0003634 | 3300053139 | Bacteria | 8500 |
| 1769 | Ga0500568_0031574 | 3300053139 | Bacteria | 2184 |
| 1770 | Ga0500573_0183116 | 3300053140 | Bacteria | 1124 |
| 1771 | Ga0500577_0001333 | 3300053142 | Bacteria | 6311 |
| 1772 | Ga0500577_0044084 | 3300053142 | Bacteria | 1642 |
| 1773 | Ga0500577_0053909 | 3300053142 | Bacteria | 1521 |
| 1774 | Ga0500589_087476 | 3300053147 | Bacteria | 1380 |
| 1775 | Ga0500590_020301 | 3300053148 | Bacteria | 3447 |
| 1776 | Ga0500590_083867 | 3300053148 | Bacteria | 1560 |
| 1777 | Ga0500590_095143 | 3300053148 | Bacteria | 1440 |
| 1778 | Ga0500603_001376 | 3300053150 | Bacteria | 5547 |
| 1779 | Ga0500604_0001164 | 3300053151 | Bacteria | 7305 |
| 1780 | Ga0500604_0045443 | 3300053151 | Bacteria | 1340 |
| 1781 | Ga0500616_0000048 | 3300053153 | Bacteria | 313108 |
| 1782 | Ga0500616_0000112 | 3300053153 | Bacteria | 151210 |
| 1783 | Ga0500622_0003950 | 3300053156 | Bacteria | 9578 |
| 1784 | Ga0500622_0005537 | 3300053156 | Bacteria | 7553 |
| 1785 | Ga0500627_0010686 | 3300053158 | Bacteria | 3356 |
| 1786 | Ga0500627_0019555 | 3300053158 | Bacteria | 2701 |
| 1787 | Ga0500633_0003166 | 3300053160 | Bacteria | 3535 |
| 1788 | Ga0500638_115914 | 3300053162 | Bacteria | 1231 |
| 1789 | Ga0500638_166815 | 3300053162 | Bacteria | 963 |
| 1790 | Ga0500638_183688 | 3300053162 | Bacteria | 900 |
| 1791 | Ga0500638_210521 | 3300053162 | Bacteria | 815 |
| 1792 | Ga0500638_222694 | 3300053162 | Bacteria | 781 |
| 1793 | Ga0500639_021054 | 3300053163 | Bacteria | 3446 |
| 1794 | Ga0500639_084480 | 3300053163 | Bacteria | 1593 |
| 1795 | Ga0500636_0002634 | 3300053177 | Bacteria | 9976 |
| 1796 | Ga0500636_0030897 | 3300053177 | Bacteria | 3170 |
| 1797 | Ga0500636_0271079 | 3300053177 | Bacteria | 853 |
| 1798 | Ga0500637_0000167 | 3300053178 | Bacteria | 24370 |
| 1799 | Ga0500637_0029622 | 3300053178 | Bacteria | 3037 |
| 1800 | Ga0500611_003582 | 3300053727 | Bacteria | 2007 |
| 1801 | Ga0500645_014193 | 3300053730 | Bacteria | 2541 |
| 1802 | Ga0500552_032337 | 3300053733 | Bacteria | 812 |
| 1803 | Ga0500596_012745 | 3300053735 | Bacteria | 1273 |
| 1804 | Ga0500596_032965 | 3300053735 | Bacteria | 808 |
| 1805 | Ga0500601_000600 | 3300053737 | Bacteria | 5137 |
| 1806 | Ga0501084_0002907 | 3300054114 | Bacteria | 13869 |
| 1807 | Ga0501084_0009842 | 3300054114 | Bacteria | 7901 |
| 1808 | Ga0500661_001069 | 3300055283 | Bacteria | 5170 |
| 1809 | Ga0587128_033533 | 3300059630 | Bacteria | 864 |
| 1810 | Ga0501082_0000285 | 3300060353 | Bacteria | 44550 |
| 1811 | Ga0501082_0017294 | 3300060353 | Bacteria | 6211 |
| 1812 | Ga0466962_0072043 | 3300061719 | Bacteria | 1651 |
| 1813 | Ga0466962_0340697 | 3300061719 | Bacteria | 746 |
| 1814 | 2824763207 | 2824753945 | Bacteria | 9787441 |
| 1815 | LJQas_1014093 | |||
| 1816 | JGI24736J21556_1035744 | |||
| 1817 | JGI24740J21852_10072451 | |||
| 1818 | JGI24739J22299_10081692 | |||
| 1819 | JGI24737J22298_10060946 | |||
| 1820 | JGI24737J22298_10091649 | |||
| 1821 | JGI24735J21928_10014119 | |||
| 1822 | JGI24738J21930_10018347 | |||
| 1823 | JGI24738J21930_10019471 | |||
| 1824 | JGI24744J21845_10035441 | |||
| 1825 | JGI25406J46586_10000043 | |||
| 1826 | JGI25406J46586_10010825 | |||
| 1827 | JGI25406J46586_10018195 | |||
| 1828 | JGI25406J46586_10085391 | |||
| 1829 | JGI25165J46597_1003856 | |||
| 1830 | JGI25153J46596_10072615 | |||
| 1831 | rootH1_10028015 | |||
| 1832 | JGI25160J50197_1001494 | |||
| 1833 | JGI25160J50197_1002898 | |||
| 1834 | JGI25160J50197_1032553 | |||
| 1835 | JGI25404J52841_10068100 | |||
| 1836 | Ga0055531_10008612 | |||
| 1837 | JGI25405J52794_10055416 | |||
| 1838 | Ga0055543_1011814 | |||
| 1839 | Ga0065165_1003257 | |||
| 1840 | Ga0065165_1003499 | |||
| 1841 | Ga0065165_1010766 | |||
| 1842 | Ga0065165_1025431 | |||
| 1843 | Ga0070658_10033745 | |||
| 1844 | Ga0070658_10427597 | |||
| 1845 | Ga0070683_100064413 | |||
| 1846 | Ga0070683_100078373 | |||
| 1847 | Ga0070683_100261695 | |||
| 1848 | Ga0070690_100000828 | |||
| 1849 | Ga0070690_100439083 | |||
| 1850 | Ga0070670_100002211 | |||
| 1851 | Ga0070670_100265280 | |||
| 1852 | Ga0068869_100047504 | |||
| 1853 | Ga0068869_100366021 | |||
| 1854 | Ga0070666_10015263 | |||
| 1855 | Ga0070666_10412773 | |||
| 1856 | Ga0070680_100047788 | |||
| 1857 | Ga0070680_100119724 | |||
| 1858 | Ga0070680_100212420 | |||
| 1859 | Ga0070680_100221154 | |||
| 1860 | Ga0070682_100039316 | |||
| 1861 | Ga0068868_100006575 | |||
| 1862 | Ga0068868_100624917 | |||
| 1863 | Ga0070660_100001272 | |||
| 1864 | Ga0070660_100073011 | |||
| 1865 | Ga0070660_100093768 | |||
| 1866 | Ga0070660_100119358 | |||
| 1867 | Ga0070660_100620570 | |||
| 1868 | Ga0070689_100004861 | |||
| 1869 | Ga0070691_10000310 | |||
| 1870 | Ga0070687_100010068 | |||
| 1871 | Ga0070687_100397661 | |||
| 1872 | Ga0070661_100001241 | |||
| 1873 | Ga0070692_10000736 | |||
| 1874 | Ga0070668_100000234 | |||
| 1875 | Ga0070668_100122354 | |||
| 1876 | Ga0070668_100196763 | |||
| 1877 | Ga0070669_100021148 | |||
| 1878 | Ga0070669_100571549 | |||
| 1879 | Ga0070669_101192093 | |||
| 1880 | Ga0070675_100102654 | |||
| 1881 | Ga0070675_100368946 | |||
| 1882 | Ga0070675_101271426 | |||
| 1883 | Ga0070671_100004140 | |||
| 1884 | Ga0070671_100134309 | |||
| 1885 | Ga0070671_100434865 | |||
| 1886 | Ga0070674_100120767 | |||
| 1887 | Ga0070673_100000403 | |||
| 1888 | Ga0070673_100272676 | |||
| 1889 | Ga0070673_100412443 | |||
| 1890 | Ga0070673_100499583 | |||
| 1891 | Ga0070688_100001474 | |||
| 1892 | Ga0070659_100008990 | |||
| 1893 | Ga0070659_100054939 | |||
| 1894 | Ga0070659_100225513 | |||
| 1895 | Ga0070667_100003240 | |||
| 1896 | Ga0070667_100052713 | |||
| 1897 | Ga0070709_10006897 | |||
| 1898 | Ga0070709_10007955 | |||
| 1899 | Ga0070709_10029947 | |||
| 1900 | Ga0070714_100012712 | |||
| 1901 | Ga0070714_100016007 | |||
| 1902 | Ga0070714_100028213 | |||
| 1903 | Ga0070714_100085025 | |||
| 1904 | Ga0070714_100119195 | |||
| 1905 | Ga0070714_100125520 | |||
| 1906 | Ga0070713_100007026 | |||
| 1907 | Ga0070713_100193746 | |||
| 1908 | Ga0070713_100234420 | |||
| 1909 | Ga0070713_100836135 | |||
| 1910 | Ga0070710_10001642 | |||
| 1911 | Ga0070710_10005669 | |||
| 1912 | Ga0070710_10011317 | |||
| 1913 | Ga0070710_10029302 | |||
| 1914 | Ga0070710_10456972 | |||
| 1915 | Ga0070701_10004206 | |||
| 1916 | Ga0070711_100023747 | |||
| 1917 | Ga0070711_100024919 | |||
| 1918 | Ga0070711_100042723 | |||
| 1919 | Ga0070711_100260716 | |||
| 1920 | Ga0070711_100444674 | |||
| 1921 | Ga0070705_100001109 | |||
| 1922 | Ga0070700_100005223 | |||
| 1923 | Ga0070700_100949402 | |||
| 1924 | Ga0070694_100002601 | |||
| 1925 | Ga0070663_100001201 | |||
| 1926 | Ga0070663_100007668 | |||
| 1927 | Ga0070663_100009968 | |||
| 1928 | Ga0070663_100147422 | |||
| 1929 | Ga0070663_100184483 | |||
| 1930 | Ga0070663_100275329 | |||
| 1931 | Ga0070663_100384719 | |||
| 1932 | Ga0070678_100002064 | |||
| 1933 | Ga0070678_100234528 | |||
| 1934 | Ga0070678_100249981 | |||
| 1935 | Ga0070678_100250971 | |||
| 1936 | Ga0070678_100454387 | |||
| 1937 | Ga0070678_100731400 | |||
| 1938 | Ga0070662_100003035 | |||
| 1939 | Ga0070662_100190550 | |||
| 1940 | Ga0070662_100219111 | |||
| 1941 | Ga0070662_100370175 | |||
| 1942 | Ga0070662_100508879 | |||
| 1943 | Ga0070681_10042162 | |||
| 1944 | Ga0070681_10054507 | |||
| 1945 | Ga0070681_10075815 | |||
| 1946 | Ga0070681_10084466 | |||
| 1947 | Ga0070681_10134876 | |||
| 1948 | Ga0070681_10206855 | |||
| 1949 | Ga0070681_10221463 | |||
| 1950 | Ga0070681_10683442 | |||
| 1951 | Ga0068867_100176779 | |||
| 1952 | Ga0068867_100371539 | |||
| 1953 | Ga0068867_100495203 | |||
| 1954 | Ga0070706_100369256 | |||
| 1955 | Ga0070698_100008454 | |||
| 1956 | Ga0070698_100117600 | |||
| 1957 | Ga0070699_100055104 | |||
| 1958 | Ga0070679_100030467 | |||
| 1959 | Ga0070679_100032524 | |||
| 1960 | Ga0070679_100178059 | |||
| 1961 | Ga0070679_100481287 | |||
| 1962 | Ga0070679_100773961 | |||
| 1963 | Ga0070684_100002674 | |||
| 1964 | Ga0070684_100011830 | |||
| 1965 | Ga0070684_100289769 | |||
| 1966 | Ga0070684_100385751 | |||
| 1967 | Ga0070697_100004351 | |||
| 1968 | Ga0068853_100002553 | |||
| 1969 | Ga0068853_100011155 | |||
