F495797

General Info

Members Datasets Scaffolds Average Seq Length
1821 528 1816 145

Family's Representative Sequence

Representative Sequence 3300009098|Ga0105245_10318274|Ga0105245_103182742
Length 155
Sequence MSGLERQPGKGKNGPDIMGMSASGAKAVMAEINVTPMVDVMLVLLIIFMVSAPLLTVGVPLDLPQTQAKSLDQDKNPLTLSVNLKGQVFLNDSEIAVDELVPKLKAITEARGGLDERIFVRGDRKVDYGTVMKVMGRLSQAGFRRVALVTEVEQG

Samples

Sample ID Description Type Environment
1 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
2 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
3 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
4 2643221651 Afipia sp. Root123D2 Isolate Unclassified
5 2828305725 Xanthobacter tagetidis DSM 11105 Isolate Unclassified
6 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
7 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
8 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
9 3300000045 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere Metagenome Rhizosphere
10 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
11 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
12 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
13 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
14 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
15 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
16 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
17 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
18 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
19 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
20 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
21 3300005276 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v1 Metagenome Rhizosphere
22 3300005277 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) Metagenome Rhizosphere
23 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
24 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
25 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
26 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
27 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
28 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
29 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
30 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
31 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
32 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
33 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
34 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
35 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
36 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
37 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
38 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
39 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
40 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
41 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
42 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
43 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
44 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
45 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
46 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
47 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
48 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
49 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
50 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
51 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
52 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
53 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
54 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
55 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
56 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
57 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
58 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
59 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
60 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
61 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
62 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
63 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
64 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
65 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
66 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
67 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
68 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
69 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
70 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
71 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
72 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
73 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
74 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
75 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
76 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
77 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
78 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
79 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
80 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
81 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
82 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
83 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
84 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
85 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
86 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
87 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
88 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
89 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
90 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
91 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
92 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
93 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
94 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
95 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
96 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
97 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
98 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
99 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
100 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
101 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
102 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
103 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
104 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
105 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
106 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
107 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
108 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
109 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
110 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
111 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
112 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
113 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
114 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
115 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
116 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
117 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
118 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
119 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
120 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
121 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
122 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
123 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
124 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
125 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
126 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
127 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
128 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
129 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
130 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
131 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
132 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
133 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
134 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
135 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
136 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
137 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
138 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
139 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
140 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
141 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
142 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
143 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
144 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
145 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
146 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
147 3300012482 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.130510 Metagenome Rhizosphere
148 3300012491 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.8.old.040610 Metagenome Rhizosphere
149 3300012494 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 Metagenome Rhizosphere
150 3300012495 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 Metagenome Rhizosphere
151 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
152 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
153 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
154 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
155 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
156 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
157 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
158 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
159 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
160 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
161 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
162 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
163 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
164 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
165 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
166 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
167 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
168 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
169 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
170 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
171 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
172 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
173 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
174 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
175 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
176 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
177 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
178 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
179 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
231 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
236 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
237 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
238 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
239 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
240 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
241 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
243 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
244 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
245 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
246 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
247 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
248 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
249 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
250 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
251 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
252 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
253 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
254 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
255 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
256 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
257 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
258 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
259 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
260 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
261 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
262 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
263 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
264 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
265 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
266 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
267 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
268 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
269 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
270 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
271 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
272 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
273 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
274 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
275 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
276 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
277 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
278 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
279 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
280 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
281 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
282 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
283 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
284 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
285 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
286 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
287 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
288 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
289 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
290 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
291 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
292 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
293 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
294 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
295 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
296 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
297 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
298 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
299 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
300 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
301 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
302 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
303 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
304 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
305 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
306 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
307 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
308 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
309 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
310 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
311 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
312 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
313 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
314 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
315 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
316 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
317 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
318 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
319 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
320 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
321 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
322 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
323 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
324 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
325 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
326 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
327 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
328 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
329 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
330 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
331 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
332 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
333 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
334 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
335 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
336 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
337 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
338 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
339 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
340 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
341 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
342 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
343 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
344 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
345 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
346 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
347 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
348 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
349 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
350 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
351 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
352 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
353 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
354 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
355 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
356 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
357 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
358 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
359 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
360 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
361 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
362 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
363 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
364 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
365 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
366 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
367 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
368 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
369 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
370 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
371 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
372 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
373 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
374 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
375 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
376 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
377 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
378 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
379 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
380 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
381 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
382 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
383 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
384 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
385 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
386 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
387 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
388 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
389 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
390 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
391 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
392 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
393 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
394 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
395 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
396 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
397 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
398 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
399 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
400 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
401 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
402 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
403 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
404 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
405 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
406 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
407 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
408 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
409 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
410 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
411 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
412 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
413 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
414 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
415 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
416 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
417 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
418 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
419 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
420 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
421 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
422 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
423 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
424 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
425 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
426 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
427 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
428 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
429 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
430 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
431 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
432 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
433 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
434 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
435 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
436 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
437 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
438 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
439 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
440 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
441 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
442 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
443 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
444 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
445 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
446 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
447 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
448 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
449 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
450 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
451 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
452 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
453 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
454 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
455 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
456 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
457 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
458 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
459 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
460 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
461 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
462 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
463 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
464 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
465 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
466 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
467 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
468 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
469 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
470 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
471 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
472 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
473 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
474 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
475 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
476 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
477 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
478 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
479 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
480 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
481 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
482 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
483 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
484 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
485 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
486 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
487 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
488 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
489 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
490 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
491 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
492 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
493 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
494 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
495 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
496 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
497 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
498 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
499 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
500 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
501 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
502 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
503 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
504 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
505 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
506 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
507 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
508 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
509 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
510 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
511 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
512 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
513 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
514 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
515 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
516 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
517 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
518 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
519 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