| 1970 | Ga0068853_100062055 | |||
| 1971 | Ga0068853_100509450 | |||
| 1972 | Ga0068853_100552721 | |||
| 1973 | Ga0068853_100814372 | |||
| 1974 | Ga0068853_101440628 | |||
| 1975 | Ga0070686_100001906 | |||
| 1976 | Ga0070695_100001397 | |||
| 1977 | Ga0070695_100175499 | |||
| 1978 | Ga0070696_100002930 | |||
| 1979 | Ga0070693_100000657 | |||
| 1980 | Ga0070693_100022640 | |||
| 1981 | Ga0070693_100178187 | |||
| 1982 | Ga0070693_100198727 | |||
| 1983 | Ga0070693_100315301 | |||
| 1984 | Ga0070693_100715344 | |||
| 1985 | Ga0070665_100010067 | |||
| 1986 | Ga0070665_100188279 | |||
| 1987 | Ga0070665_100207035 | |||
| 1988 | Ga0070665_100505028 | |||
| 1989 | Ga0070665_100698331 | |||
| 1990 | Ga0070665_101086553 | |||
| 1991 | Ga0070704_100001520 | |||
| 1992 | Ga0068855_100004506 | |||
| 1993 | Ga0068855_100062579 | |||
| 1994 | Ga0068855_100064363 | |||
| 1995 | Ga0068855_100204887 | |||
| 1996 | Ga0068855_100432807 | |||
| 1997 | Ga0068855_100487242 | |||
| 1998 | Ga0068855_100538215 | |||
| 1999 | Ga0068855_100817629 | |||
| 2000 | Ga0070664_100002217 | |||
| 2001 | Ga0070664_100092661 | |||
| 2002 | Ga0070664_100144711 | |||
| 2003 | Ga0068857_100001194 | |||
| 2004 | Ga0068857_100025466 | |||
| 2005 | Ga0068857_100071713 | |||
| 2006 | Ga0068857_100168899 | |||
| 2007 | Ga0068857_100194380 | |||
| 2008 | Ga0068854_100012304 | |||
| 2009 | Ga0068854_100021056 | |||
| 2010 | Ga0068854_100171309 | |||
| 2011 | Ga0068854_100399152 | |||
| 2012 | Ga0068854_100477178 | |||
| 2013 | Ga0068854_100600368 | |||
| 2014 | Ga0068856_100012522 | |||
| 2015 | Ga0068856_100414807 | |||
| 2016 | Ga0068856_100736952 | |||
| 2017 | Ga0068856_100835023 | |||
| 2018 | Ga0068856_101138052 | |||
| 2019 | Ga0070702_100023216 | |||
| 2020 | Ga0068852_100012153 | |||
| 2021 | Ga0068852_100462145 | |||
| 2022 | Ga0068852_100625476 | |||
| 2023 | Ga0068852_100890998 | |||
| 2024 | Ga0068852_100929270 | |||
| 2025 | Ga0068852_101010237 | |||
| 2026 | Ga0068859_100167126 | |||
| 2027 | Ga0068859_100340262 | |||
| 2028 | Ga0068859_100389406 | |||
| 2029 | Ga0068864_100006229 | |||
| 2030 | Ga0068864_100347047 | |||
| 2031 | Ga0068864_100672493 | |||
| 2032 | Ga0068866_10004323 | |||
| 2033 | Ga0068866_10062253 | |||
| 2034 | Ga0068861_100001266 | |||
| 2035 | Ga0068861_100270297 | |||
| 2036 | Ga0068861_100655078 | |||
| 2037 | Ga0068861_101155394 | |||
| 2038 | Ga0068851_10001389 | |||
| 2039 | Ga0068851_10004887 | |||
| 2040 | Ga0068870_10161975 | |||
| 2041 | Ga0068870_10222287 | |||
| 2042 | Ga0068863_100001254 | |||
| 2043 | Ga0068863_100505382 | |||
| 2044 | Ga0068863_100747692 | |||
| 2045 | Ga0068858_100005485 | |||
| 2046 | Ga0068858_100349338 | |||
| 2047 | Ga0068858_100505733 | |||
| 2048 | Ga0068860_100008151 | |||
| 2049 | Ga0068860_100282182 | |||
| 2050 | Ga0068860_100408020 | |||
| 2051 | Ga0068860_100422006 | |||
| 2052 | Ga0068860_100488827 | |||
| 2053 | Ga0068860_100661807 | |||
| 2054 | Ga0068860_100898893 | |||
| 2055 | Ga0068862_100007020 | |||
| 2056 | Ga0068862_100173484 | |||
| 2057 | Ga0068862_100358555 | |||
| 2058 | Ga0068862_100619571 | |||
| 2059 | Ga0068862_101003842 | |||
| 2060 | Ga0081455_10011644 | |||
| 2061 | Ga0081455_10016227 | |||
| 2062 | Ga0081455_10186981 | |||
| 2063 | Ga0081455_10370851 | |||
| 2064 | Ga0081538_10001959 | |||
| 2065 | Ga0081538_10030040 | |||
| 2066 | Ga0081538_10048294 | |||
| 2067 | Ga0081538_10073588 | |||
| 2068 | Ga0081540_1009974 | |||
| 2069 | Ga0081540_1014075 | |||
| 2070 | Ga0081540_1021553 | |||
| 2071 | Ga0081540_1077329 | |||
| 2072 | Ga0081539_10000324 | |||
| 2073 | Ga0081539_10000349 | |||
| 2074 | Ga0081539_10005758 | |||
| 2075 | Ga0081539_10012594 | |||
| 2076 | Ga0070717_10002984 | |||
| 2077 | Ga0070717_10132481 | |||
| 2078 | Ga0070717_10294459 | |||
| 2079 | Ga0075365_10052227 | |||
| 2080 | Ga0075365_10070247 | |||
| 2081 | Ga0075365_10081154 | |||
| 2082 | Ga0075365_10227407 | |||
| 2083 | Ga0075365_10389247 | |||
| 2084 | Ga0075368_10018719 | |||
| 2085 | Ga0075368_10031548 | |||
| 2086 | Ga0075368_10060675 | |||
| 2087 | Ga0075363_100033056 | |||
| 2088 | Ga0075363_100054835 | |||
| 2089 | Ga0075363_100085499 | |||
| 2090 | Ga0075364_10079593 | |||
| 2091 | Ga0075364_10206757 | |||
| 2092 | Ga0070715_10000165 | |||
| 2093 | Ga0070715_10000783 | |||
| 2094 | Ga0070715_10082703 | |||
| 2095 | Ga0070716_100001149 | |||
| 2096 | Ga0070716_100001653 | |||
| 2097 | Ga0070716_100163589 | |||
| 2098 | Ga0070712_100016633 | |||
| 2099 | Ga0070712_100071997 | |||
| 2100 | Ga0070712_100199388 | |||
| 2101 | Ga0075362_10077037 | |||
| 2102 | Ga0075362_10292090 | |||
| 2103 | Ga0075367_10027228 | |||
| 2104 | Ga0075367_10110179 | |||
| 2105 | Ga0075367_10118140 | |||
| 2106 | Ga0075367_10149024 | |||
| 2107 | Ga0075367_10218147 | |||
| 2108 | Ga0075369_10003699 | |||
| 2109 | Ga0075369_10099706 | |||
| 2110 | Ga0075369_10187205 | |||
| 2111 | Ga0075366_10123286 | |||
| 2112 | Ga0075366_10174625 | |||
| 2113 | Ga0097621_100078770 | |||
| 2114 | Ga0097621_100106743 | |||
| 2115 | Ga0097621_100720444 | |||
| 2116 | Ga0097621_100801675 | |||
| 2117 | Ga0097621_100858152 | |||
| 2118 | Ga0075370_10039450 | |||
| 2119 | Ga0075370_10060808 | |||
| 2120 | Ga0075370_10186526 | |||
| 2121 | Ga0075370_10449321 | |||
| 2122 | Ga0075370_10544784 | |||
| 2123 | Ga0068871_100044210 | |||
| 2124 | Ga0068871_100098484 | |||
| 2125 | Ga0075428_100065292 | |||
| 2126 | Ga0075428_100282262 | |||
| 2127 | Ga0075431_100084563 | |||
| 2128 | Ga0075431_100142956 | |||
| 2129 | Ga0075433_10010098 | |||
| 2130 | Ga0075433_10369384 | |||
| 2131 | Ga0075434_100042444 | |||
| 2132 | Ga0075434_100048898 | |||
| 2133 | Ga0075434_100066875 | |||
| 2134 | Ga0075429_100143048 | |||
| 2135 | Ga0068865_100117684 | |||
| 2136 | Ga0068865_101065392 | |||
| 2137 | Ga0075436_100072899 | |||
| 2138 | Ga0075436_100142703 | |||
| 2139 | Ga0075436_100205435 | |||
| 2140 | Ga0097620_100167123 | |||
| 2141 | Ga0097620_100340270 | |||
| 2142 | Ga0097620_100389390 | |||
| 2143 | Ga0099825_1033603 | |||
| 2144 | Ga0099824_1005683 | |||
| 2145 | Ga0099822_1013793 | |||
| 2146 | Ga0075435_100077392 | |||
| 2147 | Ga0075435_100586075 | |||
| 2148 | Ga0099794_10076492 | |||
| 2149 | Ga0099794_10312400 | |||
| 2150 | Ga0099795_10060925 | |||
| 2151 | Ga0105251_10015823 | |||
| 2152 | Ga0105251_10149090 | |||
| 2153 | Ga0105251_10209902 | |||
| 2154 | Ga0105250_10157669 | |||
| 2155 | Ga0105240_10015173 | |||
| 2156 | Ga0105240_10016901 | |||
| 2157 | Ga0105240_10017610 | |||
| 2158 | Ga0105240_10019862 | |||
| 2159 | Ga0105240_10049219 | |||
| 2160 | Ga0105240_10072796 | |||
| 2161 | Ga0105240_10123477 | |||
| 2162 | Ga0105240_10265587 | |||
| 2163 | Ga0105240_10341454 | |||
| 2164 | Ga0105240_10345866 | |||
| 2165 | Ga0105240_11203000 | |||
| 2166 | Ga0111539_10244185 | |||
| 2167 | Ga0111539_10534433 | |||
| 2168 | Ga0111539_10802764 | |||
| 2169 | Ga0105245_10302373 | |||
| 2170 | Ga0105245_10313949 | |||
| 2171 | Ga0105245_10384846 | |||
| 2172 | Ga0105245_10472113 | |||
| 2173 | Ga0105245_10692076 | |||
| 2174 | Ga0105245_11015724 | |||
| 2175 | Ga0105247_10003046 | |||
| 2176 | Ga0105247_10060680 | |||
| 2177 | Ga0105247_10072474 | |||
| 2178 | Ga0105247_10118791 | |||
| 2179 | Ga0105247_10171901 | |||
| 2180 | Ga0105247_10199851 | |||
| 2181 | Ga0114129_10225224 | |||
| 2182 | Ga0114129_10269761 | |||
| 2183 | Ga0105243_10007575 | |||
| 2184 | Ga0105243_10310621 | |||
| 2185 | Ga0105243_10537457 | |||
| 2186 | Ga0105243_10695000 | |||
| 2187 | Ga0105243_11393614 | |||
| 2188 | Ga0105241_10001143 | |||
| 2189 | Ga0105241_10013826 | |||
| 2190 | Ga0105241_10328334 | |||
| 2191 | Ga0105241_10509531 | |||
| 2192 | Ga0105242_10007065 | |||
| 2193 | Ga0105248_10002357 | |||
| 2194 | Ga0105248_10032818 | |||
| 2195 | Ga0105248_10178376 | |||
| 2196 | Ga0105248_10828473 | |||
| 2197 | Ga0105248_10855381 | |||
| 2198 | Ga0105248_11035806 | |||
| 2199 | Ga0105237_10001334 | |||
| 2200 | Ga0105237_10026647 | |||
| 2201 | Ga0105237_10100286 | |||
| 2202 | Ga0105237_10103552 | |||
| 2203 | Ga0105237_10457944 | |||
| 2204 | Ga0105237_10536359 | |||
| 2205 | Ga0105237_10547600 | |||
| 2206 | Ga0105237_11176851 | |||
| 2207 | Ga0105238_10011329 | |||
| 2208 | Ga0105238_10012083 | |||