520 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
521 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
522 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
523 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
524 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
525 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
526 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
527 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
528 8054563764 Acuticoccus kalidii M5D2P5 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.29
Metatranscriptomes 0.44
Isolates 0.27

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.66
Nodule 0.11
Rhizoplane 5.16
Rhizosphere 85.78
Stem 0
Stem Tuber 0
Unclassified 3.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 2214736872 2209111006 Bacteria 4177
2 ARSoilYngRDRAFT_c00011 3300000042 Bacteria 28426
3 ARcpr5yngRDRAFT_c000364 3300000043 Bacteria 5999
4 ARSoilOldRDRAFT_c000398 3300000044 Bacteria 5356
5 ARSoilOldRDRAFT_c009307 3300000044 Bacteria 819
6 ARCol0oldRDRAFT_c00910 3300000045 Bacteria 2320
7 ARCol0yngRDRAFT_1000010 3300000652 Bacteria 42356
8 ARCol0yngRDRAFT_1007341 3300000652 Bacteria 793
9 JGI24737J22298_10057315 3300001990 Bacteria 1176
10 JGI24750J21931_1002473 3300002070 Bacteria 2226
11 JGI24738J21930_10050817 3300002075 Bacteria 845
12 JGI24744J21845_10059487 3300002077 Bacteria 699
13 JGI24034J26672_10064147 3300002239 Bacteria 649
14 JGI24742J22300_10012463 3300002244 Bacteria 1417
15 JGI24742J22300_10033927 3300002244 Bacteria 898
16 JGI25406J46586_10003907 3300003203 Bacteria 6965
17 JGI25406J46586_10034035 3300003203 Bacteria 1875
18 JGI25406J46586_10080186 3300003203 Bacteria 1003
19 JGI25404J52841_10017244 3300003659 Bacteria 1566
20 JGI25404J52841_10036347 3300003659 Bacteria 1048
21 Ga0058861_11589086 3300004800 Bacteria 659
22 Ga0058862_12542395 3300004803 Bacteria 930
23 Ga0065717_1003945 3300005276 Bacteria 1137
24 Ga0065716_1001744 3300005277 Bacteria 3666
25 Ga0065704_10009650 3300005289 Bacteria 2958
26 Ga0065712_10000516 3300005290 Bacteria 15351
27 Ga0065712_10120705 3300005290 Bacteria 1675
28 Ga0065712_10120819 3300005290 Bacteria 1673
29 Ga0065715_10000847 3300005293 Bacteria 21445
30 Ga0065715_10035447 3300005293 Bacteria 2297
31 Ga0065715_10280612 3300005293 Bacteria 1087
32 Ga0065707_10743739 3300005295 Bacteria 621
33 Ga0070658_10197255 3300005327 Bacteria 1698
34 Ga0070658_10412650 3300005327 Bacteria 1161
35 Ga0070676_10217729 3300005328 Bacteria 1260
36 Ga0070676_10359746 3300005328 Bacteria 1003
37 Ga0070683_100014532 3300005329 Bacteria 6891
38 Ga0070683_100098540 3300005329 Bacteria 2751
39 Ga0070683_100167556 3300005329 Bacteria 2085
40 Ga0070683_100494988 3300005329 Bacteria 1168
41 Ga0070683_100819279 3300005329 Bacteria 892
42 Ga0070690_100000739 3300005330 Bacteria 16697
43 Ga0070690_100085270 3300005330 Bacteria 2072
44 Ga0070690_100258383 3300005330 Bacteria 1235
45 Ga0070690_100269436 3300005330 Bacteria 1211
46 Ga0070670_100064473 3300005331 Bacteria 3143
47 Ga0070670_100130701 3300005331 Bacteria 2168
48 Ga0070670_100140115 3300005331 Bacteria 2091
49 Ga0070677_10021325 3300005333 Bacteria 2375
50 Ga0068869_100103472 3300005334 Bacteria 2157
51 Ga0068869_100280136 3300005334 Bacteria 1341
52 Ga0068869_100612881 3300005334 Bacteria 921
53 Ga0070666_10005243 3300005335 Bacteria 7939
54 Ga0070680_100002731 3300005336 Bacteria 13090
55 Ga0070680_100006843 3300005336 Bacteria 8690
56 Ga0070680_100037382 3300005336 Bacteria 3923
57 Ga0070680_100069869 3300005336 Bacteria 2884
58 Ga0070680_100078641 3300005336 Bacteria 2718
59 Ga0070680_100351118 3300005336 Bacteria 1254
60 Ga0070680_100452701 3300005336 Bacteria 1096
61 Ga0070682_100001034 3300005337 Bacteria 16081
62 Ga0070682_100069049 3300005337 Bacteria 2255
63 Ga0070682_100729201 3300005337 Bacteria 798
64 Ga0068868_100034277 3300005338 Bacteria 3918
65 Ga0068868_100166135 3300005338 Bacteria 1825
66 Ga0068868_100363272 3300005338 Bacteria 1242
67 Ga0068868_100366737 3300005338 Bacteria 1237
68 Ga0068868_100576163 3300005338 Bacteria 995
69 Ga0070660_100006936 3300005339 Bacteria 7856
70 Ga0070660_100054443 3300005339 Bacteria 3089
71 Ga0070660_100077818 3300005339 Bacteria 2600
72 Ga0070660_100080384 3300005339 Bacteria 2558
73 Ga0070660_100251462 3300005339 Bacteria 1441
74 Ga0070660_100772217 3300005339 Bacteria 807
75 Ga0070660_101033479 3300005339 Bacteria 695
76 Ga0070689_100003596 3300005340 Bacteria 10333
77 Ga0070689_100173621 3300005340 Bacteria 1747
78 Ga0070689_100418958 3300005340 Bacteria 1135
79 Ga0070689_100457482 3300005340 Bacteria 1087
80 Ga0070689_100477534 3300005340 Bacteria 1064
81 Ga0070689_100503935 3300005340 Bacteria 1037
82 Ga0070691_10038900 3300005341 Bacteria 2246
83 Ga0070691_10070836 3300005341 Bacteria 1692
84 Ga0070691_10757076 3300005341 Bacteria 588
85 Ga0070687_100033131 3300005343 Bacteria 2547
86 Ga0070687_100072956 3300005343 Bacteria 1848
87 Ga0070687_100329455 3300005343 Bacteria 978
88 Ga0070661_100018330 3300005344 Bacteria 4976
89 Ga0070661_100361050 3300005344 Bacteria 1142
90 Ga0070661_100441998 3300005344 Bacteria 1034
91 Ga0070661_100810557 3300005344 Bacteria 769
92 Ga0070661_101500020 3300005344 Bacteria 569
93 Ga0070692_10007210 3300005345 Bacteria 4884
94 Ga0070668_100159111 3300005347 Bacteria 1831
95 Ga0070668_100199530 3300005347 Bacteria 1642
96 Ga0070668_101589365 3300005347 Bacteria 599
97 Ga0070668_101758854 3300005347 Bacteria 570
98 Ga0070669_100006422 3300005353 Bacteria 8461
99 Ga0070669_100133433 3300005353 Bacteria 1908
100 Ga0070669_100442765 3300005353 Bacteria 1070
101 Ga0070675_100018382 3300005354 Bacteria 5563
102 Ga0070675_100039379 3300005354 Bacteria 3857
103 Ga0070675_100270139 3300005354 Bacteria 1492
104 Ga0070675_101026074 3300005354 Bacteria 758
105 Ga0070671_100038425 3300005355 Bacteria 3973
106 Ga0070671_100067465 3300005355 Bacteria 2983
107 Ga0070671_100109906 3300005355 Bacteria 2315
108 Ga0070671_100220415 3300005355 Bacteria 1609
109 Ga0070671_100430576 3300005355 Bacteria 1130
110 Ga0070674_100011375 3300005356 Bacteria 5417
111 Ga0070674_101406553 3300005356 Bacteria 625
112 Ga0070673_100011329 3300005364 Bacteria 6082
113 Ga0070673_100039430 3300005364 Bacteria 3615
114 Ga0070673_100202033 3300005364 Bacteria 1712
115 Ga0070688_100037862 3300005365 Bacteria 2941
116 Ga0070688_100055442 3300005365 Bacteria 2486
117 Ga0070688_100088375 3300005365 Bacteria 2020
118 Ga0070688_100182803 3300005365 Bacteria 1455
119 Ga0070659_100001717 3300005366 Bacteria 15761
120 Ga0070659_100074244 3300005366 Bacteria 2709
121 Ga0070659_100108887 3300005366 Bacteria 2235
122 Ga0070659_100560824 3300005366 Bacteria 978
123 Ga0070659_101346712 3300005366 Bacteria 634
124 Ga0070667_100013755 3300005367 Bacteria 6690
125 Ga0070667_100041700 3300005367 Bacteria 3850
126 Ga0070667_100160709 3300005367 Bacteria 1978
127 Ga0070703_10166830 3300005406 Bacteria 840
128 Ga0070709_10001487 3300005434 Bacteria 12659
129 Ga0070709_10003164 3300005434 Bacteria 8830
130 Ga0070709_10015523 3300005434 Bacteria 4336
131 Ga0070709_10028224 3300005434 Bacteria 3345
132 Ga0070709_10031985 3300005434 Bacteria 3169
133 Ga0070709_10316726 3300005434 Bacteria 1144
134 Ga0070709_10698987 3300005434 Bacteria 789
135 Ga0070709_10900160 3300005434 Bacteria 700
136 Ga0070709_11293987 3300005434 Bacteria 588
137 Ga0070709_11605273 3300005434 Bacteria 530
138 Ga0070714_100004476 3300005435 Bacteria 10529
139 Ga0070714_100035682 3300005435 Bacteria 4167
140 Ga0070714_100059620 3300005435 Bacteria 3273
141 Ga0070714_100106273 3300005435 Bacteria 2480
142 Ga0070714_100165528 3300005435 Bacteria 2004
143 Ga0070714_100365326 3300005435 Bacteria 1358
144 Ga0070714_100450242 3300005435 Bacteria 1223
145 Ga0070714_100492879 3300005435 Bacteria 1168
146 Ga0070714_100876822 3300005435 Bacteria 871
147 Ga0070714_101693363 3300005435 Bacteria 618
148 Ga0070713_100005990 3300005436 Bacteria 8366
149 Ga0070713_100010765 3300005436 Bacteria 6625
150 Ga0070713_100244880 3300005436 Bacteria 1633
151 Ga0070713_100649623 3300005436 Bacteria 1004
152 Ga0070713_100734662 3300005436 Bacteria 944
153 Ga0070713_100766252 3300005436 Bacteria 924
154 Ga0070713_100882675 3300005436 Bacteria 860
155 Ga0070713_100967016 3300005436 Bacteria 821
156 Ga0070710_10005109 3300005437 Bacteria 6209
157 Ga0070710_10008128 3300005437 Bacteria 5100
158 Ga0070710_10013213 3300005437 Bacteria 4127
159 Ga0070710_10017107 3300005437 Bacteria 3704
160 Ga0070710_10026710 3300005437 Bacteria 3071
161 Ga0070710_10544524 3300005437 Bacteria 801
162 Ga0070710_10776448 3300005437 Bacteria 682
163 Ga0070710_10829503 3300005437 Bacteria 662
164 Ga0070710_11274787 3300005437 Bacteria 546
165 Ga0070701_10002689 3300005438 Bacteria 6894
166 Ga0070711_100158178 3300005439 Bacteria 1715
167 Ga0070711_100512470 3300005439 Bacteria 990
168 Ga0070711_100617192 3300005439 Bacteria 906
169 Ga0070711_100662892 3300005439 Bacteria 876
170 Ga0070705_100151035 3300005440 Bacteria 1541
171 Ga0070705_100200784 3300005440 Bacteria 1367
172 Ga0070700_100003759 3300005441 Bacteria 7857
173 Ga0070700_100276053 3300005441 Bacteria 1217
174 Ga0070700_101150136 3300005441 Bacteria 646
175 Ga0070694_100230917 3300005444 Bacteria 1392
176 Ga0070694_100673888 3300005444 Bacteria 839
177 Ga0070708_100096303 3300005445 Bacteria 2703
178 Ga0070663_100118071 3300005455 Bacteria 2000
179 Ga0070663_100498553 3300005455 Bacteria 1011
180 Ga0070678_100011418 3300005456 Bacteria 5479
181 Ga0070678_100022124 3300005456 Bacteria 4204
182 Ga0070678_100261147 3300005456 Bacteria 1456
183 Ga0070678_101172005 3300005456 Bacteria 712
184 Ga0070662_100001574 3300005457 Bacteria 14103
185 Ga0070662_100013663 3300005457 Bacteria 5406
186 Ga0070662_100155726 3300005457 Bacteria 1783
187 Ga0070681_10008089 3300005458 Bacteria 10290
188 Ga0070681_10162983 3300005458 Bacteria 2153
189 Ga0070681_10172967 3300005458 Bacteria 2081
190 Ga0070681_10273708 3300005458 Bacteria 1600
191 Ga0070681_10301008 3300005458 Bacteria 1513
192 Ga0070681_10348845 3300005458 Bacteria 1390
193 Ga0070681_10465056 3300005458 Bacteria 1177
194 Ga0070681_10504811 3300005458 Bacteria 1123
195 Ga0070681_10574923 3300005458 Bacteria 1041
196 Ga0070681_10736001 3300005458 Bacteria 902
197 Ga0070681_11031730 3300005458 Bacteria 743
198 Ga0070681_11580867 3300005458 Bacteria 581
199 Ga0068867_100163175 3300005459 Bacteria 1758
200 Ga0068867_100355232 3300005459 Bacteria 1224
201 Ga0070685_10044579 3300005466 Bacteria 2540
202 Ga0070685_10072974 3300005466 Bacteria 2039
203 Ga0070698_101049494 3300005471 Bacteria 763
204 Ga0070699_100666252 3300005518 Bacteria 950
205 Ga0070699_102057348 3300005518 Bacteria 522
206 Ga0070679_100043547 3300005530 Bacteria 4470
207 Ga0070679_100049240 3300005530 Bacteria 4196
208 Ga0070679_100064604 3300005530 Bacteria 3647
209 Ga0070679_100088267 3300005530 Bacteria 3088
210 Ga0070679_100090346 3300005530 Bacteria 3051
211 Ga0070679_100177567 3300005530 Bacteria 2102
212 Ga0070679_100280115 3300005530 Bacteria 1620
213 Ga0070679_100345067 3300005530 Bacteria 1437
214 Ga0070679_100379489 3300005530 Bacteria 1360
215 Ga0070679_100641978 3300005530 Bacteria 1004
216 Ga0070679_100926960 3300005530 Bacteria 815
217 Ga0070679_101073948 3300005530 Bacteria 749
218 Ga0070684_100017046 3300005535 Bacteria 5954
219 Ga0070684_100046120 3300005535 Bacteria 3776
220 Ga0070684_100359583 3300005535 Bacteria 1340
221 Ga0070684_102052240 3300005535 Bacteria 540
222 Ga0070697_100006940 3300005536 Bacteria 8809
223 Ga0070697_100032418 3300005536 Bacteria 4205
224 Ga0070697_100092168 3300005536 Bacteria 2506
225 Ga0070697_100691197 3300005536 Bacteria 900
226 Ga0070697_100936598 3300005536 Bacteria 769
227 Ga0070697_101155172 3300005536 Bacteria 690
228 Ga0070697_101247762 3300005536 Bacteria 663
229 Ga0068853_100003590 3300005539 Bacteria 11880
230 Ga0068853_100151648 3300005539 Bacteria 2087
231 Ga0068853_100554837 3300005539 Bacteria 1088
232 Ga0068853_101498975 3300005539 Bacteria 653
233 Ga0070672_100086189 3300005543 Bacteria 2525
234 Ga0070672_100553499 3300005543 Bacteria 999
235 Ga0070672_100765441 3300005543 Bacteria 848
236 Ga0070686_100069411 3300005544 Bacteria 2302
237 Ga0070686_100103749 3300005544 Bacteria 1925
238 Ga0070686_100676948 3300005544 Bacteria 820
239 Ga0070686_100678729 3300005544 Bacteria 819
240 Ga0070695_100000422 3300005545 Bacteria 21858
241 Ga0070695_100004835 3300005545 Bacteria 7930
242 Ga0070695_100100545 3300005545 Bacteria 1947
243 Ga0070696_100010897 3300005546 Bacteria 6093
244 Ga0070696_100012152 3300005546 Bacteria 5770
245 Ga0070696_100023703 3300005546 Bacteria 4172
246 Ga0070696_100044657 3300005546 Bacteria 3068
247 Ga0070696_100125790 3300005546 Bacteria 1860
248 Ga0070693_100025771 3300005547 Bacteria 3167
249 Ga0070693_100051962 3300005547 Bacteria 2348
250 Ga0070693_100134285 3300005547 Bacteria 1550
251 Ga0070693_100261226 3300005547 Bacteria 1152
252 Ga0070693_100298577 3300005547 Bacteria 1085
253 Ga0070693_100362806 3300005547 Bacteria 995
254 Ga0070665_100125441 3300005548 Bacteria 2570
255 Ga0070665_100201117 3300005548 Bacteria 1993
256 Ga0070665_100611959 3300005548 Bacteria 1102
257 Ga0070665_100712772 3300005548 Bacteria 1016
258 Ga0070665_101021822 3300005548 Bacteria 839
259 Ga0070704_100003084 3300005549 Bacteria 9486
260 Ga0070704_100240450 3300005549 Bacteria 1481
261 Ga0068855_100031114 3300005563 Bacteria 6375
262 Ga0068855_100082324 3300005563 Bacteria 3730
263 Ga0068855_100083641 3300005563 Bacteria 3697
264 Ga0068855_100110289 3300005563 Bacteria 3159
265 Ga0068855_100181169 3300005563 Bacteria 2382
266 Ga0068855_100321345 3300005563 Bacteria 1711
267 Ga0068855_100856454 3300005563 Bacteria 963
268 Ga0068855_101404407 3300005563 Bacteria 719
269 Ga0070664_100027234 3300005564 Bacteria 4749
270 Ga0070664_100563085 3300005564 Bacteria 1055
271 Ga0070664_100684651 3300005564 Bacteria 954
272 Ga0070664_101524198 3300005564 Bacteria 633
273 Ga0068857_100038997 3300005577 Bacteria 4206
274 Ga0068857_100180576 3300005577 Bacteria 1921
275 Ga0068857_100205381 3300005577 Bacteria 1797
276 Ga0068857_101302814 3300005577 Bacteria 705
277 Ga0068854_100190455 3300005578 Bacteria 1607
278 Ga0068854_100518363 3300005578 Bacteria 1006
279 Ga0068854_100839145 3300005578 Bacteria 804
280 Ga0068856_100046274 3300005614 Bacteria 4286
281 Ga0068856_100248883 3300005614 Bacteria 1792
282 Ga0068856_100301626 3300005614 Bacteria 1620
283 Ga0068856_100305830 3300005614 Bacteria 1608
284 Ga0068856_101347562 3300005614 Bacteria 728
285 Ga0070702_100051014 3300005615 Bacteria 2366
286 Ga0070702_101525219 3300005615 Bacteria 550
287 Ga0068852_100029658 3300005616 Bacteria 4496
288 Ga0068852_100150823 3300005616 Bacteria 2161
289 Ga0068852_100996250 3300005616 Bacteria 857
290 Ga0068852_101418782 3300005616 Bacteria 716
291 Ga0068859_100048118 3300005617 Bacteria 4284
292 Ga0068859_100056449 3300005617 Bacteria 3952
293 Ga0068859_101819923 3300005617 Bacteria 672
294 Ga0068859_102062622 3300005617 Bacteria 630
295 Ga0068864_100089466 3300005618 Bacteria 2712
296 Ga0068864_100161296 3300005618 Bacteria 2038
297 Ga0068864_100585272 3300005618 Bacteria 1082
298 Ga0068864_101105874 3300005618 Bacteria 789
299 Ga0068866_10227651 3300005718 Bacteria 1129
300 Ga0068866_10364924 3300005718 Bacteria 922
301 Ga0068861_100006045 3300005719 Bacteria 8233
302 Ga0068861_100122318 3300005719 Bacteria 2101
303 Ga0068861_100707503 3300005719 Bacteria 937
304 Ga0068851_10004640 3300005834 Bacteria 6203
305 Ga0068851_10490030 3300005834 Bacteria 736
306 Ga0068870_10122319 3300005840 Bacteria 1501
307 Ga0068863_100139216 3300005841 Bacteria 2319
308 Ga0068858_100035169 3300005842 Bacteria 4646
309 Ga0068858_100145849 3300005842 Bacteria 2223
310 Ga0068858_100305380 3300005842 Bacteria 1519
311 Ga0068858_100401837 3300005842 Bacteria 1316
312 Ga0068860_100011520 3300005843 Bacteria 8717
313 Ga0068860_100052275 3300005843 Bacteria 3886
314 Ga0068860_100117679 3300005843 Bacteria 2543
315 Ga0068860_100173192 3300005843 Bacteria 2085
316 Ga0068862_100076571 3300005844 Bacteria 2895
317 Ga0068862_100502068 3300005844 Bacteria 1151
318 Ga0081455_10003468 3300005937 Bacteria 18121
319 Ga0081455_10004639 3300005937 Bacteria 15307
320 Ga0081455_10012018 3300005937 Bacteria 8664
321 Ga0081455_10217536 3300005937 Bacteria 1419
322 Ga0081455_10261501 3300005937 Bacteria 1260
323 Ga0081538_10003609 3300005981 Bacteria 14538
324 Ga0081538_10003958 3300005981 Bacteria 13812
325 Ga0081538_10013091 3300005981 Bacteria 6593
326 Ga0081538_10025069 3300005981 Bacteria 4222
327 Ga0081540_1000054 3300005983 Bacteria 122877
328 Ga0081540_1000709 3300005983 Bacteria 30922
329 Ga0081540_1014507 3300005983 Bacteria 5041
330 Ga0081540_1023199 3300005983 Bacteria 3637
331 Ga0081540_1029798 3300005983 Bacteria 3034
332 Ga0081539_10000585 3300005985 Bacteria 74791
333 Ga0081539_10000798 3300005985 Bacteria 61226
334 Ga0081539_10213111 3300005985 Bacteria 884
335 Ga0070717_10000460 3300006028 Bacteria 25862
336 Ga0070717_10000580 3300006028 Bacteria 23328
337 Ga0070717_10021150 3300006028 Bacteria 5125
338 Ga0070717_10036162 3300006028 Bacteria 4003
339 Ga0070717_10051445 3300006028 Bacteria 3390
340 Ga0070717_10462969 3300006028 Bacteria 1144
341 Ga0070717_10738851 3300006028 Bacteria 895
342 Ga0070717_10851519 3300006028 Bacteria 830
343 Ga0070717_11215684 3300006028 Bacteria 686
344 Ga0075365_10009005 3300006038 Bacteria 5709
345 Ga0075365_10036525 3300006038 Bacteria 3184
346 Ga0075365_10166267 3300006038 Bacteria 1539
347 Ga0075365_10245135 3300006038 Bacteria 1258
348 Ga0075365_10351861 3300006038 Bacteria 1038
349 Ga0075365_10478315 3300006038 Bacteria 880
350 Ga0075365_11137503 3300006038 Bacteria 549
351 Ga0075368_10001052 3300006042 Bacteria 8645
352 Ga0075368_10023477 3300006042 Bacteria 2356
353 Ga0075368_10029589 3300006042 Bacteria 2118
354 Ga0075368_10327965 3300006042 Bacteria 664
355 Ga0075363_100013805 3300006048 Bacteria 3930
356 Ga0075363_100243192 3300006048 Bacteria 1035
357 Ga0075364_10014315 3300006051 Bacteria 4900
358 Ga0075364_10426291 3300006051 Bacteria 906
359 Ga0075364_10476805 3300006051 Bacteria 853
360 Ga0075364_10526001 3300006051 Bacteria 808
361 Ga0075432_10041206 3300006058 Bacteria 1613
362 Ga0070715_10009739 3300006163 Bacteria 3398
363 Ga0070715_10010528 3300006163 Bacteria 3299
364 Ga0070715_10055451 3300006163 Bacteria 1720
365 Ga0070715_10864970 3300006163 Bacteria 554
366 Ga0070716_100002502 3300006173 Bacteria 8499
367 Ga0070716_100012030 3300006173 Bacteria 4373
368 Ga0070716_100350452 3300006173 Bacteria 1045
369 Ga0070716_100551272 3300006173 Bacteria 859
370 Ga0070716_100663014 3300006173 Bacteria 793
371 Ga0070716_101220318 3300006173 Bacteria 605
372 Ga0070712_100020843 3300006175 Bacteria 4295
373 Ga0070712_100058636 3300006175 Bacteria 2709
374 Ga0070712_100082689 3300006175 Bacteria 2329
375 Ga0070712_100103310 3300006175 Bacteria 2112
376 Ga0070712_100221614 3300006175 Bacteria 1498
377 Ga0070712_100824780 3300006175 Bacteria 797
378 Ga0070712_100937636 3300006175 Bacteria 747
379 Ga0070712_101452971 3300006175 Bacteria 599
380 Ga0075362_10006492 3300006177 Bacteria 4363
381 Ga0075362_10040296 3300006177 Bacteria 2056
382 Ga0075362_10296309 3300006177 Bacteria 802
383 Ga0075362_10297929 3300006177 Bacteria 800
384 Ga0075362_10311256 3300006177 Bacteria 783
385 Ga0075367_10041132 3300006178 Bacteria 2701
386 Ga0075367_10058258 3300006178 Bacteria 2298
387 Ga0075367_10058341 3300006178 Bacteria 2296
388 Ga0075367_10068937 3300006178 Bacteria 2123
389 Ga0075367_10169257 3300006178 Bacteria 1360
390 Ga0075367_10263359 3300006178 Bacteria 1082
391 Ga0075369_10041086 3300006186 Bacteria 1979
392 Ga0075369_10111257 3300006186 Bacteria 1234
393 Ga0075369_10174157 3300006186 Bacteria 989
394 Ga0075366_10014867 3300006195 Bacteria 4450
395 Ga0075366_10111767 3300006195 Bacteria 1643
396 Ga0075366_10349233 3300006195 Bacteria 908
397 Ga0097621_100021532 3300006237 Bacteria 4989
398 Ga0097621_100032914 3300006237 Bacteria 4124
399 Ga0097621_100068929 3300006237 Bacteria 2919
400 Ga0097621_100169202 3300006237 Bacteria 1883
401 Ga0097621_101065738 3300006237 Bacteria 758
402 Ga0075370_10083239 3300006353 Bacteria 1840
403 Ga0075370_10124637 3300006353 Bacteria 1501
404 Ga0075370_10141223 3300006353 Bacteria 1408
405 Ga0068871_100018558 3300006358 Bacteria 5290
406 Ga0068871_100027806 3300006358 Bacteria 4427
407 Ga0075428_100009199 3300006844 Bacteria 10961
408 Ga0075428_100155863 3300006844 Bacteria 2481
409 Ga0075428_100527820 3300006844 Bacteria 1262
410 Ga0075428_101303602 3300006844 Bacteria 764
411 Ga0075428_101594873 3300006844 Bacteria 682
412 Ga0075428_101903106 3300006844 Bacteria 618
413 Ga0075430_100015094 3300006846 Bacteria 6575
414 Ga0075430_100021122 3300006846 Bacteria 5535
415 Ga0075430_100034133 3300006846 Bacteria 4317
416 Ga0075430_100185115 3300006846 Bacteria 1732
417 Ga0075431_100000482 3300006847 Bacteria 33049
418 Ga0075431_100039357 3300006847 Bacteria 4870
419 Ga0075431_100062070 3300006847 Bacteria 3856
420 Ga0075431_100062842 3300006847 Bacteria 3831
421 Ga0075431_100089696 3300006847 Bacteria 3173
422 Ga0075431_100359478 3300006847 Bacteria 1463
423 Ga0075431_101410930 3300006847 Bacteria 656
424 Ga0075433_10023256 3300006852 Bacteria 5214
425 Ga0075433_10088298 3300006852 Bacteria 2739
426 Ga0075433_10091450 3300006852 Bacteria 2690
427 Ga0075433_10172792 3300006852 Bacteria 1923
428 Ga0075434_100016328 3300006871 Bacteria 7137
429 Ga0075434_100095097 3300006871 Bacteria 2985
430 Ga0075434_100117083 3300006871 Bacteria 2678
431 Ga0075434_100151253 3300006871 Bacteria 2341
432 Ga0075434_100639289 3300006871 Bacteria 1082
433 Ga0075434_101377573 3300006871 Bacteria 715
434 Ga0075434_101570971 3300006871 Bacteria 667
435 Ga0075429_100034464 3300006880 Bacteria 4400
436 Ga0075429_100058229 3300006880 Bacteria 3365
437 Ga0075429_100087312 3300006880 Bacteria 2718
438 Ga0075429_100142353 3300006880 Bacteria 2099
439 Ga0075429_100661911 3300006880 Bacteria 915
440 Ga0068865_100064290 3300006881 Bacteria 2582
441 Ga0068865_100076854 3300006881 Bacteria 2384
442 Ga0068865_100180431 3300006881 Bacteria 1625
443 Ga0068865_100228426 3300006881 Bacteria 1459
444 Ga0075436_100000870 3300006914 Bacteria 20055
445 Ga0075436_100021805 3300006914 Bacteria 4396
446 Ga0075436_100572064 3300006914 Bacteria 831
447 Ga0075436_100748175 3300006914 Bacteria 726
448 Ga0097620_100048116 3300006931 Bacteria 4284
449 Ga0097620_100056449 3300006931 Bacteria 3952
450 Ga0097620_101819974 3300006931 Bacteria 672
451 Ga0097620_102062611 3300006931 Bacteria 630
452 Ga0075435_100060881 3300007076 Bacteria 3061
453 Ga0075435_100070655 3300007076 Bacteria 2850
454 Ga0075435_100170668 3300007076 Bacteria 1835
455 Ga0075435_100351742 3300007076 Bacteria 1263
456 Ga0075435_100360758 3300007076 Bacteria 1246
457 Ga0075435_100505043 3300007076 Bacteria 1045
458 Ga0075435_101627576 3300007076 Bacteria 566
459 Ga0099794_10221127 3300007265 Bacteria 973
460 Ga0105251_10013097 3300009011 Bacteria 4656
461 Ga0105251_10088361 3300009011 Bacteria 1426
462 Ga0105240_10045477 3300009093 Bacteria 5568
463 Ga0105240_10068289 3300009093 Bacteria 4402
464 Ga0105240_10108773 3300009093 Bacteria 3358
465 Ga0105240_10309812 3300009093 Bacteria 1803
466 Ga0105240_10409642 3300009093 Bacteria 1525
467 Ga0105240_11064872 3300009093 Bacteria 862
468 Ga0105240_11112013 3300009093 Bacteria 840
469 Ga0105240_11159360 3300009093 Bacteria 820
470 Ga0111539_10005362 3300009094 Bacteria 16581
471 Ga0111539_10006240 3300009094 Bacteria 15387
472 Ga0111539_10007283 3300009094 Bacteria 14167
473 Ga0111539_10048754 3300009094 Bacteria 5055
474 Ga0111539_10141523 3300009094 Bacteria 2816
475 Ga0111539_10254477 3300009094 Bacteria 2045
476 Ga0111539_10449933 3300009094 Bacteria 1500
477 Ga0111539_10486078 3300009094 Bacteria 1438
478 Ga0111539_10829670 3300009094 Bacteria 1076
479 Ga0105245_10082538 3300009098 Bacteria 2940
480 Ga0105245_10083069 3300009098 Bacteria 2931
481 Ga0105245_10170278 3300009098 Bacteria 2074
482 Ga0105245_10268803 3300009098 Bacteria 1662
483 Ga0105245_10318274 3300009098 Bacteria 1532
484 Ga0105245_11780451 3300009098 Bacteria 669
485 Ga0105247_10009864 3300009101 Bacteria 5784
486 Ga0105247_10124875 3300009101 Bacteria 1671
487 Ga0105247_11428804 3300009101 Bacteria 561
488 Ga0114129_10001318 3300009147 Bacteria 33177
489 Ga0114129_10007369 3300009147 Bacteria 15661
490 Ga0114129_10051335 3300009147 Bacteria 5790
491 Ga0114129_10137412 3300009147 Bacteria 3352
492 Ga0114129_10160606 3300009147 Bacteria 3070
493 Ga0114129_10246419 3300009147 Bacteria 2400
494 Ga0114129_10767151 3300009147 Bacteria 1233
495 Ga0114129_11041257 3300009147 Bacteria 1028
496 Ga0114129_11683901 3300009147 Bacteria 774
497 Ga0105243_10015499 3300009148 Bacteria 5763
498 Ga0105243_10029400 3300009148 Bacteria 4225
499 Ga0105243_10047915 3300009148 Bacteria 3367
500 Ga0105243_10091677 3300009148 Bacteria 2503
501 Ga0105243_10406043 3300009148 Bacteria 1267
502 Ga0105241_10023837 3300009174 Bacteria 4540
503 Ga0105241_10027353 3300009174 Bacteria 4247
504 Ga0105241_10120318 3300009174 Bacteria 2113
505 Ga0105241_10274611 3300009174 Bacteria 1437
506 Ga0105241_10326757 3300009174 Bacteria 1324
507 Ga0105241_10776645 3300009174 Bacteria 881
508 Ga0105241_10915252 3300009174 Bacteria 815
509 Ga0105241_11739991 3300009174 Bacteria 607
510 Ga0105242_10023472 3300009176 Bacteria 4860
511 Ga0105242_10054545 3300009176 Bacteria 3268
512 Ga0105242_10274182 3300009176 Bacteria 1529
513 Ga0105242_10462970 3300009176 Bacteria 1198
514 Ga0105242_10745698 3300009176 Bacteria 963
515 Ga0105242_12348433 3300009176 Bacteria 580
516 Ga0105248_10081588 3300009177 Bacteria 3635
517 Ga0105248_10333915 3300009177 Bacteria 1707
518 Ga0105248_10364615 3300009177 Bacteria 1627
519 Ga0105248_11366087 3300009177 Bacteria 801
520 Ga0105237_10030966 3300009545 Bacteria 5427
521 Ga0105237_10079148 3300009545 Bacteria 3277
522 Ga0105237_10080105 3300009545 Bacteria 3256
523 Ga0105237_10131770 3300009545 Bacteria 2494
524 Ga0105238_10001743 3300009551 Bacteria 21842
525 Ga0105238_10004073 3300009551 Bacteria 14490
526 Ga0105238_10023170 3300009551 Bacteria 6332
527 Ga0105238_10047926 3300009551 Bacteria 4307
528 Ga0105238_10065189 3300009551 Bacteria 3643
529 Ga0105238_10324242 3300009551 Bacteria 1526
530 Ga0105238_10650801 3300009551 Bacteria 1064
531 Ga0105238_11585536 3300009551 Bacteria 684
532 Ga0105238_11680917 3300009551 Bacteria 666
533 Ga0105249_10001406 3300009553 Bacteria 21077
534 Ga0105249_10001696 3300009553 Bacteria 19290
535 Ga0105249_10391241 3300009553 Bacteria 1418
536 Ga0105249_10804321 3300009553 Bacteria 1004
537 Ga0105249_11260372 3300009553 Bacteria 811
538 Ga0099796_10011586 3300010159 Bacteria 2464
539 Ga0099796_10018761 3300010159 Bacteria 2084
540 Ga0099796_10162742 3300010159 Bacteria 885
541 Ga0105239_10061745 3300010375 Bacteria 4113
542 Ga0105239_10083859 3300010375 Bacteria 3510
543 Ga0105239_10204193 3300010375 Bacteria 2214
544 Ga0105239_10221672 3300010375 Bacteria 2121
545 Ga0105239_10296610 3300010375 Bacteria 1820
546 Ga0105239_10626524 3300010375 Bacteria 1228
547 Ga0105246_10043600 3300011119 Bacteria 3044
548 Ga0105246_10058742 3300011119 Bacteria 2666
549 Ga0105246_10192737 3300011119 Bacteria 1579
550 Ga0105246_10252064 3300011119 Bacteria 1401
551 Ga0105246_11420641 3300011119 Bacteria 648
552 Ga0105246_11547349 3300011119 Bacteria 625
553 Ga0157318_1014066 3300012482 Bacteria 639
554 Ga0157329_1015557 3300012491 Bacteria 659
555 Ga0157341_1003029 3300012494 Bacteria 1151
556 Ga0157341_1006465 3300012494 Bacteria 908
557 Ga0157323_1001906 3300012495 Bacteria 1107
558 Ga0157345_1005950 3300012498 Bacteria 960
559 Ga0157314_1004032 3300012500 Bacteria 1065
560 Ga0157342_1001008 3300012507 Bacteria 1953
561 Ga0157342_1050052 3300012507 Bacteria 585
562 Ga0157373_10110985 3300013100 Bacteria 1928
563 Ga0157373_10850568 3300013100 Bacteria 675
564 Ga0157371_10212623 3300013102 Bacteria 1388
565 Ga0157371_10446823 3300013102 Bacteria 950
566 Ga0157371_11096184 3300013102 Bacteria 610
567 Ga0157370_10029223 3300013104 Bacteria 5414
568 Ga0157370_10102165 3300013104 Bacteria 2685
569 Ga0157370_10217275 3300013104 Bacteria 1771
570 Ga0157370_10242585 3300013104 Bacteria 1667
571 Ga0157369_10020019 3300013105 Bacteria 7484
572 Ga0157369_10155782 3300013105 Bacteria 2413
573 Ga0157369_10494355 3300013105 Bacteria 1266
574 Ga0157369_10544616 3300013105 Bacteria 1200
575 Ga0157374_10028057 3300013296 Bacteria 5084
576 Ga0157374_10293201 3300013296 Bacteria 1608
577 Ga0157374_11172027 3300013296 Bacteria 789
578 Ga0157374_11436625 3300013296 Bacteria 713
579 Ga0157378_10066349 3300013297 Bacteria 3232
580 Ga0157378_10299218 3300013297 Bacteria 1557
581 Ga0157378_10398276 3300013297 Bacteria 1356
582 Ga0157378_10442280 3300013297 Bacteria 1289
583 Ga0163162_10203522 3300013306 Bacteria 2109
584 Ga0163162_10259731 3300013306 Bacteria 1869
585 Ga0163162_10324754 3300013306 Bacteria 1671
586 Ga0157372_10051812 3300013307 Bacteria 4568
587 Ga0157372_10116032 3300013307 Bacteria 3070
588 Ga0157372_10466147 3300013307 Bacteria 1472
589 Ga0157372_10896222 3300013307 Bacteria 1029
590 Ga0157372_12604100 3300013307 Bacteria 580
591 Ga0157375_10012593 3300013308 Bacteria 7506
592 Ga0157375_10071929 3300013308 Bacteria 3473
593 Ga0157375_10288137 3300013308 Bacteria 1805
594 Ga0157375_11344411 3300013308 Bacteria 841
595 Ga0157375_11839416 3300013308 Bacteria 718
596 Ga0157375_12572015 3300013308 Bacteria 608
597 Ga0163163_10088301 3300014325 Bacteria 3111
598 Ga0163163_10099848 3300014325 Bacteria 2924
599 Ga0157380_10257829 3300014326 Bacteria 1582
600 Ga0157380_10359902 3300014326 Bacteria 1365
601 Ga0157377_10119186 3300014745 Bacteria 1597
602 Ga0157377_10300840 3300014745 Bacteria 1059
603 Ga0157379_10053335 3300014968 Bacteria 3611
604 Ga0157379_10539004 3300014968 Bacteria 1085
605 Ga0157379_10618752 3300014968 Bacteria 1012
606 Ga0157379_11327826 3300014968 Bacteria 695
607 Ga0157376_10214639 3300014969 Bacteria 1778
608 Ga0157376_10285391 3300014969 Bacteria 1556
609 Ga0157376_10307635 3300014969 Bacteria 1502
610 Ga0182006_1256586 3300015261 Bacteria 574
611 Ga0182005_1024185 3300015265 Bacteria 1660
612 Ga0163161_10211031 3300017792 Bacteria 1500
613 Ga0163161_10438384 3300017792 Bacteria 1054
614 Ga0163161_10563673 3300017792 Bacteria 935
615 Ga0163161_10946012 3300017792 Bacteria 732
616 Ga0206356_11106051 3300020070 Bacteria 1608
617 Ga0206356_11150990 3300020070 Bacteria 1151
618 Ga0206356_11642503 3300020070 Bacteria 732
619 Ga0206354_11510404 3300020081 Bacteria 604
620 Ga0206353_11873720 3300020082 Bacteria 888
621 Ga0213872_10092003 3300021361 Bacteria 1357
622 Ga0213874_10093563 3300021377 Bacteria 991
623 Ga0213874_10093988 3300021377 Bacteria 989
624 Ga0213876_10012071 3300021384 Bacteria 4601
625 Ga0213876_10044820 3300021384 Bacteria 2338
626 Ga0213876_10212857 3300021384 Bacteria 1027
627 Ga0213876_10360525 3300021384 Bacteria 773
628 Ga0213876_10598158 3300021384 Bacteria 587
629 Ga0213875_10000009 3300021388 Bacteria 451129
630 Ga0213875_10072556 3300021388 Bacteria 1607
631 Ga0213875_10239028 3300021388 Bacteria 856
632 Ga0213871_10030021 3300021441 Bacteria 1412
633 Ga0213871_10086239 3300021441 Bacteria 905
634 Ga0207697_10007644 3300025315 Bacteria 4797
635 Ga0207697_10208085 3300025315 Bacteria 862
636 Ga0207656_10002183 3300025321 Bacteria 6545
637 Ga0207656_10098997 3300025321 Bacteria 1334
638 Ga0207656_10343898 3300025321 Bacteria 744
639 Ga0207682_10005853 3300025893 Bacteria 4983
640 Ga0207682_10203703 3300025893 Bacteria 911
641 Ga0207692_10014631 3300025898 Bacteria 3432
642 Ga0207692_10023436 3300025898 Bacteria 2855
643 Ga0207692_10033255 3300025898 Bacteria 2486
644 Ga0207692_10053450 3300025898 Bacteria 2057
645 Ga0207692_10092168 3300025898 Bacteria 1645
646 Ga0207642_10028788 3300025899 Bacteria 2292
647 Ga0207710_10002529 3300025900 Bacteria 8455
648 Ga0207710_10011202 3300025900 Bacteria 3776
649 Ga0207688_10026485 3300025901 Bacteria 3188
650 Ga0207688_10148467 3300025901 Bacteria 1383
651 Ga0207680_10052845 3300025903 Bacteria 2436
652 Ga0207680_10087398 3300025903 Bacteria 1974
653 Ga0207685_10210174 3300025905 Bacteria 920
654 Ga0207685_10603039 3300025905 Bacteria 589
655 Ga0207699_10002385 3300025906 Bacteria 8867
656 Ga0207699_10013735 3300025906 Bacteria 4154
657 Ga0207699_10018834 3300025906 Bacteria 3666
658 Ga0207699_10081396 3300025906 Bacteria 2008
659 Ga0207699_10163636 3300025906 Bacteria 1483
660 Ga0207699_10214599 3300025906 Bacteria 1310
661 Ga0207699_10340600 3300025906 Bacteria 1056
662 Ga0207699_10620962 3300025906 Bacteria 788
663 Ga0207699_10778243 3300025906 Bacteria 703
664 Ga0207699_11088916 3300025906 Bacteria 591
665 Ga0207645_10025748 3300025907 Bacteria 3806
666 Ga0207645_10173965 3300025907 Bacteria 1412
667 Ga0207645_10257397 3300025907 Bacteria 1156
668 Ga0207643_10252494 3300025908 Bacteria 1087
669 Ga0207643_10475302 3300025908 Bacteria 797
670 Ga0207705_10011785 3300025909 Bacteria 6319
671 Ga0207705_10158784 3300025909 Bacteria 1698
672 Ga0207654_10029708 3300025911 Bacteria 2995
673 Ga0207654_10039087 3300025911 Bacteria 2666
674 Ga0207654_10079980 3300025911 Bacteria 1964
675 Ga0207654_10165334 3300025911 Bacteria 1432
676 Ga0207654_10286624 3300025911 Bacteria 1115
677 Ga0207707_10001016 3300025912 Bacteria 26912
678 Ga0207707_10036666 3300025912 Bacteria 4286
679 Ga0207707_10059791 3300025912 Bacteria 3315
680 Ga0207707_10079464 3300025912 Bacteria 2864
681 Ga0207707_10121156 3300025912 Bacteria 2287
682 Ga0207707_10252292 3300025912 Bacteria 1532
683 Ga0207707_10607021 3300025912 Bacteria 926
684 Ga0207695_10029400 3300025913 Bacteria 6074
685 Ga0207695_10252176 3300025913 Bacteria 1664
686 Ga0207695_10540430 3300025913 Bacteria 1047
687 Ga0207671_10068162 3300025914 Bacteria 2650
688 Ga0207671_10088814 3300025914 Bacteria 2325
689 Ga0207671_10125301 3300025914 Bacteria 1967
690 Ga0207671_10194054 3300025914 Bacteria 1584
691 Ga0207693_10003501 3300025915 Bacteria 13400
692 Ga0207693_10011990 3300025915 Bacteria 7008
693 Ga0207693_10017747 3300025915 Bacteria 5675
694 Ga0207693_10018439 3300025915 Bacteria 5559
695 Ga0207693_10107729 3300025915 Bacteria 2186
696 Ga0207693_10113161 3300025915 Bacteria 2129
697 Ga0207693_10126387 3300025915 Bacteria 2010
698 Ga0207693_10231529 3300025915 Bacteria 1451
699 Ga0207693_10764884 3300025915 Bacteria 746
700 Ga0207693_11024805 3300025915 Bacteria 629
701 Ga0207663_10059712 3300025916 Bacteria 2414
702 Ga0207663_10082104 3300025916 Bacteria 2113
703 Ga0207663_10209093 3300025916 Bacteria 1413
704 Ga0207663_11178851 3300025916 Bacteria 616
705 Ga0207660_10000924 3300025917 Bacteria 19378
706 Ga0207660_10006298 3300025917 Bacteria 7698
707 Ga0207660_10017365 3300025917 Bacteria 4780
708 Ga0207660_10127540 3300025917 Bacteria 1933
709 Ga0207660_10237994 3300025917 Bacteria 1433
710 Ga0207660_10298512 3300025917 Bacteria 1282
711 Ga0207660_10442431 3300025917 Bacteria 1050
712 Ga0207660_10798362 3300025917 Bacteria 770
713 Ga0207660_11408034 3300025917 Bacteria 565
714 Ga0207662_10021121 3300025918 Bacteria 3717
715 Ga0207662_10069319 3300025918 Bacteria 2131
716 Ga0207657_10001391 3300025919 Bacteria 25799
717 Ga0207657_10088837 3300025919 Bacteria 2582
718 Ga0207657_10133728 3300025919 Bacteria 2031
719 Ga0207657_10186294 3300025919 Bacteria 1676
720 Ga0207657_10213743 3300025919 Bacteria 1547
721 Ga0207657_10276319 3300025919 Bacteria 1334
722 Ga0207657_10326525 3300025919 Bacteria 1213
723 Ga0207649_10040101 3300025920 Bacteria 2843
724 Ga0207649_10382057 3300025920 Bacteria 1050
725 Ga0207649_10717590 3300025920 Bacteria 776
726 Ga0207652_10003893 3300025921 Bacteria 12209
727 Ga0207652_10089968 3300025921 Bacteria 2696
728 Ga0207652_10165569 3300025921 Bacteria 1982
729 Ga0207652_10179251 3300025921 Bacteria 1903
730 Ga0207652_10203852 3300025921 Bacteria 1780
731 Ga0207652_10229417 3300025921 Bacteria 1673
732 Ga0207652_10368073 3300025921 Bacteria 1297
733 Ga0207652_10838266 3300025921 Bacteria 815
734 Ga0207652_10875630 3300025921 Bacteria 794
735 Ga0207652_11064175 3300025921 Bacteria 709
736 Ga0207681_10024411 3300025923 Bacteria 3880
737 Ga0207681_10237903 3300025923 Bacteria 1416
738 Ga0207694_10017893 3300025924 Bacteria 5357
739 Ga0207694_10030192 3300025924 Bacteria 4139
740 Ga0207694_10051493 3300025924 Bacteria 3191
741 Ga0207694_10115713 3300025924 Bacteria 2137
742 Ga0207694_10120976 3300025924 Bacteria 2090
743 Ga0207694_10123309 3300025924 Bacteria 2070
744 Ga0207694_10204774 3300025924 Bacteria 1606
745 Ga0207694_10486977 3300025924 Bacteria 1032
746 Ga0207650_10102906 3300025925 Bacteria 2201
747 Ga0207650_10493039 3300025925 Bacteria 1023
748 Ga0207659_10027163 3300025926 Bacteria 3871
749 Ga0207659_10119405 3300025926 Bacteria 2018
750 Ga0207659_10359899 3300025926 Bacteria 1209
751 Ga0207687_10047644 3300025927 Bacteria 2972
752 Ga0207687_10164531 3300025927 Bacteria 1706
753 Ga0207700_10009021 3300025928 Bacteria 6209
754 Ga0207700_10040526 3300025928 Bacteria 3400
755 Ga0207700_10103916 3300025928 Bacteria 2272
756 Ga0207700_10268172 3300025928 Bacteria 1464
757 Ga0207700_10310549 3300025928 Bacteria 1364
758 Ga0207700_10394157 3300025928 Bacteria 1212
759 Ga0207700_10450284 3300025928 Bacteria 1134
760 Ga0207700_10473147 3300025928 Bacteria 1106
761 Ga0207664_10131243 3300025929 Bacteria 2109
762 Ga0207664_10137141 3300025929 Bacteria 2066
763 Ga0207664_10223419 3300025929 Bacteria 1634
764 Ga0207664_10230369 3300025929 Bacteria 1610
765 Ga0207664_10268542 3300025929 Bacteria 1494
766 Ga0207664_11191478 3300025929 Bacteria 679
767 Ga0207644_10006460 3300025931 Bacteria 7641
768 Ga0207644_11082472 3300025931 Bacteria 673
769 Ga0207644_11678234 3300025931 Bacteria 532
770 Ga0207690_10034073 3300025932 Bacteria 3279
771 Ga0207690_10073600 3300025932 Bacteria 2363
772 Ga0207690_10171924 3300025932 Bacteria 1624
773 Ga0207690_10269961 3300025932 Bacteria 1321
774 Ga0207690_10511668 3300025932 Bacteria 972
775 Ga0207690_10861758 3300025932 Bacteria 750
776 Ga0207706_10012794 3300025933 Bacteria 7636
777 Ga0207706_10015046 3300025933 Bacteria 7005
778 Ga0207706_10303646 3300025933 Bacteria 1390
779 Ga0207686_10145674 3300025934 Bacteria 1642
780 Ga0207686_10496843 3300025934 Bacteria 946
781 Ga0207686_10572644 3300025934 Bacteria 885
782 Ga0207709_10043087 3300025935 Bacteria 2719
783 Ga0207709_10066135 3300025935 Bacteria 2276
784 Ga0207709_10093391 3300025935 Bacteria 1972
785 Ga0207709_10330515 3300025935 Bacteria 1144
786 Ga0207670_10033150 3300025936 Bacteria 3326
787 Ga0207670_10153265 3300025936 Bacteria 1712
788 Ga0207670_10196876 3300025936 Bacteria 1528
789 Ga0207670_10270878 3300025936 Bacteria 1320
790 Ga0207670_10388977 3300025936 Bacteria 1112
791 Ga0207670_10832216 3300025936 Bacteria 770
792 Ga0207669_10000663 3300025937 Bacteria 14845
793 Ga0207669_10373980 3300025937 Bacteria 1108
794 Ga0207669_10456377 3300025937 Bacteria 1014
795 Ga0207669_10653917 3300025937 Bacteria 860
796 Ga0207704_10088177 3300025938 Bacteria 2029
797 Ga0207704_10368978 3300025938 Bacteria 1123
798 Ga0207704_11102530 3300025938 Bacteria 674
799 Ga0207665_10002320 3300025939 Bacteria 12843
800 Ga0207665_10067225 3300025939 Bacteria 2440
801 Ga0207665_10163387 3300025939 Bacteria 1603
802 Ga0207665_10187392 3300025939 Bacteria 1501
803 Ga0207665_10228245 3300025939 Bacteria 1367
804 Ga0207665_10356663 3300025939 Bacteria 1105
805 Ga0207691_10018720 3300025940 Bacteria 6560
806 Ga0207691_10742791 3300025940 Bacteria 826
807 Ga0207691_11286229 3300025940 Bacteria 604
808 Ga0207711_10064158 3300025941 Bacteria 3172
809 Ga0207711_10086833 3300025941 Bacteria 2744
810 Ga0207711_10179896 3300025941 Bacteria 1922
811 Ga0207711_10820675 3300025941 Bacteria 866
812 Ga0207689_10017590 3300025942 Bacteria 6043
813 Ga0207689_10371689 3300025942 Bacteria 1190
814 Ga0207661_10019804 3300025944 Bacteria 5021
815 Ga0207661_10095096 3300025944 Bacteria 2490
816 Ga0207661_10213885 3300025944 Bacteria 1700
817 Ga0207661_10442693 3300025944 Bacteria 1183
818 Ga0207661_11506521 3300025944 Bacteria 616
819 Ga0207679_10129995 3300025945 Bacteria 2019
820 Ga0207679_10424346 3300025945 Bacteria 1174
821 Ga0207679_10444107 3300025945 Bacteria 1149
822 Ga0207679_10503706 3300025945 Bacteria 1081
823 Ga0207679_11158219 3300025945 Bacteria 709
824 Ga0207667_10009169 3300025949 Bacteria 11685
825 Ga0207667_10011614 3300025949 Bacteria 10225
826 Ga0207667_10085893 3300025949 Bacteria 3257
827 Ga0207667_10137426 3300025949 Bacteria 2516
828 Ga0207667_10142779 3300025949 Bacteria 2465
829 Ga0207667_10180470 3300025949 Bacteria 2168
830 Ga0207667_10214775 3300025949 Bacteria 1971
831 Ga0207667_10259817 3300025949 Bacteria 1776
832 Ga0207667_11029698 3300025949 Bacteria 809
833 Ga0207667_11060096 3300025949 Bacteria 795
834 Ga0207651_10068873 3300025960 Bacteria 2496
835 Ga0207651_10184575 3300025960 Bacteria 1658
836 Ga0207651_10268982 3300025960 Bacteria 1403
837 Ga0207712_10001933 3300025961 Bacteria 13619
838 Ga0207712_10061291 3300025961 Bacteria 2670
839 Ga0207712_10083637 3300025961 Bacteria 2330
840 Ga0207712_10119535 3300025961 Bacteria 1991
841 Ga0207668_10480636 3300025972 Bacteria 1065
842 Ga0207668_10659374 3300025972 Bacteria 916
843 Ga0207640_10095612 3300025981 Bacteria 2069
844 Ga0207640_10162782 3300025981 Bacteria 1653
845 Ga0207640_10237815 3300025981 Bacteria 1405
846 Ga0207640_10552703 3300025981 Bacteria 967
847 Ga0207658_10027766 3300025986 Bacteria 3980
848 Ga0207658_10031687 3300025986 Bacteria 3757
849 Ga0207658_10162188 3300025986 Bacteria 1833
850 Ga0207677_10096964 3300026023 Bacteria 2159
851 Ga0207677_10179922 3300026023 Bacteria 1662
852 Ga0207677_10285060 3300026023 Bacteria 1358
853 Ga0207677_10964781 3300026023 Bacteria 771
854 Ga0207703_10047773 3300026035 Bacteria 3452
855 Ga0207703_10054005 3300026035 Bacteria 3266
856 Ga0207703_10075815 3300026035 Bacteria 2788
857 Ga0207703_10878938 3300026035 Bacteria 858
858 Ga0207639_10046780 3300026041 Bacteria 3266
859 Ga0207639_10150270 3300026041 Bacteria 1950
860 Ga0207639_10223328 3300026041 Bacteria 1628
861 Ga0207639_10525103 3300026041 Bacteria 1084
862 Ga0207639_11244084 3300026041 Bacteria 699
863 Ga0207639_12053457 3300026041 Bacteria 533
864 Ga0207678_10039364 3300026067 Bacteria 4104
865 Ga0207678_10232535 3300026067 Bacteria 1578
866 Ga0207678_10243232 3300026067 Bacteria 1541
867 Ga0207678_10468503 3300026067 Bacteria 1096
868 Ga0207678_11290399 3300026067 Bacteria 646
869 Ga0207708_10007166 3300026075 Bacteria 8239
870 Ga0207708_10306232 3300026075 Bacteria 1293
871 Ga0207708_11316732 3300026075 Bacteria 633
872 Ga0207702_10106009 3300026078 Bacteria 2490
873 Ga0207702_10179557 3300026078 Bacteria 1948
874 Ga0207702_10240056 3300026078 Bacteria 1697
875 Ga0207702_11353195 3300026078 Bacteria 706
876 Ga0207641_10595765 3300026088 Bacteria 1081
877 Ga0207641_10910371 3300026088 Bacteria 874
878 Ga0207648_10008772 3300026089 Bacteria 9745
879 Ga0207648_10150331 3300026089 Bacteria 2055
880 Ga0207648_10257248 3300026089 Bacteria 1557
881 Ga0207676_10226791 3300026095 Bacteria 1667
882 Ga0207676_10460897 3300026095 Bacteria 1200
883 Ga0207676_10668258 3300026095 Bacteria 1004
884 Ga0207676_11833255 3300026095 Bacteria 605
885 Ga0207674_10012767 3300026116 Bacteria 9383
886 Ga0207674_10120112 3300026116 Bacteria 2596
887 Ga0207674_10627837 3300026116 Bacteria 1038
888 Ga0207674_10741390 3300026116 Bacteria 948
889 Ga0207675_100005803 3300026118 Bacteria 11802
890 Ga0207675_100257912 3300026118 Bacteria 1689
891 Ga0207675_101117437 3300026118 Bacteria 808
892 Ga0207675_101483170 3300026118 Bacteria 699
893 Ga0207675_101700554 3300026118 Bacteria 651
894 Ga0207675_102258802 3300026118 Bacteria 558
895 Ga0207683_10000604 3300026121 Bacteria 33136
896 Ga0207683_10002222 3300026121 Bacteria 17079
897 Ga0207683_10012670 3300026121 Bacteria 7190
898 Ga0207683_10141994 3300026121 Bacteria 2164
899 Ga0207683_10279764 3300026121 Bacteria 1525
900 Ga0207698_10007647 3300026142 Bacteria 6776
901 Ga0207698_10064141 3300026142 Bacteria 2878
902 Ga0207698_10150938 3300026142 Bacteria 2017
903 Ga0207698_10236353 3300026142 Bacteria 1662
904 Ga0207698_10244698 3300026142 Bacteria 1637
905 Ga0207698_10756806 3300026142 Bacteria 971
906 Ga0209969_1018684 3300027360 Bacteria 1025
907 Ga0209967_1011648 3300027364 Bacteria 1236
908 Ga0209968_1017318 3300027526 Bacteria 1149
909 Ga0209999_1005199 3300027543 Bacteria 2340
910 Ga0209983_1012066 3300027665 Bacteria 1772
911 Ga0209971_1008003 3300027682 Bacteria 2510
912 Ga0209966_1002733 3300027695 Bacteria 2951
913 Ga0209998_10001308 3300027717 Bacteria 6082
914 Ga0209813_10016580 3300027866 Bacteria 2012
915 Ga0209813_10024591 3300027866 Bacteria 1724
916 Ga0209813_10162557 3300027866 Bacteria 806
917 Ga0209813_10174546 3300027866 Bacteria 783
918 Ga0207428_10000528 3300027907 Bacteria 45643
919 Ga0207428_10001098 3300027907 Bacteria 29431
920 Ga0207428_10001412 3300027907 Bacteria 25305
921 Ga0207428_10079223 3300027907 Bacteria 2569
922 Ga0207428_10333412 3300027907 Bacteria 1118
923 Ga0207428_10361628 3300027907 Bacteria 1067
924 Ga0268266_10079013 3300028379 Bacteria 2864
925 Ga0268266_10086824 3300028379 Bacteria 2735
926 Ga0268266_10812243 3300028379 Bacteria 903
927 Ga0268266_11981462 3300028379 Bacteria 556
928 Ga0268265_10056781 3300028380 Bacteria 2981
929 Ga0268265_10258535 3300028380 Bacteria 1546
930 Ga0268265_10572783 3300028380 Bacteria 1075
931 Ga0268264_10036802 3300028381 Bacteria 4033
932 Ga0268264_10055174 3300028381 Bacteria 3320
933 Ga0268264_10236336 3300028381 Bacteria 1690
934 Ga0268264_11224407 3300028381 Bacteria 760
935 Ga0265334_10149218 3300028573 Bacteria 825
936 Ga0265334_10281447 3300028573 Bacteria 571
937 Ga0265318_10010479 3300028577 Bacteria 4035
938 Ga0265318_10234396 3300028577 Bacteria 670
939 Ga0265330_10045414 3300031235 Bacteria 1937
940 Ga0265330_10167077 3300031235 Bacteria 933
941 Ga0265330_10383082 3300031235 Bacteria 594
942 Ga0265332_10045165 3300031238 Bacteria 1899
943 Ga0265328_10034110 3300031239 Bacteria 1885
944 Ga0265320_10107450 3300031240 Bacteria 1281
945 Ga0265325_10000062 3300031241 Bacteria 74697
946 Ga0265325_10024961 3300031241 Bacteria 3247
947 Ga0265325_10054613 3300031241 Bacteria 2044
948 Ga0265325_10111990 3300031241 Bacteria 1325
949 Ga0265340_10006734 3300031247 Bacteria 6293
950 Ga0265340_10028497 3300031247 Bacteria 2808
951 Ga0265340_10035291 3300031247 Bacteria 2484
952 Ga0265340_10057090 3300031247 Bacteria 1876
953 Ga0265340_10190490 3300031247 Bacteria 925
954 Ga0265340_10460099 3300031247 Bacteria 560
955 Ga0265339_10000906 3300031249 Bacteria 22779
956 Ga0265339_10038136 3300031249 Bacteria 2682
957 Ga0265339_10099121 3300031249 Bacteria 1519
958 Ga0265339_10121661 3300031249 Bacteria 1341
959 Ga0265339_10236242 3300031249 Bacteria 889
960 Ga0265331_10021238 3300031250 Bacteria 3325
961 Ga0265331_10057909 3300031250 Bacteria 1836
962 Ga0265331_10121260 3300031250 Bacteria 1195
963 Ga0265316_10059431 3300031344 Bacteria 2973
964 Ga0265316_10216802 3300031344 Bacteria 1413
965 Ga0265316_10252421 3300031344 Bacteria 1295
966 Ga0265316_10323498 3300031344 Bacteria 1120
967 Ga0265316_10584584 3300031344 Bacteria 793
968 Ga0265316_11049556 3300031344 Bacteria 566
969 Ga0307513_10394779 3300031456 Bacteria 1119
970 Ga0307513_10399078 3300031456 Bacteria 1110
971 Ga0307513_10617860 3300031456 Bacteria 792
972 Ga0307513_10679461 3300031456 Bacteria 736
973 Ga0307408_100485988 3300031548 Bacteria 1078
974 Ga0265313_10022528 3300031595 Bacteria 3414
975 Ga0265313_10099117 3300031595 Bacteria 1295
976 Ga0265313_10112520 3300031595 Bacteria 1195
977 Ga0307508_10621139 3300031616 Bacteria 684
978 Ga0316575_10096962 3300031665 Bacteria 1197
979 Ga0316575_10355306 3300031665 Bacteria 625
980 Ga0265314_10003523 3300031711 Bacteria 15112
981 Ga0265314_10005511 3300031711 Bacteria 11393
982 Ga0265314_10049675 3300031711 Bacteria 2935
983 Ga0265314_10060747 3300031711 Bacteria 2578
984 Ga0265342_10000348 3300031712 Bacteria 51971
985 Ga0265342_10060583 3300031712 Bacteria 2231
986 Ga0265342_10069781 3300031712 Bacteria 2051
987 Ga0265342_10379460 3300031712 Bacteria 732
988 Ga0316576_10045817 3300031727 Bacteria 3164
989 Ga0316578_10083861 3300031728 Bacteria 1898
990 Ga0307406_11000703 3300031901 Bacteria 717
991 Ga0307412_11588933 3300031911 Bacteria 597
992 Ga0307409_100642954 3300031995 Bacteria 1054
993 Ga0307409_101538231 3300031995 Bacteria 693
994 Ga0307416_101211836 3300032002 Bacteria 860
995 Ga0307416_102307383 3300032002 Bacteria 638
996 Ga0316593_10213175 3300032168 Bacteria 716
997 Ga0373930_0013075 3300034816 Bacteria 1524
998 Ga0373948_0000223 3300034817 Bacteria 6689
999 Ga0373948_0043723 3300034817 Bacteria 944
1000 Ga0373950_0000536 3300034818 Bacteria 4663
1001 Ga0373958_0000051 3300034819 Bacteria 11334
1002 Ga0373958_0006699 3300034819 Bacteria 1806
1003 Ga0373938_0000082 3300034957 Bacteria 12812
1004 Ga0373938_0036190 3300034957 Bacteria 1079
1005 Ga0373928_0000130 3300035084 Bacteria 14312
1006 Ga0373928_0001490 3300035084 Bacteria 4551
1007 Ga0373928_0066982 3300035084 Bacteria 880
1008 Ga0373929_0028723 3300035085 Bacteria 1176
1009 Ga0373934_0002725 3300035086 Bacteria 6483
1010 Ga0373934_0161562 3300035086 Bacteria 919
1011 Ga0373934_0242163 3300035086 Bacteria 745
1012 Ga0373940_0000285 3300035088 Bacteria 7293
1013 Ga0373940_0002754 3300035088 Bacteria 3478
1014 Ga0373940_0007638 3300035088 Bacteria 2447
1015 Ga0373944_0029855 3300035089 Bacteria 1632
1016 Ga0373944_0238621 3300035089 Bacteria 668
1017 Ga0373949_0000533 3300035090 Bacteria 12541
1018 Ga0373949_0018845 3300035090 Bacteria 1568
1019 Ga0373949_0041276 3300035090 Bacteria 1135
1020 Ga0373951_0000415 3300035091 Bacteria 12515
1021 Ga0373952_0000016 3300035092 Bacteria 21410
1022 Ga0373952_0022265 3300035092 Bacteria 1344
1023 Ga0373952_0110266 3300035092 Bacteria 736
1024 Ga0373923_0061303 3300035111 Bacteria 1598
1025 Ga0373923_0086452 3300035111 Bacteria 1366
1026 Ga0373923_0112894 3300035111 Bacteria 1208
1027 Ga0373923_0234992 3300035111 Bacteria 855
1028 Ga0373932_0000752 3300035112 Bacteria 9657
1029 Ga0373932_0001517 3300035112 Bacteria 6454
1030 Ga0373932_0049043 3300035112 Bacteria 1247
1031 Ga0373936_0076147 3300035113 Bacteria 1390
1032 Ga0373936_0094538 3300035113 Bacteria 1256
1033 Ga0373936_0207994 3300035113 Bacteria 865
1034 Ga0373939_0000298 3300035114 Bacteria 12914
1035 Ga0373939_0000784 3300035114 Bacteria 7828
1036 Ga0373939_0005068 3300035114 Bacteria 3128
1037 Ga0373939_0035419 3300035114 Bacteria 1471
1038 Ga0373939_0258488 3300035114 Bacteria 680
1039 Ga0373941_0000180 3300035115 Bacteria 11834
1040 Ga0373941_0251898 3300035115 Bacteria 690
1041 Ga0373945_0396288 3300035116 Bacteria 604
1042 Ga0373953_0000985 3300035117 Bacteria 8003
1043 Ga0373953_0027211 3300035117 Bacteria 2196
1044 Ga0373953_0228697 3300035117 Bacteria 806
1045 Ga0373954_0001160 3300035118 Bacteria 10599
1046 Ga0373954_0002860 3300035118 Bacteria 7279
1047 Ga0373954_0017515 3300035118 Bacteria 3219
1048 Ga0373954_0615196 3300035118 Bacteria 538
1049 Ga0373956_0001463 3300035119 Bacteria 9760
1050 Ga0373956_0005624 3300035119 Bacteria 5012
1051 Ga0373956_0012986 3300035119 Bacteria 3461
1052 Ga0373956_0099464 3300035119 Bacteria 1348
1053 Ga0373956_0235748 3300035119 Bacteria 869
1054 Ga0373956_0348093 3300035119 Bacteria 706
1055 Ga0373957_0000218 3300035120 Bacteria 14250
1056 Ga0373957_0008800 3300035120 Bacteria 3286
1057 Ga0373957_0059706 3300035120 Bacteria 1475
1058 Ga0373960_0002043 3300035121 Bacteria 4534
1059 Ga0373960_0004024 3300035121 Bacteria 3356
1060 Ga0373960_0286607 3300035121 Bacteria 608
1061 Ga0373943_0050841 3300035170 Bacteria 2038
1062 Ga0373943_0073690 3300035170 Bacteria 1735
1063 Ga0373943_0252632 3300035170 Bacteria 990
1064 Ga0373946_0025253 3300035171 Bacteria 2336
1065 Ga0373946_0098258 3300035171 Bacteria 1308
1066 Ga0373946_0217048 3300035171 Bacteria 922
1067 Ga0373955_0001372 3300035172 Bacteria 10349
1068 Ga0373955_0003279 3300035172 Bacteria 7094
1069 Ga0373955_0003676 3300035172 Bacteria 6754
1070 Ga0373955_0087945 3300035172 Bacteria 1766
1071 Ga0373955_0286314 3300035172 Bacteria 992
1072 Ga0373942_0000890 3300035207 Bacteria 8188
1073 Ga0373942_0002933 3300035207 Bacteria 4042
1074 Ga0373942_0097974 3300035207 Bacteria 892
1075 Ga0373942_0332173 3300035207 Bacteria 534
1076 Ga0373961_0002364 3300035241 Bacteria 4921
1077 Ga0373961_0129233 3300035241 Bacteria 844
1078 Ga0373962_0000695 3300035242 Bacteria 7603
1079 Ga0373962_0015722 3300035242 Bacteria 1943
1080 Ga0316574_0000666 3300035398 Bacteria 14482
1081 Ga0316574_0113599 3300035398 Bacteria 1737
1082 Ga0373924_0009703 3300035410 Bacteria 3536
1083 Ga0373931_0007190 3300035691 Bacteria 5238
1084 Ga0373931_0013474 3300035691 Bacteria 3982
1085 Ga0373931_0042125 3300035691 Bacteria 2400
1086 Ga0373931_0188580 3300035691 Bacteria 1225
1087 Ga0373931_0222375 3300035691 Bacteria 1137
1088 Ga0373931_1096730 3300035691 Bacteria 542
1089 Ga0373935_0006152 3300035692 Bacteria 7142
1090 Ga0373935_0033704 3300035692 Bacteria 3189
1091 Ga0373935_0112937 3300035692 Bacteria 1805
1092 Ga0373935_0186862 3300035692 Bacteria 1425
1093 Ga0373935_0233523 3300035692 Bacteria 1281
1094 Ga0373935_0543831 3300035692 Bacteria 846
1095 Ga0373935_1348945 3300035692 Bacteria 533
1096 Ga0373927_0001072 3300035695 Bacteria 20927
1097 Ga0373927_0009305 3300035695 Bacteria 6590
1098 Ga0373927_0014484 3300035695 Bacteria 5218
1099 Ga0373927_0016144 3300035695 Bacteria 4927
1100 Ga0373927_0024105 3300035695 Bacteria 3981
1101 Ga0373927_0695909 3300035695 Bacteria 671
1102 Ga0373927_1115138 3300035695 Bacteria 520
1103 Ga0373933_0000026 3300035724 Bacteria 90309
1104 Ga0373933_0002073 3300035724 Bacteria 11509
1105 Ga0373933_0006390 3300035724 Bacteria 6414
1106 Ga0373933_0008756 3300035724 Bacteria 5517
1107 Ga0373933_0025020 3300035724 Bacteria 3420
1108 Ga0373933_0494269 3300035724 Bacteria 801
1109 Ga0373947_0000461 3300035725 Bacteria 23224
1110 Ga0373947_0014310 3300035725 Bacteria 4551
1111 Ga0373947_0028777 3300035725 Bacteria 3259
1112 Ga0373947_0029816 3300035725 Bacteria 3203
1113 Ga0373947_0178280 3300035725 Bacteria 1382
1114 Ga0373947_0514322 3300035725 Bacteria 814
1115 Ga0373937_0001207 3300036401 Bacteria 21751
1116 Ga0373937_0001465 3300036401 Bacteria 19748
1117 Ga0373937_0011496 3300036401 Bacteria 7770
1118 Ga0373937_0041439 3300036401 Bacteria 4199
1119 Ga0373937_0080374 3300036401 Bacteria 3014
1120 Ga0316582_0024263 3300036647 Bacteria 3628
1121 Ga0316584_0289104 3300036712 Bacteria 1189
1122 Ga0373925_0001840 3300037068 Bacteria 17680
1123 Ga0373925_0018621 3300037068 Bacteria 5049
1124 Ga0373925_0023631 3300037068 Bacteria 4485