| 2209 | Ga0105238_10032652 | |||
| 2210 | Ga0105238_10046062 | |||
| 2211 | Ga0105238_10102208 | |||
| 2212 | Ga0105238_10407505 | |||
| 2213 | Ga0105238_10639926 | |||
| 2214 | Ga0105238_10677922 | |||
| 2215 | Ga0105238_10705670 | |||
| 2216 | Ga0105238_10797032 | |||
| 2217 | Ga0105238_11542459 | |||
| 2218 | Ga0105249_10926303 | |||
| 2219 | Ga0105249_11081794 | |||
| 2220 | Ga0105249_11313091 | |||
| 2221 | Ga0105249_11444651 | |||
| 2222 | Ga0105239_10016313 | |||
| 2223 | Ga0105239_10017529 | |||
| 2224 | Ga0105239_10115903 | |||
| 2225 | Ga0105239_10741515 | |||
| 2226 | Ga0105239_10765029 | |||
| 2227 | Ga0105239_10804435 | |||
| 2228 | Ga0105246_10001629 | |||
| 2229 | Ga0105246_10042500 | |||
| 2230 | Ga0105246_10212883 | |||
| 2231 | Ga0105246_10227291 | |||
| 2232 | Ga0157373_10011907 | |||
| 2233 | Ga0157373_10025406 | |||
| 2234 | Ga0157373_10169117 | |||
| 2235 | Ga0157371_10035502 | |||
| 2236 | Ga0157371_10057815 | |||
| 2237 | Ga0157370_10136894 | |||
| 2238 | Ga0157370_10792600 | |||
| 2239 | Ga0157370_11081769 | |||
| 2240 | Ga0157369_10047474 | |||
| 2241 | Ga0157369_10898916 | |||
| 2242 | Ga0157374_10011043 | |||
| 2243 | Ga0157374_10083007 | |||
| 2244 | Ga0157374_10158941 | |||
| 2245 | Ga0157374_10875427 | |||
| 2246 | Ga0157374_11003444 | |||
| 2247 | Ga0157378_10007996 | |||
| 2248 | Ga0157378_10016489 | |||
| 2249 | Ga0157378_10408742 | |||
| 2250 | Ga0157378_10519232 | |||
| 2251 | Ga0157378_10673291 | |||
| 2252 | Ga0157378_11455185 | |||
| 2253 | Ga0163162_10013742 | |||
| 2254 | Ga0163162_10015427 | |||
| 2255 | Ga0163162_10188128 | |||
| 2256 | Ga0163162_10688856 | |||
| 2257 | Ga0163162_10690929 | |||
| 2258 | Ga0163162_10712948 | |||
| 2259 | Ga0163162_11058342 | |||
| 2260 | Ga0157372_10007909 | |||
| 2261 | Ga0157372_10048129 | |||
| 2262 | Ga0157372_10415726 | |||
| 2263 | Ga0157372_10619947 | |||
| 2264 | Ga0157372_11449267 | |||
| 2265 | Ga0157375_10005712 | |||
| 2266 | Ga0157375_10042423 | |||
| 2267 | Ga0157375_10180966 | |||
| 2268 | Ga0157375_10631181 | |||
| 2269 | Ga0157375_10951432 | |||
| 2270 | Ga0157375_11165823 | |||
| 2271 | Ga0157375_11582129 | |||
| 2272 | Ga0163163_10027564 | |||
| 2273 | Ga0163163_10379302 | |||
| 2274 | Ga0163163_10426741 | |||
| 2275 | Ga0163163_10479102 | |||
| 2276 | Ga0157380_10002785 | |||
| 2277 | Ga0157380_10905341 | |||
| 2278 | Ga0157380_11436177 | |||
| 2279 | Ga0157380_11437975 | |||
| 2280 | Ga0182008_10050394 | |||
| 2281 | Ga0182008_10216401 | |||
| 2282 | Ga0157377_10019216 | |||
| 2283 | Ga0157377_10260049 | |||
| 2284 | Ga0157377_10382545 | |||
| 2285 | Ga0157379_10005941 | |||
| 2286 | Ga0157379_10387892 | |||
| 2287 | Ga0157379_10790933 | |||
| 2288 | Ga0157379_10883197 | |||
| 2289 | Ga0157376_10001343 | |||
| 2290 | Ga0157376_10065591 | |||
| 2291 | Ga0157376_10069593 | |||
| 2292 | Ga0157376_10304886 | |||
| 2293 | Ga0157376_10795479 | |||
| 2294 | Ga0182006_1122416 | |||
| 2295 | Ga0182007_10055674 | |||
| 2296 | Ga0163161_10002609 | |||
| 2297 | Ga0163161_10346132 | |||
| 2298 | Ga0163161_10569256 | |||
| 2299 | Ga0206353_11667404 | |||
| 2300 | Ga0214544_1015907 | |||
| 2301 | Ga0214542_1014952 | |||
| 2302 | Ga0214545_1015411 | |||
| 2303 | Ga0214543_1018060 | |||
| 2304 | Ga0213873_10003651 | |||
| 2305 | Ga0213872_10204589 | |||
| 2306 | Ga0213872_10297516 | |||
| 2307 | Ga0213874_10024702 | |||
| 2308 | Ga0213876_10004166 | |||
| 2309 | Ga0213876_10024133 | |||
| 2310 | Ga0213876_10057134 | |||
| 2311 | Ga0213875_10093645 | |||
| 2312 | Ga0213875_10129808 | |||
| 2313 | Ga0209563_101182 | |||
| 2314 | Ga0209677_100506 | |||
| 2315 | Ga0209148_1000232 | |||
| 2316 | Ga0209233_1000632 | |||
| 2317 | Ga0209233_1025487 | |||
| 2318 | Ga0209455_1005172 | |||
| 2319 | Ga0209455_1009071 | |||
| 2320 | Ga0209455_1017417 | |||
| 2321 | Ga0209455_1022868 | |||
| 2322 | Ga0209673_1022256 | |||
| 2323 | Ga0209564_1005236 | |||
| 2324 | Ga0209564_1009874 | |||
| 2325 | Ga0209564_1011022 | |||
| 2326 | Ga0209758_1000767 | |||
| 2327 | Ga0209758_1001616 | |||
| 2328 | Ga0209758_1002758 | |||
| 2329 | Ga0209758_1005920 | |||
| 2330 | Ga0209758_1017084 | |||
| 2331 | Ga0209256_1001558 | |||
| 2332 | Ga0207426_1000857 | |||
| 2333 | Ga0207426_1002486 | |||
| 2334 | Ga0207426_1031375 | |||
| 2335 | Ga0207426_1107434 | |||
| 2336 | Ga0209257_1025491 | |||
| 2337 | Ga0207697_10022765 | |||
| 2338 | Ga0207656_10001686 | |||
| 2339 | Ga0207656_10097849 | |||
| 2340 | Ga0207653_10012247 | |||
| 2341 | Ga0207682_10076659 | |||
| 2342 | Ga0207692_10000223 | |||
| 2343 | Ga0207692_10001143 | |||
| 2344 | Ga0207692_10034968 | |||
| 2345 | Ga0207692_10055808 | |||
| 2346 | Ga0207692_10384177 | |||
| 2347 | Ga0207692_10424076 | |||
| 2348 | Ga0207642_10147707 | |||
| 2349 | Ga0207710_10036155 | |||
| 2350 | Ga0207710_10047017 | |||
| 2351 | Ga0207710_10109102 | |||
| 2352 | Ga0207710_10180346 | |||
| 2353 | Ga0207688_10101169 | |||
| 2354 | Ga0207688_10119246 | |||
| 2355 | Ga0207688_10177490 | |||
| 2356 | Ga0207688_10204329 | |||
| 2357 | Ga0207647_10001818 | |||
| 2358 | Ga0207647_10224257 | |||
| 2359 | Ga0207647_10385368 | |||
| 2360 | Ga0207685_10016503 | |||
| 2361 | Ga0207685_10128218 | |||
| 2362 | Ga0207699_10001787 | |||
| 2363 | Ga0207699_10006491 | |||
| 2364 | Ga0207699_10012972 | |||
| 2365 | Ga0207699_10067557 | |||
| 2366 | Ga0207699_10272797 | |||
| 2367 | Ga0207699_10424397 | |||
| 2368 | Ga0207699_10500916 | |||
| 2369 | Ga0207645_10016248 | |||
| 2370 | Ga0207645_10265697 | |||
| 2371 | Ga0207645_10324107 | |||
| 2372 | Ga0207643_10049899 | |||
| 2373 | Ga0207705_10032338 | |||
| 2374 | Ga0207705_10131136 | |||
| 2375 | Ga0207705_10275307 | |||
| 2376 | Ga0207705_10389925 | |||
| 2377 | Ga0207684_10225898 | |||
| 2378 | Ga0207654_10000510 | |||
| 2379 | Ga0207654_10004655 | |||
| 2380 | Ga0207654_10275945 | |||
| 2381 | Ga0207654_10350079 | |||
| 2382 | Ga0207707_10001868 | |||
| 2383 | Ga0207707_10034179 | |||
| 2384 | Ga0207707_10044573 | |||
| 2385 | Ga0207707_10108163 | |||
| 2386 | Ga0207707_10253676 | |||
| 2387 | Ga0207707_10393532 | |||
| 2388 | Ga0207695_10000123 | |||
| 2389 | Ga0207695_10000579 | |||
| 2390 | Ga0207695_10019584 | |||
| 2391 | Ga0207695_10037202 | |||
| 2392 | Ga0207695_10101893 | |||
| 2393 | Ga0207695_10111316 | |||
| 2394 | Ga0207695_10166164 | |||
| 2395 | Ga0207695_10357479 | |||
| 2396 | Ga0207695_10372640 | |||
| 2397 | Ga0207671_10003497 | |||
| 2398 | Ga0207671_10044835 | |||
| 2399 | Ga0207671_10055354 | |||
| 2400 | Ga0207671_10154406 | |||
| 2401 | Ga0207671_10190013 | |||
| 2402 | Ga0207671_10197839 | |||
| 2403 | Ga0207671_10240482 | |||
| 2404 | Ga0207671_10292388 | |||
| 2405 | Ga0207671_10625174 | |||
| 2406 | Ga0207693_10002297 | |||
| 2407 | Ga0207693_10015263 | |||
| 2408 | Ga0207693_10046312 | |||
| 2409 | Ga0207693_10212343 | |||
| 2410 | Ga0207693_10344040 | |||
| 2411 | Ga0207693_10555593 | |||
| 2412 | Ga0207663_10000540 | |||
| 2413 | Ga0207663_10002303 | |||
| 2414 | Ga0207663_10004575 | |||
| 2415 | Ga0207663_10073312 | |||
| 2416 | Ga0207663_10089460 | |||
| 2417 | Ga0207663_10553801 | |||
| 2418 | Ga0207660_10028347 | |||
| 2419 | Ga0207660_10206895 | |||
| 2420 | Ga0207660_10502474 | |||
| 2421 | Ga0207662_10009750 | |||
| 2422 | Ga0207657_10000793 | |||
| 2423 | Ga0207657_10005801 | |||
| 2424 | Ga0207657_10198897 | |||
| 2425 | Ga0207657_10250812 | |||
| 2426 | Ga0207657_10319814 | |||
| 2427 | Ga0207657_10367847 | |||
| 2428 | Ga0207649_10002671 | |||
| 2429 | Ga0207649_10136312 | |||
| 2430 | Ga0207649_10644762 | |||
| 2431 | Ga0207652_10025143 | |||
| 2432 | Ga0207652_10319679 | |||
| 2433 | Ga0207652_10536186 | |||
| 2434 | Ga0207681_10024728 | |||
| 2435 | Ga0207681_10370397 | |||
| 2436 | Ga0207694_10000263 | |||
| 2437 | Ga0207694_10036200 | |||
| 2438 | Ga0207694_10088782 | |||
| 2439 | Ga0207694_10164360 | |||
| 2440 | Ga0207694_10190392 | |||
| 2441 | Ga0207694_10213078 | |||
| 2442 | Ga0207694_10236169 | |||
| 2443 | Ga0207650_10027650 | |||
| 2444 | Ga0207650_10222592 | |||
| 2445 | Ga0207650_10232090 | |||
| 2446 | Ga0207650_10572214 | |||
| 2447 | Ga0207659_10748400 | |||
| 2448 | Ga0207687_10023005 | |||
| 2449 | Ga0207687_10045852 | |||
| 2450 | Ga0207687_10055506 | |||
| 2451 | Ga0207687_10147432 | |||
| 2452 | Ga0207687_10389201 | |||