1125 Ga0373925_0536649 3300037068 Bacteria 961
1126 Ga0373925_0718157 3300037068 Bacteria 824
1127 Ga0373925_0819304 3300037068 Bacteria 767
1128 Ga0395899_0058785 3300037312 Bacteria 2835
1129 Ga0395899_0059463 3300037312 Bacteria 2817
1130 Ga0395899_0090431 3300037312 Bacteria 2219
1131 Ga0395899_0517771 3300037312 Bacteria 771
1132 Ga0395900_0003202 3300037418 Bacteria 17723
1133 Ga0395900_0008627 3300037418 Bacteria 10475
1134 Ga0395900_0045483 3300037418 Bacteria 4521
1135 Ga0395900_0367664 3300037418 Bacteria 1408
1136 Ga0395900_0378034 3300037418 Bacteria 1385
1137 Ga0395900_0620382 3300037418 Bacteria 1020
1138 Ga0395898_0010780 3300037466 Bacteria 9548
1139 Ga0395898_0038196 3300037466 Bacteria 4760
1140 Ga0395898_0062553 3300037466 Bacteria 3614
1141 Ga0395898_0111578 3300037466 Bacteria 2621
1142 Ga0395898_0136648 3300037466 Bacteria 2347
1143 Ga0395898_0716816 3300037466 Bacteria 942
1144 Ga0395905_0302519 3300037471 Bacteria 1487
1145 Ga0436364_0133169 3300037853 Bacteria 2254
1146 Ga0436364_0232161 3300037853 Bacteria 1144
1147 Ga0436364_0246985 3300037853 Bacteria 1236
1148 Ga0436364_0326250 3300037853 Bacteria 1461
1149 Ga0436364_0326624 3300037853 Bacteria 509
1150 Ga0436364_0413488 3300037853 Bacteria 83589
1151 Ga0436364_0946357 3300037853 Bacteria 2700
1152 Ga0436364_1319910 3300037853 Bacteria 681
1153 Ga0436364_1385490 3300037853 Bacteria 752
1154 Ga0395901_0022764 3300038443 Bacteria 6425
1155 Ga0395901_0025837 3300038443 Bacteria 6030
1156 Ga0395901_0084156 3300038443 Bacteria 3324
1157 Ga0395901_0320768 3300038443 Bacteria 1603
1158 Ga0395901_0598883 3300038443 Bacteria 1111
1159 Ga0395901_0917811 3300038443 Bacteria 856
1160 Ga0242420_069385 3300038996 Bacteria 714
1161 Ga0436365_0022723 3300039437 Bacteria 968
1162 Ga0436365_0047901 3300039437 Bacteria 752
1163 Ga0436365_0143772 3300039437 Bacteria 1424
1164 Ga0436365_0321657 3300039437 Bacteria 745
1165 Ga0436365_0477466 3300039437 Bacteria 1399
1166 Ga0436365_0520674 3300039437 Bacteria 534
1167 Ga0436365_0730964 3300039437 Bacteria 752
1168 Ga0436365_0836696 3300039437 Bacteria 1897
1169 Ga0436365_0896224 3300039437 Bacteria 4759
1170 Ga0436365_1130471 3300039437 Bacteria 1084
1171 Ga0436365_1314922 3300039437 Bacteria 1140
1172 Ga0436365_1318441 3300039437 Bacteria 2852
1173 Ga0436360_0019956 3300039438 Bacteria 4385
1174 Ga0436360_0557516 3300039438 Bacteria 551
1175 Ga0436360_0912793 3300039438 Bacteria 1831
1176 Ga0436360_0951710 3300039438 Bacteria 554
1177 Ga0436360_0963942 3300039438 Bacteria 1830
1178 Ga0436360_1042695 3300039438 Bacteria 917
1179 Ga0436361_0402592 3300039447 Bacteria 5475
1180 Ga0436361_0444423 3300039447 Bacteria 635
1181 Ga0436361_0522581 3300039447 Bacteria 770
1182 Ga0436361_0590313 3300039447 Bacteria 529
1183 Ga0436361_1063193 3300039447 Bacteria 672
1184 Ga0436361_1095086 3300039447 Bacteria 1350
1185 Ga0436363_0362500 3300039450 Bacteria 546
1186 Ga0436363_0541440 3300039450 Bacteria 1117
1187 Ga0436363_0546121 3300039450 Bacteria 513
1188 Ga0436363_0593788 3300039450 Bacteria 1087
1189 Ga0436363_0737946 3300039450 Bacteria 838
1190 Ga0436363_0743008 3300039450 Bacteria 2327
1191 Ga0436363_1305623 3300039450 Bacteria 542
1192 Ga0436363_1361493 3300039450 Bacteria 686
1193 Ga0436363_1431185 3300039450 Bacteria 633
1194 Ga0436363_1475973 3300039450 Bacteria 784
1195 Ga0436363_1531982 3300039450 Bacteria 979
1196 Ga0436363_1605563 3300039450 Bacteria 1047
1197 Ga0436363_1622384 3300039450 Bacteria 515
1198 Ga0436362_0112950 3300039453 Bacteria 793
1199 Ga0436362_0275053 3300039453 Bacteria 867
1200 Ga0436362_0305805 3300039453 Bacteria 1322
1201 Ga0436362_0370131 3300039453 Bacteria 689
1202 Ga0436362_0990218 3300039453 Bacteria 1468
1203 Ga0439453_0000215 3300041408 Bacteria 5679
1204 Ga0439461_0048521 3300041410 Bacteria 936
1205 Ga0439465_0043973 3300041413 Bacteria 1450
1206 Ga0451847_0751876 3300041503 Bacteria 649
1207 Ga0439441_102032 3300042001 Bacteria 644
1208 Ga0439443_004767 3300042003 Bacteria 1785
1209 Ga0439448_0041810 3300042005 Bacteria 1484
1210 Ga0439450_019657 3300042008 Bacteria 1433
1211 Ga0439451_031263 3300042009 Bacteria 1070
1212 Ga0439452_052512 3300042010 Bacteria 930
1213 Ga0439455_0064102 3300042012 Bacteria 978
1214 Ga0439457_076736 3300042014 Bacteria 766
1215 Ga0439462_0124520 3300042015 Bacteria 718
1216 Ga0439458_0034527 3300042157 Bacteria 1214
1217 Ga0439435_0059009 3300042436 Bacteria 1114
1218 Ga0439444_0009681 3300042437 Bacteria 1524
1219 Ga0439464_0025163 3300042439 Bacteria 1647
1220 Ga0439460_0002120 3300042461 Bacteria 4754
1221 Ga0439460_0264575 3300042461 Bacteria 596
1222 Ga0450893_0004438 3300042532 Bacteria 2237
1223 Ga0450893_0013592 3300042532 Bacteria 1359
1224 Ga0439440_0026202 3300042993 Bacteria 1348
1225 Ga0466969_0064725 3300044656 Bacteria 1769
1226 Ga0466966_0066050 3300044684 Bacteria 2274
1227 Ga0466963_0678077 3300044694 Bacteria 727
1228 Ga0453684_0631579 3300044712 Bacteria 1170
1229 Ga0453684_1501980 3300044712 Bacteria 695
1230 Ga0466970_0386892 3300044765 Bacteria 797
1231 Ga0466957_0478883 3300044842 Bacteria 861
1232 Ga0466959_0022800 3300045049 Bacteria 4629
1233 Ga0466959_1070390 3300045049 Bacteria 536
1234 Ga0451576_0014126 3300045051 Bacteria 8898
1235 Ga0466958_0752425 3300045836 Bacteria 635
1236 Ga0466967_0118435 3300045976 Bacteria 2443
1237 Ga0466967_0139863 3300045976 Bacteria 2254
1238 Ga0495592_0001238 3300046454 Bacteria 17695
1239 Ga0495592_0011873 3300046454 Bacteria 6601
1240 Ga0495592_0030625 3300046454 Bacteria 4069
1241 Ga0495603_0014409 3300046455 Bacteria 4783
1242 Ga0495603_0269879 3300046455 Bacteria 979
1243 Ga0495629_0000102 3300046459 Bacteria 75235
1244 Ga0495629_0000750 3300046459 Bacteria 26239
1245 Ga0495638_0030906 3300046460 Bacteria 3443
1246 Ga0495638_0141884 3300046460 Bacteria 1401
1247 Ga0495638_0392127 3300046460 Bacteria 722
1248 Ga0495641_0487281 3300046461 Bacteria 562
1249 Ga0495651_0001857 3300046462 Bacteria 16336
1250 Ga0495651_0019393 3300046462 Bacteria 5271
1251 Ga0495651_0122804 3300046462 Bacteria 1905
1252 Ga0495651_0807997 3300046462 Bacteria 578
1253 Ga0495653_0018692 3300046463 Bacteria 5626
1254 Ga0495653_0065888 3300046463 Bacteria 2725
1255 Ga0495653_0457585 3300046463 Bacteria 802
1256 Ga0495653_0645262 3300046463 Bacteria 647
1257 Ga0495580_0233962 3300046472 Bacteria 1261
1258 Ga0495582_0023268 3300046473 Bacteria 3390
1259 Ga0495582_0046015 3300046473 Bacteria 2403
1260 Ga0495582_0075510 3300046473 Bacteria 1867
1261 Ga0495605_0280662 3300046474 Bacteria 708
1262 Ga0495639_0027403 3300046475 Bacteria 2522
1263 Ga0495639_0761680 3300046475 Bacteria 501
1264 Ga0495662_0042172 3300046476 Bacteria 2202
1265 Ga0495662_0048399 3300046476 Bacteria 2052
1266 Ga0495664_0192319 3300046477 Bacteria 1237
1267 Ga0495584_0005333 3300046491 Bacteria 6812
1268 Ga0495584_0092694 3300046491 Bacteria 1524
1269 Ga0495584_0260957 3300046491 Bacteria 881
1270 Ga0495585_0613110 3300046492 Bacteria 511
1271 Ga0495594_0015194 3300046499 Bacteria 4043
1272 Ga0495594_0197624 3300046499 Bacteria 1146
1273 Ga0495594_0513057 3300046499 Bacteria 681
1274 Ga0495607_0024108 3300046501 Bacteria 3798
1275 Ga0495606_0001505 3300046507 Bacteria 30975
1276 Ga0495608_0000738 3300046511 Bacteria 22828
1277 Ga0495608_0004665 3300046511 Bacteria 9799
1278 Ga0495608_0026779 3300046511 Bacteria 3929
1279 Ga0495608_0205749 3300046511 Bacteria 1239
1280 Ga0495610_0064806 3300046512 Bacteria 1726
1281 Ga0495618_0052750 3300046514 Bacteria 2571
1282 Ga0495618_0463737 3300046514 Bacteria 767
1283 Ga0495628_0013184 3300046516 Bacteria 6956
1284 Ga0495628_0034488 3300046516 Bacteria 4069
1285 Ga0495630_0442408 3300046517 Bacteria 996
1286 Ga0495637_0211653 3300046520 Bacteria 709
1287 Ga0495643_0171661 3300046522 Bacteria 1060
1288 Ga0495648_0001119 3300046524 Bacteria 27174
1289 Ga0495663_0326366 3300046525 Bacteria 556
1290 Ga0495642_0186707 3300046528 Bacteria 903
1291 Ga0495652_0004125 3300046529 Bacteria 14021
1292 Ga0495652_0029748 3300046529 Bacteria 4795
1293 Ga0495652_0075183 3300046529 Bacteria 2807
1294 Ga0495652_0809475 3300046529 Bacteria 623
1295 Ga0495654_0310866 3300046530 Bacteria 641
1296 Ga0495665_0015123 3300046531 Bacteria 4159
1297 Ga0495665_0271544 3300046531 Bacteria 871
1298 Ga0495640_0006556 3300046533 Bacteria 9199
1299 Ga0495640_0473442 3300046533 Bacteria 764
1300 Ga0495586_0756311 3300046535 Bacteria 561
1301 Ga0495587_0007411 3300046536 Bacteria 7105
1302 Ga0495587_0012212 3300046536 Bacteria 5423
1303 Ga0495587_0152242 3300046536 Bacteria 1318
1304 Ga0495587_0242460 3300046536 Bacteria 1014
1305 Ga0495587_0244609 3300046536 Bacteria 1009
1306 Ga0495621_0027388 3300046539 Bacteria 1929
1307 Ga0495645_0005931 3300046543 Bacteria 8440
1308 Ga0495645_0009298 3300046543 Bacteria 6873
1309 Ga0495645_0084459 3300046543 Bacteria 2274
1310 Ga0495622_0384509 3300046557 Bacteria 605
1311 Ga0495667_0004216 3300046559 Bacteria 9688
1312 Ga0495667_0013804 3300046559 Bacteria 5455
1313 Ga0495667_0035490 3300046559 Bacteria 3332
1314 Ga0495667_0144154 3300046559 Bacteria 1534
1315 Ga0495656_0037088 3300046615 Bacteria 2011
1316 Ga0495656_0472811 3300046615 Bacteria 662
1317 Ga0495668_0181295 3300046616 Bacteria 1154
1318 Ga0495634_0015272 3300046642 Bacteria 5521
1319 Ga0495634_0171268 3300046642 Bacteria 1364
1320 Ga0495634_0333887 3300046642 Bacteria 910
1321 Ga0495634_0699367 3300046642 Bacteria 583
1322 Ga0495635_0000166 3300046663 Bacteria 40939
1323 Ga0495635_0003618 3300046663 Bacteria 10708
1324 Ga0495635_0052067 3300046663 Bacteria 2820
1325 Ga0495659_0009928 3300046664 Bacteria 3045
1326 Ga0495659_0107774 3300046664 Bacteria 1085
1327 Ga0495659_0182825 3300046664 Bacteria 854
1328 Ga0495659_0329414 3300046664 Bacteria 649
1329 Ga0495588_0047824 3300046674 Bacteria 2197
1330 Ga0495588_0362636 3300046674 Bacteria 761
1331 Ga0495657_0004131 3300046675 Bacteria 11623
1332 Ga0495657_0009824 3300046675 Bacteria 7223
1333 Ga0495657_0060377 3300046675 Bacteria 2512
1334 Ga0495657_0514877 3300046675 Bacteria 697
1335 Ga0495599_0005025 3300046678 Bacteria 7865
1336 Ga0495599_0017759 3300046678 Bacteria 4427
1337 Ga0495599_0092006 3300046678 Bacteria 1892
1338 Ga0495599_0202169 3300046678 Bacteria 1220
1339 Ga0495623_0002267 3300046679 Bacteria 12801
1340 Ga0495623_0121833 3300046679 Bacteria 1569
1341 Ga0495623_0129740 3300046679 Bacteria 1510
1342 Ga0495646_0017015 3300046680 Bacteria 4615
1343 Ga0495646_0060601 3300046680 Bacteria 2256
1344 Ga0495646_0116458 3300046680 Bacteria 1516
1345 Ga0495646_0559598 3300046680 Bacteria 583
1346 Ga0495647_0000220 3300046681 Bacteria 15389
1347 Ga0495647_0193524 3300046681 Bacteria 889
1348 Ga0495647_0372743 3300046681 Bacteria 652
1349 Ga0495658_0004011 3300046683 Bacteria 7258
1350 Ga0495658_0005284 3300046683 Bacteria 6354
1351 Ga0495613_0091635 3300046689 Bacteria 2201
1352 Ga0495624_0260400 3300046690 Bacteria 1048
1353 Ga0495624_0624277 3300046690 Bacteria 642
1354 Ga0495670_0636642 3300046691 Bacteria 581
1355 Ga0495671_0255312 3300046692 Bacteria 846
1356 Ga0495600_0008000 3300046809 Bacteria 6479
1357 Ga0495600_0009218 3300046809 Bacteria 6088
1358 Ga0495600_0105241 3300046809 Bacteria 1839
1359 Ga0495581_0208007 3300047315 Bacteria 1144
1360 Ga0495581_0434645 3300047315 Bacteria 765
1361 Ga0495581_0613217 3300047315 Bacteria 630
1362 Ga0495604_0004924 3300047317 Bacteria 10588
1363 Ga0495604_0008225 3300047317 Bacteria 8255
1364 Ga0495604_0054808 3300047317 Bacteria 3075
1365 Ga0495604_0932216 3300047317 Bacteria 541
1366 Ga0495636_0147444 3300047318 Bacteria 1054
1367 Ga0495674_0075521 3300047319 Bacteria 2900
1368 Ga0495674_0095121 3300047319 Bacteria 2540
1369 Ga0495674_0176179 3300047319 Bacteria 1782
1370 Ga0495674_0837281 3300047319 Bacteria 713
1371 Ga0495672_0042429 3300047320 Bacteria 2743
1372 Ga0495672_0097754 3300047320 Bacteria 1598
1373 Ga0495676_0259927 3300047321 Bacteria 1181
1374 Ga0495680_0004903 3300047322 Bacteria 12674
1375 Ga0495680_0017205 3300047322 Bacteria 6183
1376 Ga0495680_0040990 3300047322 Bacteria 3684
1377 Ga0495680_0047548 3300047322 Bacteria 3374
1378 Ga0495680_0128632 3300047322 Bacteria 1863
1379 Ga0495675_0011758 3300047444 Bacteria 5499
1380 Ga0495675_0011953 3300047444 Bacteria 5455
1381 Ga0495675_0041487 3300047444 Bacteria 2933
1382 Ga0495685_038847 3300047447 Bacteria 1630
1383 Ga0495673_0138484 3300047469 Bacteria 951
1384 Ga0495684_0000501 3300047471 Bacteria 31747
1385 Ga0495684_0063368 3300047471 Bacteria 2810
1386 Ga0495684_0188675 3300047471 Bacteria 1525
1387 Ga0495684_1048057 3300047471 Bacteria 515
1388 Ga0495686_0091392 3300047472 Bacteria 1848
1389 Ga0495593_0023958 3300047673 Bacteria 3387
1390 Ga0495593_0038207 3300047673 Bacteria 2593
1391 Ga0495602_0014308 3300048088 Bacteria 8059
1392 Ga0495602_0030627 3300048088 Bacteria 5100
1393 Ga0495602_0034153 3300048088 Bacteria 4762
1394 Ga0495602_0049384 3300048088 Bacteria 3769
1395 Ga0495614_0061324 3300048089 Bacteria 1616
1396 Ga0495615_0003308 3300048090 Bacteria 2682
1397 Ga0496100_0025495 3300048903 Bacteria 3617
1398 Ga0496100_0027290 3300048903 Bacteria 3510
1399 Ga0496100_1020902 3300048903 Bacteria 651
1400 Ga0496101_0053754 3300048904 Bacteria 2907
1401 Ga0496101_0189731 3300048904 Bacteria 1586
1402 Ga0496101_0266228 3300048904 Bacteria 1337
1403 Ga0496101_0411671 3300048904 Bacteria 1065
1404 Ga0496101_0485678 3300048904 Bacteria 975
1405 Ga0496101_0692796 3300048904 Bacteria 804
1406 Ga0496102_0039370 3300048905 Bacteria 4271
1407 Ga0496102_0054108 3300048905 Bacteria 3659
1408 Ga0496102_0113767 3300048905 Bacteria 2525
1409 Ga0496102_0398717 3300048905 Bacteria 1294
1410 Ga0496102_0505406 3300048905 Bacteria 1131
1411 Ga0496102_0657070 3300048905 Bacteria 971
1412 Ga0496102_1376915 3300048905 Bacteria 624
1413 Ga0496103_0200419 3300048906 Bacteria 1283
1414 Ga0496103_0249421 3300048906 Bacteria 1142
1415 Ga0496104_0023486 3300048907 Bacteria 5669
1416 Ga0496104_0026734 3300048907 Bacteria 5332
1417 Ga0496104_0035166 3300048907 Bacteria 4677
1418 Ga0496104_0103787 3300048907 Bacteria 2723
1419 Ga0496104_0200703 3300048907 Bacteria 1906
1420 Ga0496104_0239352 3300048907 Bacteria 1727
1421 Ga0496104_0730453 3300048907 Bacteria 897
1422 Ga0496104_1553632 3300048907 Bacteria 564
1423 Ga0496105_0001001 3300048908 Bacteria 19520
1424 Ga0496105_0020521 3300048908 Bacteria 5340
1425 Ga0496105_0056076 3300048908 Bacteria 3253
1426 Ga0496105_0085375 3300048908 Bacteria 2608
1427 Ga0496105_0183889 3300048908 Bacteria 1710
1428 Ga0496105_1027125 3300048908 Bacteria 615
1429 Ga0496106_0029044 3300048909 Bacteria 4120
1430 Ga0496106_0785924 3300048909 Bacteria 755
1431 Ga0496106_1448966 3300048909 Bacteria 529
1432 Ga0496107_0042962 3300048910 Bacteria 3247
1433 Ga0496107_0143686 3300048910 Bacteria 1764
1434 Ga0496107_0299646 3300048910 Bacteria 1196
1435 Ga0496107_0323197 3300048910 Bacteria 1148
1436 Ga0496107_0386184 3300048910 Bacteria 1041
1437 Ga0496107_0482802 3300048910 Bacteria 919
1438 Ga0496107_1382920 3300048910 Bacteria 501
1439 Ga0496108_0035528 3300048911 Bacteria 4144
1440 Ga0496108_0039628 3300048911 Bacteria 3926
1441 Ga0496108_0227114 3300048911 Bacteria 1623
1442 Ga0496108_0612506 3300048911 Bacteria 948
1443 Ga0496109_0060061 3300048912 Bacteria 3474
1444 Ga0496109_0061064 3300048912 Bacteria 3445
1445 Ga0496109_0125137 3300048912 Bacteria 2396
1446 Ga0496109_0158313 3300048912 Bacteria 2121
1447 Ga0496109_0355701 3300048912 Bacteria 1383
1448 Ga0496109_0553731 3300048912 Bacteria 1085
1449 Ga0496109_0801996 3300048912 Bacteria 879
1450 Ga0496110_0004745 3300048913 Bacteria 10581
1451 Ga0496110_0025359 3300048913 Bacteria 5065
1452 Ga0496110_0031106 3300048913 Bacteria 4604
1453 Ga0496110_0078466 3300048913 Bacteria 2940
1454 Ga0496110_0149499 3300048913 Bacteria 2114
1455 Ga0496110_0197035 3300048913 Bacteria 1829
1456 Ga0496110_0242488 3300048913 Bacteria 1640
1457 Ga0496111_0003290 3300048914 Bacteria 9987
1458 Ga0496111_0576726 3300048914 Bacteria 825
1459 Ga0496112_0025634 3300048915 Bacteria 5663
1460 Ga0496112_0134110 3300048915 Bacteria 2447
1461 Ga0496112_0177324 3300048915 Bacteria 2096
1462 Ga0496112_0187244 3300048915 Bacteria 2033
1463 Ga0496112_0220137 3300048915 Bacteria 1854
1464 Ga0496112_0302187 3300048915 Bacteria 1545
1465 Ga0496112_0362358 3300048915 Bacteria 1391
1466 Ga0496112_0376706 3300048915 Bacteria 1360
1467 Ga0496112_0390944 3300048915 Bacteria 1331
1468 Ga0496112_1168289 3300048915 Bacteria 687
1469 Ga0496112_1466730 3300048915 Bacteria 596
1470 Ga0496113_0000277 3300048916 Bacteria 24261
1471 Ga0496113_0041229 3300048916 Bacteria 3405
1472 Ga0496113_0165996 3300048916 Bacteria 1747
1473 Ga0496114_0018702 3300048917 Bacteria 5606
1474 Ga0496114_0095025 3300048917 Bacteria 2536
1475 Ga0496114_0098458 3300048917 Bacteria 2493
1476 Ga0496114_0366292 3300048917 Bacteria 1275
1477 Ga0496114_1447964 3300048917 Bacteria 574
1478 Ga0496115_0013992 3300048918 Bacteria 6073
1479 Ga0496115_0056163 3300048918 Bacteria 3164
1480 Ga0496115_0061473 3300048918 Bacteria 3028
1481 Ga0496115_0123264 3300048918 Bacteria 2133
1482 Ga0496115_0132943 3300048918 Bacteria 2051
1483 Ga0496115_0184044 3300048918 Bacteria 1726
1484 Ga0496115_0215847 3300048918 Bacteria 1584
1485 Ga0496115_0272668 3300048918 Bacteria 1390
1486 Ga0496115_0325938 3300048918 Bacteria 1255
1487 Ga0496115_0359434 3300048918 Bacteria 1187
1488 Ga0496115_0432035 3300048918 Bacteria 1066
1489 Ga0496115_0501294 3300048918 Bacteria 976
1490 Ga0496115_0779083 3300048918 Bacteria 746
1491 Ga0496121_0003837 3300048924 Bacteria 20905
1492 Ga0496121_0278841 3300048924 Bacteria 1145
1493 Ga0496125_0251464 3300048928 Bacteria 1115
1494 Ga0496125_0288165 3300048928 Bacteria 1013
1495 Ga0496126_0016054 3300048929 Bacteria 7509
1496 Ga0496126_0024497 3300048929 Bacteria 5826
1497 Ga0496126_0077662 3300048929 Bacteria 2943
1498 Ga0501031_0131210 3300049568 Bacteria 1637
1499 Ga0501031_1004348 3300049568 Bacteria 533
1500 Ga0501032_0070139 3300049569 Bacteria 2337
1501 Ga0501032_0689941 3300049569 Bacteria 647
1502 Ga0501033_0031833 3300049570 Bacteria 3960
1503 Ga0501033_0061389 3300049570 Bacteria 2770
1504 Ga0501033_0081086 3300049570 Bacteria 2380
1505 Ga0501033_0178204 3300049570 Bacteria 1524
1506 Ga0501033_0391415 3300049570 Bacteria 970
1507 Ga0501034_0011107 3300049571 Bacteria 9350
1508 Ga0501034_0087327 3300049571 Bacteria 3118
1509 Ga0501034_0113696 3300049571 Bacteria 2696
1510 Ga0501034_0161629 3300049571 Bacteria 2210
1511 Ga0501034_0168565 3300049571 Bacteria 2158
1512 Ga0501034_0755553 3300049571 Bacteria 868
1513 Ga0501034_1033748 3300049571 Bacteria 704
1514 Ga0501036_0013581 3300049572 Bacteria 6768
1515 Ga0501036_0077992 3300049572 Bacteria 2802
1516 Ga0501036_0087504 3300049572 Bacteria 2633
1517 Ga0501036_0090776 3300049572 Bacteria 2581
1518 Ga0501036_0114682 3300049572 Bacteria 2277
1519 Ga0501036_0164560 3300049572 Bacteria 1870
1520 Ga0501036_0232539 3300049572 Bacteria 1547
1521 Ga0501036_0282044 3300049572 Bacteria 1390
1522 Ga0501037_0058381 3300049573 Bacteria 2816
1523 Ga0501037_0217166 3300049573 Bacteria 1346
1524 Ga0501037_0226077 3300049573 Bacteria 1315
1525 Ga0501037_0498235 3300049573 Bacteria 826
1526 Ga0501037_0703138 3300049573 Bacteria 672
1527 Ga0501038_0021702 3300049574 Bacteria 5760
1528 Ga0501038_0069444 3300049574 Bacteria 2993
1529 Ga0501038_0086125 3300049574 Bacteria 2640
1530 Ga0501038_0218069 3300049574 Bacteria 1523
1531 Ga0501038_0254502 3300049574 Bacteria 1390
1532 Ga0501038_0293028 3300049574 Bacteria 1278
1533 Ga0501038_0451610 3300049574 Bacteria 988
1534 Ga0501038_0752021 3300049574 Bacteria 727
1535 Ga0501039_0037169 3300049575 Bacteria 3758
1536 Ga0501039_0054212 3300049575 Bacteria 3104
1537 Ga0501039_0496825 3300049575 Bacteria 958
1538 Ga0501040_0051341 3300049576 Bacteria 2821
1539 Ga0501040_0241871 3300049576 Bacteria 1287
1540 Ga0501040_0508077 3300049576 Bacteria 869
1541 Ga0501041_0053777 3300049577 Bacteria 2456
1542 Ga0501041_0120569 3300049577 Bacteria 1630
1543 Ga0501041_1123615 3300049577 Bacteria 507
1544 Ga0501042_1406841 3300049578 Bacteria 509
1545 Ga0501043_0011069 3300049579 Bacteria 7065
1546 Ga0501043_0052163 3300049579 Bacteria 3213
1547 Ga0501043_0106418 3300049579 Bacteria 2203
1548 Ga0501043_0109403 3300049579 Bacteria 2170
1549 Ga0501043_0140224 3300049579 Bacteria 1893
1550 Ga0501043_0391113 3300049579 Bacteria 1051
1551 Ga0501043_1016758 3300049579 Bacteria 589
1552 Ga0501046_0023298 3300049580 Bacteria 5094
1553 Ga0501046_0118322 3300049580 Bacteria 2018
1554 Ga0501046_0174509 3300049580 Bacteria 1611
1555 Ga0501046_0290551 3300049580 Bacteria 1196
1556 Ga0501046_0737956 3300049580 Bacteria 692
1557 Ga0501047_0013975 3300049581 Bacteria 7630
1558 Ga0501047_0028483 3300049581 Bacteria 5386
1559 Ga0501047_0045446 3300049581 Bacteria 4247
1560 Ga0501047_0162683 3300049581 Bacteria 2103
1561 Ga0501047_0208494 3300049581 Bacteria 1813
1562 Ga0501047_0783680 3300049581 Bacteria 768
1563 Ga0501047_1152986 3300049581 Bacteria 588
1564 Ga0501048_0089882 3300049582 Bacteria 2167
1565 Ga0501048_0134214 3300049582 Bacteria 1749
1566 Ga0501048_0173509 3300049582 Bacteria 1528
1567 Ga0501048_0501665 3300049582 Bacteria 870
1568 Ga0501048_0611805 3300049582 Bacteria 782
1569 Ga0501068_0026554 3300049584 Bacteria 3413
1570 Ga0501068_0149822 3300049584 Bacteria 1466
1571 Ga0501068_0502638 3300049584 Bacteria 786
1572 Ga0501068_0772686 3300049584 Bacteria 629
1573 Ga0501070_0055874 3300049586 Bacteria 3272
1574 Ga0501070_0073371 3300049586 Bacteria 2831
1575 Ga0501070_0151504 3300049586 Bacteria 1913
1576 Ga0501070_0249040 3300049586 Bacteria 1453
1577 Ga0501070_0495907 3300049586 Bacteria 981
1578 Ga0501070_0871436 3300049586 Bacteria 704
1579 Ga0501070_1400603 3300049586 Bacteria 531
1580 Ga0501071_0036817 3300049587 Bacteria 3490
1581 Ga0501071_0268185 3300049587 Bacteria 1290
1582 Ga0501071_0410719 3300049587 Bacteria 1034
1583 Ga0501072_0008706 3300049588 Bacteria 7704
1584 Ga0501072_0054986 3300049588 Bacteria 3138
1585 Ga0501072_0124188 3300049588 Bacteria 2057
1586 Ga0501073_0010951 3300049589 Bacteria 6635
1587 Ga0501073_0067848 3300049589 Bacteria 2486
1588 Ga0501073_0080371 3300049589 Bacteria 2268
1589 Ga0501073_0170672 3300049589 Bacteria 1506
1590 Ga0501073_0515186 3300049589 Bacteria 827
1591 Ga0501073_0604053 3300049589 Bacteria 758
1592 Ga0501073_0614896 3300049589 Bacteria 750
1593 Ga0501074_0047205 3300049590 Bacteria 3113
1594 Ga0501074_0127371 3300049590 Bacteria 1822
1595 Ga0501074_0663432 3300049590 Bacteria 737
1596 Ga0501074_0915360 3300049590 Bacteria 617
1597 Ga0501074_1202939 3300049590 Bacteria 531
1598 Ga0501075_0009692 3300049591 Bacteria 6747
1599 Ga0501075_0155622 3300049591 Bacteria 1743
1600 Ga0501075_0286039 3300049591 Bacteria 1256
1601 Ga0501075_0316301 3300049591 Bacteria 1190
1602 Ga0501075_0886781 3300049591 Bacteria 678
1603 Ga0501075_1121082 3300049591 Bacteria 597
1604 Ga0501076_0030930 3300049592 Bacteria 4172
1605 Ga0501076_0059590 3300049592 Bacteria 3037
1606 Ga0501076_0068824 3300049592 Bacteria 2828
1607 Ga0501076_0090046 3300049592 Bacteria 2467
1608 Ga0501076_0094739 3300049592 Bacteria 2404
1609 Ga0501076_0194016 3300049592 Bacteria 1658
1610 Ga0501076_1266800 3300049592 Bacteria 606
1611 Ga0501077_0003724 3300049593 Bacteria 9169
1612 Ga0501077_0310706 3300049593 Bacteria 1005
1613 Ga0501077_0468722 3300049593 Bacteria 807
1614 Ga0501077_0504767 3300049593 Bacteria 775
1615 Ga0501077_0603188 3300049593 Bacteria 705
1616 Ga0501079_0029927 3300049741 Bacteria 4183
1617 Ga0501079_0054438 3300049741 Bacteria 3086
1618 Ga0501079_0188076 3300049741 Bacteria 1612
1619 Ga0501079_0818119 3300049741 Bacteria 733
1620 Ga0501079_0923396 3300049741 Bacteria 687
1621 Ga0501080_0010934 3300049742 Bacteria 8304
1622 Ga0501080_0108310 3300049742 Bacteria 2575
1623 Ga0501080_0109388 3300049742 Bacteria 2562
1624 Ga0501080_0117223 3300049742 Bacteria 2468
1625 Ga0501080_0194490 3300049742 Bacteria 1863
1626 Ga0501080_0437560 3300049742 Bacteria 1173
1627 Ga0501080_0830787 3300049742 Bacteria 809
1628 Ga0501080_1319528 3300049742 Bacteria 617
1629 Ga0501081_0000399 3300049743 Bacteria 23971
1630 Ga0501081_0306076 3300049743 Bacteria 1166
1631 Ga0501081_0792516 3300049743 Bacteria 713
1632 Ga0501083_0047836 3300049744 Bacteria 2888
1633 Ga0501083_0089328 3300049744 Bacteria 2036
1634 Ga0501083_0175848 3300049744 Bacteria 1398
1635 Ga0501083_0176254 3300049744 Bacteria 1397
1636 Ga0501083_0286337 3300049744 Bacteria 1072
1637 Ga0501083_0323460 3300049744 Bacteria 1003
1638 Ga0501083_0333314 3300049744 Bacteria 987
1639 Ga0501083_0592107 3300049744 Bacteria 722
1640 Ga0501035_0017191 3300049822 Bacteria 6666
1641 Ga0501035_0038188 3300049822 Bacteria 4348
1642 Ga0501035_0070905 3300049822 Bacteria 3086
1643 Ga0501035_0071348 3300049822 Bacteria 3075
1644 Ga0501035_0081479 3300049822 Bacteria 2856
1645 Ga0501035_0118926 3300049822 Bacteria 2311
1646 Ga0501035_0228472 3300049822 Bacteria 1586
1647 Ga0501044_0009555 3300049823 Bacteria 10559
1648 Ga0501044_0011587 3300049823 Bacteria 9555
1649 Ga0501044_0050451 3300049823 Bacteria 4293
1650 Ga0501044_0051105 3300049823 Bacteria 4263
1651 Ga0501044_0148056 3300049823 Bacteria 2331
1652 Ga0501044_0185986 3300049823 Bacteria 2042
1653 Ga0501044_0308515 3300049823 Bacteria 1510
1654 Ga0501044_0430567 3300049823 Bacteria 1228
1655 Ga0501045_0175978 3300049824 Bacteria 1594
1656 Ga0501045_0614349 3300049824 Bacteria 804
1657 nmdc:mga03683_161196_c1 3300050489 Bacteria 1016
1658 nmdc:mga03683_193879_c1 3300050489 Bacteria 930
1659 nmdc:mga03683_298123_c1 3300050489 Bacteria 756
1660 nmdc:mga03683_416699_c1 3300050489 Bacteria 643
1661 nmdc:mga03n38_273783_c1 3300050490 Bacteria 899
1662 nmdc:mga03n38_35883_c1 3300050490 Bacteria 2128
1663 nmdc:mga00v17_189638_c1 3300050491 Bacteria 1327
1664 nmdc:mga00v17_23806_c1 3300050491 Bacteria 3546
1665 nmdc:mga00v17_664977_c1 3300050491 Bacteria 669
1666 nmdc:mga00v17_78511_c1 3300050491 Bacteria 2057
1667 nmdc:mga00v17_81881_c1 3300050491 Bacteria 1247
1668 nmdc:mga0yw44_1056256_c1 3300050492 Bacteria 549
1669 nmdc:mga0yw44_146322_c1 3300050492 Bacteria 1539
1670 nmdc:mga0yw44_154446_c1 3300050492 Bacteria 1499
1671 nmdc:mga0yw44_464333_c1 3300050492 Bacteria 858
1672 nmdc:mga0yw44_628924_c1 3300050492 Bacteria 729
1673 nmdc:mga0k408_188050_c1 3300050493 Bacteria 869
1674 nmdc:mga0k408_19764_c1 3300050493 Bacteria 3768
1675 nmdc:mga0k408_206016_c1 3300050493 Bacteria 1174
1676 nmdc:mga0k408_488216_c1 3300050493 Bacteria 730
1677 nmdc:mga06z11_145251_c1 3300050494 Bacteria 1344
1678 nmdc:mga06z11_19981_c1 3300050494 Bacteria 3089
1679 nmdc:mga06z11_213154_c1 3300050494 Bacteria 1126
1680 nmdc:mga06z11_22993_c1 3300050494 Bacteria 2921
1681 nmdc:mga06z11_309410_c1 3300050494 Bacteria 941
1682 nmdc:mga06z11_374561_c1 3300050494 Bacteria 855
1683 nmdc:mga06z11_560913_c1 3300050494 Bacteria 694
1684 nmdc:mga06z11_80831_c1 3300050494 Bacteria 1743
1685 nmdc:mga04h51_10834_c1 3300050495 Bacteria 2515
1686 nmdc:mga04h51_18824_c1 3300050495 Bacteria 2039
1687 nmdc:mga04h51_38427_c1 3300050495 Bacteria 1550
1688 nmdc:mga04h51_541447_c1 3300050495 Bacteria 501
1689 nmdc:mga04h51_70754_c1 3300050495 Bacteria 1217
1690 nmdc:mga07m45_40889_c1 3300050496 Bacteria 2595
1691 nmdc:mga07m45_455252_c1 3300050496 Bacteria 742
1692 nmdc:mga07m45_711285_c1 3300050496 Bacteria 577
1693 nmdc:mga05p37_142822_c1 3300050507 Bacteria 2932
1694 nmdc:mga05p37_17594_c1 3300050507 Bacteria 8627
1695 nmdc:mga05p37_308741_c1 3300050507 Bacteria 1876
1696 nmdc:mga05p37_313322_c1 3300050507 Bacteria 1859
1697 nmdc:mga05p37_442823_c1 3300050507 Bacteria 1506
1698 nmdc:mga05p37_49906_c1 3300050507 Bacteria 5147
1699 nmdc:mga05p37_70389_c1 3300050507 Bacteria 4303
1700 nmdc:mga09592_1104039_c1 3300050508 Bacteria 659
1701 nmdc:mga09592_1212_c1 3300050508 Bacteria 20682
1702 nmdc:mga09592_266358_c1 3300050508 Bacteria 1486
1703 nmdc:mga09592_507002_c1 3300050508 Bacteria 1038
1704 nmdc:mga09592_56784_c1 3300050508 Bacteria 3308
1705 nmdc:mga09592_60595_c1 3300050508 Bacteria 3199
1706 nmdc:mga0qj67_102566_c1 3300050509 Bacteria 2307
1707 nmdc:mga0qj67_319621_c1 3300050509 Bacteria 1257
1708 nmdc:mga0qj67_452495_c1 3300050509 Bacteria 1034
1709 nmdc:mga0qj67_48091_c1 3300050509 Bacteria 3370
1710 nmdc:mga0qj67_9239_c1 3300050509 Bacteria 7327
1711 nmdc:mga06r32_1657_c1 3300050510 Bacteria 20114
1712 nmdc:mga06r32_199078_c1 3300050510 Bacteria 1991
1713 nmdc:mga06r32_201241_c1 3300050510 Bacteria 1979
1714 nmdc:mga06r32_303067_c1 3300050510 Bacteria 1584
1715 nmdc:mga06r32_45696_c1 3300050510 Bacteria 4175
1716 nmdc:mga06r32_560736_c1 3300050510 Bacteria 1115
1717 nmdc:mga06r32_897502_c1 3300050510 Bacteria 843
1718 nmdc:mga08y16_180705_c1 3300050511 Bacteria 2191
1719 nmdc:mga08y16_247628_c1 3300050511 Bacteria 1842
1720 nmdc:mga08y16_40252_c1 3300050511 Bacteria 4899
1721 nmdc:mga08y16_605_c1 3300050511 Bacteria 33478
1722 nmdc:mga08y16_673354_c1 3300050511 Bacteria 1037
1723 nmdc:mga08y16_74850_c1 3300050511 Bacteria 3529
1724 nmdc:mga08y16_982432_c1 3300050511 Bacteria 825
1725 nmdc:mga0n895_1103236_c1 3300050512 Bacteria 771
1726 nmdc:mga0n895_13760_c1 3300050512 Bacteria 7317
1727 nmdc:mga0n895_242733_c1 3300050512 Bacteria 1828
1728 nmdc:mga0n895_288538_c1 3300050512 Bacteria 1664
1729 nmdc:mga0n895_289544_c1 3300050512 Bacteria 1661
1730 nmdc:mga0n895_35605_c1 3300050512 Bacteria 4801
1731 nmdc:mga0n895_60710_c1 3300050512 Bacteria 3731
1732 nmdc:mga0n895_6700_c1 3300050512 Bacteria 9816
1733 nmdc:mga0n895_890954_c1 3300050512 Bacteria 876
1734 nmdc:mga0rr50_274071_c1 3300050513 Bacteria 1407
1735 nmdc:mga0rr50_39027_c1 3300050513 Bacteria 3442
1736 nmdc:mga0rr50_512446_c1 3300050513 Bacteria 1020
1737 nmdc:mga0rr50_67873_c1 3300050513 Bacteria 2710
1738 nmdc:mga0rr50_68414_c1 3300050513 Bacteria 2700
1739 nmdc:mga0rr50_8249_c1 3300050513 Bacteria 6473
1740 nmdc:mga08x19_114073_c1 3300050514 Bacteria 1805
1741 nmdc:mga08x19_135365_c1 3300050514 Bacteria 1660
1742 nmdc:mga08x19_142527_c1 3300050514 Bacteria 1619
1743 nmdc:mga08x19_665700_c1 3300050514 Bacteria 738
1744 nmdc:mga08x19_6_c1 3300050514 Bacteria 405679
1745 nmdc:mga08x19_78337_c1 3300050514 Bacteria 2166
1746 nmdc:mga0a205_261161_c1 3300050515 Bacteria 1609
1747 nmdc:mga0a205_74728_c1 3300050515 Bacteria 3274
1748 nmdc:mga0a205_87055_c1 3300050515 Bacteria 3018
1749 nmdc:mga0a205_92285_c1 3300050515 Bacteria 2926
1750 nmdc:mga0a205_98886_c1 3300050515 Bacteria 2816
1751 nmdc:mga0sz30_94500_c1 3300050516 Bacteria 1303
1752 Ga0495601_0000047 3300053077 Bacteria 70553
1753 Ga0495601_0018096 3300053077 Bacteria 4284
1754 Ga0495601_0084826 3300053077 Bacteria 2035
1755 Ga0495601_0127783 3300053077 Bacteria 1654
1756 Ga0495612_0000445 3300053078 Bacteria 16541
1757 Ga0495612_0002406 3300053078 Bacteria 7710
1758 Ga0495612_0187205 3300053078 Bacteria 910
1759 Ga0500610_0161754 3300053079 Bacteria 1113
1760 Ga0495655_0112885 3300053083 Bacteria 819
1761 Ga0495595_0000332 3300053084 Bacteria 18218
1762 Ga0495595_0019108 3300053084 Bacteria 2969
1763 Ga0495595_0020883 3300053084 Bacteria 2854
1764 Ga0495595_0033111 3300053084 Bacteria 2330
1765 Ga0495619_0000122 3300053085 Bacteria 57583
1766 Ga0495619_0000633 3300053085 Bacteria 23194
1767 Ga0495619_0000740 3300053085 Bacteria 21287
1768 Ga0495619_0010941 3300053085 Bacteria 5709
1769 Ga0495619_0302138 3300053085 Bacteria 1108
1770 Ga0495619_0558495 3300053085 Bacteria 785
1771 Ga0500644_0001826 3300053088 Bacteria 5503
1772 Ga0500641_0012310 3300053096 Bacteria 3123
1773 Ga0500641_0027247 3300053096 Bacteria 2224
1774 Ga0500641_0066882 3300053096 Bacteria 1505
1775 Ga0500593_003192 3300053117 Bacteria 6149
1776 Ga0500594_0247679 3300053118 Bacteria 593
1777 Ga0500595_009606 3300053119 Bacteria 3896
1778 Ga0500595_176295 3300053119 Bacteria 593
1779 Ga0500642_0124549 3300053130 Bacteria 1207
1780 Ga0500652_000021 3300053131 Bacteria 119100
1781 Ga0500658_0106983 3300053134 Bacteria 1227
1782 Ga0500568_0039755 3300053139 Bacteria 1897
1783 Ga0500573_0302385 3300053140 Bacteria 799
1784 Ga0500604_0004893 3300053151 Bacteria 3552
1785 Ga0500604_0179025 3300053151 Bacteria 726
1786 Ga0500616_0000001 3300053153 Bacteria 1986011
1787 Ga0500616_0000046 3300053153 Bacteria 333409
1788 Ga0500627_0400621 3300053158 Bacteria 585
1789 Ga0500636_0044472 3300053177 Bacteria 2619
1790 Ga0500611_250155 3300053727 Bacteria 511
1791 Ga0500645_042045 3300053730 Bacteria 1349
1792 Ga0500645_090779 3300053730 Bacteria 866
1793 Ga0500645_106624 3300053730 Bacteria 788
1794 Ga0500645_134516 3300053730 Bacteria 686
1795 Ga0501084_0004601 3300054114 Bacteria 11273
1796 Ga0501084_0029044 3300054114 Bacteria 4624
1797 Ga0501084_0159294 3300054114 Bacteria 1904
1798 Ga0501084_0162844 3300054114 Bacteria 1882
1799 Ga0501084_0193081 3300054114 Bacteria 1718
1800 Ga0501084_0281300 3300054114 Bacteria 1405
1801 Ga0501084_0291374 3300054114 Bacteria 1379
1802 Ga0501082_0000486 3300060353 Bacteria 35135
1803 Ga0501082_0020730 3300060353 Bacteria 5668
1804 Ga0501082_0141464 3300060353 Bacteria 2088
1805 Ga0501082_0167947 3300060353 Bacteria 1907
1806 Ga0501082_0206951 3300060353 Bacteria 1707
1807 Ga0501082_0407291 3300060353 Bacteria 1187
1808 Ga0501082_0417931 3300060353 Bacteria 1171
1809 Ga0501082_0598449 3300060353 Bacteria 965
1810 Ga0501082_0608823 3300060353 Bacteria 956
1811 Ga0501082_0770733 3300060353 Bacteria 842
1812 Ga0501082_0809537 3300060353 Bacteria 819
1813 Ga0530510_0195094 3300061734 Bacteria 1503
1814 Ga0530510_0264618 3300061734 Bacteria 1283
1815 Ga0530510_0472249 3300061734 Bacteria 950
1816 Ga0530510_0675163 3300061734 Bacteria 787

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041413 Ga0439465_0043973 Ga0439465_0043973_1066_1431 120
2 3300039437 Ga0436365_0143772 Ga0436365_0143772_439_897 121
3 3300005937 Ga0081455_10261501 Ga0081455_102615012 122
4 3300006038 Ga0075365_10036525 Ga0075365_100365253 123
5 3300006177 Ga0075362_10040296 Ga0075362_100402962 123
6 3300049570 Ga0501033_0061389 Ga0501033_0061389_1567_2019 126
7 3300049571 Ga0501034_0087327 Ga0501034_0087327_1142_1594 126
8 3300049572 Ga0501036_0164560 Ga0501036_0164560_212_664 126
9 3300049574 Ga0501038_0218069 Ga0501038_0218069_503_955 126
10 3300049581 Ga0501047_0208494 Ga0501047_0208494_514_966 126
11 3300049582 Ga0501048_0501665 Ga0501048_0501665_307_759 126
12 3300049586 Ga0501070_0151504 Ga0501070_0151504_1346_1798 126
13 3300049822 Ga0501035_0038188 Ga0501035_0038188_255_707 126
14 3300049823 Ga0501044_0050451 Ga0501044_0050451_3163_3615 126
15 3300003203 JGI25406J46586_10003907 JGI25406J46586_100039072 127
16 3300005344 Ga0070661_101500020 Ga0070661_1015000201 127
17 3300006028 Ga0070717_10738851 Ga0070717_107388512 127
18 3300006237 Ga0097621_101065738 Ga0097621_1010657382 127
19 3300031665 Ga0316575_10355306 Ga0316575_103553061 127
20 3300035086 Ga0373934_0242163 Ga0373934_0242163_37_420 127
21 3300035089 Ga0373944_0238621 Ga0373944_0238621_30_422 127
22 3300035119 Ga0373956_0099464 Ga0373956_0099464_523_909 127
23 3300035172 Ga0373955_0286314 Ga0373955_0286314_219_605 127
24 3300035695 Ga0373927_1115138 Ga0373927_1115138_18_401 127
25 3300035724 Ga0373933_0494269 Ga0373933_0494269_349_735 127
26 3300036401 Ga0373937_0001207 Ga0373937_0001207_18874_19260 127
27 3300037466 Ga0395898_0111578 Ga0395898_0111578_267_650 127
28 3300039437 Ga0436365_0321657 Ga0436365_0321657_312_704 127
29 3300039438 Ga0436360_0019956 Ga0436360_0019956_53_436 127
30 3300039438 Ga0436360_0963942 Ga0436360_0963942_313_696 127
31 3300044765 Ga0466970_0386892 Ga0466970_0386892_56_439 127
32 3300046463 Ga0495653_0645262 Ga0495653_0645262_243_629 127
33 3300046529 Ga0495652_0809475 Ga0495652_0809475_204_599 127
34 3300046535 Ga0495586_0756311 Ga0495586_0756311_21_404 127
35 3300046678 Ga0495599_0202169 Ga0495599_0202169_821_1207 127
36 3300047319 Ga0495674_0176179 Ga0495674_0176179_1369_1758 127
37 3300048908 Ga0496105_1027125 Ga0496105_1027125_22_405 127
38 3300048915 Ga0496112_1466730 Ga0496112_1466730_192_575 127
39 3300048918 Ga0496115_0184044 Ga0496115_0184044_134_520 127
40 3300049579 Ga0501043_1016758 Ga0501043_1016758_191_574 127
41 3300049591 Ga0501075_1121082 Ga0501075_1121082_145_528 127
42 3300049592 Ga0501076_1266800 Ga0501076_1266800_191_580 127
43 3300050496 nmdc:mga07m45_711285_c1 nmdc:mga07m45_711285_c1_14_403 127
44 3300053085 Ga0495619_0558495 Ga0495619_0558495_42_425 127
45 3300003659 JGI25404J52841_10017244 JGI25404J52841_100172442 128
46 3300005981 Ga0081538_10013091 Ga0081538_100130912 128
47 3300005981 Ga0081538_10025069 Ga0081538_100250692 128
48 3300005983 Ga0081540_1000709 Ga0081540_10007094 128
49 3300006038 Ga0075365_10478315 Ga0075365_104783152 128
50 3300006038 Ga0075365_11137503 Ga0075365_111375031 128
51 3300006042 Ga0075368_10029589 Ga0075368_100295892 128
52 3300006042 Ga0075368_10327965 Ga0075368_103279652 128
53 3300006048 Ga0075363_100013805 Ga0075363_1000138055 128
54 3300006051 Ga0075364_10014315 Ga0075364_100143156 128
55 3300006051 Ga0075364_10526001 Ga0075364_105260011 128
56 3300006177 Ga0075362_10006492 Ga0075362_100064922 128
57 3300006178 Ga0075367_10041132 Ga0075367_100411324 128
58 3300006178 Ga0075367_10169257 Ga0075367_101692571 128
59 3300006195 Ga0075366_10014867 Ga0075366_100148672 128
60 3300006846 Ga0075430_100185115 Ga0075430_1001851152 128
61 3300006847 Ga0075431_100039357 Ga0075431_1000393577 128
62 3300006847 Ga0075431_100062070 Ga0075431_1000620703 128
63 3300007265 Ga0099794_10221127 Ga0099794_102211272 128
64 3300009094 Ga0111539_10449933 Ga0111539_104499332 128
65 3300009101 Ga0105247_11428804 Ga0105247_114288041 128
66 3300009148 Ga0105243_10091677 Ga0105243_100916772 128
67 3300011119 Ga0105246_11420641 Ga0105246_114206411 128
68 3300013102 Ga0157371_10446823 Ga0157371_104468231 128
69 3300027866 Ga0209813_10016580 Ga0209813_100165803 128
70 3300028577 Ga0265318_10010479 Ga0265318_100104795 128
71 3300031235 Ga0265330_10167077 Ga0265330_101670771 128
72 3300031241 Ga0265325_10024961 Ga0265325_100249616 128
73 3300031241 Ga0265325_10054613 Ga0265325_100546132 128
74 3300031247 Ga0265340_10028497 Ga0265340_100284974 128
75 3300031247 Ga0265340_10057090 Ga0265340_100570902 128
76 3300031249 Ga0265339_10121661 Ga0265339_101216612 128
77 3300031250 Ga0265331_10021238 Ga0265331_100212382 128
78 3300031344 Ga0265316_10216802 Ga0265316_102168022 128
79 3300031595 Ga0265313_10099117 Ga0265313_100991172 128
80 3300031711 Ga0265314_10060747 Ga0265314_100607474 128
81 3300031712 Ga0265342_10060583 Ga0265342_100605833 128
82 3300031712 Ga0265342_10379460 Ga0265342_103794602 128
83 3300035116 Ga0373945_0396288 Ga0373945_0396288_193_579 128
84 3300035118 Ga0373954_0615196 Ga0373954_0615196_139_525 128
85 3300035691 Ga0373931_0042125 Ga0373931_0042125_184_570 128
86 3300035695 Ga0373927_0001072 Ga0373927_0001072_3399_3785 128
87 3300035725 Ga0373947_0029816 Ga0373947_0029816_544_930 128
88 3300035725 Ga0373947_0514322 Ga0373947_0514322_275_661 128
89 3300037068 Ga0373925_0819304 Ga0373925_0819304_287_673 128
90 3300039437 Ga0436365_0047901 Ga0436365_0047901_169_555 128
91 3300039450 Ga0436363_0362500 Ga0436363_0362500_47_433 128
92 3300039450 Ga0436363_1305623 Ga0436363_1305623_101_487 128
93 3300039450 Ga0436363_1361493 Ga0436363_1361493_73_459 128
94 3300041503 Ga0451847_0751876 Ga0451847_0751876_74_463 128
95 3300046460 Ga0495638_0141884 Ga0495638_0141884_448_834 128
96 3300046472 Ga0495580_0233962 Ga0495580_0233962_551_937 128
97 3300046473 Ga0495582_0075510 Ga0495582_0075510_852_1238 128
98 3300046491 Ga0495584_0260957 Ga0495584_0260957_464_850 128
99 3300046499 Ga0495594_0197624 Ga0495594_0197624_103_489 128
100 3300046499 Ga0495594_0513057 Ga0495594_0513057_72_458 128
101 3300046520 Ga0495637_0211653 Ga0495637_0211653_94_480 128
102 3300046616 Ga0495668_0181295 Ga0495668_0181295_292_678 128
103 3300046664 Ga0495659_0009928 Ga0495659_0009928_277_663 128
104 3300046674 Ga0495588_0362636 Ga0495588_0362636_134_520 128
105 3300046683 Ga0495658_0005284 Ga0495658_0005284_3907_4293 128
106 3300046690 Ga0495624_0624277 Ga0495624_0624277_42_428 128
107 3300047320 Ga0495672_0097754 Ga0495672_0097754_713_1102 128
108 3300048907 Ga0496104_0035166 Ga0496104_0035166_2649_3035 128
109 3300048908 Ga0496105_0056076 Ga0496105_0056076_2079_2465 128
110 3300048910 Ga0496107_0143686 Ga0496107_0143686_1068_1454 128
111 3300048913 Ga0496110_0149499 Ga0496110_0149499_987_1373 128
112 3300048918 Ga0496115_0215847 Ga0496115_0215847_329_715 128
113 3300048924 Ga0496121_0278841 Ga0496121_0278841_737_1123 128
114 3300049571 Ga0501034_0161629 Ga0501034_0161629_30_416 128
115 3300049579 Ga0501043_0109403 Ga0501043_0109403_1741_2127 128
116 3300049581 Ga0501047_1152986 Ga0501047_1152986_43_429 128
117 3300049586 Ga0501070_1400603 Ga0501070_1400603_32_418 128
118 3300049589 Ga0501073_0170672 Ga0501073_0170672_1093_1479 128
119 3300049593 Ga0501077_0468722 Ga0501077_0468722_375_761 128
120 3300049742 Ga0501080_0437560 Ga0501080_0437560_750_1139 128
121 3300049742 Ga0501080_0830787 Ga0501080_0830787_108_494 128
122 3300049744 Ga0501083_0176254 Ga0501083_0176254_990_1376 128
123 3300049822 Ga0501035_0118926 Ga0501035_0118926_23_409 128
124 3300049823 Ga0501044_0308515 Ga0501044_0308515_585_971 128
125 3300050489 nmdc:mga03683_161196_c1 nmdc:mga03683_161196_c1_243_632 128
126 3300050489 nmdc:mga03683_298123_c1 nmdc:mga03683_298123_c1_359_745 128
127 3300050489 nmdc:mga03683_416699_c1 nmdc:mga03683_416699_c1_226_615 128
128 3300050491 nmdc:mga00v17_664977_c1 nmdc:mga00v17_664977_c1_211_600 128
129 3300050491 nmdc:mga00v17_81881_c1 nmdc:mga00v17_81881_c1_513_902 128
130 3300050492 nmdc:mga0yw44_1056256_c1 nmdc:mga0yw44_1056256_c1_43_429 128
131 3300050492 nmdc:mga0yw44_154446_c1 nmdc:mga0yw44_154446_c1_250_639 128
132 3300050493 nmdc:mga0k408_488216_c1 nmdc:mga0k408_488216_c1_327_713 128
133 3300050494 nmdc:mga06z11_560913_c1 nmdc:mga06z11_560913_c1_121_510 128
134 3300050495 nmdc:mga04h51_18824_c1 nmdc:mga04h51_18824_c1_425_814 128
135 3300050495 nmdc:mga04h51_541447_c1 nmdc:mga04h51_541447_c1_35_430 128
136 3300050508 nmdc:mga09592_1104039_c1 nmdc:mga09592_1104039_c1_14_400 128
137 3300050514 nmdc:mga08x19_665700_c1 nmdc:mga08x19_665700_c1_320_706 128
138 3300050515 nmdc:mga0a205_74728_c1 nmdc:mga0a205_74728_c1_2831_3217 128
139 3300053096 Ga0500641_0027247 Ga0500641_0027247_1628_2014 128
140 3300053118 Ga0500594_0247679 Ga0500594_0247679_128_514 128
141 3300053119 Ga0500595_176295 Ga0500595_176295_168_554 128
142 3300053134 Ga0500658_0106983 Ga0500658_0106983_54_440 128
143 3300053139 Ga0500568_0039755 Ga0500568_0039755_713_1102 128
144 3300053151 Ga0500604_0004893 Ga0500604_0004893_2197_2583 128
145 3300053151 Ga0500604_0179025 Ga0500604_0179025_159_545 128
146 3300053158 Ga0500627_0400621 Ga0500627_0400621_14_400 128
147 3300053727 Ga0500611_250155 Ga0500611_250155_113_499 128
148 3300053730 Ga0500645_090779 Ga0500645_090779_120_506 128
149 3300053730 Ga0500645_134516 Ga0500645_134516_185_571 128
150 3300060353 Ga0501082_0417931 Ga0501082_0417931_33_422 128
151 3300060353 Ga0501082_0809537 Ga0501082_0809537_397_783 128
152 3300005341 Ga0070691_10757076 Ga0070691_107570761 129
153 3300005435 Ga0070714_100492879 Ga0070714_1004928791 129
154 3300005437 Ga0070710_10017107 Ga0070710_100171073 129
155 3300005535 Ga0070684_100017046 Ga0070684_1000170465 129
156 3300005577 Ga0068857_100180576 Ga0068857_1001805763 129
157 3300006846 Ga0075430_100021122 Ga0075430_1000211224 129
158 3300006847 Ga0075431_100062842 Ga0075431_1000628423 129
159 3300006880 Ga0075429_100034464 Ga0075429_1000344645 129
160 3300006914 Ga0075436_100021805 Ga0075436_1000218053 129
161 3300009174 Ga0105241_10915252 Ga0105241_109152522 129
162 3300025915 Ga0207693_10003501 Ga0207693_100035016 129
163 3300025928 Ga0207700_10450284 Ga0207700_104502841 129
164 3300035111 Ga0373923_0112894 Ga0373923_0112894_53_442 129
165 3300035113 Ga0373936_0207994 Ga0373936_0207994_19_408 129
166 3300046475 Ga0495639_0761680 Ga0495639_0761680_12_401 129
167 3300046664 Ga0495659_0107774 Ga0495659_0107774_350_739 129
168 3300046679 Ga0495623_0121833 Ga0495623_0121833_1158_1547 129
169 3300047471 Ga0495684_1048057 Ga0495684_1048057_105_494 129
170 3300049570 Ga0501033_0031833 Ga0501033_0031833_3502_3891 129
171 3300049571 Ga0501034_0168565 Ga0501034_0168565_1530_1919 129
172 3300049578 Ga0501042_1406841 Ga0501042_1406841_32_424 129
173 3300049589 Ga0501073_0604053 Ga0501073_0604053_133_525 129
174 3300049822 Ga0501035_0070905 Ga0501035_0070905_1701_2090 129
175 3300050492 nmdc:mga0yw44_628924_c1 nmdc:mga0yw44_628924_c1_53_445 129
176 3300005435 Ga0070714_100365326 Ga0070714_1003653261 130
177 3300005618 Ga0068864_101105874 Ga0068864_1011058742 130
178 3300005937 Ga0081455_10012018 Ga0081455_100120181 130
179 3300005981 Ga0081538_10003958 Ga0081538_1000395819 130
180 3300006237 Ga0097621_100068929 Ga0097621_1000689292 130
181 3300009098 Ga0105245_10082538 Ga0105245_100825383 130
182 3300009176 Ga0105242_10462970 Ga0105242_104629702 130
183 3300009177 Ga0105248_11366087 Ga0105248_113660872 130
184 3300013297 Ga0157378_10066349 Ga0157378_100663495 130
185 3300025924 Ga0207694_10204774 Ga0207694_102047743 130
186 3300025934 Ga0207686_10496843 Ga0207686_104968431 130
187 3300025935 Ga0207709_10330515 Ga0207709_103305152 130
188 3300025941 Ga0207711_10820675 Ga0207711_108206752 130
189 3300026023 Ga0207677_10179922 Ga0207677_101799222 130
190 3300026095 Ga0207676_10460897 Ga0207676_104608972 130
191 3300039437 Ga0436365_0836696 Ga0436365_0836696_1418_1867 130
192 3300046491 Ga0495584_0005333 Ga0495584_0005333_3899_4294 130
193 3300046528 Ga0495642_0186707 Ga0495642_0186707_341_736 130
194 3300046615 Ga0495656_0472811 Ga0495656_0472811_229_624 130
195 3300046691 Ga0495670_0636642 Ga0495670_0636642_169_564 130
196 3300047320 Ga0495672_0042429 Ga0495672_0042429_805_1254 130
197 3300009093 Ga0105240_10045477 Ga0105240_100454775 131
198 3300009148 Ga0105243_10047915 Ga0105243_100479154 131
199 3300037068 Ga0373925_0536649 Ga0373925_0536649_547_942 131
200 3300039447 Ga0436361_0522581 Ga0436361_0522581_133_588 131
201 3300046461 Ga0495641_0487281 Ga0495641_0487281_133_528 131
202 3300046557 Ga0495622_0384509 Ga0495622_0384509_168_563 131
203 3300048904 Ga0496101_0266228 Ga0496101_0266228_884_1279 131
204 3300048910 Ga0496107_1382920 Ga0496107_1382920_60_455 131
205 3300049587 Ga0501071_0410719 Ga0501071_0410719_613_1008 131
206 3300005330 Ga0070690_100269436 Ga0070690_1002694362 132
207 3300020070 Ga0206356_11642503 Ga0206356_116425032 132
208 3300005436 Ga0070713_100734662 Ga0070713_1007346622 133
209 3300005536 Ga0070697_100092168 Ga0070697_1000921683 133
210 3300006173 Ga0070716_101220318 Ga0070716_1012203182 133
211 3300006175 Ga0070712_100082689 Ga0070712_1000826892 133
212 3300009553 Ga0105249_10804321 Ga0105249_108043212 133
213 3300013308 Ga0157375_10288137 Ga0157375_102881372 133
214 3300025915 Ga0207693_10018439 Ga0207693_100184395 133
215 3300025928 Ga0207700_10473147 Ga0207700_104731472 133
216 3300025939 Ga0207665_10067225 Ga0207665_100672252 133
217 3300031548 Ga0307408_100485988 Ga0307408_1004859882 133
218 3300032002 Ga0307416_101211836 Ga0307416_1012118362 133
219 3300035113 Ga0373936_0076147 Ga0373936_0076147_601_1047 133
220 3300035398 Ga0316574_0113599 Ga0316574_0113599_1278_1727 133
221 3300035691 Ga0373931_0222375 Ga0373931_0222375_550_996 133
222 3300035695 Ga0373927_0009305 Ga0373927_0009305_1512_1958 133
223 3300035695 Ga0373927_0016144 Ga0373927_0016144_1300_1755 133
224 3300035725 Ga0373947_0014310 Ga0373947_0014310_3719_4165 133
225 3300037068 Ga0373925_0018621 Ga0373925_0018621_836_1291 133
226 3300039438 Ga0436360_0951710 Ga0436360_0951710_31_477 133
227 3300046475 Ga0495639_0027403 Ga0495639_0027403_1896_2342 133
228 3300046531 Ga0495665_0271544 Ga0495665_0271544_154_600 133
229 3300046681 Ga0495647_0372743 Ga0495647_0372743_94_540 133
230 3300046690 Ga0495624_0260400 Ga0495624_0260400_385_831 133
231 3300047315 Ga0495581_0434645 Ga0495581_0434645_304_750 133
232 3300048907 Ga0496104_0026734 Ga0496104_0026734_3806_4252 133
233 3300048911 Ga0496108_0039628 Ga0496108_0039628_1354_1800 133
234 3300048912 Ga0496109_0355701 Ga0496109_0355701_310_756 133
235 3300048913 Ga0496110_0031106 Ga0496110_0031106_2475_2921 133
236 3300048915 Ga0496112_0025634 Ga0496112_0025634_1480_1926 133
237 3300048917 Ga0496114_0095025 Ga0496114_0095025_1524_1976 133
238 3300048918 Ga0496115_0056163 Ga0496115_0056163_2252_2698 133
239 3300048918 Ga0496115_0272668 Ga0496115_0272668_934_1380 133
240 3300048928 Ga0496125_0288165 Ga0496125_0288165_265_717 133
241 3300004800 Ga0058861_11589086 Ga0058861_115890861 134
242 3300004803 Ga0058862_12542395 Ga0058862_125423951 134
243 3300005327 Ga0070658_10412650 Ga0070658_104126502 134
244 3300005329 Ga0070683_100014532 Ga0070683_1000145322 134
245 3300005336 Ga0070680_100006843 Ga0070680_1000068435 134
246 3300005336 Ga0070680_100351118 Ga0070680_1003511182 134
247 3300005339 Ga0070660_100006936 Ga0070660_1000069366 134
248 3300005341 Ga0070691_10070836 Ga0070691_100708362 134
249 3300005344 Ga0070661_100018330 Ga0070661_1000183304 134
250 3300005366 Ga0070659_100560824 Ga0070659_1005608242 134
251 3300005458 Ga0070681_10736001 Ga0070681_107360011 134
252 3300005518 Ga0070699_102057348 Ga0070699_1020573481 134
253 3300005530 Ga0070679_100641978 Ga0070679_1006419782 134
254 3300005535 Ga0070684_100046120 Ga0070684_1000461204 134
255 3300005535 Ga0070684_102052240 Ga0070684_1020522401 134
256 3300005539 Ga0068853_100003590 Ga0068853_1000035907 134
257 3300005547 Ga0070693_100298577 Ga0070693_1002985772 134
258 3300005563 Ga0068855_100082324 Ga0068855_1000823243 134
259 3300005577 Ga0068857_100038997 Ga0068857_1000389974 134
260 3300005834 Ga0068851_10004640 Ga0068851_100046402 134
261 3300006038 Ga0075365_10351861 Ga0075365_103518612 134
262 3300006042 Ga0075368_10023477 Ga0075368_100234772 134
263 3300006051 Ga0075364_10426291 Ga0075364_104262912 134
264 3300006178 Ga0075367_10058258 Ga0075367_100582582 134
265 3300006186 Ga0075369_10174157 Ga0075369_101741572 134
266 3300006353 Ga0075370_10124637 Ga0075370_101246372 134
267 3300009093 Ga0105240_10068289 Ga0105240_100682893 134
268 3300009545 Ga0105237_10079148 Ga0105237_100791483 134
269 3300009551 Ga0105238_10001743 Ga0105238_100017439 134
270 3300010375 Ga0105239_10061745 Ga0105239_100617454 134
271 3300013104 Ga0157370_10102165 Ga0157370_101021652 134
272 3300013105 Ga0157369_10020019 Ga0157369_100200197 134
273 3300025321 Ga0207656_10002183 Ga0207656_100021834 134
274 3300025909 Ga0207705_10158784 Ga0207705_101587843 134
275 3300025912 Ga0207707_10001016 Ga0207707_1000101623 134
276 3300025912 Ga0207707_10607021 Ga0207707_106070212 134
277 3300025913 Ga0207695_10029400 Ga0207695_100294004 134
278 3300025914 Ga0207671_10194054 Ga0207671_101940542 134
279 3300025917 Ga0207660_10000924 Ga0207660_1000092424 134
280 3300025917 Ga0207660_10442431 Ga0207660_104424312 134
281 3300025919 Ga0207657_10001391 Ga0207657_1000139115 134
282 3300025920 Ga0207649_10717590 Ga0207649_107175902 134
283 3300025921 Ga0207652_10003893 Ga0207652_100038934 134
284 3300025924 Ga0207694_10030192 Ga0207694_100301926 134
285 3300025944 Ga0207661_10019804 Ga0207661_100198044 134
286 3300025949 Ga0207667_10011614 Ga0207667_100116145 134
287 3300025949 Ga0207667_11029698 Ga0207667_110296981 134
288 3300026067 Ga0207678_10232535 Ga0207678_102325351 134
289 3300026116 Ga0207674_10012767 Ga0207674_100127674 134
290 3300027866 Ga0209813_10174546 Ga0209813_101745462 134
291 3300031235 Ga0265330_10045414 Ga0265330_100454141 134
292 3300031238 Ga0265332_10045165 Ga0265332_100451652 134
293 3300031239 Ga0265328_10034110 Ga0265328_100341102 134
294 3300031249 Ga0265339_10038136 Ga0265339_100381362 134
295 3300031249 Ga0265339_10099121 Ga0265339_100991212 134
296 3300031250 Ga0265331_10057909 Ga0265331_100579092 134
297 3300031344 Ga0265316_10252421 Ga0265316_102524212 134
298 3300031712 Ga0265342_10069781 Ga0265342_100697813 134
299 3300037312 Ga0395899_0059463 Ga0395899_0059463_631_1083 134
300 3300037418 Ga0395900_0045483 Ga0395900_0045483_1637_2089 134
301 3300037466 Ga0395898_0136648 Ga0395898_0136648_211_663 134
302 3300038443 Ga0395901_0084156 Ga0395901_0084156_1581_2033 134
303 3300039450 Ga0436363_1431185 Ga0436363_1431185_100_519 134
304 3300049568 Ga0501031_1004348 Ga0501031_1004348_54_500 134
305 3300049574 Ga0501038_0752021 Ga0501038_0752021_258_704 134
306 3300049575 Ga0501039_0037169 Ga0501039_0037169_2962_3408 134
307 3300049576 Ga0501040_0051341 Ga0501040_0051341_808_1254 134
308 3300049577 Ga0501041_0120569 Ga0501041_0120569_345_791 134
309 3300049582 Ga0501048_0611805 Ga0501048_0611805_326_772 134
310 3300049584 Ga0501068_0772686 Ga0501068_0772686_123_569 134
311 3300049586 Ga0501070_0871436 Ga0501070_0871436_227_676 134
312 3300049587 Ga0501071_0036817 Ga0501071_0036817_2981_3427 134
313 3300049588 Ga0501072_0008706 Ga0501072_0008706_4085_4531 134
314 3300049590 Ga0501074_0915360 Ga0501074_0915360_51_497 134
315 3300049591 Ga0501075_0155622 Ga0501075_0155622_270_716 134
316 3300049592 Ga0501076_0030930 Ga0501076_0030930_2950_3396 134
317 3300049741 Ga0501079_0054438 Ga0501079_0054438_2419_2865 134
318 3300049743 Ga0501081_0792516 Ga0501081_0792516_182_628 134
319 3300049744 Ga0501083_0323460 Ga0501083_0323460_255_701 134
320 3300050491 nmdc:mga00v17_78511_c1 nmdc:mga00v17_78511_c1_190_642 134
321 3300050494 nmdc:mga06z11_309410_c1 nmdc:mga06z11_309410_c1_313_765 134
322 3300050495 nmdc:mga04h51_38427_c1 nmdc:mga04h51_38427_c1_228_680 134
323 3300050496 nmdc:mga07m45_455252_c1 nmdc:mga07m45_455252_c1_142_594 134
324 3300054114 Ga0501084_0029044 Ga0501084_0029044_3646_4092 134
325 3300061734 Ga0530510_0195094 Ga0530510_0195094_1007_1453 134
326 3300005338 Ga0068868_100363272 Ga0068868_1003632722 135
327 3300005339 Ga0070660_100077818 Ga0070660_1000778182 135
328 3300005366 Ga0070659_100074244 Ga0070659_1000742443 135
329 3300005435 Ga0070714_100876822 Ga0070714_1008768222 135
330 3300005436 Ga0070713_100005990 Ga0070713_1000059907 135
331 3300005437 Ga0070710_10544524 Ga0070710_105445241 135
332 3300005471 Ga0070698_101049494 Ga0070698_1010494942 135
333 3300005530 Ga0070679_100280115 Ga0070679_1002801152 135
334 3300005536 Ga0070697_100032418 Ga0070697_1000324184 135
335 3300005577 Ga0068857_101302814 Ga0068857_1013028142 135
336 3300005614 Ga0068856_100046274 Ga0068856_1000462743 135
337 3300005616 Ga0068852_100029658 Ga0068852_1000296584 135
338 3300005834 Ga0068851_10490030 Ga0068851_104900302 135
339 3300006028 Ga0070717_10000460 Ga0070717_100004604 135
340 3300006028 Ga0070717_10021150 Ga0070717_100211503 135
341 3300006028 Ga0070717_10851519 Ga0070717_108515192 135
342 3300009551 Ga0105238_10650801 Ga0105238_106508011 135
343 3300021361 Ga0213872_10092003 Ga0213872_100920032 135
344 3300021441 Ga0213871_10030021 Ga0213871_100300212 135
345 3300025321 Ga0207656_10343898 Ga0207656_103438981 135