| 2453 | Ga0207700_10078973 | |||
| 2454 | Ga0207700_10096260 | |||
| 2455 | Ga0207700_10226285 | |||
| 2456 | Ga0207700_10301453 | |||
| 2457 | Ga0207700_10614852 | |||
| 2458 | Ga0207664_10017743 | |||
| 2459 | Ga0207664_10026417 | |||
| 2460 | Ga0207664_10031016 | |||
| 2461 | Ga0207664_10060987 | |||
| 2462 | Ga0207664_10131568 | |||
| 2463 | Ga0207664_10269169 | |||
| 2464 | Ga0207664_10289038 | |||
| 2465 | Ga0207664_10338309 | |||
| 2466 | Ga0207664_10718540 | |||
| 2467 | Ga0207644_10056924 | |||
| 2468 | Ga0207644_10192660 | |||
| 2469 | Ga0207644_10385623 | |||
| 2470 | Ga0207690_10006770 | |||
| 2471 | Ga0207690_10114952 | |||
| 2472 | Ga0207690_10338158 | |||
| 2473 | Ga0207706_10000771 | |||
| 2474 | Ga0207706_10224825 | |||
| 2475 | Ga0207706_10257539 | |||
| 2476 | Ga0207706_10704925 | |||
| 2477 | Ga0207686_10008730 | |||
| 2478 | Ga0207686_10322178 | |||
| 2479 | Ga0207686_10583954 | |||
| 2480 | Ga0207709_10012176 | |||
| 2481 | Ga0207709_10199369 | |||
| 2482 | Ga0207709_10214117 | |||
| 2483 | Ga0207709_10286329 | |||
| 2484 | Ga0207709_10786311 | |||
| 2485 | Ga0207709_10828057 | |||
| 2486 | Ga0207670_10008051 | |||
| 2487 | Ga0207669_10006537 | |||
| 2488 | Ga0207669_10172996 | |||
| 2489 | Ga0207704_10005473 | |||
| 2490 | Ga0207704_10400111 | |||
| 2491 | Ga0207665_10002391 | |||
| 2492 | Ga0207665_10003603 | |||
| 2493 | Ga0207665_10006864 | |||
| 2494 | Ga0207665_10163384 | |||
| 2495 | Ga0207665_10220260 | |||
| 2496 | Ga0207665_10244178 | |||
| 2497 | Ga0207665_10551696 | |||
| 2498 | Ga0207691_10318069 | |||
| 2499 | Ga0207691_10367091 | |||
| 2500 | Ga0207691_10660466 | |||
| 2501 | Ga0207711_10021306 | |||
| 2502 | Ga0207711_10083708 | |||
| 2503 | Ga0207711_10177204 | |||
| 2504 | Ga0207711_10392520 | |||
| 2505 | Ga0207711_10464151 | |||
| 2506 | Ga0207711_11048096 | |||
| 2507 | Ga0207689_10050310 | |||
| 2508 | Ga0207689_10202619 | |||
| 2509 | Ga0207689_10209708 | |||
| 2510 | Ga0207661_10002076 | |||
| 2511 | Ga0207661_10127222 | |||
| 2512 | Ga0207661_10203894 | |||
| 2513 | Ga0207661_10234839 | |||
| 2514 | Ga0207679_10022137 | |||
| 2515 | Ga0207679_10192661 | |||
| 2516 | Ga0207679_10237151 | |||
| 2517 | Ga0207679_10736037 | |||
| 2518 | Ga0207667_10023490 | |||
| 2519 | Ga0207667_10033130 | |||
| 2520 | Ga0207667_10118343 | |||
| 2521 | Ga0207667_10323347 | |||
| 2522 | Ga0207667_10852603 | |||
| 2523 | Ga0207651_10198212 | |||
| 2524 | Ga0207651_10334754 | |||
| 2525 | Ga0207651_10401506 | |||
| 2526 | Ga0207651_10409528 | |||
| 2527 | Ga0207651_10580972 | |||
| 2528 | Ga0207712_10007876 | |||
| 2529 | Ga0207712_10310748 | |||
| 2530 | Ga0207712_10401138 | |||
| 2531 | Ga0207712_10689005 | |||
| 2532 | Ga0207712_10932602 | |||
| 2533 | Ga0207668_10023245 | |||
| 2534 | Ga0207668_10108421 | |||
| 2535 | Ga0207668_10130765 | |||
| 2536 | Ga0207668_10416243 | |||
| 2537 | Ga0207640_10003248 | |||
| 2538 | Ga0207640_10040096 | |||
| 2539 | Ga0207640_10176417 | |||
| 2540 | Ga0207658_10106963 | |||
| 2541 | Ga0207677_10096293 | |||
| 2542 | Ga0207677_10330580 | |||
| 2543 | Ga0207677_10393546 | |||
| 2544 | Ga0207677_10592288 | |||
| 2545 | Ga0207677_10809288 | |||
| 2546 | Ga0207703_10129122 | |||
| 2547 | Ga0207703_10543739 | |||
| 2548 | Ga0207703_10651135 | |||
| 2549 | Ga0207639_10043322 | |||
| 2550 | Ga0207639_10063940 | |||
| 2551 | Ga0207639_10239221 | |||
| 2552 | Ga0207639_10496628 | |||
| 2553 | Ga0207639_10509563 | |||
| 2554 | Ga0207639_10751207 | |||
| 2555 | Ga0207678_10001022 | |||
| 2556 | Ga0207678_10015763 | |||
| 2557 | Ga0207678_10027423 | |||
| 2558 | Ga0207678_10057664 | |||
| 2559 | Ga0207678_10143956 | |||
| 2560 | Ga0207678_10178387 | |||
| 2561 | Ga0207678_10281286 | |||
| 2562 | Ga0207678_10503264 | |||
| 2563 | Ga0207678_10571664 | |||
| 2564 | Ga0207708_10004422 | |||
| 2565 | Ga0207708_10147045 | |||
| 2566 | Ga0207708_10177210 | |||
| 2567 | Ga0207708_10281993 | |||
| 2568 | Ga0207708_10548000 | |||
| 2569 | Ga0207708_10550264 | |||
| 2570 | Ga0207702_10000003 | |||
| 2571 | Ga0207702_10000014 | |||
| 2572 | Ga0207702_10188227 | |||
| 2573 | Ga0207702_10283384 | |||
| 2574 | Ga0207702_10791535 | |||
| 2575 | Ga0207702_11079307 | |||
| 2576 | Ga0207641_10036007 | |||
| 2577 | Ga0207641_10157037 | |||
| 2578 | Ga0207641_10249677 | |||
| 2579 | Ga0207641_11091183 | |||
| 2580 | Ga0207648_10271011 | |||
| 2581 | Ga0207648_10854767 | |||
| 2582 | Ga0207648_10986344 | |||
| 2583 | Ga0207648_11118208 | |||
| 2584 | Ga0207676_10011184 | |||
| 2585 | Ga0207676_10345408 | |||
| 2586 | Ga0207674_10004073 | |||
| 2587 | Ga0207674_10043484 | |||
| 2588 | Ga0207674_10102019 | |||
| 2589 | Ga0207674_10159346 | |||
| 2590 | Ga0207674_10175795 | |||
| 2591 | Ga0207674_10244427 | |||
| 2592 | Ga0207674_10279899 | |||
| 2593 | Ga0207674_10430329 | |||
| 2594 | Ga0207675_100000706 | |||
| 2595 | Ga0207675_100100025 | |||
| 2596 | Ga0207675_100182572 | |||
| 2597 | Ga0207675_100317133 | |||
| 2598 | Ga0207675_100527653 | |||
| 2599 | Ga0207675_100618036 | |||
| 2600 | Ga0207683_10001159 | |||
| 2601 | Ga0207683_10211625 | |||
| 2602 | Ga0207683_10235957 | |||
| 2603 | Ga0207683_10282561 | |||
| 2604 | Ga0207683_10282620 | |||
| 2605 | Ga0207683_11108069 | |||
| 2606 | Ga0207698_10010360 | |||
| 2607 | Ga0207698_10010611 | |||
| 2608 | Ga0207698_10082749 | |||
| 2609 | Ga0207698_10180046 | |||
| 2610 | Ga0207698_10292703 | |||
| 2611 | Ga0207698_10901048 | |||
| 2612 | Ga0207698_11043676 | |||
| 2613 | Ga0207698_11131066 | |||
| 2614 | Ga0209389_1000019 | |||
| 2615 | Ga0209389_1000070 | |||
| 2616 | Ga0209589_1000007 | |||
| 2617 | Ga0209589_1000420 | |||
| 2618 | Ga0209489_100008 | |||
| 2619 | Ga0209489_100033 | |||
| 2620 | Ga0209489_100196 | |||
| 2621 | Ga0209700_100009 | |||
| 2622 | Ga0209700_100012 | |||
| 2623 | Ga0209179_1002798 | |||
| 2624 | Ga0209813_10008076 | |||
| 2625 | Ga0209813_10062842 | |||
| 2626 | Ga0209813_10063564 | |||
| 2627 | Ga0207428_10027694 | |||
| 2628 | Ga0207428_10112328 | |||
| 2629 | Ga0268266_10041188 | |||
| 2630 | Ga0268266_10047340 | |||
| 2631 | Ga0268266_10109096 | |||
| 2632 | Ga0268266_10130708 | |||
| 2633 | Ga0268266_10204902 | |||
| 2634 | Ga0268266_10270663 | |||
| 2635 | Ga0268266_10273924 | |||
| 2636 | Ga0268266_10825403 | |||
| 2637 | Ga0268266_10842950 | |||
| 2638 | Ga0268265_10005729 | |||
| 2639 | Ga0268265_10061049 | |||
| 2640 | Ga0268265_10362921 | |||
| 2641 | Ga0268265_10429922 | |||
| 2642 | Ga0268264_10000042 | |||
| 2643 | Ga0268264_10007308 | |||
| 2644 | Ga0268264_10174382 | |||
| 2645 | Ga0268264_10340079 | |||
| 2646 | Ga0268264_10480808 | |||
| 2647 | Ga0268264_10585161 | |||
| 2648 | Ga0265337_1031653 | |||
| 2649 | Ga0265326_10007650 | |||
| 2650 | Ga0265319_1007216 | |||
| 2651 | Ga0265334_10014698 | |||
| 2652 | Ga0265334_10053228 | |||
| 2653 | Ga0265318_10041862 | |||
| 2654 | Ga0265336_10000955 | |||
| 2655 | Ga0307517_10000859 | |||
| 2656 | Ga0307517_10173665 | |||
| 2657 | Ga0307515_10228857 | |||
| 2658 | Ga0265338_10000271 | |||
| 2659 | Ga0265324_10026824 | |||
| 2660 | Ga0307511_10105551 | |||
| 2661 | Ga0307512_10259945 | |||
| 2662 | Ga0265330_10033612 | |||
| 2663 | Ga0265330_10035098 | |||
| 2664 | Ga0265330_10058426 | |||
| 2665 | Ga0265330_10101385 | |||
| 2666 | Ga0265332_10153119 | |||
| 2667 | Ga0265328_10019645 | |||
| 2668 | Ga0265325_10003254 | |||
| 2669 | Ga0265340_10009546 | |||
| 2670 | Ga0265339_10048328 | |||
| 2671 | Ga0265331_10092909 | |||
| 2672 | Ga0307509_10383663 | |||
| 2673 | Ga0307408_100652976 | |||
| 2674 | Ga0265313_10044293 | |||
| 2675 | Ga0307508_10054997 | |||
| 2676 | Ga0307508_10119474 | |||
| 2677 | Ga0307508_10282200 | |||
| 2678 | Ga0265314_10009643 | |||
| 2679 | Ga0265314_10064721 | |||
| 2680 | Ga0265314_10075437 | |||
| 2681 | Ga0265342_10037952 | |||
| 2682 | Ga0265342_10082285 | |||
| 2683 | Ga0307516_10087890 | |||
| 2684 | Ga0307516_10122100 | |||
| 2685 | Ga0307405_10791720 | |||
| 2686 | Ga0307413_10111893 | |||
| 2687 | Ga0307518_10300633 | |||
| 2688 | Ga0307406_10102265 | |||
| 2689 | Ga0307406_10719037 | |||
| 2690 | Ga0307409_100460083 | |||
| 2691 | Ga0307416_101236979 | |||
| 2692 | Ga0307416_101749411 | |||
| 2693 | Ga0307414_10562450 | |||
| 2694 | Ga0307411_10170814 | |||
| 2695 | Ga0307411_10697252 | |||
| 2696 | Ga0307415_100036915 | |||
| 2697 | Ga0307415_100564787 | |||
| 2698 | Ga0307507_10008161 | |||
| 2699 | Ga0307510_10052034 | |||
| 2700 | Ga0307510_10317707 | |||
| 2701 | Ga0373926_0054856 | |||
| 2702 | Ga0373929_0043970 | |||
| 2703 | Ga0373934_0010871 | |||
| 2704 | Ga0373934_0023427 | |||
| 2705 | Ga0373944_0005274 | |||
| 2706 | Ga0373923_0016142 | |||
| 2707 | Ga0373923_0026747 | |||
| 2708 | Ga0373923_0038880 | |||
| 2709 | Ga0373923_0179038 | |||
| 2710 | Ga0373936_0004114 | |||
| 2711 | Ga0373936_0029726 | |||
| 2712 | Ga0373936_0056647 | |||
| 2713 | Ga0373936_0103635 | |||
| 2714 | Ga0373939_0032006 | |||
| 2715 | Ga0373941_0018567 | |||
| 2716 | Ga0373941_0030648 | |||
| 2717 | Ga0373945_0000395 | |||
| 2718 | Ga0373953_0012063 | |||
| 2719 | Ga0373953_0175082 | |||
| 2720 | Ga0373954_0014441 | |||
| 2721 | Ga0373954_0017590 | |||
| 2722 | Ga0373954_0093392 | |||
| 2723 | Ga0373956_0004238 | |||
| 2724 | Ga0373956_0057666 | |||
| 2725 | Ga0373956_0166894 | |||
| 2726 | Ga0373956_0207018 | |||
| 2727 | Ga0373956_0241703 | |||
| 2728 | Ga0373957_0057417 | |||
| 2729 | Ga0373960_0014317 | |||
| 2730 | Ga0373960_0066853 | |||
| 2731 | Ga0373943_0024548 | |||
| 2732 | Ga0373943_0273010 | |||
| 2733 | Ga0373946_0023533 | |||
| 2734 | Ga0373946_0035404 | |||
| 2735 | Ga0373946_0102613 | |||
| 2736 | Ga0373946_0211691 | |||
| 2737 | Ga0373955_0000678 | |||
| 2738 | Ga0373955_0051059 | |||
| 2739 | Ga0373955_0101614 | |||
| 2740 | Ga0373955_0186617 | |||
| 2741 | Ga0373955_0283761 | |||
| 2742 | Ga0373962_0085587 | |||
| 2743 | Ga0373924_0010590 | |||
| 2744 | Ga0373924_0013149 | |||
| 2745 | Ga0373924_0014176 | |||
| 2746 | Ga0373924_0173974 | |||
| 2747 | Ga0373931_0211514 | |||
| 2748 | Ga0373931_0275267 | |||
| 2749 | Ga0373931_0455270 | |||
| 2750 | Ga0373935_0005649 | |||
| 2751 | Ga0373935_0048165 | |||
| 2752 | Ga0373935_0091752 | |||
| 2753 | Ga0373935_0136237 | |||
| 2754 | Ga0373927_0001392 | |||
| 2755 | Ga0373927_0011983 | |||
| 2756 | Ga0373927_0048986 | |||
| 2757 | Ga0373927_0119662 | |||
| 2758 | Ga0373927_0239834 | |||
| 2759 | Ga0373933_0006110 | |||
| 2760 | Ga0373933_0009814 | |||
| 2761 | Ga0373933_0037854 | |||
| 2762 | Ga0373933_0039721 | |||
| 2763 | Ga0373933_0215151 | |||
| 2764 | Ga0373933_0509724 | |||
| 2765 | Ga0373947_0002951 | |||
| 2766 | Ga0373947_0045327 | |||
| 2767 | Ga0373947_0063714 | |||
| 2768 | Ga0373947_0121182 | |||
| 2769 | Ga0373937_0050834 | |||
| 2770 | Ga0373937_0098011 | |||
| 2771 | Ga0373937_0100171 | |||
| 2772 | Ga0373937_0124163 | |||
| 2773 | Ga0373937_0149495 | |||
| 2774 | Ga0373937_0463752 | |||
| 2775 | Ga0373925_0004635 | |||
| 2776 | Ga0373925_0010628 | |||
| 2777 | Ga0373925_0014677 | |||
| 2778 | Ga0373925_0087558 | |||
| 2779 | Ga0373925_0372724 | |||
| 2780 | Ga0395899_0071950 | |||
| 2781 | Ga0395899_0191292 | |||
| 2782 | Ga0395900_0001526 | |||
| 2783 | Ga0395900_0005676 | |||
| 2784 | Ga0395900_0026147 | |||
| 2785 | Ga0395900_0116784 | |||
| 2786 | Ga0395900_0268963 | |||
| 2787 | Ga0395898_0026979 | |||
| 2788 | Ga0395898_0041517 | |||
| 2789 | Ga0395898_0173644 | |||
| 2790 | Ga0395898_0177718 | |||
| 2791 | Ga0395905_0050159 | |||
| 2792 | Ga0395905_0130606 | |||
| 2793 | Ga0395905_0160500 | |||
| 2794 | Ga0395905_0884646 | |||
| 2795 | Ga0436364_0168836 | |||
| 2796 | Ga0436364_0305434 | |||
| 2797 | Ga0436364_1198463 | |||
| 2798 | Ga0436364_1239073 | |||
| 2799 | Ga0436364_1527050 | |||
| 2800 | Ga0395901_0011004 | |||
| 2801 | Ga0395901_0011455 | |||
| 2802 | Ga0395901_0015205 | |||
| 2803 | Ga0395901_0068693 | |||
| 2804 | Ga0395901_0192976 | |||
| 2805 | Ga0395901_0764367 | |||
| 2806 | Ga0436365_0147099 | |||
| 2807 | Ga0436365_0217873 | |||
| 2808 | Ga0436365_0418339 | |||
| 2809 | Ga0436365_0447822 | |||
| 2810 | Ga0436365_0543732 | |||
| 2811 | Ga0436365_0662047 | |||
| 2812 | Ga0436365_0717665 | |||
| 2813 | Ga0436365_0760445 | |||
| 2814 | Ga0436365_1099091 | |||
| 2815 | Ga0436365_1334356 | |||
| 2816 | Ga0436360_0740992 | |||
| 2817 | Ga0436361_0222158 | |||
| 2818 | Ga0436361_0671770 | |||
| 2819 | Ga0436363_0036150 | |||
| 2820 | Ga0436363_0067190 | |||
| 2821 | Ga0436363_0769259 | |||
| 2822 | Ga0436363_1419967 | |||
| 2823 | Ga0436362_0062599 | |||
| 2824 | Ga0436362_0291034 | |||
| 2825 | Ga0439465_0088485 | |||
| 2826 | Ga0439465_0098986 | |||
| 2827 | Ga0451797_0120081 | |||
| 2828 | Ga0451802_1537279 | |||
| 2829 | Ga0451841_0002079 | |||
| 2830 | Ga0451841_0425213 | |||
| 2831 | Ga0451853_2705975 | |||
| 2832 | Ga0466969_0055578 | |||
| 2833 | Ga0466969_0313822 | |||
| 2834 | Ga0466972_0000126 | |||
| 2835 | Ga0466972_0006027 | |||
| 2836 | Ga0466966_0001699 | |||
| 2837 | Ga0466961_0000095 | |||
| 2838 | Ga0466963_0051455 | |||
| 2839 | Ga0466964_0007963 | |||
| 2840 | Ga0466964_0105720 | |||
| 2841 | Ga0466971_0091570 | |||
| 2842 | Ga0466968_0009584 | |||
| 2843 | Ga0466968_0104471 | |||
| 2844 | Ga0466970_0068686 | |||
| 2845 | Ga0466957_0089296 | |||
| 2846 | Ga0466957_0159728 | |||
| 2847 | Ga0466957_0159819 | |||
| 2848 | Ga0466957_0558333 | |||
| 2849 | Ga0466959_0034600 | |||
| 2850 | Ga0466959_0236093 | |||
| 2851 | Ga0466959_0478501 | |||
| 2852 | Ga0466958_0610171 | |||
| 2853 | Ga0466958_0698380 | |||
| 2854 | Ga0466967_0037921 | |||
| 2855 | Ga0466967_0179708 | |||
| 2856 | Ga0466967_0365063 | |||
| 2857 | Ga0466967_0988657 | |||
| 2858 | Ga0495617_058430 | |||
| 2859 | Ga0495592_0009935 | |||
| 2860 | Ga0495592_0033511 | |||
| 2861 | Ga0495592_0090419 | |||
| 2862 | Ga0495592_0098193 | |||
| 2863 | Ga0495592_0589040 | |||
| 2864 | Ga0495603_0001272 | |||
| 2865 | Ga0495603_0004214 | |||
| 2866 | Ga0495603_0013633 | |||
| 2867 | Ga0495603_0048593 | |||
| 2868 | Ga0495603_0066820 | |||
| 2869 | Ga0495603_0436548 | |||
| 2870 | Ga0495590_0122408 | |||
| 2871 | Ga0495629_0000333 | |||
| 2872 | Ga0495629_0003378 | |||
| 2873 | Ga0495629_0009814 | |||
| 2874 | Ga0495629_0015488 | |||
| 2875 | Ga0495629_0051684 | |||
| 2876 | Ga0495629_0057330 | |||
| 2877 | Ga0495629_0269864 | |||
| 2878 | Ga0495629_0426630 | |||
| 2879 | Ga0495638_0154696 | |||
| 2880 | Ga0495638_0250451 | |||
| 2881 | Ga0495638_0331045 | |||
| 2882 | Ga0495641_0018469 | |||
| 2883 | Ga0495651_0010321 | |||
| 2884 | Ga0495651_0017093 | |||
| 2885 | Ga0495651_0135646 | |||
| 2886 | Ga0495653_0000367 | |||
| 2887 | Ga0495653_0159437 | |||
| 2888 | Ga0495653_0169822 | |||
| 2889 | Ga0495580_0001991 | |||
| 2890 | Ga0495580_0013840 | |||
| 2891 | Ga0495582_0000581 | |||
| 2892 | Ga0495582_0014383 | |||
| 2893 | Ga0495582_0036160 | |||
| 2894 | Ga0495582_0080212 | |||
| 2895 | Ga0495582_0119898 | |||
| 2896 | Ga0495605_0043685 | |||
| 2897 | Ga0495639_0000585 | |||
| 2898 | Ga0495639_0006240 | |||
| 2899 | Ga0495639_0056572 | |||
| 2900 | Ga0495639_0208209 | |||
| 2901 | Ga0495662_0000101 | |||
| 2902 | Ga0495662_0024402 | |||
| 2903 | Ga0495662_0026132 | |||
| 2904 | Ga0495662_0061536 | |||
| 2905 | Ga0495664_0002862 | |||
| 2906 | Ga0495664_0003595 | |||
| 2907 | Ga0495664_0027264 | |||
| 2908 | Ga0495664_0027670 | |||
| 2909 | Ga0495664_0142534 | |||
| 2910 | Ga0495664_0155619 | |||
| 2911 | Ga0495664_0167881 | |||
| 2912 | Ga0495584_0072425 | |||
| 2913 | Ga0495584_0105922 | |||
| 2914 | Ga0495585_0002078 | |||
| 2915 | Ga0495585_0148570 | |||
| 2916 | Ga0495594_0001601 | |||
| 2917 | Ga0495594_0056783 | |||
| 2918 | Ga0495594_0339832 | |||
| 2919 | Ga0495607_0004674 | |||
| 2920 | Ga0495607_0221647 | |||
| 2921 | Ga0495583_0138895 | |||
| 2922 | Ga0495606_0060698 | |||
| 2923 | Ga0495606_0078463 | |||
| 2924 | Ga0495606_0091062 | |||
| 2925 | Ga0495606_0402973 | |||
| 2926 | Ga0495608_0041050 | |||
| 2927 | Ga0495608_0056482 | |||
| 2928 | Ga0495608_0081395 | |||
| 2929 | Ga0495608_0110124 | |||
| 2930 | Ga0495610_0137438 | |||
| 2931 | Ga0495610_0190304 | |||
| 2932 | Ga0495616_0037865 | |||
| 2933 | Ga0495616_0053890 | |||
| 2934 | Ga0495616_0215604 | |||
| 2935 | Ga0495618_0015090 | |||
| 2936 | Ga0495618_0087161 | |||
| 2937 | Ga0495618_0182344 | |||
| 2938 | Ga0495618_0211331 | |||
| 2939 | Ga0495620_0139470 | |||
| 2940 | Ga0495628_0009952 | |||
| 2941 | Ga0495628_0010205 | |||
| 2942 | Ga0495628_0032131 | |||
| 2943 | Ga0495628_0073293 | |||
| 2944 | Ga0495628_0090285 | |||