346 3300025915 Ga0207693_11024805 Ga0207693_110248051 135
347 3300025919 Ga0207657_10213743 Ga0207657_102137432 135
348 3300025921 Ga0207652_10368073 Ga0207652_103680732 135
349 3300025924 Ga0207694_10486977 Ga0207694_104869771 135
350 3300025928 Ga0207700_10009021 Ga0207700_100090213 135
351 3300025929 Ga0207664_10223419 Ga0207664_102234192 135
352 3300025932 Ga0207690_10034073 Ga0207690_100340734 135
353 3300025949 Ga0207667_10214775 Ga0207667_102147752 135
354 3300026078 Ga0207702_10106009 Ga0207702_101060092 135
355 3300026116 Ga0207674_10741390 Ga0207674_107413902 135
356 3300026142 Ga0207698_10007647 Ga0207698_100076475 135
357 3300028573 Ga0265334_10149218 Ga0265334_101492181 135
358 3300031235 Ga0265330_10383082 Ga0265330_103830821 135
359 3300031247 Ga0265340_10006734 Ga0265340_100067343 135
360 3300035086 Ga0373934_0002725 Ga0373934_0002725_5442_5888 135
361 3300035111 Ga0373923_0086452 Ga0373923_0086452_116_562 135
362 3300035117 Ga0373953_0000985 Ga0373953_0000985_975_1421 135
363 3300035118 Ga0373954_0001160 Ga0373954_0001160_9435_9881 135
364 3300035119 Ga0373956_0001463 Ga0373956_0001463_7006_7452 135
365 3300035120 Ga0373957_0000218 Ga0373957_0000218_1198_1644 135
366 3300035172 Ga0373955_0001372 Ga0373955_0001372_7130_7576 135
367 3300035692 Ga0373935_0233523 Ga0373935_0233523_265_711 135
368 3300035724 Ga0373933_0006390 Ga0373933_0006390_2301_2747 135
369 3300036401 Ga0373937_0011496 Ga0373937_0011496_5217_5663 135
370 3300037312 Ga0395899_0090431 Ga0395899_0090431_1277_1729 135
371 3300037418 Ga0395900_0367664 Ga0395900_0367664_636_1088 135
372 3300037466 Ga0395898_0062553 Ga0395898_0062553_2414_2866 135
373 3300038443 Ga0395901_0598883 Ga0395901_0598883_554_1006 135
374 3300039450 Ga0436363_0593788 Ga0436363_0593788_69_515 135
375 3300039453 Ga0436362_0275053 Ga0436362_0275053_240_686 135
376 3300044842 Ga0466957_0478883 Ga0466957_0478883_216_662 135
377 3300045836 Ga0466958_0752425 Ga0466958_0752425_48_494 135
378 3300045976 Ga0466967_0139863 Ga0466967_0139863_1173_1619 135
379 3300046459 Ga0495629_0000750 Ga0495629_0000750_16459_16905 135
380 3300046462 Ga0495651_0019393 Ga0495651_0019393_3132_3578 135
381 3300046463 Ga0495653_0065888 Ga0495653_0065888_1566_2012 135
382 3300046477 Ga0495664_0192319 Ga0495664_0192319_377_823 135
383 3300046511 Ga0495608_0000738 Ga0495608_0000738_19200_19646 135
384 3300046514 Ga0495618_0052750 Ga0495618_0052750_1667_2113 135
385 3300046524 Ga0495648_0001119 Ga0495648_0001119_14156_14602 135
386 3300046529 Ga0495652_0004125 Ga0495652_0004125_4019_4465 135
387 3300046533 Ga0495640_0473442 Ga0495640_0473442_233_679 135
388 3300046536 Ga0495587_0012212 Ga0495587_0012212_3107_3553 135
389 3300046543 Ga0495645_0009298 Ga0495645_0009298_1393_1839 135
390 3300046559 Ga0495667_0013804 Ga0495667_0013804_2236_2682 135
391 3300046642 Ga0495634_0015272 Ga0495634_0015272_1171_1617 135
392 3300046663 Ga0495635_0000166 Ga0495635_0000166_3132_3578 135
393 3300046675 Ga0495657_0004131 Ga0495657_0004131_9484_9930 135
394 3300046678 Ga0495599_0005025 Ga0495599_0005025_3752_4198 135
395 3300046679 Ga0495623_0002267 Ga0495623_0002267_9096_9542 135
396 3300046680 Ga0495646_0060601 Ga0495646_0060601_245_691 135
397 3300046689 Ga0495613_0091635 Ga0495613_0091635_314_760 135
398 3300046809 Ga0495600_0008000 Ga0495600_0008000_3132_3578 135
399 3300047317 Ga0495604_0004924 Ga0495604_0004924_9557_10003 135
400 3300047322 Ga0495680_0004903 Ga0495680_0004903_10121_10567 135
401 3300047444 Ga0495675_0011953 Ga0495675_0011953_2902_3348 135
402 3300047471 Ga0495684_0000501 Ga0495684_0000501_30262_30708 135
403 3300047673 Ga0495593_0038207 Ga0495593_0038207_98_544 135
404 3300048088 Ga0495602_0030627 Ga0495602_0030627_3590_4036 135
405 3300048904 Ga0496101_0189731 Ga0496101_0189731_943_1389 135
406 3300048913 Ga0496110_0197035 Ga0496110_0197035_1194_1643 135
407 3300048914 Ga0496111_0576726 Ga0496111_0576726_175_624 135
408 3300048915 Ga0496112_0134110 Ga0496112_0134110_60_509 135
409 3300048915 Ga0496112_0187244 Ga0496112_0187244_428_874 135
410 3300049568 Ga0501031_0131210 Ga0501031_0131210_794_1246 135
411 3300049569 Ga0501032_0689941 Ga0501032_0689941_106_558 135
412 3300049570 Ga0501033_0178204 Ga0501033_0178204_53_505 135
413 3300049570 Ga0501033_0391415 Ga0501033_0391415_191_640 135
414 3300049571 Ga0501034_1033748 Ga0501034_1033748_132_584 135
415 3300049572 Ga0501036_0090776 Ga0501036_0090776_344_793 135
416 3300049572 Ga0501036_0282044 Ga0501036_0282044_649_1101 135
417 3300049573 Ga0501037_0226077 Ga0501037_0226077_790_1239 135
418 3300049574 Ga0501038_0069444 Ga0501038_0069444_2400_2852 135
419 3300049574 Ga0501038_0254502 Ga0501038_0254502_863_1312 135
420 3300049574 Ga0501038_0451610 Ga0501038_0451610_253_708 135
421 3300049575 Ga0501039_0496825 Ga0501039_0496825_412_867 135
422 3300049579 Ga0501043_0140224 Ga0501043_0140224_35_487 135
423 3300049579 Ga0501043_0391113 Ga0501043_0391113_530_982 135
424 3300049580 Ga0501046_0023298 Ga0501046_0023298_2350_2802 135
425 3300049580 Ga0501046_0118322 Ga0501046_0118322_705_1154 135
426 3300049580 Ga0501046_0290551 Ga0501046_0290551_441_896 135
427 3300049581 Ga0501047_0783680 Ga0501047_0783680_107_559 135
428 3300049582 Ga0501048_0089882 Ga0501048_0089882_787_1242 135
429 3300049582 Ga0501048_0173509 Ga0501048_0173509_251_703 135
430 3300049592 Ga0501076_0090046 Ga0501076_0090046_1085_1540 135
431 3300049744 Ga0501083_0286337 Ga0501083_0286337_459_914 135
432 3300049744 Ga0501083_0333314 Ga0501083_0333314_17_469 135
433 3300049744 Ga0501083_0592107 Ga0501083_0592107_36_485 135
434 3300049822 Ga0501035_0071348 Ga0501035_0071348_863_1312 135
435 3300049823 Ga0501044_0148056 Ga0501044_0148056_1532_1984 135
436 3300049823 Ga0501044_0430567 Ga0501044_0430567_105_554 135
437 3300049824 Ga0501045_0614349 Ga0501045_0614349_196_651 135
438 3300053077 Ga0495601_0084826 Ga0495601_0084826_1096_1542 135
439 3300053083 Ga0495655_0112885 Ga0495655_0112885_109_555 135
440 3300053084 Ga0495595_0000332 Ga0495595_0000332_10044_10490 135
441 3300053085 Ga0495619_0000633 Ga0495619_0000633_10178_10624 135
442 3300054114 Ga0501084_0291374 Ga0501084_0291374_291_746 135
443 3300061734 Ga0530510_0472249 Ga0530510_0472249_217_672 135
444 3300005327 Ga0070658_10197255 Ga0070658_101972552 136
445 3300005329 Ga0070683_100098540 Ga0070683_1000985403 136
446 3300005344 Ga0070661_100441998 Ga0070661_1004419982 136
447 3300005436 Ga0070713_100766252 Ga0070713_1007662522 136
448 3300005456 Ga0070678_101172005 Ga0070678_1011720051 136
449 3300005458 Ga0070681_11031730 Ga0070681_110317302 136
450 3300005548 Ga0070665_101021822 Ga0070665_1010218222 136
451 3300006051 Ga0075364_10476805 Ga0075364_104768052 136
452 3300009098 Ga0105245_10318274 Ga0105245_103182742 136
453 3300009545 Ga0105237_10080105 Ga0105237_100801053 136
454 3300009551 Ga0105238_10023170 Ga0105238_100231705 136
455 3300014968 Ga0157379_10539004 Ga0157379_105390042 136
456 3300014968 Ga0157379_11327826 Ga0157379_113278261 136
457 3300025914 Ga0207671_10068162 Ga0207671_100681623 136
458 3300025920 Ga0207649_10382057 Ga0207649_103820572 136
459 3300025924 Ga0207694_10051493 Ga0207694_100514933 136
460 3300025944 Ga0207661_10095096 Ga0207661_100950962 136
461 3300026041 Ga0207639_10525103 Ga0207639_105251032 136
462 3300026121 Ga0207683_10279764 Ga0207683_102797642 136
463 3300028379 Ga0268266_10812243 Ga0268266_108122432 136
464 3300031911 Ga0307412_11588933 Ga0307412_115889331 136
465 3300031995 Ga0307409_101538231 Ga0307409_1015382312 136
466 3300037853 Ga0436364_1319910 Ga0436364_1319910_68_517 136
467 3300039437 Ga0436365_0022723 Ga0436365_0022723_26_475 136
468 3300046512 Ga0495610_0064806 Ga0495610_0064806_330_776 136
469 3300048910 Ga0496107_0323197 Ga0496107_0323197_663_1115 136
470 3300048924 Ga0496121_0003837 Ga0496121_0003837_14183_14635 136
471 3300048929 Ga0496126_0016054 Ga0496126_0016054_43_495 136
472 3300048929 Ga0496126_0077662 Ga0496126_0077662_70_522 136
473 3300049573 Ga0501037_0703138 Ga0501037_0703138_197_646 136
474 3300049823 Ga0501044_0185986 Ga0501044_0185986_248_697 136
475 3300050491 nmdc:mga00v17_189638_c1 nmdc:mga00v17_189638_c1_83_538 136
476 3300050494 nmdc:mga06z11_145251_c1 nmdc:mga06z11_145251_c1_821_1273 136
477 3300053153 Ga0500616_0000046 Ga0500616_0000046_289208_289660 136
478 3300005434 Ga0070709_10001487 Ga0070709_100014878 137
479 3300005434 Ga0070709_10316726 Ga0070709_103167261 137
480 3300005435 Ga0070714_100106273 Ga0070714_1001062733 137
481 3300005436 Ga0070713_100967016 Ga0070713_1009670161 137
482 3300005437 Ga0070710_10013213 Ga0070710_100132132 137
483 3300006163 Ga0070715_10864970 Ga0070715_108649701 137
484 3300006175 Ga0070712_100020843 Ga0070712_1000208433 137
485 3300009174 Ga0105241_11739991 Ga0105241_117399911 137
486 3300013308 Ga0157375_12572015 Ga0157375_125720151 137
487 3300025898 Ga0207692_10033255 Ga0207692_100332553 137
488 3300025905 Ga0207685_10603039 Ga0207685_106030391 137
489 3300025906 Ga0207699_10018834 Ga0207699_100188343 137
490 3300025915 Ga0207693_10017747 Ga0207693_100177477 137
491 3300025915 Ga0207693_10126387 Ga0207693_101263872 137
492 3300031616 Ga0307508_10621139 Ga0307508_106211391 137
493 3300035117 Ga0373953_0228697 Ga0373953_0228697_127_570 137
494 3300039450 Ga0436363_0541440 Ga0436363_0541440_315_758 137
495 3300046454 Ga0495592_0001238 Ga0495592_0001238_10495_10938 137
496 3300048929 Ga0496126_0024497 Ga0496126_0024497_2122_2568 137
497 3300038443 Ga0395901_0320768 Ga0395901_0320768_817_1269 138
498 3300039447 Ga0436361_1095086 Ga0436361_1095086_138_584 138
499 3300049577 Ga0501041_0053777 Ga0501041_0053777_817_1254 138
500 3300049588 Ga0501072_0054986 Ga0501072_0054986_1490_1927 138
501 3300049591 Ga0501075_0009692 Ga0501075_0009692_3646_4083 138
502 3300049592 Ga0501076_0094739 Ga0501076_0094739_553_990 138
503 3300049593 Ga0501077_0003724 Ga0501077_0003724_5439_5876 138
504 3300049593 Ga0501077_0310706 Ga0501077_0310706_46_483 138
505 3300049741 Ga0501079_0029927 Ga0501079_0029927_3400_3837 138
506 3300049742 Ga0501080_0108310 Ga0501080_0108310_1574_2011 138
507 3300049743 Ga0501081_0000399 Ga0501081_0000399_19591_20028 138
508 3300050514 nmdc:mga08x19_142527_c1 nmdc:mga08x19_142527_c1_811_1263 138
509 3300054114 Ga0501084_0004601 Ga0501084_0004601_1916_2353 138
510 3300060353 Ga0501082_0020730 Ga0501082_0020730_327_764 138
511 iso_pu_bacteria 8054563764 8054565533 138
512 3300006844 Ga0075428_101303602 Ga0075428_1013036022 139
513 3300009147 Ga0114129_10007369 Ga0114129_100073695 139
514 3300035112 Ga0373932_0049043 Ga0373932_0049043_421_867 139
515 3300039438 Ga0436360_1042695 Ga0436360_1042695_406_852 139
516 3300046460 Ga0495638_0392127 Ga0495638_0392127_174_614 139
517 3300046530 Ga0495654_0310866 Ga0495654_0310866_72_491 139
518 3300049589 Ga0501073_0614896 Ga0501073_0614896_133_573 139
519 3300049741 Ga0501079_0188076 Ga0501079_0188076_25_447 139
520 3300050507 nmdc:mga05p37_49906_c1 nmdc:mga05p37_49906_c1_1124_1573 139
521 3300053730 Ga0500645_042045 Ga0500645_042045_430_870 139
522 3300060353 Ga0501082_0407291 Ga0501082_0407291_486_926 139
523 3300005336 Ga0070680_100078641 Ga0070680_1000786412 140
524 3300009176 Ga0105242_10274182 Ga0105242_102741822 140
525 3300009551 Ga0105238_11680917 Ga0105238_116809172 140
526 3300011119 Ga0105246_11547349 Ga0105246_115473491 140
527 3300014326 Ga0157380_10257829 Ga0157380_102578292 140
528 3300021377 Ga0213874_10093988 Ga0213874_100939882 140
529 3300021384 Ga0213876_10212857 Ga0213876_102128572 140
530 3300021388 Ga0213875_10239028 Ga0213875_102390282 140
531 3300021441 Ga0213871_10086239 Ga0213871_100862392 140
532 3300025906 Ga0207699_10778243 Ga0207699_107782432 140
533 3300025917 Ga0207660_10127540 Ga0207660_101275402 140
534 3300025929 Ga0207664_10268542 Ga0207664_102685422 140
535 3300026078 Ga0207702_11353195 Ga0207702_113531952 140
536 3300031247 Ga0265340_10190490 Ga0265340_101904901 140
537 3300037312 Ga0395899_0517771 Ga0395899_0517771_166_621 140
538 3300037418 Ga0395900_0008627 Ga0395900_0008627_9532_9987 140
539 3300037418 Ga0395900_0620382 Ga0395900_0620382_260_715 140
540 3300037466 Ga0395898_0038196 Ga0395898_0038196_282_737 140
541 3300037466 Ga0395898_0716816 Ga0395898_0716816_171_626 140
542 3300038443 Ga0395901_0025837 Ga0395901_0025837_2492_2947 140
543 3300041408 Ga0439453_0000215 Ga0439453_0000215_4831_5253 140
544 3300042014 Ga0439457_076736 Ga0439457_076736_252_674 140
545 3300046539 Ga0495621_0027388 Ga0495621_0027388_751_1173 140
546 3300046615 Ga0495656_0037088 Ga0495656_0037088_1042_1464 140
547 3300047447 Ga0495685_038847 Ga0495685_038847_750_1172 140
548 3300048090 Ga0495615_0003308 Ga0495615_0003308_22_444 140
549 3300049571 Ga0501034_0755553 Ga0501034_0755553_122_574 140
550 3300050510 nmdc:mga06r32_560736_c1 nmdc:mga06r32_560736_c1_194_616 140
551 3300050511 nmdc:mga08y16_982432_c1 nmdc:mga08y16_982432_c1_317_739 140
552 3300060353 Ga0501082_0598449 Ga0501082_0598449_530_952 140
553 iso_pu_bacteria 2508501128 2509147825 140
554 iso_pu_bacteria 2513237141 2513893096 140
555 3300005347 Ga0070668_100199530 Ga0070668_1001995302 141
556 3300005406 Ga0070703_10166830 Ga0070703_101668302 141
557 3300005530 Ga0070679_100345067 Ga0070679_1003450672 141
558 3300005546 Ga0070696_100012152 Ga0070696_1000121523 141
559 3300005549 Ga0070704_100003084 Ga0070704_1000030846 141
560 3300005843 Ga0068860_100173192 Ga0068860_1001731922 141
561 3300006038 Ga0075365_10009005 Ga0075365_100090053 141
562 3300006042 Ga0075368_10001052 Ga0075368_100010525 141
563 3300006048 Ga0075363_100243192 Ga0075363_1002431921 141
564 3300006177 Ga0075362_10311256 Ga0075362_103112561 141
565 3300006178 Ga0075367_10263359 Ga0075367_102633592 141
566 3300006186 Ga0075369_10041086 Ga0075369_100410862 141
567 3300006237 Ga0097621_100169202 Ga0097621_1001692022 141
568 3300009553 Ga0105249_10001406 Ga0105249_1000140615 141
569 3300013105 Ga0157369_10155782 Ga0157369_101557822 141
570 3300013308 Ga0157375_11839416 Ga0157375_118394162 141
571 3300021384 Ga0213876_10012071 Ga0213876_100120712 141
572 3300025921 Ga0207652_11064175 Ga0207652_110641751 141
573 3300025961 Ga0207712_10001933 Ga0207712_1000193312 141
574 3300027866 Ga0209813_10024591 Ga0209813_100245912 141
575 3300031344 Ga0265316_10584584 Ga0265316_105845842 141
576 3300031995 Ga0307409_100642954 Ga0307409_1006429542 141
577 3300048918 Ga0496115_0359434 Ga0496115_0359434_489_944 141
578 3300050490 nmdc:mga03n38_273783_c1 nmdc:mga03n38_273783_c1_401_853 141
579 3300050492 nmdc:mga0yw44_146322_c1 nmdc:mga0yw44_146322_c1_274_726 141
580 3300050494 nmdc:mga06z11_374561_c1 nmdc:mga06z11_374561_c1_235_687 141
581 3300050495 nmdc:mga04h51_10834_c1 nmdc:mga04h51_10834_c1_1251_1703 141
582 3300053096 Ga0500641_0066882 Ga0500641_0066882_373_822 141
583 iso_pu_bacteria 2643221651 2644289906 141
584 iso_pu_bacteria 2828305725 2828306507 141
585 3300005336 Ga0070680_100002731 Ga0070680_1000027314 142
586 3300005337 Ga0070682_100001034 Ga0070682_1000010345 142
587 3300005339 Ga0070660_100080384 Ga0070660_1000803843 142
588 3300005366 Ga0070659_101346712 Ga0070659_1013467121 142
589 3300005434 Ga0070709_11293987 Ga0070709_112939872 142
590 3300005434 Ga0070709_11605273 Ga0070709_116052731 142
591 3300005436 Ga0070713_100882675 Ga0070713_1008826752 142
592 3300005458 Ga0070681_10172967 Ga0070681_101729673 142
593 3300005458 Ga0070681_11580867 Ga0070681_115808671 142
594 3300005530 Ga0070679_100088267 Ga0070679_1000882673 142
595 3300005536 Ga0070697_100006940 Ga0070697_1000069403 142
596 3300005536 Ga0070697_101247762 Ga0070697_1012477622 142
597 3300005545 Ga0070695_100004835 Ga0070695_1000048358 142
598 3300005547 Ga0070693_100025771 Ga0070693_1000257712 142
599 3300005563 Ga0068855_100083641 Ga0068855_1000836413 142
600 3300005578 Ga0068854_100190455 Ga0068854_1001904552 142
601 3300006173 Ga0070716_100350452 Ga0070716_1003504522 142
602 3300006178 Ga0075367_10068937 Ga0075367_100689373 142
603 3300006914 Ga0075436_100000870 Ga0075436_10000087021 142
604 3300009093 Ga0105240_11112013 Ga0105240_111120132 142
605 3300009174 Ga0105241_10027353 Ga0105241_100273533 142
606 3300010375 Ga0105239_10083859 Ga0105239_100838594 142
607 3300012507 Ga0157342_1050052 Ga0157342_10500521 142
608 3300013104 Ga0157370_10029223 Ga0157370_100292233 142
609 3300013307 Ga0157372_10051812 Ga0157372_100518123 142
610 3300025906 Ga0207699_11088916 Ga0207699_110889161 142
611 3300025911 Ga0207654_10029708 Ga0207654_100297082 142
612 3300025912 Ga0207707_10036666 Ga0207707_100366663 142
613 3300025915 Ga0207693_10011990 Ga0207693_100119907 142
614 3300025919 Ga0207657_10133728 Ga0207657_101337282 142
615 3300025932 Ga0207690_10171924 Ga0207690_101719241 142
616 3300025939 Ga0207665_10356663 Ga0207665_103566632 142
617 3300025981 Ga0207640_10162782 Ga0207640_101627822 142
618 3300026041 Ga0207639_10150270 Ga0207639_101502702 142
619 3300026067 Ga0207678_11290399 Ga0207678_112903991 142
620 3300027866 Ga0209813_10162557 Ga0209813_101625572 142
621 3300037853 Ga0436364_0246985 Ga0436364_0246985_152_595 142
622 3300039437 Ga0436365_1130471 Ga0436365_1130471_343_783 142
623 3300039438 Ga0436360_0912793 Ga0436360_0912793_440_880 142
624 3300039447 Ga0436361_0590313 Ga0436361_0590313_62_508 142
625 3300039447 Ga0436361_1063193 Ga0436361_1063193_154_594 142
626 3300039450 Ga0436363_0743008 Ga0436363_0743008_310_750 142
627 3300046536 Ga0495587_0244609 Ga0495587_0244609_85_525 142
628 3300046642 Ga0495634_0699367 Ga0495634_0699367_100_540 142
629 3300046809 Ga0495600_0105241 Ga0495600_0105241_495_935 142
630 3300048903 Ga0496100_1020902 Ga0496100_1020902_51_491 142
631 3300048904 Ga0496101_0053754 Ga0496101_0053754_2349_2789 142
632 3300048905 Ga0496102_0113767 Ga0496102_0113767_50_490 142
633 3300048907 Ga0496104_0200703 Ga0496104_0200703_958_1398 142
634 3300048912 Ga0496109_0060061 Ga0496109_0060061_1263_1703 142
635 3300048913 Ga0496110_0242488 Ga0496110_0242488_80_520 142
636 3300048917 Ga0496114_0366292 Ga0496114_0366292_336_776 142
637 3300048918 Ga0496115_0432035 Ga0496115_0432035_593_1033 142
638 3300049571 Ga0501034_0011107 Ga0501034_0011107_6569_7027 142
639 3300049572 Ga0501036_0087504 Ga0501036_0087504_1402_1860 142
640 3300049573 Ga0501037_0058381 Ga0501037_0058381_416_874 142
641 3300049574 Ga0501038_0021702 Ga0501038_0021702_1639_2097 142
642 3300049575 Ga0501039_0054212 Ga0501039_0054212_233_691 142
643 3300049579 Ga0501043_0106418 Ga0501043_0106418_1353_1811 142
644 3300049580 Ga0501046_0174509 Ga0501046_0174509_649_1107 142
645 3300049584 Ga0501068_0026554 Ga0501068_0026554_2443_2901 142
646 3300049589 Ga0501073_0010951 Ga0501073_0010951_5701_6159 142
647 3300049742 Ga0501080_0194490 Ga0501080_0194490_255_713 142
648 3300049823 Ga0501044_0011587 Ga0501044_0011587_7324_7782 142
649 3300050494 nmdc:mga06z11_22993_c1 nmdc:mga06z11_22993_c1_1086_1535 142
650 3300050495 nmdc:mga04h51_70754_c1 nmdc:mga04h51_70754_c1_123_572 142
651 3300050514 nmdc:mga08x19_6_c1 nmdc:mga08x19_6_c1_202857_203306 142
652 3300053077 Ga0495601_0127783 Ga0495601_0127783_231_671 142
653 3300053078 Ga0495612_0187205 Ga0495612_0187205_141_581 142
654 3300053085 Ga0495619_0302138 Ga0495619_0302138_292_732 142
655 3300060353 Ga0501082_0206951 Ga0501082_0206951_275_733 142
656 3300005434 Ga0070709_10698987 Ga0070709_106989872 143
657 3300005435 Ga0070714_100165528 Ga0070714_1001655283 143
658 3300005441 Ga0070700_101150136 Ga0070700_1011501361 143
659 3300005458 Ga0070681_10348845 Ga0070681_103488452 143
660 3300005539 Ga0068853_101498975 Ga0068853_1014989752 143
661 3300005985 Ga0081539_10000798 Ga0081539_1000079817 143
662 3300006038 Ga0075365_10166267 Ga0075365_101662672 143
663 3300006177 Ga0075362_10297929 Ga0075362_102979291 143
664 3300006844 Ga0075428_101903106 Ga0075428_1019031062 143
665 3300009094 Ga0111539_10829670 Ga0111539_108296702 143
666 3300013296 Ga0157374_11436625 Ga0157374_114366251 143
667 3300021377 Ga0213874_10093563 Ga0213874_100935632 143
668 3300021384 Ga0213876_10044820 Ga0213876_100448202 143
669 3300025928 Ga0207700_10394157 Ga0207700_103941572 143
670 3300025929 Ga0207664_10230369 Ga0207664_102303692 143
671 3300025934 Ga0207686_10572644 Ga0207686_105726442 143
672 3300026116 Ga0207674_10627837 Ga0207674_106278371 143
673 3300035692 Ga0373935_1348945 Ga0373935_1348945_54_497 143
674 3300035724 Ga0373933_0000026 Ga0373933_0000026_73052_73492 143
675 3300037853 Ga0436364_0326624 Ga0436364_0326624_35_481 143
676 3300039437 Ga0436365_0730964 Ga0436365_0730964_281_727 143
677 3300039450 Ga0436363_1605563 Ga0436363_1605563_262_708 143
678 3300046463 Ga0495653_0457585 Ga0495653_0457585_178_621 143
679 3300046511 Ga0495608_0205749 Ga0495608_0205749_91_534 143
680 3300046543 Ga0495645_0084459 Ga0495645_0084459_1224_1667 143
681 3300046675 Ga0495657_0514877 Ga0495657_0514877_87_530 143
682 3300047317 Ga0495604_0932216 Ga0495604_0932216_23_466 143
683 3300048918 Ga0496115_0061473 Ga0496115_0061473_2136_2579 143
684 3300048918 Ga0496115_0779083 Ga0496115_0779083_115_558 143
685 3300049570 Ga0501033_0081086 Ga0501033_0081086_1005_1451 143
686 3300049574 Ga0501038_0293028 Ga0501038_0293028_529_975 143
687 3300049580 Ga0501046_0737956 Ga0501046_0737956_46_492 143
688 3300049581 Ga0501047_0045446 Ga0501047_0045446_3009_3455 143
689 3300049584 Ga0501068_0502638 Ga0501068_0502638_300_746 143
690 3300049586 Ga0501070_0073371 Ga0501070_0073371_113_559 143
691 3300049590 Ga0501074_1202939 Ga0501074_1202939_42_488 143
692 3300049742 Ga0501080_0109388 Ga0501080_0109388_372_818 143
693 3300049822 Ga0501035_0081479 Ga0501035_0081479_2320_2766 143
694 3300049823 Ga0501044_0009555 Ga0501044_0009555_6208_6654 143
695 3300050489 nmdc:mga03683_193879_c1 nmdc:mga03683_193879_c1_188_631 143
696 3300050492 nmdc:mga0yw44_464333_c1 nmdc:mga0yw44_464333_c1_268_711 143
697 3300050509 nmdc:mga0qj67_452495_c1 nmdc:mga0qj67_452495_c1_471_914 143
698 3300050510 nmdc:mga06r32_45696_c1 nmdc:mga06r32_45696_c1_1018_1461 143
699 3300053119 Ga0500595_009606 Ga0500595_009606_468_917 143
700 3300053131 Ga0500652_000021 Ga0500652_000021_13927_14382 143
701 3300053177 Ga0500636_0044472 Ga0500636_0044472_303_758 143
702 3300005434 Ga0070709_10028224 Ga0070709_100282244 144
703 3300005434 Ga0070709_10900160 Ga0070709_109001602 144
704 3300005435 Ga0070714_100004476 Ga0070714_10000447613 144
705 3300005435 Ga0070714_101693363 Ga0070714_1016933631 144
706 3300005436 Ga0070713_100244880 Ga0070713_1002448802 144
707 3300005437 Ga0070710_10026710 Ga0070710_100267103 144
708 3300005530 Ga0070679_100090346 Ga0070679_1000903463 144
709 3300005539 Ga0068853_100151648 Ga0068853_1001516482 144
710 3300005563 Ga0068855_100181169 Ga0068855_1001811692 144
711 3300005614 Ga0068856_101347562 Ga0068856_1013475621 144
712 3300005719 Ga0068861_100707503 Ga0068861_1007075031 144
713 3300005937 Ga0081455_10003468 Ga0081455_100034688 144
714 3300005983 Ga0081540_1014507 Ga0081540_10145074 144
715 3300005983 Ga0081540_1029798 Ga0081540_10297982 144
716 3300005985 Ga0081539_10000585 Ga0081539_1000058553 144
717 3300006028 Ga0070717_10036162 Ga0070717_100361625 144
718 3300006163 Ga0070715_10010528 Ga0070715_100105283 144
719 3300006173 Ga0070716_100012030 Ga0070716_1000120305 144
720 3300006173 Ga0070716_100663014 Ga0070716_1006630142 144
721 3300006852 Ga0075433_10091450 Ga0075433_100914503 144
722 3300006871 Ga0075434_100016328 Ga0075434_1000163284 144
723 3300006871 Ga0075434_100151253 Ga0075434_1001512533 144
724 3300006914 Ga0075436_100572064 Ga0075436_1005720642 144
725 3300007076 Ga0075435_100351742 Ga0075435_1003517422 144
726 3300009093 Ga0105240_11064872 Ga0105240_110648722 144
727 3300009094 Ga0111539_10048754 Ga0111539_100487543 144
728 3300009147 Ga0114129_11041257 Ga0114129_110412572 144
729 3300009148 Ga0105243_10406043 Ga0105243_104060432 144
730 3300009176 Ga0105242_10745698 Ga0105242_107456981 144
731 3300009551 Ga0105238_10004073 Ga0105238_100040737 144
732 3300009551 Ga0105238_11585536 Ga0105238_115855361 144
733 3300010159 Ga0099796_10011586 Ga0099796_100115861 144
734 3300010375 Ga0105239_10221672 Ga0105239_102216722 144
735 3300013306 Ga0163162_10259731 Ga0163162_102597313 144
736 3300014969 Ga0157376_10285391 Ga0157376_102853912 144
737 3300021384 Ga0213876_10360525 Ga0213876_103605252 144
738 3300021388 Ga0213875_10000009 Ga0213875_10000009397 144
739 3300025906 Ga0207699_10013735 Ga0207699_100137355 144
740 3300025906 Ga0207699_10620962 Ga0207699_106209622 144
741 3300025916 Ga0207663_10082104 Ga0207663_100821042 144
742 3300025924 Ga0207694_10017893 Ga0207694_100178935 144
743 3300025928 Ga0207700_10268172 Ga0207700_102681721 144
744 3300025928 Ga0207700_10310549 Ga0207700_103105492 144
745 3300025929 Ga0207664_10131243 Ga0207664_101312432 144
746 3300025929 Ga0207664_11191478 Ga0207664_111914781 144
747 3300025949 Ga0207667_10137426 Ga0207667_101374263 144
748 3300026023 Ga0207677_10285060 Ga0207677_102850602 144
749 3300027907 Ga0207428_10079223 Ga0207428_100792234 144
750 3300031456 Ga0307513_10617860 Ga0307513_106178602 144
751 3300031665 Ga0316575_10096962 Ga0316575_100969622 144
752 3300031727 Ga0316576_10045817 Ga0316576_100458173 144
753 3300031728 Ga0316578_10083861 Ga0316578_100838613 144
754 3300035088 Ga0373940_0007638 Ga0373940_0007638_1846_2292 144
755 3300035090 Ga0373949_0041276 Ga0373949_0041276_42_488 144
756 3300035207 Ga0373942_0097974 Ga0373942_0097974_427_873 144
757 3300035398 Ga0316574_0000666 Ga0316574_0000666_5699_6148 144
758 3300036647 Ga0316582_0024263 Ga0316582_0024263_288_737 144
759 3300036712 Ga0316584_0289104 Ga0316584_0289104_516_965 144
760 3300037853 Ga0436364_0232161 Ga0436364_0232161_190_636 144
761 3300037853 Ga0436364_0413488 Ga0436364_0413488_52274_52720 144
762 3300037853 Ga0436364_1385490 Ga0436364_1385490_284_733 144
763 3300039437 Ga0436365_0477466 Ga0436365_0477466_133_582 144
764 3300039447 Ga0436361_0402592 Ga0436361_0402592_362_808 144
765 3300039450 Ga0436363_0546121 Ga0436363_0546121_24_473 144
766 3300039450 Ga0436363_0737946 Ga0436363_0737946_213_662 144
767 3300039450 Ga0436363_1475973 Ga0436363_1475973_88_537 144
768 3300039453 Ga0436362_0112950 Ga0436362_0112950_277_723 144
769 3300039453 Ga0436362_0370131 Ga0436362_0370131_70_522 144
770 3300039453 Ga0436362_0990218 Ga0436362_0990218_636_1082 144
771 3300044656 Ga0466969_0064725 Ga0466969_0064725_397_843 144
772 3300044684 Ga0466966_0066050 Ga0466966_0066050_419_865 144
773 3300045049 Ga0466959_0022800 Ga0466959_0022800_88_534 144
774 3300045049 Ga0466959_1070390 Ga0466959_1070390_54_500 144
775 3300045976 Ga0466967_0118435 Ga0466967_0118435_1094_1540 144
776 3300046507 Ga0495606_0001505 Ga0495606_0001505_12614_13060 144
777 3300048905 Ga0496102_0398717 Ga0496102_0398717_327_773 144
778 3300048905 Ga0496102_0505406 Ga0496102_0505406_548_994 144
779 3300048907 Ga0496104_0239352 Ga0496104_0239352_496_945 144
780 3300048908 Ga0496105_0085375 Ga0496105_0085375_345_791 144
781 3300048918 Ga0496115_0132943 Ga0496115_0132943_665_1111 144
782 3300048918 Ga0496115_0501294 Ga0496115_0501294_208_654 144
783 3300050494 nmdc:mga06z11_80831_c1 nmdc:mga06z11_80831_c1_124_570 144
784 3300050507 nmdc:mga05p37_313322_c1 nmdc:mga05p37_313322_c1_1234_1680 144
785 3300050511 nmdc:mga08y16_40252_c1 nmdc:mga08y16_40252_c1_2679_3125 144
786 3300050512 nmdc:mga0n895_13760_c1 nmdc:mga0n895_13760_c1_3618_4064 144
787 3300050512 nmdc:mga0n895_288538_c1 nmdc:mga0n895_288538_c1_437_883 144
788 3300050513 nmdc:mga0rr50_68414_c1 nmdc:mga0rr50_68414_c1_605_1051 144