| 2945 | Ga0495628_0390296 | |||
| 2946 | Ga0495628_0455444 | |||
| 2947 | Ga0495630_0010453 | |||
| 2948 | Ga0495630_0026726 | |||
| 2949 | Ga0495630_0027607 | |||
| 2950 | Ga0495630_0048627 | |||
| 2951 | Ga0495631_0020085 | |||
| 2952 | Ga0495631_0173436 | |||
| 2953 | Ga0495632_0098026 | |||
| 2954 | Ga0495643_0011352 | |||
| 2955 | Ga0495643_0043785 | |||
| 2956 | Ga0495643_0078440 | |||
| 2957 | Ga0495643_0143778 | |||
| 2958 | Ga0495644_0000312 | |||
| 2959 | Ga0495644_0116576 | |||
| 2960 | Ga0495648_0027010 | |||
| 2961 | Ga0495648_0057268 | |||
| 2962 | Ga0495666_0001337 | |||
| 2963 | Ga0495652_0009044 | |||
| 2964 | Ga0495652_0022671 | |||
| 2965 | Ga0495652_0026811 | |||
| 2966 | Ga0495652_0043388 | |||
| 2967 | Ga0495652_0107567 | |||
| 2968 | Ga0495652_0406589 | |||
| 2969 | Ga0495654_0005815 | |||
| 2970 | Ga0495654_0099437 | |||
| 2971 | Ga0495665_0003505 | |||
| 2972 | Ga0495665_0006056 | |||
| 2973 | Ga0495665_0024104 | |||
| 2974 | Ga0495640_0003357 | |||
| 2975 | Ga0495640_0023394 | |||
| 2976 | Ga0495640_0042537 | |||
| 2977 | Ga0495640_0060880 | |||
| 2978 | Ga0495640_0148117 | |||
| 2979 | Ga0495586_0008435 | |||
| 2980 | Ga0495586_0150801 | |||
| 2981 | Ga0495587_0002119 | |||
| 2982 | Ga0495587_0014439 | |||
| 2983 | Ga0495587_0089088 | |||
| 2984 | Ga0495587_0173840 | |||
| 2985 | Ga0495587_0471444 | |||
| 2986 | Ga0495598_0099710 | |||
| 2987 | Ga0495609_0019460 | |||
| 2988 | Ga0495609_0020209 | |||
| 2989 | Ga0495609_0130212 | |||
| 2990 | Ga0495609_0149926 | |||
| 2991 | Ga0495621_0031173 | |||
| 2992 | Ga0495621_0132310 | |||
| 2993 | Ga0495597_0021036 | |||
| 2994 | Ga0495597_0081019 | |||
| 2995 | Ga0495645_0010574 | |||
| 2996 | Ga0495645_0036325 | |||
| 2997 | Ga0495645_0254415 | |||
| 2998 | Ga0495622_0007994 | |||
| 2999 | Ga0495622_0009473 | |||
| 3000 | Ga0495622_0016292 | |||
| 3001 | Ga0495622_0054858 | |||
| 3002 | Ga0495622_0082331 | |||
| 3003 | Ga0495633_0045186 | |||
| 3004 | Ga0495633_0072140 | |||
| 3005 | Ga0495667_0003431 | |||
| 3006 | Ga0495667_0012919 | |||
| 3007 | Ga0495667_0081581 | |||
| 3008 | Ga0495667_0347047 | |||
| 3009 | Ga0495667_0451570 | |||
| 3010 | Ga0495656_0000338 | |||
| 3011 | Ga0495656_0033902 | |||
| 3012 | Ga0495656_0087544 | |||
| 3013 | Ga0495656_0260122 | |||
| 3014 | Ga0495668_0032729 | |||
| 3015 | Ga0495668_0091552 | |||
| 3016 | Ga0495668_0124630 | |||
| 3017 | Ga0495668_0131926 | |||
| 3018 | Ga0495668_0275479 | |||
| 3019 | Ga0495634_0000633 | |||
| 3020 | Ga0495634_0007068 | |||
| 3021 | Ga0495634_0017810 | |||
| 3022 | Ga0495634_0056949 | |||
| 3023 | Ga0495634_0183386 | |||
| 3024 | Ga0495634_0245498 | |||
| 3025 | Ga0495611_0117023 | |||
| 3026 | Ga0495611_0247226 | |||
| 3027 | Ga0495611_0278965 | |||
| 3028 | Ga0495625_0312789 | |||
| 3029 | Ga0495635_0001089 | |||
| 3030 | Ga0495635_0019171 | |||
| 3031 | Ga0495635_0034059 | |||
| 3032 | Ga0495635_0048853 | |||
| 3033 | Ga0495635_0118183 | |||
| 3034 | Ga0495635_0477749 | |||
| 3035 | Ga0495635_0654401 | |||
| 3036 | Ga0495659_0015030 | |||
| 3037 | Ga0495661_0082564 | |||
| 3038 | Ga0495588_0015218 | |||
| 3039 | Ga0495588_0015938 | |||
| 3040 | Ga0495588_0025596 | |||
| 3041 | Ga0495588_0250324 | |||
| 3042 | Ga0495657_0023571 | |||
| 3043 | Ga0495657_0034109 | |||
| 3044 | Ga0495657_0078286 | |||
| 3045 | Ga0495657_0145889 | |||
| 3046 | Ga0495599_0001176 | |||
| 3047 | Ga0495599_0115491 | |||
| 3048 | Ga0495599_0191132 | |||
| 3049 | Ga0495599_0305678 | |||
| 3050 | Ga0495623_0044749 | |||
| 3051 | Ga0495646_0002685 | |||
| 3052 | Ga0495646_0004437 | |||
| 3053 | Ga0495646_0015905 | |||
| 3054 | Ga0495646_0049766 | |||
| 3055 | Ga0495647_0005918 | |||
| 3056 | Ga0495647_0063440 | |||
| 3057 | Ga0495658_0000485 | |||
| 3058 | Ga0495658_0087126 | |||
| 3059 | Ga0495658_0162202 | |||
| 3060 | Ga0495669_0041667 | |||
| 3061 | Ga0495669_0077634 | |||
| 3062 | Ga0495613_0011737 | |||
| 3063 | Ga0495613_0050741 | |||
| 3064 | Ga0495613_0088905 | |||
| 3065 | Ga0495613_0125461 | |||
| 3066 | Ga0495613_0217113 | |||
| 3067 | Ga0495613_0535599 | |||
| 3068 | Ga0495624_0002728 | |||
| 3069 | Ga0495624_0038263 | |||
| 3070 | Ga0495624_0090428 | |||
| 3071 | Ga0495624_0330436 | |||
| 3072 | Ga0495670_0000232 | |||
| 3073 | Ga0495649_0031195 | |||
| 3074 | Ga0495589_0077488 | |||
| 3075 | Ga0495589_0114719 | |||
| 3076 | Ga0495589_0130170 | |||
| 3077 | Ga0495589_0209375 | |||
| 3078 | Ga0495600_0006096 | |||
| 3079 | Ga0495600_0014421 | |||
| 3080 | Ga0495600_0047963 | |||
| 3081 | Ga0495600_0147325 | |||
| 3082 | Ga0495660_0251295 | |||
| 3083 | Ga0495581_0004200 | |||
| 3084 | Ga0495581_0021531 | |||
| 3085 | Ga0495581_0099047 | |||
| 3086 | Ga0495581_0478194 | |||
| 3087 | Ga0495604_0007154 | |||
| 3088 | Ga0495604_0009413 | |||
| 3089 | Ga0495604_0010035 | |||
| 3090 | Ga0495604_0021471 | |||
| 3091 | Ga0495604_0032634 | |||
| 3092 | Ga0495604_0137932 | |||
| 3093 | Ga0495604_0222748 | |||
| 3094 | Ga0495674_0004552 | |||
| 3095 | Ga0495674_0006956 | |||
| 3096 | Ga0495674_0015538 | |||
| 3097 | Ga0495674_0019348 | |||
| 3098 | Ga0495674_0109833 | |||
| 3099 | Ga0495674_0170596 | |||
| 3100 | Ga0495674_0582033 | |||
| 3101 | Ga0495672_0055254 | |||
| 3102 | Ga0495672_0056212 | |||
| 3103 | Ga0495676_0042489 | |||
| 3104 | Ga0495676_0077595 | |||
| 3105 | Ga0495676_0582959 | |||
| 3106 | Ga0495680_0009493 | |||
| 3107 | Ga0495680_0015757 | |||
| 3108 | Ga0495680_0061335 | |||
| 3109 | Ga0495680_0231419 | |||
| 3110 | Ga0495683_0043754 | |||
| 3111 | Ga0495687_007651 | |||
| 3112 | Ga0495675_0004613 | |||
| 3113 | Ga0495675_0058767 | |||
| 3114 | Ga0495675_0216014 | |||
| 3115 | Ga0495677_0024863 | |||
| 3116 | Ga0495677_0235725 | |||
| 3117 | Ga0495685_087380 | |||
| 3118 | Ga0495673_0210858 | |||
| 3119 | Ga0495681_0097528 | |||
| 3120 | Ga0495681_0125161 | |||
| 3121 | Ga0495681_0191125 | |||
| 3122 | Ga0495684_0004994 | |||
| 3123 | Ga0495684_0028649 | |||
| 3124 | Ga0495684_0140471 | |||
| 3125 | Ga0495686_0068506 | |||
| 3126 | Ga0495686_0344638 | |||
| 3127 | Ga0495593_0000679 | |||
| 3128 | Ga0495593_0003433 | |||
| 3129 | Ga0495593_0120964 | |||
| 3130 | Ga0495593_0260074 | |||
| 3131 | Ga0495602_0005817 | |||
| 3132 | Ga0495602_0065563 | |||
| 3133 | Ga0495602_0154738 | |||
| 3134 | Ga0495614_0004306 | |||
| 3135 | Ga0495614_0014718 | |||
| 3136 | Ga0496100_0012284 | |||
| 3137 | Ga0496100_0324548 | |||
| 3138 | Ga0496100_0672805 | |||
| 3139 | Ga0496100_0689141 | |||
| 3140 | Ga0496101_0004662 | |||
| 3141 | Ga0496101_0283130 | |||
| 3142 | Ga0496101_0332561 | |||
| 3143 | Ga0496101_0358041 | |||
| 3144 | Ga0496101_0394731 | |||
| 3145 | Ga0496101_0549379 | |||
| 3146 | Ga0496102_0047801 | |||
| 3147 | Ga0496102_0062740 | |||
| 3148 | Ga0496102_0238564 | |||
| 3149 | Ga0496102_0485723 | |||
| 3150 | Ga0496102_0495046 | |||
| 3151 | Ga0496102_0665053 | |||
| 3152 | Ga0496102_0950128 | |||
| 3153 | Ga0496102_1121632 | |||
| 3154 | Ga0496103_0006185 | |||
| 3155 | Ga0496103_0008894 | |||
| 3156 | Ga0496103_0015621 | |||
| 3157 | Ga0496103_0037996 | |||
| 3158 | Ga0496103_0527669 | |||
| 3159 | Ga0496103_0539607 | |||
| 3160 | Ga0496104_0010719 | |||
| 3161 | Ga0496104_0059060 | |||
| 3162 | Ga0496104_0210504 | |||
| 3163 | Ga0496104_0210756 | |||
| 3164 | Ga0496104_0263367 | |||
| 3165 | Ga0496104_0312094 | |||
| 3166 | Ga0496104_0360865 | |||
| 3167 | Ga0496104_0423961 | |||
| 3168 | Ga0496105_0019738 | |||
| 3169 | Ga0496105_0079466 | |||
| 3170 | Ga0496105_0081795 | |||
| 3171 | Ga0496105_0121851 | |||
| 3172 | Ga0496105_0161651 | |||
| 3173 | Ga0496105_0272126 | |||
| 3174 | Ga0496105_0471731 | |||
| 3175 | Ga0496105_0854905 | |||
| 3176 | Ga0496106_0000714 | |||
| 3177 | Ga0496106_0001507 | |||
| 3178 | Ga0496106_0063296 | |||
| 3179 | Ga0496106_0123148 | |||
| 3180 | Ga0496106_0198249 | |||
| 3181 | Ga0496106_0249330 | |||
| 3182 | Ga0496106_0254150 | |||
| 3183 | Ga0496106_0275869 | |||
| 3184 | Ga0496107_0013027 | |||
| 3185 | Ga0496107_0034503 | |||
| 3186 | Ga0496107_0070218 | |||
| 3187 | Ga0496107_0259257 | |||
| 3188 | Ga0496108_0000467 | |||
| 3189 | Ga0496108_0008923 | |||
| 3190 | Ga0496108_0024693 | |||
| 3191 | Ga0496108_0068526 | |||
| 3192 | Ga0496108_0112328 | |||
| 3193 | Ga0496108_0398780 | |||
| 3194 | Ga0496108_0717461 | |||
| 3195 | Ga0496109_0000919 | |||
| 3196 | Ga0496109_0004359 | |||
| 3197 | Ga0496109_0006181 | |||
| 3198 | Ga0496109_0032499 | |||
| 3199 | Ga0496109_0051358 | |||
| 3200 | Ga0496109_0283841 | |||
| 3201 | Ga0496109_0361076 | |||
| 3202 | Ga0496109_0545486 | |||
| 3203 | Ga0496110_0005112 | |||
| 3204 | Ga0496110_0027117 | |||
| 3205 | Ga0496110_0119628 | |||
| 3206 | Ga0496110_0269128 | |||
| 3207 | Ga0496110_0652424 | |||
| 3208 | Ga0496111_0015259 | |||
| 3209 | Ga0496111_0021221 | |||
| 3210 | Ga0496111_0071906 | |||
| 3211 | Ga0496111_0123592 | |||
| 3212 | Ga0496111_0507797 | |||
| 3213 | Ga0496112_0000023 | |||
| 3214 | Ga0496112_0021640 | |||
| 3215 | Ga0496112_0028400 | |||
| 3216 | Ga0496112_0031782 | |||
| 3217 | Ga0496112_0041638 | |||
| 3218 | Ga0496112_0055881 | |||
| 3219 | Ga0496112_0180223 | |||
| 3220 | Ga0496112_0345617 | |||
| 3221 | Ga0496113_0015295 | |||
| 3222 | Ga0496113_0024655 | |||
| 3223 | Ga0496113_0025557 | |||
| 3224 | Ga0496113_0188175 | |||
| 3225 | Ga0496113_0250665 | |||
| 3226 | Ga0496114_0007710 | |||
| 3227 | Ga0496114_0045487 | |||
| 3228 | Ga0496114_0078470 | |||
| 3229 | Ga0496114_0100495 | |||
| 3230 | Ga0496114_0306974 | |||
| 3231 | Ga0496114_0438094 | |||
| 3232 | Ga0496115_0004655 | |||
| 3233 | Ga0496115_0007641 | |||
| 3234 | Ga0496115_0041793 | |||
| 3235 | Ga0496115_0104793 | |||
| 3236 | Ga0496115_0144949 | |||
| 3237 | Ga0496115_0157371 | |||
| 3238 | Ga0496115_0179701 | |||
| 3239 | Ga0496115_0809883 | |||
| 3240 | Ga0496116_0001929 | |||
| 3241 | Ga0496116_0060694 | |||
| 3242 | Ga0496116_0075862 | |||
| 3243 | Ga0496116_0138668 | |||
| 3244 | Ga0496116_0259699 | |||
| 3245 | Ga0496117_0037055 | |||
| 3246 | Ga0496117_0108104 | |||
| 3247 | Ga0496117_0229465 | |||
| 3248 | Ga0496118_0002645 | |||
| 3249 | Ga0496118_0042077 | |||
| 3250 | Ga0496118_0050486 | |||
| 3251 | Ga0496118_0050606 | |||
| 3252 | Ga0496118_0082338 | |||
| 3253 | Ga0496119_0046967 | |||
| 3254 | Ga0496119_0136521 | |||
| 3255 | Ga0496120_0041581 | |||
| 3256 | Ga0496120_0093898 | |||
| 3257 | Ga0496120_0094161 | |||
| 3258 | Ga0496121_0000418 | |||
| 3259 | Ga0496121_0001793 | |||
| 3260 | Ga0496121_0009034 | |||
| 3261 | Ga0496121_0027543 | |||
| 3262 | Ga0496121_0037923 | |||
| 3263 | Ga0496121_0039233 | |||
| 3264 | Ga0496121_0041124 | |||
| 3265 | Ga0496121_0053458 | |||
| 3266 | Ga0496121_0058984 | |||
| 3267 | Ga0496121_0062764 | |||
| 3268 | Ga0496121_0069465 | |||
| 3269 | Ga0496121_0089604 | |||
| 3270 | Ga0496121_0141111 | |||
| 3271 | Ga0496121_0429561 | |||
| 3272 | Ga0496121_0614354 | |||
| 3273 | Ga0496122_0017800 | |||
| 3274 | Ga0496122_0046458 | |||
| 3275 | Ga0496122_0107440 | |||
| 3276 | Ga0496122_0113567 | |||
| 3277 | Ga0496123_0031532 | |||
| 3278 | Ga0496123_0051676 | |||
| 3279 | Ga0496123_0255826 | |||
| 3280 | Ga0496124_0002424 | |||
| 3281 | Ga0496124_0100219 | |||
| 3282 | Ga0496124_0125808 | |||
| 3283 | Ga0496124_0147591 | |||
| 3284 | Ga0496124_0162569 | |||
| 3285 | Ga0496124_0169448 | |||
| 3286 | Ga0496124_0205903 | |||
| 3287 | Ga0496124_0477137 | |||
| 3288 | Ga0496124_0646596 | |||
| 3289 | Ga0496125_0000158 | |||
| 3290 | Ga0496125_0004941 | |||
| 3291 | Ga0496125_0016540 | |||
| 3292 | Ga0496125_0025957 | |||
| 3293 | Ga0496125_0035736 | |||
| 3294 | Ga0496125_0047195 | |||
| 3295 | Ga0496125_0073349 | |||
| 3296 | Ga0496125_0292789 | |||
| 3297 | Ga0496126_0006284 | |||
| 3298 | Ga0496126_0010261 | |||
| 3299 | Ga0496126_0019358 | |||
| 3300 | Ga0496126_0021246 | |||
| 3301 | Ga0496126_0026831 | |||
| 3302 | Ga0496126_0028328 | |||
| 3303 | Ga0496126_0044951 | |||
| 3304 | Ga0496126_0062639 | |||
| 3305 | Ga0496126_0068498 | |||
| 3306 | Ga0496126_0100099 | |||
| 3307 | Ga0496126_0130795 | |||
| 3308 | Ga0496126_0207432 | |||
| 3309 | Ga0496126_0208690 | |||
| 3310 | Ga0496126_0225436 | |||
| 3311 | Ga0496126_0277785 | |||
| 3312 | Ga0496126_0312298 | |||
| 3313 | Ga0496126_0361231 | |||
| 3314 | Ga0496126_0363217 | |||
| 3315 | Ga0496126_0512357 | |||
| 3316 | Ga0496126_0565216 | |||
| 3317 | Ga0496126_0734024 | |||
| 3318 | Ga0496126_0905897 | |||
| 3319 | Ga0495678_144482 | |||
| 3320 | Ga0495682_0003462 | |||
| 3321 | Ga0495682_0060395 | |||
| 3322 | Ga0501031_0000946 | |||
| 3323 | Ga0501031_0005295 | |||
| 3324 | Ga0501031_0032191 | |||
| 3325 | Ga0501032_0000329 | |||
| 3326 | Ga0501032_0010457 | |||
| 3327 | Ga0501032_0026506 | |||
| 3328 | Ga0501032_0069586 | |||
| 3329 | Ga0501032_0194723 | |||
| 3330 | Ga0501032_0365845 | |||
| 3331 | Ga0501032_0438956 | |||
| 3332 | Ga0501033_0000140 | |||
| 3333 | Ga0501033_0001234 | |||
| 3334 | Ga0501033_0027357 | |||
| 3335 | Ga0501033_0043768 | |||
| 3336 | Ga0501033_0273162 | |||
| 3337 | Ga0501034_0000072 | |||
| 3338 | Ga0501034_0001020 | |||
| 3339 | Ga0501034_0068138 | |||
| 3340 | Ga0501034_0097128 | |||
| 3341 | Ga0501034_0110745 | |||
| 3342 | Ga0501034_0221349 | |||
| 3343 | Ga0501034_0276062 | |||
| 3344 | Ga0501034_0644797 | |||
| 3345 | Ga0501036_0000050 | |||
| 3346 | Ga0501036_0018274 | |||
| 3347 | Ga0501036_0053063 | |||
| 3348 | Ga0501036_0303755 | |||
| 3349 | Ga0501036_0328208 | |||
| 3350 | Ga0501036_0341412 | |||
| 3351 | Ga0501036_0738254 | |||
| 3352 | Ga0501037_0000030 | |||
| 3353 | Ga0501037_0000580 | |||
| 3354 | Ga0501037_0151612 | |||
| 3355 | Ga0501037_0182547 | |||
| 3356 | Ga0501037_0270237 | |||
| 3357 | Ga0501037_0469317 | |||
| 3358 | Ga0501038_0000039 | |||
| 3359 | Ga0501038_0007292 | |||
| 3360 | Ga0501038_0028303 | |||
| 3361 | Ga0501038_0038610 | |||
| 3362 | Ga0501038_0433522 | |||
| 3363 | Ga0501039_0000060 | |||
| 3364 | Ga0501039_0032111 | |||
| 3365 | Ga0501039_0127856 | |||
| 3366 | Ga0501039_0159198 | |||
| 3367 | Ga0501039_0239165 | |||
| 3368 | Ga0501039_0248133 | |||
| 3369 | Ga0501039_0560394 | |||
| 3370 | Ga0501040_0006065 | |||
| 3371 | Ga0501041_0379512 | |||
| 3372 | Ga0501042_0005278 | |||
| 3373 | Ga0501042_0010958 | |||
| 3374 | Ga0501042_0030827 | |||
| 3375 | Ga0501042_0527459 | |||
| 3376 | Ga0501043_0009259 | |||
| 3377 | Ga0501043_0035883 | |||
| 3378 | Ga0501043_0042113 | |||
| 3379 | Ga0501043_0045148 | |||
| 3380 | Ga0501043_0251366 | |||
| 3381 | Ga0501046_0000419 | |||
| 3382 | Ga0501046_0011289 | |||
| 3383 | Ga0501046_0091782 | |||
| 3384 | Ga0501046_0173125 | |||
| 3385 | Ga0501046_0372165 | |||
| 3386 | Ga0501047_0000174 | |||
| 3387 | Ga0501047_0038683 | |||
| 3388 | Ga0501047_0185687 | |||
| 3389 | Ga0501047_0428033 | |||
| 3390 | Ga0501047_0510880 | |||
| 3391 | Ga0501047_0811252 | |||
| 3392 | Ga0501048_0000068 | |||
| 3393 | Ga0501048_0005561 | |||
| 3394 | Ga0501048_0033997 | |||
| 3395 | Ga0501048_0130953 | |||
| 3396 | Ga0501067_0000239 | |||
| 3397 | Ga0501067_0018480 | |||
| 3398 | Ga0501067_0043286 | |||
| 3399 | Ga0501067_0275596 | |||
| 3400 | Ga0501068_0000227 | |||
| 3401 | Ga0501068_0005447 | |||
| 3402 | Ga0501068_0148656 | |||
| 3403 | Ga0501068_0392281 | |||
| 3404 | Ga0501068_0625810 | |||
| 3405 | Ga0501068_0683633 | |||
| 3406 | Ga0501069_0015919 | |||
| 3407 | Ga0501069_0194362 | |||
| 3408 | Ga0501070_0013633 | |||
| 3409 | Ga0501070_0019317 | |||
| 3410 | Ga0501070_0111360 | |||
| 3411 | Ga0501070_0131274 | |||
| 3412 | Ga0501070_0137291 | |||
| 3413 | Ga0501070_0145913 | |||
| 3414 | Ga0501070_0428653 | |||
| 3415 | Ga0501071_0015009 | |||
| 3416 | Ga0501071_0503427 | |||
| 3417 | Ga0501071_0519834 | |||
| 3418 | Ga0501072_0065634 | |||
| 3419 | Ga0501072_0067565 | |||
| 3420 | Ga0501072_0635447 | |||
| 3421 | Ga0501073_0000009 | |||
| 3422 | Ga0501073_0009574 | |||
| 3423 | Ga0501073_0041581 | |||
| 3424 | Ga0501074_0000049 | |||
| 3425 | Ga0501074_0006029 | |||
| 3426 | Ga0501074_0129548 | |||
| 3427 | Ga0501074_0515052 | |||
| 3428 | Ga0501075_0097959 | |||
| 3429 | Ga0501076_0016565 | |||
| 3430 | Ga0501076_0103098 | |||
| 3431 | Ga0501076_0130960 | |||
| 3432 | Ga0501077_0101337 | |||
| 3433 | Ga0501077_0114788 | |||
| 3434 | Ga0501077_0337825 | |||
| 3435 | Ga0501079_0030777 | |||
| 3436 | Ga0501079_0129494 | |||
| 3437 | Ga0501079_0185439 | |||
| 3438 | Ga0501079_0435831 | |||
| 3439 | Ga0501079_0479178 | |||
| 3440 | Ga0501080_0009583 | |||
| 3441 | Ga0501080_0011921 | |||
| 3442 | Ga0501080_0027522 | |||
| 3443 | Ga0501080_0039570 | |||
| 3444 | Ga0501080_0455452 | |||