789 3300050514 nmdc:mga08x19_135365_c1 nmdc:mga08x19_135365_c1_189_635 144
790 3300050515 nmdc:mga0a205_98886_c1 nmdc:mga0a205_98886_c1_484_930 144
791 3300053117 Ga0500593_003192 Ga0500593_003192_1946_2401 144
792 3300002244 JGI24742J22300_10012463 JGI24742J22300_100124632 145
793 3300003203 JGI25406J46586_10034035 JGI25406J46586_100340352 145
794 3300003203 JGI25406J46586_10080186 JGI25406J46586_100801861 145
795 3300003659 JGI25404J52841_10036347 JGI25404J52841_100363472 145
796 3300005290 Ga0065712_10120819 Ga0065712_101208192 145
797 3300005293 Ga0065715_10035447 Ga0065715_100354471 145
798 3300005330 Ga0070690_100085270 Ga0070690_1000852702 145
799 3300005331 Ga0070670_100064473 Ga0070670_1000644734 145
800 3300005333 Ga0070677_10021325 Ga0070677_100213254 145
801 3300005334 Ga0068869_100103472 Ga0068869_1001034722 145
802 3300005338 Ga0068868_100166135 Ga0068868_1001661352 145
803 3300005340 Ga0070689_100457482 Ga0070689_1004574822 145
804 3300005340 Ga0070689_100503935 Ga0070689_1005039351 145
805 3300005343 Ga0070687_100329455 Ga0070687_1003294552 145
806 3300005353 Ga0070669_100442765 Ga0070669_1004427651 145
807 3300005354 Ga0070675_100039379 Ga0070675_1000393793 145
808 3300005355 Ga0070671_100067465 Ga0070671_1000674652 145
809 3300005355 Ga0070671_100109906 Ga0070671_1001099064 145
810 3300005356 Ga0070674_100011375 Ga0070674_1000113752 145
811 3300005364 Ga0070673_100011329 Ga0070673_1000113292 145
812 3300005365 Ga0070688_100037862 Ga0070688_1000378622 145
813 3300005367 Ga0070667_100160709 Ga0070667_1001607093 145
814 3300005437 Ga0070710_11274787 Ga0070710_112747871 145
815 3300005456 Ga0070678_100011418 Ga0070678_1000114183 145
816 3300005466 Ga0070685_10044579 Ga0070685_100445793 145
817 3300005530 Ga0070679_100049240 Ga0070679_1000492403 145
818 3300005543 Ga0070672_100086189 Ga0070672_1000861894 145
819 3300005983 Ga0081540_1000054 Ga0081540_1000054118 145
820 3300006028 Ga0070717_10462969 Ga0070717_104629692 145
821 3300006173 Ga0070716_100551272 Ga0070716_1005512722 145
822 3300006353 Ga0075370_10083239 Ga0075370_100832394 145
823 3300006871 Ga0075434_100117083 Ga0075434_1001170833 145
824 3300006881 Ga0068865_100228426 Ga0068865_1002284262 145
825 3300009094 Ga0111539_10006240 Ga0111539_1000624015 145
826 3300010159 Ga0099796_10162742 Ga0099796_101627422 145
827 3300014326 Ga0157380_10359902 Ga0157380_103599022 145
828 3300015261 Ga0182006_1256586 Ga0182006_12565861 145
829 3300017792 Ga0163161_10563673 Ga0163161_105636732 145
830 3300021384 Ga0213876_10598158 Ga0213876_105981581 145
831 3300021388 Ga0213875_10072556 Ga0213875_100725562 145
832 3300025893 Ga0207682_10005853 Ga0207682_100058534 145
833 3300025901 Ga0207688_10026485 Ga0207688_100264853 145
834 3300025915 Ga0207693_10231529 Ga0207693_102315292 145
835 3300025921 Ga0207652_10203852 Ga0207652_102038522 145
836 3300025925 Ga0207650_10493039 Ga0207650_104930392 145
837 3300025926 Ga0207659_10119405 Ga0207659_101194052 145
838 3300025931 Ga0207644_11082472 Ga0207644_110824722 145
839 3300025936 Ga0207670_10153265 Ga0207670_101532652 145
840 3300025937 Ga0207669_10000663 Ga0207669_1000066310 145
841 3300025937 Ga0207669_10653917 Ga0207669_106539172 145
842 3300025938 Ga0207704_10368978 Ga0207704_103689782 145
843 3300025940 Ga0207691_10018720 Ga0207691_100187205 145
844 3300025960 Ga0207651_10068873 Ga0207651_100688732 145
845 3300026023 Ga0207677_10096964 Ga0207677_100969642 145
846 3300026041 Ga0207639_12053457 Ga0207639_120534571 145
847 3300026089 Ga0207648_10008772 Ga0207648_1000877210 145
848 3300026118 Ga0207675_101483170 Ga0207675_1014831701 145
849 3300026118 Ga0207675_101700554 Ga0207675_1017005542 145
850 3300026121 Ga0207683_10002222 Ga0207683_100022225 145
851 3300028379 Ga0268266_11981462 Ga0268266_119814621 145
852 3300028577 Ga0265318_10234396 Ga0265318_102343962 145
853 3300031240 Ga0265320_10107450 Ga0265320_101074502 145
854 3300031247 Ga0265340_10035291 Ga0265340_100352913 145
855 3300031247 Ga0265340_10460099 Ga0265340_104600991 145
856 3300031249 Ga0265339_10000906 Ga0265339_100009066 145
857 3300031344 Ga0265316_10059431 Ga0265316_100594313 145
858 3300031901 Ga0307406_11000703 Ga0307406_110007032 145
859 3300032168 Ga0316593_10213175 Ga0316593_102131752 145
860 3300035170 Ga0373943_0050841 Ga0373943_0050841_246_695 145
861 3300035171 Ga0373946_0025253 Ga0373946_0025253_1142_1591 145
862 3300035692 Ga0373935_0033704 Ga0373935_0033704_1457_1906 145
863 3300035695 Ga0373927_0024105 Ga0373927_0024105_2429_2878 145
864 3300035725 Ga0373947_0028777 Ga0373947_0028777_1006_1455 145
865 3300037068 Ga0373925_0718157 Ga0373925_0718157_139_588 145
866 3300037853 Ga0436364_0133169 Ga0436364_0133169_1157_1609 145
867 3300037853 Ga0436364_0326250 Ga0436364_0326250_500_949 145
868 3300037853 Ga0436364_0946357 Ga0436364_0946357_1541_1990 145
869 3300039438 Ga0436360_0557516 Ga0436360_0557516_16_465 145
870 3300039450 Ga0436363_1622384 Ga0436363_1622384_20_475 145
871 3300039453 Ga0436362_0305805 Ga0436362_0305805_182_631 145
872 3300046455 Ga0495603_0269879 Ga0495603_0269879_314_763 145
873 3300046476 Ga0495662_0042172 Ga0495662_0042172_1481_1930 145
874 3300046517 Ga0495630_0442408 Ga0495630_0442408_439_888 145
875 3300046522 Ga0495643_0171661 Ga0495643_0171661_464_928 145
876 3300046642 Ga0495634_0171268 Ga0495634_0171268_230_679 145
877 3300046664 Ga0495659_0329414 Ga0495659_0329414_53_502 145
878 3300046692 Ga0495671_0255312 Ga0495671_0255312_228_674 145
879 3300047315 Ga0495581_0613217 Ga0495581_0613217_68_517 145
880 3300047319 Ga0495674_0075521 Ga0495674_0075521_694_1143 145
881 3300047469 Ga0495673_0138484 Ga0495673_0138484_68_514 145
882 3300047472 Ga0495686_0091392 Ga0495686_0091392_346_792 145
883 3300049589 Ga0501073_0080371 Ga0501073_0080371_270_722 145
884 3300049741 Ga0501079_0818119 Ga0501079_0818119_165_620 145
885 3300049742 Ga0501080_0117223 Ga0501080_0117223_516_968 145
886 3300049744 Ga0501083_0175848 Ga0501083_0175848_820_1269 145
887 3300050512 nmdc:mga0n895_60710_c1 nmdc:mga0n895_60710_c1_2353_2802 145
888 3300053730 Ga0500645_106624 Ga0500645_106624_281_730 145
889 3300054114 Ga0501084_0159294 Ga0501084_0159294_118_570 145
890 3300060353 Ga0501082_0608823 Ga0501082_0608823_340_792 145
891 3300005293 Ga0065715_10280612 Ga0065715_102806122 146
892 3300005328 Ga0070676_10359746 Ga0070676_103597462 146
893 3300005329 Ga0070683_100494988 Ga0070683_1004949882 146
894 3300005331 Ga0070670_100140115 Ga0070670_1001401153 146
895 3300005334 Ga0068869_100612881 Ga0068869_1006128812 146
896 3300005338 Ga0068868_100576163 Ga0068868_1005761632 146
897 3300005340 Ga0070689_100418958 Ga0070689_1004189582 146
898 3300005340 Ga0070689_100477534 Ga0070689_1004775342 146
899 3300005343 Ga0070687_100033131 Ga0070687_1000331312 146
900 3300005353 Ga0070669_100133433 Ga0070669_1001334332 146
901 3300005354 Ga0070675_101026074 Ga0070675_1010260741 146
902 3300005365 Ga0070688_100055442 Ga0070688_1000554422 146
903 3300005445 Ga0070708_100096303 Ga0070708_1000963033 146
904 3300005457 Ga0070662_100013663 Ga0070662_1000136632 146
905 3300005536 Ga0070697_100691197 Ga0070697_1006911972 146
906 3300005544 Ga0070686_100676948 Ga0070686_1006769482 146
907 3300005544 Ga0070686_100678729 Ga0070686_1006787292 146
908 3300005547 Ga0070693_100261226 Ga0070693_1002612262 146
909 3300005548 Ga0070665_100201117 Ga0070665_1002011172 146
910 3300005615 Ga0070702_100051014 Ga0070702_1000510142 146
911 3300005617 Ga0068859_101819923 Ga0068859_1018199231 146
912 3300005618 Ga0068864_100089466 Ga0068864_1000894661 146
913 3300005842 Ga0068858_100305380 Ga0068858_1003053802 146
914 3300005937 Ga0081455_10217536 Ga0081455_102175361 146
915 3300005981 Ga0081538_10003609 Ga0081538_100036093 146
916 3300005985 Ga0081539_10213111 Ga0081539_102131112 146
917 3300006038 Ga0075365_10245135 Ga0075365_102451352 146
918 3300006175 Ga0070712_101452971 Ga0070712_1014529711 146
919 3300006186 Ga0075369_10111257 Ga0075369_101112572 146
920 3300006195 Ga0075366_10349233 Ga0075366_103492331 146
921 3300006353 Ga0075370_10141223 Ga0075370_101412232 146
922 3300006844 Ga0075428_100009199 Ga0075428_10000919911 146
923 3300006844 Ga0075428_100155863 Ga0075428_1001558632 146
924 3300006844 Ga0075428_101594873 Ga0075428_1015948731 146
925 3300006846 Ga0075430_100015094 Ga0075430_1000150942 146
926 3300006847 Ga0075431_100000482 Ga0075431_10000048223 146
927 3300006847 Ga0075431_100359478 Ga0075431_1003594782 146
928 3300006852 Ga0075433_10023256 Ga0075433_100232564 146
929 3300006880 Ga0075429_100058229 Ga0075429_1000582294 146
930 3300006880 Ga0075429_100087312 Ga0075429_1000873122 146
931 3300006880 Ga0075429_100661911 Ga0075429_1006619112 146
932 3300006914 Ga0075436_100748175 Ga0075436_1007481751 146
933 3300006931 Ga0097620_101819974 Ga0097620_1018199741 146
934 3300007076 Ga0075435_100070655 Ga0075435_1000706552 146
935 3300009094 Ga0111539_10007283 Ga0111539_1000728314 146
936 3300009098 Ga0105245_10170278 Ga0105245_101702782 146
937 3300009098 Ga0105245_11780451 Ga0105245_117804512 146
938 3300009147 Ga0114129_10001318 Ga0114129_1000131823 146
939 3300009147 Ga0114129_10051335 Ga0114129_100513353 146
940 3300009147 Ga0114129_10137412 Ga0114129_101374125 146
941 3300009147 Ga0114129_10767151 Ga0114129_107671512 146
942 3300009147 Ga0114129_11683901 Ga0114129_116839012 146
943 3300009174 Ga0105241_10274611 Ga0105241_102746112 146
944 3300009553 Ga0105249_11260372 Ga0105249_112603722 146
945 3300010159 Ga0099796_10018761 Ga0099796_100187612 146
946 3300011119 Ga0105246_10043600 Ga0105246_100436002 146
947 3300013297 Ga0157378_10398276 Ga0157378_103982762 146
948 3300013308 Ga0157375_11344411 Ga0157375_113444112 146
949 3300014325 Ga0163163_10099848 Ga0163163_100998483 146
950 3300014745 Ga0157377_10300840 Ga0157377_103008402 146
951 3300015265 Ga0182005_1024185 Ga0182005_10241852 146
952 3300025893 Ga0207682_10203703 Ga0207682_102037032 146
953 3300025908 Ga0207643_10252494 Ga0207643_102524941 146
954 3300025911 Ga0207654_10079980 Ga0207654_100799802 146
955 3300025918 Ga0207662_10021121 Ga0207662_100211212 146
956 3300025926 Ga0207659_10359899 Ga0207659_103598992 146
957 3300025927 Ga0207687_10164531 Ga0207687_101645312 146
958 3300025933 Ga0207706_10303646 Ga0207706_103036462 146
959 3300025935 Ga0207709_10093391 Ga0207709_100933911 146
960 3300025936 Ga0207670_10388977 Ga0207670_103889771 146
961 3300025936 Ga0207670_10832216 Ga0207670_108322162 146
962 3300025937 Ga0207669_10456377 Ga0207669_104563772 146
963 3300025938 Ga0207704_11102530 Ga0207704_111025301 146
964 3300025944 Ga0207661_10442693 Ga0207661_104426932 146
965 3300025961 Ga0207712_10119535 Ga0207712_101195353 146
966 3300026035 Ga0207703_10047773 Ga0207703_100477733 146
967 3300026035 Ga0207703_10878938 Ga0207703_108789382 146
968 3300026075 Ga0207708_11316732 Ga0207708_113167321 146
969 3300026088 Ga0207641_10910371 Ga0207641_109103711 146
970 3300026095 Ga0207676_11833255 Ga0207676_118332552 146
971 3300026118 Ga0207675_100257912 Ga0207675_1002579121 146
972 3300026118 Ga0207675_101117437 Ga0207675_1011174372 146
973 3300026118 Ga0207675_102258802 Ga0207675_1022588021 146
974 3300026121 Ga0207683_10141994 Ga0207683_101419943 146
975 3300026142 Ga0207698_10756806 Ga0207698_107568061 146
976 3300027907 Ga0207428_10001098 Ga0207428_1000109823 146
977 3300027907 Ga0207428_10361628 Ga0207428_103616282 146
978 3300028379 Ga0268266_10079013 Ga0268266_100790133 146
979 3300028380 Ga0268265_10056781 Ga0268265_100567812 146
980 3300028380 Ga0268265_10572783 Ga0268265_105727832 146
981 3300028573 Ga0265334_10281447 Ga0265334_102814471 146
982 3300031456 Ga0307513_10394779 Ga0307513_103947792 146
983 3300031456 Ga0307513_10399078 Ga0307513_103990782 146
984 3300031456 Ga0307513_10679461 Ga0307513_106794612 146
985 3300032002 Ga0307416_102307383 Ga0307416_1023073831 146
986 3300035113 Ga0373936_0094538 Ga0373936_0094538_730_1185 146
987 3300035207 Ga0373942_0332173 Ga0373942_0332173_30_482 146
988 3300037418 Ga0395900_0378034 Ga0395900_0378034_834_1289 146
989 3300037471 Ga0395905_0302519 Ga0395905_0302519_810_1265 146
990 3300038443 Ga0395901_0917811 Ga0395901_0917811_66_521 146
991 3300039437 Ga0436365_0520674 Ga0436365_0520674_51_497 146
992 3300039437 Ga0436365_1314922 Ga0436365_1314922_223_675 146
993 3300041410 Ga0439461_0048521 Ga0439461_0048521_429_881 146
994 3300042001 Ga0439441_102032 Ga0439441_102032_119_571 146
995 3300042003 Ga0439443_004767 Ga0439443_004767_261_713 146
996 3300042009 Ga0439451_031263 Ga0439451_031263_434_886 146
997 3300042010 Ga0439452_052512 Ga0439452_052512_398_850 146
998 3300042015 Ga0439462_0124520 Ga0439462_0124520_42_494 146
999 3300042436 Ga0439435_0059009 Ga0439435_0059009_230_682 146
1000 3300042437 Ga0439444_0009681 Ga0439444_0009681_714_1166 146
1001 3300042461 Ga0439460_0264575 Ga0439460_0264575_29_481 146
1002 3300042532 Ga0450893_0004438 Ga0450893_0004438_1746_2198 146
1003 3300042993 Ga0439440_0026202 Ga0439440_0026202_453_905 146
1004 3300046460 Ga0495638_0030906 Ga0495638_0030906_2893_3345 146
1005 3300046491 Ga0495584_0092694 Ga0495584_0092694_977_1429 146
1006 3300046492 Ga0495585_0613110 Ga0495585_0613110_44_499 146
1007 3300046525 Ga0495663_0326366 Ga0495663_0326366_57_509 146
1008 3300047318 Ga0495636_0147444 Ga0495636_0147444_89_541 146
1009 3300048903 Ga0496100_0025495 Ga0496100_0025495_2245_2697 146
1010 3300048911 Ga0496108_0227114 Ga0496108_0227114_630_1082 146
1011 3300048912 Ga0496109_0553731 Ga0496109_0553731_511_963 146
1012 3300048916 Ga0496113_0165996 Ga0496113_0165996_274_726 146
1013 3300049576 Ga0501040_0508077 Ga0501040_0508077_244_693 146
1014 3300049577 Ga0501041_1123615 Ga0501041_1123615_17_469 146
1015 3300049588 Ga0501072_0124188 Ga0501072_0124188_635_1084 146
1016 3300049591 Ga0501075_0886781 Ga0501075_0886781_110_559 146
1017 3300049592 Ga0501076_0194016 Ga0501076_0194016_816_1265 146
1018 3300049593 Ga0501077_0603188 Ga0501077_0603188_27_476 146
1019 3300049744 Ga0501083_0047836 Ga0501083_0047836_371_823 146
1020 3300049744 Ga0501083_0089328 Ga0501083_0089328_1077_1529 146
1021 3300049824 Ga0501045_0175978 Ga0501045_0175978_717_1166 146
1022 3300050490 nmdc:mga03n38_35883_c1 nmdc:mga03n38_35883_c1_1046_1498 146
1023 3300050491 nmdc:mga00v17_23806_c1 nmdc:mga00v17_23806_c1_2602_3054 146
1024 3300050493 nmdc:mga0k408_19764_c1 nmdc:mga0k408_19764_c1_2983_3435 146
1025 3300050493 nmdc:mga0k408_206016_c1 nmdc:mga0k408_206016_c1_647_1099 146
1026 3300050494 nmdc:mga06z11_19981_c1 nmdc:mga06z11_19981_c1_2431_2883 146
1027 3300050496 nmdc:mga07m45_40889_c1 nmdc:mga07m45_40889_c1_1977_2429 146
1028 3300050507 nmdc:mga05p37_142822_c1 nmdc:mga05p37_142822_c1_1263_1715 146
1029 3300050507 nmdc:mga05p37_308741_c1 nmdc:mga05p37_308741_c1_1323_1775 146
1030 3300050507 nmdc:mga05p37_442823_c1 nmdc:mga05p37_442823_c1_437_892 146
1031 3300050507 nmdc:mga05p37_70389_c1 nmdc:mga05p37_70389_c1_2680_3132 146
1032 3300050508 nmdc:mga09592_1212_c1 nmdc:mga09592_1212_c1_8144_8596 146
1033 3300050508 nmdc:mga09592_266358_c1 nmdc:mga09592_266358_c1_26_475 146
1034 3300050508 nmdc:mga09592_507002_c1 nmdc:mga09592_507002_c1_265_720 146
1035 3300050508 nmdc:mga09592_56784_c1 nmdc:mga09592_56784_c1_2750_3202 146
1036 3300050508 nmdc:mga09592_60595_c1 nmdc:mga09592_60595_c1_2434_2886 146
1037 3300050509 nmdc:mga0qj67_102566_c1 nmdc:mga0qj67_102566_c1_709_1158 146
1038 3300050509 nmdc:mga0qj67_319621_c1 nmdc:mga0qj67_319621_c1_70_522 146
1039 3300050509 nmdc:mga0qj67_9239_c1 nmdc:mga0qj67_9239_c1_1719_2171 146
1040 3300050510 nmdc:mga06r32_1657_c1 nmdc:mga06r32_1657_c1_13468_13920 146
1041 3300050510 nmdc:mga06r32_199078_c1 nmdc:mga06r32_199078_c1_1280_1729 146
1042 3300050510 nmdc:mga06r32_201241_c1 nmdc:mga06r32_201241_c1_1341_1796 146
1043 3300050510 nmdc:mga06r32_303067_c1 nmdc:mga06r32_303067_c1_860_1312 146
1044 3300050510 nmdc:mga06r32_897502_c1 nmdc:mga06r32_897502_c1_233_682 146
1045 3300050511 nmdc:mga08y16_605_c1 nmdc:mga08y16_605_c1_13773_14225 146
1046 3300050511 nmdc:mga08y16_673354_c1 nmdc:mga08y16_673354_c1_283_735 146
1047 3300050512 nmdc:mga0n895_1103236_c1 nmdc:mga0n895_1103236_c1_293_745 146
1048 3300050513 nmdc:mga0rr50_67873_c1 nmdc:mga0rr50_67873_c1_355_807 146
1049 3300050516 nmdc:mga0sz30_94500_c1 nmdc:mga0sz30_94500_c1_638_1090 146
1050 3300053079 Ga0500610_0161754 Ga0500610_0161754_602_1054 146
1051 3300053096 Ga0500641_0012310 Ga0500641_0012310_318_770 146
1052 3300053130 Ga0500642_0124549 Ga0500642_0124549_95_547 146
1053 3300054114 Ga0501084_0281300 Ga0501084_0281300_203_655 146
1054 3300060353 Ga0501082_0000486 Ga0501082_0000486_9530_9982 146
1055 3300060353 Ga0501082_0167947 Ga0501082_0167947_484_933 146
1056 3300061734 Ga0530510_0264618 Ga0530510_0264618_666_1118 146
1057 3300006177 Ga0075362_10296309 Ga0075362_102963092 147
1058 3300006178 Ga0075367_10058341 Ga0075367_100583413 147
1059 3300006195 Ga0075366_10111767 Ga0075366_101117671 147
1060 3300006871 Ga0075434_101570971 Ga0075434_1015709712 147
1061 3300025939 Ga0207665_10163387 Ga0207665_101633872 147
1062 3300039447 Ga0436361_0444423 Ga0436361_0444423_148_618 147
1063 3300049572 Ga0501036_0114682 Ga0501036_0114682_365_820 147
1064 3300049576 Ga0501040_0241871 Ga0501040_0241871_469_924 147
1065 3300049581 Ga0501047_0013975 Ga0501047_0013975_282_737 147
1066 3300049584 Ga0501068_0149822 Ga0501068_0149822_583_1038 147
1067 3300049586 Ga0501070_0495907 Ga0501070_0495907_82_537 147
1068 3300049590 Ga0501074_0663432 Ga0501074_0663432_37_492 147
1069 3300049591 Ga0501075_0316301 Ga0501075_0316301_460_915 147
1070 3300049592 Ga0501076_0059590 Ga0501076_0059590_2339_2794 147
1071 3300050493 nmdc:mga0k408_188050_c1 nmdc:mga0k408_188050_c1_342_800 147
1072 3300050494 nmdc:mga06z11_213154_c1 nmdc:mga06z11_213154_c1_189_647 147
1073 3300054114 Ga0501084_0193081 Ga0501084_0193081_464_919 147
1074 3300060353 Ga0501082_0770733 Ga0501082_0770733_198_653 147
1075 3300005339 Ga0070660_100772217 Ga0070660_1007722172 148
1076 3300013307 Ga0157372_10896222 Ga0157372_108962222 148
1077 3300017792 Ga0163161_10946012 Ga0163161_109460122 148
1078 3300031241 Ga0265325_10111990 Ga0265325_101119902 148
1079 3300031249 Ga0265339_10236242 Ga0265339_102362422 148
1080 3300031250 Ga0265331_10121260 Ga0265331_101212602 148
1081 3300031344 Ga0265316_11049556 Ga0265316_110495562 148
1082 3300031711 Ga0265314_10005511 Ga0265314_1000551116 148
1083 3300037312 Ga0395899_0058785 Ga0395899_0058785_1413_1868 148
1084 3300037418 Ga0395900_0003202 Ga0395900_0003202_1091_1546 148
1085 3300037466 Ga0395898_0010780 Ga0395898_0010780_7918_8373 148
1086 3300038443 Ga0395901_0022764 Ga0395901_0022764_4028_4483 148
1087 3300039437 Ga0436365_0896224 Ga0436365_0896224_3379_3825 148
1088 3300039437 Ga0436365_1318441 Ga0436365_1318441_539_985 148
1089 3300049569 Ga0501032_0070139 Ga0501032_0070139_947_1396 148
1090 3300049571 Ga0501034_0113696 Ga0501034_0113696_289_744 148
1091 3300049572 Ga0501036_0013581 Ga0501036_0013581_6102_6557 148
1092 3300049572 Ga0501036_0077992 Ga0501036_0077992_10_459 148
1093 3300049573 Ga0501037_0217166 Ga0501037_0217166_235_690 148
1094 3300049573 Ga0501037_0498235 Ga0501037_0498235_247_696 148
1095 3300049574 Ga0501038_0086125 Ga0501038_0086125_1113_1562 148
1096 3300049579 Ga0501043_0011069 Ga0501043_0011069_5913_6368 148
1097 3300049579 Ga0501043_0052163 Ga0501043_0052163_1318_1767 148
1098 3300049581 Ga0501047_0162683 Ga0501047_0162683_215_664 148
1099 3300049582 Ga0501048_0134214 Ga0501048_0134214_755_1210 148
1100 3300049586 Ga0501070_0055874 Ga0501070_0055874_1031_1486 148
1101 3300049586 Ga0501070_0249040 Ga0501070_0249040_36_485 148
1102 3300049587 Ga0501071_0268185 Ga0501071_0268185_557_1006 148
1103 3300049589 Ga0501073_0067848 Ga0501073_0067848_1417_1866 148
1104 3300049590 Ga0501074_0047205 Ga0501074_0047205_1458_1907 148
1105 3300049590 Ga0501074_0127371 Ga0501074_0127371_820_1275 148
1106 3300049742 Ga0501080_0010934 Ga0501080_0010934_1778_2233 148
1107 3300049742 Ga0501080_1319528 Ga0501080_1319528_131_580 148
1108 3300049822 Ga0501035_0017191 Ga0501035_0017191_223_678 148
1109 3300049822 Ga0501035_0228472 Ga0501035_0228472_37_486 148
1110 3300060353 Ga0501082_0141464 Ga0501082_0141464_61_516 148
1111 3300005329 Ga0070683_100167556 Ga0070683_1001675563 149
1112 3300005344 Ga0070661_100810557 Ga0070661_1008105571 149
1113 3300005434 Ga0070709_10031985 Ga0070709_100319853 149
1114 3300005439 Ga0070711_100158178 Ga0070711_1001581783 149
1115 3300005458 Ga0070681_10465056 Ga0070681_104650562 149
1116 3300005530 Ga0070679_100064604 Ga0070679_1000646043 149
1117 3300005547 Ga0070693_100051962 Ga0070693_1000519623 149
1118 3300005563 Ga0068855_100110289 Ga0068855_1001102894 149
1119 3300005614 Ga0068856_100248883 Ga0068856_1002488832 149
1120 3300009093 Ga0105240_10309812 Ga0105240_103098122 149
1121 3300009551 Ga0105238_10047926 Ga0105238_100479263 149
1122 3300013104 Ga0157370_10242585 Ga0157370_102425852 149
1123 3300013307 Ga0157372_10116032 Ga0157372_101160324 149
1124 3300020070 Ga0206356_11106051 Ga0206356_111060511 149
1125 3300025898 Ga0207692_10092168 Ga0207692_100921682 149
1126 3300025906 Ga0207699_10214599 Ga0207699_102145991 149
1127 3300025911 Ga0207654_10165334 Ga0207654_101653342 149
1128 3300025917 Ga0207660_10798362 Ga0207660_107983622 149
1129 3300025924 Ga0207694_10115713 Ga0207694_101157132 149
1130 3300025944 Ga0207661_10213885 Ga0207661_102138852 149
1131 3300025949 Ga0207667_10180470 Ga0207667_101804702 149
1132 3300025981 Ga0207640_10095612 Ga0207640_100956122 149
1133 3300026041 Ga0207639_10223328 Ga0207639_102233282 149
1134 3300026142 Ga0207698_10244698 Ga0207698_102446982 149
1135 3300031344 Ga0265316_10323498 Ga0265316_103234982 149
1136 3300031595 Ga0265313_10112520 Ga0265313_101125202 149
1137 3300035119 Ga0373956_0005624 Ga0373956_0005624_2308_2757 149
1138 3300035172 Ga0373955_0003676 Ga0373955_0003676_1680_2129 149
1139 3300035691 Ga0373931_1096730 Ga0373931_1096730_65_514 149
1140 3300035692 Ga0373935_0543831 Ga0373935_0543831_335_784 149
1141 3300035724 Ga0373933_0002073 Ga0373933_0002073_547_996 149
1142 3300036401 Ga0373937_0041439 Ga0373937_0041439_2398_2847 149
1143 3300039450 Ga0436363_1531982 Ga0436363_1531982_176_643 149
1144 3300046511 Ga0495608_0026779 Ga0495608_0026779_1261_1710 149
1145 3300046536 Ga0495587_0242460 Ga0495587_0242460_14_463 149
1146 3300046559 Ga0495667_0035490 Ga0495667_0035490_1900_2349 149
1147 3300047322 Ga0495680_0040990 Ga0495680_0040990_3074_3523 149
1148 3300048088 Ga0495602_0049384 Ga0495602_0049384_795_1244 149
1149 3300048915 Ga0496112_0177324 Ga0496112_0177324_1442_1891 149
1150 3300050514 nmdc:mga08x19_114073_c1 nmdc:mga08x19_114073_c1_1111_1560 149
1151 3300053084 Ga0495595_0033111 Ga0495595_0033111_1462_1911 149
1152 3300005530 Ga0070679_100926960 Ga0070679_1009269601 150
1153 3300006028 Ga0070717_11215684 Ga0070717_112156841 150
1154 3300009093 Ga0105240_11159360 Ga0105240_111593602 150
1155 3300025921 Ga0207652_10838266 Ga0207652_108382661 150
1156 3300031711 Ga0265314_10003523 Ga0265314_1000352311 150
1157 3300044694 Ga0466963_0678077 Ga0466963_0678077_52_510 150
1158 3300046462 Ga0495651_0807997 Ga0495651_0807997_61_513 150
1159 3300053088 Ga0500644_0001826 Ga0500644_0001826_546_1001 150
1160 3300053140 Ga0500573_0302385 Ga0500573_0302385_288_740 150
1161 3300053153 Ga0500616_0000001 Ga0500616_0000001_197692_198147 150
1162 2209111006 2214736872 2213742941 151
1163 3300000042 ARSoilYngRDRAFT_c00011 ARSoilYngRDRAFT_0001133 151
1164 3300000043 ARcpr5yngRDRAFT_c000364 ARcpr5yngRDRAFT_0003645 151
1165 3300000044 ARSoilOldRDRAFT_c000398 ARSoilOldRDRAFT_0003984 151
1166 3300000044 ARSoilOldRDRAFT_c009307 ARSoilOldRDRAFT_0093072 151
1167 3300000045 ARCol0oldRDRAFT_c00910 ARCol0oldRDRAFT_009104 151
1168 3300000652 ARCol0yngRDRAFT_1000010 ARCol0yngRDRAFT_100001033 151
1169 3300000652 ARCol0yngRDRAFT_1007341 ARCol0yngRDRAFT_10073412 151
1170 3300001990 JGI24737J22298_10057315 JGI24737J22298_100573152 151
1171 3300002070 JGI24750J21931_1002473 JGI24750J21931_10024732 151
1172 3300002075 JGI24738J21930_10050817 JGI24738J21930_100508172 151
1173 3300002077 JGI24744J21845_10059487 JGI24744J21845_100594872 151
1174 3300002239 JGI24034J26672_10064147 JGI24034J26672_100641471 151
1175 3300002244 JGI24742J22300_10033927 JGI24742J22300_100339272 151
1176 3300005276 Ga0065717_1003945 Ga0065717_10039452 151
1177 3300005277 Ga0065716_1001744 Ga0065716_10017442 151
1178 3300005289 Ga0065704_10009650 Ga0065704_100096502 151
1179 3300005290 Ga0065712_10000516 Ga0065712_1000051616 151
1180 3300005290 Ga0065712_10120705 Ga0065712_101207052 151
1181 3300005293 Ga0065715_10000847 Ga0065715_1000084719 151
1182 3300005295 Ga0065707_10743739 Ga0065707_107437392 151
1183 3300005328 Ga0070676_10217729 Ga0070676_102177292 151
1184 3300005329 Ga0070683_100819279 Ga0070683_1008192791 151
1185 3300005330 Ga0070690_100000739 Ga0070690_10000073920 151
1186 3300005330 Ga0070690_100258383 Ga0070690_1002583832 151
1187 3300005331 Ga0070670_100130701 Ga0070670_1001307013 151
1188 3300005334 Ga0068869_100280136 Ga0068869_1002801362 151
1189 3300005335 Ga0070666_10005243 Ga0070666_100052433 151
1190 3300005336 Ga0070680_100037382 Ga0070680_1000373822 151
1191 3300005336 Ga0070680_100069869 Ga0070680_1000698692 151
1192 3300005336 Ga0070680_100452701 Ga0070680_1004527011 151
1193 3300005337 Ga0070682_100069049 Ga0070682_1000690492 151
1194 3300005337 Ga0070682_100729201 Ga0070682_1007292012 151
1195 3300005338 Ga0068868_100034277 Ga0068868_1000342776 151
1196 3300005338 Ga0068868_100366737 Ga0068868_1003667372 151
1197 3300005339 Ga0070660_100054443 Ga0070660_1000544432 151
1198 3300005339 Ga0070660_100251462 Ga0070660_1002514622 151
1199 3300005339 Ga0070660_101033479 Ga0070660_1010334792 151
1200 3300005340 Ga0070689_100003596 Ga0070689_10000359612 151
1201 3300005340 Ga0070689_100173621 Ga0070689_1001736213 151
1202 3300005341 Ga0070691_10038900 Ga0070691_100389002 151
1203 3300005343 Ga0070687_100072956 Ga0070687_1000729562 151
1204 3300005344 Ga0070661_100361050 Ga0070661_1003610501 151
1205 3300005345 Ga0070692_10007210 Ga0070692_100072105 151
1206 3300005347 Ga0070668_100159111 Ga0070668_1001591112 151
1207 3300005347 Ga0070668_101589365 Ga0070668_1015893651 151
1208 3300005347 Ga0070668_101758854 Ga0070668_1017588541 151
1209 3300005353 Ga0070669_100006422 Ga0070669_1000064229 151
1210 3300005354 Ga0070675_100018382 Ga0070675_1000183822 151
1211 3300005354 Ga0070675_100270139 Ga0070675_1002701392 151
1212 3300005355 Ga0070671_100038425 Ga0070671_1000384256 151
1213 3300005355 Ga0070671_100220415 Ga0070671_1002204153 151
1214 3300005355 Ga0070671_100430576 Ga0070671_1004305762 151
1215 3300005356 Ga0070674_101406553 Ga0070674_1014065531 151
1216 3300005364 Ga0070673_100039430 Ga0070673_1000394305 151
1217 3300005364 Ga0070673_100202033 Ga0070673_1002020331 151
1218 3300005365 Ga0070688_100088375 Ga0070688_1000883753 151
1219 3300005365 Ga0070688_100182803 Ga0070688_1001828032 151
1220 3300005366 Ga0070659_100001717 Ga0070659_10000171713 151
1221 3300005366 Ga0070659_100108887 Ga0070659_1001088872 151
1222 3300005367 Ga0070667_100013755 Ga0070667_1000137555 151
1223 3300005367 Ga0070667_100041700 Ga0070667_1000417003 151
1224 3300005434 Ga0070709_10003164 Ga0070709_1000316411 151
1225 3300005434 Ga0070709_10015523 Ga0070709_100155233 151
1226 3300005435 Ga0070714_100035682 Ga0070714_1000356825 151
1227 3300005435 Ga0070714_100059620 Ga0070714_1000596202 151
1228 3300005435 Ga0070714_100450242 Ga0070714_1004502422 151