| 3445 | Ga0501081_0175569 | |||
| 3446 | Ga0501083_0000251 | |||
| 3447 | Ga0501083_0022825 | |||
| 3448 | Ga0501035_0000067 | |||
| 3449 | Ga0501035_0029907 | |||
| 3450 | Ga0501035_0251266 | |||
| 3451 | Ga0501035_0398985 | |||
| 3452 | Ga0501035_0410605 | |||
| 3453 | Ga0501035_0528315 | |||
| 3454 | Ga0501035_0794665 | |||
| 3455 | Ga0501044_0000258 | |||
| 3456 | Ga0501044_0028375 | |||
| 3457 | Ga0501044_0032575 | |||
| 3458 | Ga0501044_0044657 | |||
| 3459 | Ga0501044_0082260 | |||
| 3460 | Ga0501044_0144020 | |||
| 3461 | Ga0501044_0247622 | |||
| 3462 | Ga0501044_0390598 | |||
| 3463 | Ga0501044_0437253 | |||
| 3464 | Ga0501044_0451905 | |||
| 3465 | Ga0501045_0015738 | |||
| 3466 | Ga0501045_0022830 | |||
| 3467 | nmdc:mga03683_42818_c1 | |||
| 3468 | nmdc:mga03n38_10359_c1 | |||
| 3469 | nmdc:mga03n38_70977_c1 | |||
| 3470 | nmdc:mga00v17_179408_c1 | |||
| 3471 | nmdc:mga00v17_294550_c1 | |||
| 3472 | nmdc:mga00v17_76067_c1 | |||
| 3473 | nmdc:mga00v17_98756_c1 | |||
| 3474 | nmdc:mga0yw44_239785_c1 | |||
| 3475 | nmdc:mga0yw44_514038_c1 | |||
| 3476 | nmdc:mga0k408_103724_c1 | |||
| 3477 | nmdc:mga06z11_149339_c1 | |||
| 3478 | nmdc:mga06z11_29780_c1 | |||
| 3479 | nmdc:mga06z11_299517_c1 | |||
| 3480 | nmdc:mga06z11_40821_c1 | |||
| 3481 | nmdc:mga06z11_53027_c1 | |||
| 3482 | nmdc:mga06z11_544520_c1 | |||
| 3483 | nmdc:mga04h51_100979_c1 | |||
| 3484 | nmdc:mga04h51_177382_c1 | |||
| 3485 | nmdc:mga04h51_27367_c1 | |||
| 3486 | nmdc:mga04h51_75880_c1 | |||
| 3487 | nmdc:mga07m45_135203_c1 | |||
| 3488 | nmdc:mga07m45_140890_c1 | |||
| 3489 | nmdc:mga07m45_395047_c1 | |||
| 3490 | nmdc:mga09592_294600_c1 | |||
| 3491 | nmdc:mga09592_528540_c1 | |||
| 3492 | nmdc:mga0qj67_657461_c1 | |||
| 3493 | nmdc:mga06r32_119899_c1 | |||
| 3494 | nmdc:mga06r32_301476_c1 | |||
| 3495 | nmdc:mga06r32_785428_c1 | |||
| 3496 | nmdc:mga08y16_138351_c1 | |||
| 3497 | nmdc:mga08y16_140320_c1 | |||
| 3498 | nmdc:mga08y16_616682_c1 | |||
| 3499 | nmdc:mga0n895_522168_c1 | |||
| 3500 | nmdc:mga0n895_650660_c1 | |||
| 3501 | nmdc:mga0n895_82387_c1 | |||
| 3502 | nmdc:mga0rr50_108376_c1 | |||
| 3503 | nmdc:mga0rr50_29681_c1 | |||
| 3504 | nmdc:mga08x19_200664_c1 | |||
| 3505 | nmdc:mga0a205_369212_c1 | |||
| 3506 | nmdc:mga0a205_5596_c1 | |||
| 3507 | nmdc:mga0sz30_10467_c1 | |||
| 3508 | nmdc:mga0sz30_17818_c1 | |||
| 3509 | nmdc:mga0sz30_199290_c1 | |||
| 3510 | nmdc:mga0sz30_34515_c1 | |||
| 3511 | Ga0495601_0052538 | |||
| 3512 | Ga0495601_0153803 | |||
| 3513 | Ga0495601_0181861 | |||
| 3514 | Ga0495601_0307767 | |||
| 3515 | Ga0495601_0397807 | |||
| 3516 | Ga0495612_0030896 | |||
| 3517 | Ga0500610_0181776 | |||
| 3518 | Ga0495655_0009530 | |||
| 3519 | Ga0495655_0054531 | |||
| 3520 | Ga0495655_0127642 | |||
| 3521 | Ga0495595_0002393 | |||
| 3522 | Ga0495595_0012856 | |||
| 3523 | Ga0495619_0000630 | |||
| 3524 | Ga0495619_0004668 | |||
| 3525 | Ga0495619_0023019 | |||
| 3526 | Ga0495619_0095094 | |||
| 3527 | Ga0495619_0134172 | |||
| 3528 | Ga0495619_0313676 | |||
| 3529 | Ga0500643_000013 | |||
| 3530 | Ga0500644_0014340 | |||
| 3531 | Ga0500644_0167880 | |||
| 3532 | Ga0500581_032588 | |||
| 3533 | Ga0500581_158955 | |||
| 3534 | Ga0500647_0030491 | |||
| 3535 | Ga0500647_0062056 | |||
| 3536 | Ga0500651_0173478 | |||
| 3537 | Ga0500651_0357220 | |||
| 3538 | Ga0500566_0000368 | |||
| 3539 | Ga0500566_0001157 | |||
| 3540 | Ga0500566_0049191 | |||
| 3541 | Ga0500566_0088650 | |||
| 3542 | Ga0500566_0198014 | |||
| 3543 | Ga0500641_0013287 | |||
| 3544 | Ga0500641_0035646 | |||
| 3545 | Ga0500641_0106243 | |||
| 3546 | Ga0500648_182017 | |||
| 3547 | Ga0500650_0132863 | |||
| 3548 | Ga0500554_137689 | |||
| 3549 | Ga0500555_020600 | |||
| 3550 | Ga0500556_0000029 | |||
| 3551 | Ga0500557_000077 | |||
| 3552 | Ga0500562_027619 | |||
| 3553 | Ga0500572_007440 | |||
| 3554 | Ga0500592_001314 | |||
| 3555 | Ga0500592_029342 | |||
| 3556 | Ga0500594_0017938 | |||
| 3557 | Ga0500594_0162243 | |||
| 3558 | Ga0500595_000413 | |||
| 3559 | Ga0500595_004232 | |||
| 3560 | Ga0500595_004585 | |||
| 3561 | Ga0500595_006515 | |||
| 3562 | Ga0500595_017562 | |||
| 3563 | Ga0500595_060464 | |||
| 3564 | Ga0500607_087275 | |||
| 3565 | Ga0500607_089952 | |||
| 3566 | Ga0500608_035959 | |||
| 3567 | Ga0500614_094925 | |||
| 3568 | Ga0500621_191913 | |||
| 3569 | Ga0500642_0000020 | |||
| 3570 | Ga0500642_0000155 | |||
| 3571 | Ga0500642_0030053 | |||
| 3572 | Ga0500642_0090877 | |||
| 3573 | Ga0500652_000109 | |||
| 3574 | Ga0500655_011853 | |||
| 3575 | Ga0500658_0108476 | |||
| 3576 | Ga0500559_0000517 | |||
| 3577 | Ga0500559_0094840 | |||
| 3578 | Ga0500559_0103024 | |||
| 3579 | Ga0500559_0197217 | |||
| 3580 | Ga0500561_0149560 | |||
| 3581 | Ga0500564_065616 | |||
| 3582 | Ga0500568_0003634 | |||
| 3583 | Ga0500568_0031574 | |||
| 3584 | Ga0500573_0183116 | |||
| 3585 | Ga0500577_0001333 | |||
| 3586 | Ga0500577_0044084 | |||
| 3587 | Ga0500577_0053909 | |||
| 3588 | Ga0500589_087476 | |||
| 3589 | Ga0500590_020301 | |||
| 3590 | Ga0500590_083867 | |||
| 3591 | Ga0500590_095143 | |||
| 3592 | Ga0500603_001376 | |||
| 3593 | Ga0500604_0001164 | |||
| 3594 | Ga0500604_0045443 | |||
| 3595 | Ga0500616_0000048 | |||
| 3596 | Ga0500616_0000112 | |||
| 3597 | Ga0500622_0003950 | |||
| 3598 | Ga0500622_0005537 | |||
| 3599 | Ga0500627_0010686 | |||
| 3600 | Ga0500627_0019555 | |||
| 3601 | Ga0500633_0003166 | |||
| 3602 | Ga0500638_115914 | |||
| 3603 | Ga0500638_166815 | |||
| 3604 | Ga0500638_183688 | |||
| 3605 | Ga0500638_210521 | |||
| 3606 | Ga0500638_222694 | |||
| 3607 | Ga0500639_021054 | |||
| 3608 | Ga0500639_084480 | |||
| 3609 | Ga0500636_0002634 | |||
| 3610 | Ga0500636_0030897 | |||
| 3611 | Ga0500636_0271079 | |||
| 3612 | Ga0500637_0000167 | |||
| 3613 | Ga0500637_0029622 | |||
| 3614 | Ga0500611_003582 | |||
| 3615 | Ga0500645_014193 | |||
| 3616 | Ga0500552_032337 | |||
| 3617 | Ga0500596_012745 | |||
| 3618 | Ga0500596_032965 | |||
| 3619 | Ga0500601_000600 | |||
| 3620 | Ga0501084_0002907 | |||
| 3621 | Ga0501084_0009842 | |||
| 3622 | Ga0500661_001069 | |||
| 3623 | Ga0587128_033533 | |||
| 3624 | Ga0501082_0000285 | |||
| 3625 | Ga0501082_0017294 | |||
| 3626 | Ga0466962_0072043 | |||
| 3627 | Ga0466962_0340697 | |||
| 3628 | 2824763207 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4olj-assembly1.cif.gz_A | crystal structure of arg119gln mutant of peptidyl-trna hydrolase from acinetobacter baumannii at 1.49 a resolution | 0.9428 | 1 | 183 |
| 2z2j-assembly1.cif.gz_A | crystal structure of peptidyl-trna hydrolase from mycobacterium tuberculosis | 0.9425 | 2 | 171 |
| 4zxp-assembly3.cif.gz_A | crystal structure of peptidyl- trna hydrolase from vibrio cholerae | 0.9409 | 1 | 184 |
| 1ryb-assembly1.cif.gz_A | crystal structure of the chloroplast group ii intron splicing factor crs2 | 0.9396 | 2 | 176 |
| 8axp-assembly1.cif.gz_B | neisseria gonorrhoeae peptidyl-trna hydrolase complexed with an xchem hit. | 0.9392 | 2 | 184 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5ektA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidyl-tRNA hydrolase | 0.9342 | 1 | 185 | 3.40.50.1470 |
| af_F1M8A9_28_144_3.40.50.1470 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidyl-tRNA hydrolase | 0.9276 | 2 | 109 | 3.40.50.1470 |
| af_Q10LI6_46_183_3.40.50.1470 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidyl-tRNA hydrolase | 0.927 | 2 | 131 | 3.40.50.1470 |
| 4ylyA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidyl-tRNA hydrolase | 0.9186 | 1 | 183 | 3.40.50.1470 |
| af_Q86Y79_27_209_3.40.50.1470 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidyl-tRNA hydrolase | 0.9156 | 2 | 177 | 3.40.50.1470 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A527ZGE1-F1-model_v4 | Peptidyl-tRNA hydrolase | 1.002 | 1 | 78 |
GO:0004045
|
| AF-A0A356FV50-F1-model_v4 | Aminoacyl-tRNA hydrolase | 0.9974 | 1 | 73 |
GO:0004045
|
| AF-A0A2D5SCR2-F1-model_v4 | Aminoacyl-tRNA hydrolase | 0.9926 | 2 | 88 |
GO:0004045
|
| AF-A0A4Q9VJW5-F1-model_v4 | Peptidyl-tRNA hydrolase (PTH) (EC 3.1.1.29) | 0.9923 | 1 | 183 |
GO:0004045
GO:0005737 GO:0006412 |
| AF-A0A1W9I528-F1-model_v4 | Peptidyl-tRNA hydrolase (PTH) (EC 3.1.1.29) | 0.992 | 1 | 192 |
GO:0004045
GO:0005737 GO:0006412 |