1229 3300005436 Ga0070713_100010765 Ga0070713_1000107653 151
1230 3300005436 Ga0070713_100649623 Ga0070713_1006496232 151
1231 3300005437 Ga0070710_10005109 Ga0070710_100051092 151
1232 3300005437 Ga0070710_10008128 Ga0070710_100081283 151
1233 3300005437 Ga0070710_10776448 Ga0070710_107764482 151
1234 3300005437 Ga0070710_10829503 Ga0070710_108295032 151
1235 3300005438 Ga0070701_10002689 Ga0070701_100026899 151
1236 3300005439 Ga0070711_100512470 Ga0070711_1005124702 151
1237 3300005439 Ga0070711_100617192 Ga0070711_1006171922 151
1238 3300005439 Ga0070711_100662892 Ga0070711_1006628921 151
1239 3300005440 Ga0070705_100151035 Ga0070705_1001510352 151
1240 3300005440 Ga0070705_100200784 Ga0070705_1002007842 151
1241 3300005441 Ga0070700_100003759 Ga0070700_1000037592 151
1242 3300005441 Ga0070700_100276053 Ga0070700_1002760532 151
1243 3300005444 Ga0070694_100230917 Ga0070694_1002309172 151
1244 3300005444 Ga0070694_100673888 Ga0070694_1006738882 151
1245 3300005455 Ga0070663_100118071 Ga0070663_1001180713 151
1246 3300005455 Ga0070663_100498553 Ga0070663_1004985532 151
1247 3300005456 Ga0070678_100022124 Ga0070678_1000221247 151
1248 3300005456 Ga0070678_100261147 Ga0070678_1002611472 151
1249 3300005457 Ga0070662_100001574 Ga0070662_1000015743 151
1250 3300005457 Ga0070662_100155726 Ga0070662_1001557262 151
1251 3300005458 Ga0070681_10008089 Ga0070681_100080895 151
1252 3300005458 Ga0070681_10162983 Ga0070681_101629833 151
1253 3300005458 Ga0070681_10273708 Ga0070681_102737082 151
1254 3300005458 Ga0070681_10301008 Ga0070681_103010082 151
1255 3300005458 Ga0070681_10504811 Ga0070681_105048112 151
1256 3300005458 Ga0070681_10574923 Ga0070681_105749232 151
1257 3300005459 Ga0068867_100163175 Ga0068867_1001631752 151
1258 3300005459 Ga0068867_100355232 Ga0068867_1003552321 151
1259 3300005466 Ga0070685_10072974 Ga0070685_100729743 151
1260 3300005518 Ga0070699_100666252 Ga0070699_1006662522 151
1261 3300005530 Ga0070679_100043547 Ga0070679_1000435474 151
1262 3300005530 Ga0070679_100177567 Ga0070679_1001775673 151
1263 3300005530 Ga0070679_100379489 Ga0070679_1003794892 151
1264 3300005530 Ga0070679_101073948 Ga0070679_1010739481 151
1265 3300005535 Ga0070684_100359583 Ga0070684_1003595831 151
1266 3300005536 Ga0070697_100936598 Ga0070697_1009365981 151
1267 3300005536 Ga0070697_101155172 Ga0070697_1011551721 151
1268 3300005539 Ga0068853_100554837 Ga0068853_1005548372 151
1269 3300005543 Ga0070672_100553499 Ga0070672_1005534992 151
1270 3300005543 Ga0070672_100765441 Ga0070672_1007654412 151
1271 3300005544 Ga0070686_100069411 Ga0070686_1000694113 151
1272 3300005544 Ga0070686_100103749 Ga0070686_1001037492 151
1273 3300005545 Ga0070695_100000422 Ga0070695_1000004229 151
1274 3300005545 Ga0070695_100100545 Ga0070695_1001005452 151
1275 3300005546 Ga0070696_100010897 Ga0070696_1000108975 151
1276 3300005546 Ga0070696_100023703 Ga0070696_1000237033 151
1277 3300005546 Ga0070696_100044657 Ga0070696_1000446574 151
1278 3300005546 Ga0070696_100125790 Ga0070696_1001257902 151
1279 3300005547 Ga0070693_100134285 Ga0070693_1001342852 151
1280 3300005547 Ga0070693_100362806 Ga0070693_1003628062 151
1281 3300005548 Ga0070665_100125441 Ga0070665_1001254412 151
1282 3300005548 Ga0070665_100611959 Ga0070665_1006119591 151
1283 3300005548 Ga0070665_100712772 Ga0070665_1007127722 151
1284 3300005549 Ga0070704_100240450 Ga0070704_1002404502 151
1285 3300005563 Ga0068855_100031114 Ga0068855_1000311142 151
1286 3300005563 Ga0068855_100321345 Ga0068855_1003213452 151
1287 3300005563 Ga0068855_100856454 Ga0068855_1008564542 151
1288 3300005563 Ga0068855_101404407 Ga0068855_1014044072 151
1289 3300005564 Ga0070664_100027234 Ga0070664_1000272345 151
1290 3300005564 Ga0070664_100563085 Ga0070664_1005630852 151
1291 3300005564 Ga0070664_100684651 Ga0070664_1006846511 151
1292 3300005564 Ga0070664_101524198 Ga0070664_1015241982 151
1293 3300005577 Ga0068857_100205381 Ga0068857_1002053813 151
1294 3300005578 Ga0068854_100518363 Ga0068854_1005183632 151
1295 3300005578 Ga0068854_100839145 Ga0068854_1008391452 151
1296 3300005614 Ga0068856_100301626 Ga0068856_1003016263 151
1297 3300005614 Ga0068856_100305830 Ga0068856_1003058301 151
1298 3300005615 Ga0070702_101525219 Ga0070702_1015252191 151
1299 3300005616 Ga0068852_100150823 Ga0068852_1001508233 151
1300 3300005616 Ga0068852_100996250 Ga0068852_1009962501 151
1301 3300005616 Ga0068852_101418782 Ga0068852_1014187821 151
1302 3300005617 Ga0068859_100048118 Ga0068859_1000481182 151
1303 3300005617 Ga0068859_100056449 Ga0068859_1000564492 151
1304 3300005617 Ga0068859_102062622 Ga0068859_1020626222 151
1305 3300005618 Ga0068864_100161296 Ga0068864_1001612962 151
1306 3300005618 Ga0068864_100585272 Ga0068864_1005852722 151
1307 3300005718 Ga0068866_10227651 Ga0068866_102276512 151
1308 3300005718 Ga0068866_10364924 Ga0068866_103649242 151
1309 3300005719 Ga0068861_100006045 Ga0068861_10000604510 151
1310 3300005719 Ga0068861_100122318 Ga0068861_1001223182 151
1311 3300005840 Ga0068870_10122319 Ga0068870_101223193 151
1312 3300005841 Ga0068863_100139216 Ga0068863_1001392162 151
1313 3300005842 Ga0068858_100035169 Ga0068858_1000351697 151
1314 3300005842 Ga0068858_100145849 Ga0068858_1001458492 151
1315 3300005842 Ga0068858_100401837 Ga0068858_1004018372 151
1316 3300005843 Ga0068860_100011520 Ga0068860_10001152010 151
1317 3300005843 Ga0068860_100052275 Ga0068860_1000522756 151
1318 3300005843 Ga0068860_100117679 Ga0068860_1001176793 151
1319 3300005844 Ga0068862_100076571 Ga0068862_1000765713 151
1320 3300005844 Ga0068862_100502068 Ga0068862_1005020682 151
1321 3300005937 Ga0081455_10004639 Ga0081455_1000463910 151
1322 3300005983 Ga0081540_1023199 Ga0081540_10231995 151
1323 3300006028 Ga0070717_10000580 Ga0070717_100005807 151
1324 3300006028 Ga0070717_10051445 Ga0070717_100514452 151
1325 3300006058 Ga0075432_10041206 Ga0075432_100412063 151
1326 3300006163 Ga0070715_10009739 Ga0070715_100097392 151
1327 3300006163 Ga0070715_10055451 Ga0070715_100554512 151
1328 3300006173 Ga0070716_100002502 Ga0070716_10000250211 151
1329 3300006175 Ga0070712_100058636 Ga0070712_1000586362 151
1330 3300006175 Ga0070712_100103310 Ga0070712_1001033102 151
1331 3300006175 Ga0070712_100221614 Ga0070712_1002216141 151
1332 3300006175 Ga0070712_100824780 Ga0070712_1008247802 151
1333 3300006175 Ga0070712_100937636 Ga0070712_1009376362 151
1334 3300006237 Ga0097621_100021532 Ga0097621_1000215323 151
1335 3300006237 Ga0097621_100032914 Ga0097621_1000329146 151
1336 3300006358 Ga0068871_100018558 Ga0068871_1000185586 151
1337 3300006358 Ga0068871_100027806 Ga0068871_1000278062 151
1338 3300006844 Ga0075428_100527820 Ga0075428_1005278202 151
1339 3300006846 Ga0075430_100034133 Ga0075430_1000341334 151
1340 3300006847 Ga0075431_100089696 Ga0075431_1000896962 151
1341 3300006847 Ga0075431_101410930 Ga0075431_1014109302 151
1342 3300006852 Ga0075433_10088298 Ga0075433_100882982 151
1343 3300006852 Ga0075433_10172792 Ga0075433_101727923 151
1344 3300006871 Ga0075434_100095097 Ga0075434_1000950974 151
1345 3300006871 Ga0075434_100639289 Ga0075434_1006392891 151
1346 3300006871 Ga0075434_101377573 Ga0075434_1013775731 151
1347 3300006880 Ga0075429_100142353 Ga0075429_1001423532 151
1348 3300006881 Ga0068865_100064290 Ga0068865_1000642903 151
1349 3300006881 Ga0068865_100076854 Ga0068865_1000768542 151
1350 3300006881 Ga0068865_100180431 Ga0068865_1001804313 151
1351 3300006931 Ga0097620_100048116 Ga0097620_1000481164 151
1352 3300006931 Ga0097620_100056449 Ga0097620_1000564492 151
1353 3300006931 Ga0097620_102062611 Ga0097620_1020626112 151
1354 3300007076 Ga0075435_100060881 Ga0075435_1000608813 151
1355 3300007076 Ga0075435_100170668 Ga0075435_1001706683 151
1356 3300007076 Ga0075435_100360758 Ga0075435_1003607582 151
1357 3300007076 Ga0075435_100505043 Ga0075435_1005050432 151
1358 3300007076 Ga0075435_101627576 Ga0075435_1016275761 151
1359 3300009011 Ga0105251_10013097 Ga0105251_100130975 151
1360 3300009011 Ga0105251_10088361 Ga0105251_100883612 151
1361 3300009093 Ga0105240_10108773 Ga0105240_101087732 151
1362 3300009093 Ga0105240_10409642 Ga0105240_104096422 151
1363 3300009094 Ga0111539_10005362 Ga0111539_100053625 151
1364 3300009094 Ga0111539_10141523 Ga0111539_101415233 151
1365 3300009094 Ga0111539_10254477 Ga0111539_102544772 151
1366 3300009094 Ga0111539_10486078 Ga0111539_104860782 151
1367 3300009098 Ga0105245_10083069 Ga0105245_100830695 151
1368 3300009098 Ga0105245_10268803 Ga0105245_102688032 151
1369 3300009101 Ga0105247_10009864 Ga0105247_100098643 151
1370 3300009101 Ga0105247_10124875 Ga0105247_101248752 151
1371 3300009147 Ga0114129_10160606 Ga0114129_101606063 151
1372 3300009147 Ga0114129_10246419 Ga0114129_102464192 151
1373 3300009148 Ga0105243_10015499 Ga0105243_100154995 151
1374 3300009148 Ga0105243_10029400 Ga0105243_100294004 151
1375 3300009174 Ga0105241_10023837 Ga0105241_100238374 151
1376 3300009174 Ga0105241_10120318 Ga0105241_101203182 151
1377 3300009174 Ga0105241_10326757 Ga0105241_103267572 151
1378 3300009174 Ga0105241_10776645 Ga0105241_107766452 151
1379 3300009176 Ga0105242_10023472 Ga0105242_100234727 151
1380 3300009176 Ga0105242_10054545 Ga0105242_100545455 151
1381 3300009176 Ga0105242_12348433 Ga0105242_123484331 151
1382 3300009177 Ga0105248_10081588 Ga0105248_100815883 151
1383 3300009177 Ga0105248_10333915 Ga0105248_103339152 151
1384 3300009177 Ga0105248_10364615 Ga0105248_103646153 151
1385 3300009545 Ga0105237_10030966 Ga0105237_100309667 151
1386 3300009545 Ga0105237_10131770 Ga0105237_101317703 151
1387 3300009551 Ga0105238_10065189 Ga0105238_100651893 151
1388 3300009551 Ga0105238_10324242 Ga0105238_103242422 151
1389 3300009553 Ga0105249_10001696 Ga0105249_100016968 151
1390 3300009553 Ga0105249_10391241 Ga0105249_103912411 151
1391 3300010375 Ga0105239_10204193 Ga0105239_102041933 151
1392 3300010375 Ga0105239_10296610 Ga0105239_102966102 151
1393 3300010375 Ga0105239_10626524 Ga0105239_106265242 151
1394 3300011119 Ga0105246_10058742 Ga0105246_100587423 151
1395 3300011119 Ga0105246_10192737 Ga0105246_101927372 151
1396 3300011119 Ga0105246_10252064 Ga0105246_102520642 151
1397 3300012482 Ga0157318_1014066 Ga0157318_10140662 151
1398 3300012491 Ga0157329_1015557 Ga0157329_10155571 151
1399 3300012494 Ga0157341_1003029 Ga0157341_10030292 151
1400 3300012494 Ga0157341_1006465 Ga0157341_10064652 151
1401 3300012495 Ga0157323_1001906 Ga0157323_10019062 151
1402 3300012498 Ga0157345_1005950 Ga0157345_10059502 151
1403 3300012500 Ga0157314_1004032 Ga0157314_10040321 151
1404 3300012507 Ga0157342_1001008 Ga0157342_10010082 151
1405 3300013100 Ga0157373_10110985 Ga0157373_101109852 151
1406 3300013100 Ga0157373_10850568 Ga0157373_108505682 151
1407 3300013102 Ga0157371_10212623 Ga0157371_102126231 151
1408 3300013102 Ga0157371_11096184 Ga0157371_110961842 151
1409 3300013104 Ga0157370_10217275 Ga0157370_102172752 151
1410 3300013105 Ga0157369_10494355 Ga0157369_104943552 151
1411 3300013105 Ga0157369_10544616 Ga0157369_105446162 151
1412 3300013296 Ga0157374_10028057 Ga0157374_100280573 151
1413 3300013296 Ga0157374_10293201 Ga0157374_102932012 151
1414 3300013296 Ga0157374_11172027 Ga0157374_111720271 151
1415 3300013297 Ga0157378_10299218 Ga0157378_102992182 151
1416 3300013297 Ga0157378_10442280 Ga0157378_104422802 151
1417 3300013306 Ga0163162_10203522 Ga0163162_102035222 151
1418 3300013306 Ga0163162_10324754 Ga0163162_103247542 151
1419 3300013307 Ga0157372_10466147 Ga0157372_104661472 151
1420 3300013307 Ga0157372_12604100 Ga0157372_126041001 151
1421 3300013308 Ga0157375_10012593 Ga0157375_100125937 151
1422 3300013308 Ga0157375_10071929 Ga0157375_100719293 151
1423 3300014325 Ga0163163_10088301 Ga0163163_100883014 151
1424 3300014745 Ga0157377_10119186 Ga0157377_101191862 151
1425 3300014968 Ga0157379_10053335 Ga0157379_100533353 151
1426 3300014968 Ga0157379_10618752 Ga0157379_106187522 151
1427 3300014969 Ga0157376_10214639 Ga0157376_102146393 151
1428 3300014969 Ga0157376_10307635 Ga0157376_103076352 151
1429 3300017792 Ga0163161_10211031 Ga0163161_102110312 151
1430 3300017792 Ga0163161_10438384 Ga0163161_104383841 151
1431 3300020070 Ga0206356_11150990 Ga0206356_111509902 151
1432 3300020081 Ga0206354_11510404 Ga0206354_115104042 151
1433 3300020082 Ga0206353_11873720 Ga0206353_118737201 151
1434 3300025315 Ga0207697_10007644 Ga0207697_100076445 151
1435 3300025315 Ga0207697_10208085 Ga0207697_102080852 151
1436 3300025321 Ga0207656_10098997 Ga0207656_100989972 151
1437 3300025898 Ga0207692_10014631 Ga0207692_100146317 151
1438 3300025898 Ga0207692_10023436 Ga0207692_100234362 151
1439 3300025898 Ga0207692_10053450 Ga0207692_100534503 151
1440 3300025899 Ga0207642_10028788 Ga0207642_100287882 151
1441 3300025900 Ga0207710_10002529 Ga0207710_100025298 151
1442 3300025900 Ga0207710_10011202 Ga0207710_100112025 151
1443 3300025901 Ga0207688_10148467 Ga0207688_101484672 151
1444 3300025903 Ga0207680_10052845 Ga0207680_100528453 151
1445 3300025903 Ga0207680_10087398 Ga0207680_100873982 151
1446 3300025905 Ga0207685_10210174 Ga0207685_102101742 151
1447 3300025906 Ga0207699_10002385 Ga0207699_1000238511 151
1448 3300025906 Ga0207699_10081396 Ga0207699_100813962 151
1449 3300025906 Ga0207699_10163636 Ga0207699_101636362 151
1450 3300025906 Ga0207699_10340600 Ga0207699_103406002 151
1451 3300025907 Ga0207645_10025748 Ga0207645_100257485 151
1452 3300025907 Ga0207645_10173965 Ga0207645_101739652 151
1453 3300025907 Ga0207645_10257397 Ga0207645_102573972 151
1454 3300025908 Ga0207643_10475302 Ga0207643_104753022 151
1455 3300025909 Ga0207705_10011785 Ga0207705_100117857 151
1456 3300025911 Ga0207654_10039087 Ga0207654_100390873 151
1457 3300025911 Ga0207654_10286624 Ga0207654_102866242 151
1458 3300025912 Ga0207707_10059791 Ga0207707_100597912 151
1459 3300025912 Ga0207707_10079464 Ga0207707_100794642 151
1460 3300025912 Ga0207707_10121156 Ga0207707_101211563 151
1461 3300025912 Ga0207707_10252292 Ga0207707_102522922 151
1462 3300025913 Ga0207695_10252176 Ga0207695_102521762 151
1463 3300025913 Ga0207695_10540430 Ga0207695_105404303 151
1464 3300025914 Ga0207671_10088814 Ga0207671_100888143 151
1465 3300025914 Ga0207671_10125301 Ga0207671_101253013 151
1466 3300025915 Ga0207693_10107729 Ga0207693_101077294 151
1467 3300025915 Ga0207693_10113161 Ga0207693_101131612 151
1468 3300025915 Ga0207693_10764884 Ga0207693_107648842 151
1469 3300025916 Ga0207663_10059712 Ga0207663_100597123 151
1470 3300025916 Ga0207663_10209093 Ga0207663_102090932 151
1471 3300025916 Ga0207663_11178851 Ga0207663_111788512 151
1472 3300025917 Ga0207660_10006298 Ga0207660_1000629812 151
1473 3300025917 Ga0207660_10017365 Ga0207660_100173655 151
1474 3300025917 Ga0207660_10237994 Ga0207660_102379942 151
1475 3300025917 Ga0207660_10298512 Ga0207660_102985122 151
1476 3300025917 Ga0207660_11408034 Ga0207660_114080342 151
1477 3300025918 Ga0207662_10069319 Ga0207662_100693192 151
1478 3300025919 Ga0207657_10088837 Ga0207657_100888372 151
1479 3300025919 Ga0207657_10186294 Ga0207657_101862943 151
1480 3300025919 Ga0207657_10276319 Ga0207657_102763192 151
1481 3300025919 Ga0207657_10326525 Ga0207657_103265252 151
1482 3300025920 Ga0207649_10040101 Ga0207649_100401013 151
1483 3300025921 Ga0207652_10089968 Ga0207652_100899682 151
1484 3300025921 Ga0207652_10165569 Ga0207652_101655692 151
1485 3300025921 Ga0207652_10179251 Ga0207652_101792512 151
1486 3300025921 Ga0207652_10229417 Ga0207652_102294171 151
1487 3300025921 Ga0207652_10875630 Ga0207652_108756302 151
1488 3300025923 Ga0207681_10024411 Ga0207681_100244115 151
1489 3300025923 Ga0207681_10237903 Ga0207681_102379032 151
1490 3300025924 Ga0207694_10120976 Ga0207694_101209764 151
1491 3300025924 Ga0207694_10123309 Ga0207694_101233092 151
1492 3300025925 Ga0207650_10102906 Ga0207650_101029063 151
1493 3300025926 Ga0207659_10027163 Ga0207659_100271635 151
1494 3300025927 Ga0207687_10047644 Ga0207687_100476443 151
1495 3300025928 Ga0207700_10040526 Ga0207700_100405265 151
1496 3300025928 Ga0207700_10103916 Ga0207700_101039162 151
1497 3300025929 Ga0207664_10137141 Ga0207664_101371412 151
1498 3300025931 Ga0207644_10006460 Ga0207644_1000646011 151
1499 3300025931 Ga0207644_11678234 Ga0207644_116782341 151
1500 3300025932 Ga0207690_10073600 Ga0207690_100736003 151
1501 3300025932 Ga0207690_10269961 Ga0207690_102699612 151
1502 3300025932 Ga0207690_10511668 Ga0207690_105116682 151
1503 3300025932 Ga0207690_10861758 Ga0207690_108617582 151
1504 3300025933 Ga0207706_10012794 Ga0207706_100127942 151
1505 3300025933 Ga0207706_10015046 Ga0207706_100150465 151
1506 3300025934 Ga0207686_10145674 Ga0207686_101456743 151
1507 3300025935 Ga0207709_10043087 Ga0207709_100430875 151
1508 3300025935 Ga0207709_10066135 Ga0207709_100661353 151
1509 3300025936 Ga0207670_10033150 Ga0207670_100331503 151
1510 3300025936 Ga0207670_10196876 Ga0207670_101968763 151
1511 3300025936 Ga0207670_10270878 Ga0207670_102708782 151
1512 3300025937 Ga0207669_10373980 Ga0207669_103739802 151
1513 3300025938 Ga0207704_10088177 Ga0207704_100881772 151
1514 3300025939 Ga0207665_10002320 Ga0207665_1000232012 151
1515 3300025939 Ga0207665_10187392 Ga0207665_101873922 151
1516 3300025939 Ga0207665_10228245 Ga0207665_102282452 151
1517 3300025940 Ga0207691_10742791 Ga0207691_107427912 151
1518 3300025940 Ga0207691_11286229 Ga0207691_112862291 151
1519 3300025941 Ga0207711_10064158 Ga0207711_100641583 151
1520 3300025941 Ga0207711_10086833 Ga0207711_100868332 151
1521 3300025941 Ga0207711_10179896 Ga0207711_101798962 151
1522 3300025942 Ga0207689_10017590 Ga0207689_100175906 151
1523 3300025942 Ga0207689_10371689 Ga0207689_103716892 151
1524 3300025944 Ga0207661_11506521 Ga0207661_115065211 151
1525 3300025945 Ga0207679_10129995 Ga0207679_101299953 151
1526 3300025945 Ga0207679_10424346 Ga0207679_104243462 151
1527 3300025945 Ga0207679_10444107 Ga0207679_104441072 151
1528 3300025945 Ga0207679_10503706 Ga0207679_105037061 151
1529 3300025945 Ga0207679_11158219 Ga0207679_111582192 151
1530 3300025949 Ga0207667_10009169 Ga0207667_100091696 151
1531 3300025949 Ga0207667_10085893 Ga0207667_100858932 151
1532 3300025949 Ga0207667_10142779 Ga0207667_101427792 151
1533 3300025949 Ga0207667_10259817 Ga0207667_102598171 151
1534 3300025949 Ga0207667_11060096 Ga0207667_110600961 151
1535 3300025960 Ga0207651_10184575 Ga0207651_101845752 151
1536 3300025960 Ga0207651_10268982 Ga0207651_102689822 151
1537 3300025961 Ga0207712_10061291 Ga0207712_100612913 151
1538 3300025961 Ga0207712_10083637 Ga0207712_100836373 151
1539 3300025972 Ga0207668_10480636 Ga0207668_104806362 151
1540 3300025972 Ga0207668_10659374 Ga0207668_106593742 151
1541 3300025981 Ga0207640_10237815 Ga0207640_102378152 151
1542 3300025981 Ga0207640_10552703 Ga0207640_105527032 151
1543 3300025986 Ga0207658_10027766 Ga0207658_100277664 151
1544 3300025986 Ga0207658_10031687 Ga0207658_100316874 151
1545 3300025986 Ga0207658_10162188 Ga0207658_101621883 151
1546 3300026023 Ga0207677_10964781 Ga0207677_109647812 151
1547 3300026035 Ga0207703_10054005 Ga0207703_100540053 151
1548 3300026035 Ga0207703_10075815 Ga0207703_100758153 151
1549 3300026041 Ga0207639_10046780 Ga0207639_100467802 151
1550 3300026041 Ga0207639_11244084 Ga0207639_112440842 151
1551 3300026067 Ga0207678_10039364 Ga0207678_100393642 151
1552 3300026067 Ga0207678_10243232 Ga0207678_102432322 151
1553 3300026067 Ga0207678_10468503 Ga0207678_104685032 151
1554 3300026075 Ga0207708_10007166 Ga0207708_1000716613 151
1555 3300026075 Ga0207708_10306232 Ga0207708_103062322 151
1556 3300026078 Ga0207702_10179557 Ga0207702_101795573 151
1557 3300026078 Ga0207702_10240056 Ga0207702_102400563 151
1558 3300026088 Ga0207641_10595765 Ga0207641_105957652 151
1559 3300026089 Ga0207648_10150331 Ga0207648_101503312 151
1560 3300026089 Ga0207648_10257248 Ga0207648_102572482 151
1561 3300026095 Ga0207676_10226791 Ga0207676_102267912 151
1562 3300026095 Ga0207676_10668258 Ga0207676_106682582 151
1563 3300026116 Ga0207674_10120112 Ga0207674_101201122 151
1564 3300026118 Ga0207675_100005803 Ga0207675_10000580310 151
1565 3300026121 Ga0207683_10000604 Ga0207683_1000060424 151
1566 3300026121 Ga0207683_10012670 Ga0207683_100126704 151
1567 3300026142 Ga0207698_10064141 Ga0207698_100641412 151
1568 3300026142 Ga0207698_10150938 Ga0207698_101509382 151
1569 3300026142 Ga0207698_10236353 Ga0207698_102363532 151
1570 3300027360 Ga0209969_1018684 Ga0209969_10186842 151
1571 3300027364 Ga0209967_1011648 Ga0209967_10116482 151
1572 3300027526 Ga0209968_1017318 Ga0209968_10173182 151
1573 3300027543 Ga0209999_1005199 Ga0209999_10051994 151
1574 3300027665 Ga0209983_1012066 Ga0209983_10120663 151
1575 3300027682 Ga0209971_1008003 Ga0209971_10080032 151
1576 3300027695 Ga0209966_1002733 Ga0209966_10027332 151
1577 3300027717 Ga0209998_10001308 Ga0209998_100013083 151
1578 3300027907 Ga0207428_10000528 Ga0207428_1000052825 151
1579 3300027907 Ga0207428_10001412 Ga0207428_1000141216 151
1580 3300027907 Ga0207428_10333412 Ga0207428_103334122 151
1581 3300028379 Ga0268266_10086824 Ga0268266_100868243 151
1582 3300028380 Ga0268265_10258535 Ga0268265_102585352 151
1583 3300028381 Ga0268264_10036802 Ga0268264_100368023 151
1584 3300028381 Ga0268264_10055174 Ga0268264_100551743 151
1585 3300028381 Ga0268264_10236336 Ga0268264_102363363 151
1586 3300028381 Ga0268264_11224407 Ga0268264_112244071 151
1587 3300031241 Ga0265325_10000062 Ga0265325_100000627 151
1588 3300031595 Ga0265313_10022528 Ga0265313_100225283 151
1589 3300031711 Ga0265314_10049675 Ga0265314_100496752 151
1590 3300031712 Ga0265342_10000348 Ga0265342_1000034833 151
1591 3300034816 Ga0373930_0013075 Ga0373930_0013075_933_1388 151
1592 3300034817 Ga0373948_0000223 Ga0373948_0000223_2269_2724 151
1593 3300034817 Ga0373948_0043723 Ga0373948_0043723_318_773 151
1594 3300034818 Ga0373950_0000536 Ga0373950_0000536_3715_4170 151
1595 3300034819 Ga0373958_0000051 Ga0373958_0000051_657_1112 151
1596 3300034819 Ga0373958_0006699 Ga0373958_0006699_321_776 151
1597 3300034957 Ga0373938_0000082 Ga0373938_0000082_6520_6975 151
1598 3300034957 Ga0373938_0036190 Ga0373938_0036190_373_828 151
1599 3300035084 Ga0373928_0000130 Ga0373928_0000130_10022_10477 151
1600 3300035084 Ga0373928_0001490 Ga0373928_0001490_2927_3382 151
1601 3300035084 Ga0373928_0066982 Ga0373928_0066982_275_730 151
1602 3300035085 Ga0373929_0028723 Ga0373929_0028723_273_728 151
1603 3300035086 Ga0373934_0161562 Ga0373934_0161562_269_724 151
1604 3300035088 Ga0373940_0000285 Ga0373940_0000285_3379_3834 151
1605 3300035088 Ga0373940_0002754 Ga0373940_0002754_1690_2145 151
1606 3300035089 Ga0373944_0029855 Ga0373944_0029855_971_1426 151
1607 3300035090 Ga0373949_0000533 Ga0373949_0000533_7421_7876 151
1608 3300035090 Ga0373949_0018845 Ga0373949_0018845_1018_1482 151
1609 3300035091 Ga0373951_0000415 Ga0373951_0000415_3378_3833 151
1610 3300035092 Ga0373952_0000016 Ga0373952_0000016_16639_17094 151
1611 3300035092 Ga0373952_0022265 Ga0373952_0022265_87_542 151
1612 3300035092 Ga0373952_0110266 Ga0373952_0110266_234_689 151
1613 3300035111 Ga0373923_0061303 Ga0373923_0061303_1065_1520 151
1614 3300035111 Ga0373923_0234992 Ga0373923_0234992_28_483 151
1615 3300035112 Ga0373932_0000752 Ga0373932_0000752_2862_3317 151
1616 3300035112 Ga0373932_0001517 Ga0373932_0001517_4575_5030 151
1617 3300035114 Ga0373939_0000298 Ga0373939_0000298_7482_7937 151
1618 3300035114 Ga0373939_0000784 Ga0373939_0000784_2719_3174 151
1619 3300035114 Ga0373939_0005068 Ga0373939_0005068_1504_1959 151
1620 3300035114 Ga0373939_0035419 Ga0373939_0035419_919_1374 151
1621 3300035114 Ga0373939_0258488 Ga0373939_0258488_189_644 151
1622 3300035115 Ga0373941_0000180 Ga0373941_0000180_3015_3470 151
1623 3300035115 Ga0373941_0251898 Ga0373941_0251898_113_568 151
1624 3300035117 Ga0373953_0027211 Ga0373953_0027211_1638_2093 151
1625 3300035118 Ga0373954_0002860 Ga0373954_0002860_5064_5519 151
1626 3300035118 Ga0373954_0017515 Ga0373954_0017515_200_655 151
1627 3300035119 Ga0373956_0012986 Ga0373956_0012986_118_573 151
1628 3300035119 Ga0373956_0235748 Ga0373956_0235748_355_810 151
1629 3300035119 Ga0373956_0348093 Ga0373956_0348093_82_537 151
1630 3300035120 Ga0373957_0008800 Ga0373957_0008800_2784_3239 151
1631 3300035120 Ga0373957_0059706 Ga0373957_0059706_675_1130 151
1632 3300035121 Ga0373960_0002043 Ga0373960_0002043_2677_3132 151
1633 3300035121 Ga0373960_0004024 Ga0373960_0004024_880_1335 151
1634 3300035121 Ga0373960_0286607 Ga0373960_0286607_114_569 151
1635 3300035170 Ga0373943_0073690 Ga0373943_0073690_1011_1466 151
1636 3300035170 Ga0373943_0252632 Ga0373943_0252632_383_838 151
1637 3300035171 Ga0373946_0098258 Ga0373946_0098258_540_995 151
1638 3300035171 Ga0373946_0217048 Ga0373946_0217048_442_897 151
1639 3300035172 Ga0373955_0003279 Ga0373955_0003279_418_873 151
1640 3300035172 Ga0373955_0087945 Ga0373955_0087945_947_1402 151
1641 3300035207 Ga0373942_0000890 Ga0373942_0000890_2996_3451 151
1642 3300035207 Ga0373942_0002933 Ga0373942_0002933_2210_2665 151
1643 3300035241 Ga0373961_0002364 Ga0373961_0002364_1518_1973 151
1644 3300035241 Ga0373961_0129233 Ga0373961_0129233_189_644 151
1645 3300035242 Ga0373962_0000695 Ga0373962_0000695_3940_4395 151
1646 3300035242 Ga0373962_0015722 Ga0373962_0015722_404_859 151
1647 3300035410 Ga0373924_0009703 Ga0373924_0009703_2853_3308 151
1648 3300035691 Ga0373931_0007190 Ga0373931_0007190_658_1113 151
1649 3300035691 Ga0373931_0013474 Ga0373931_0013474_1357_1812 151
1650 3300035691 Ga0373931_0188580 Ga0373931_0188580_750_1205 151
1651 3300035692 Ga0373935_0006152 Ga0373935_0006152_6448_6903 151
1652 3300035692 Ga0373935_0112937 Ga0373935_0112937_888_1343 151
1653 3300035692 Ga0373935_0186862 Ga0373935_0186862_640_1095 151
1654 3300035695 Ga0373927_0014484 Ga0373927_0014484_1874_2329 151
1655 3300035695 Ga0373927_0695909 Ga0373927_0695909_104_559 151
1656 3300035724 Ga0373933_0008756 Ga0373933_0008756_3948_4403 151
1657 3300035724 Ga0373933_0025020 Ga0373933_0025020_1989_2444 151
1658 3300035725 Ga0373947_0000461 Ga0373947_0000461_3888_4343 151
1659 3300035725 Ga0373947_0178280 Ga0373947_0178280_213_668 151
1660 3300036401 Ga0373937_0001465 Ga0373937_0001465_11527_11982 151
1661 3300036401 Ga0373937_0080374 Ga0373937_0080374_182_637 151
1662 3300037068 Ga0373925_0001840 Ga0373925_0001840_4410_4865 151
1663 3300037068 Ga0373925_0023631 Ga0373925_0023631_577_1032 151
1664 3300038996 Ga0242420_069385 Ga0242420_069385_97_552 151
1665 3300042005 Ga0439448_0041810 Ga0439448_0041810_94_549 151
1666 3300042008 Ga0439450_019657 Ga0439450_019657_586_1041 151
1667 3300042012 Ga0439455_0064102 Ga0439455_0064102_430_885 151
1668 3300042157 Ga0439458_0034527 Ga0439458_0034527_148_603 151
1669 3300042439 Ga0439464_0025163 Ga0439464_0025163_792_1247 151
1670 3300042461 Ga0439460_0002120 Ga0439460_0002120_2112_2567 151
1671 3300042532 Ga0450893_0013592 Ga0450893_0013592_567_1022 151
1672 3300044712 Ga0453684_0631579 Ga0453684_0631579_232_687 151
1673 3300044712 Ga0453684_1501980 Ga0453684_1501980_118_573 151
1674 3300045051 Ga0451576_0014126 Ga0451576_0014126_5965_6420 151
1675 3300046454 Ga0495592_0011873 Ga0495592_0011873_2492_2947 151
1676 3300046454 Ga0495592_0030625 Ga0495592_0030625_396_851 151
1677 3300046455 Ga0495603_0014409 Ga0495603_0014409_2174_2629 151
1678 3300046459 Ga0495629_0000102 Ga0495629_0000102_8658_9113 151
1679 3300046462 Ga0495651_0001857 Ga0495651_0001857_428_883 151
1680 3300046462 Ga0495651_0122804 Ga0495651_0122804_951_1406 151
1681 3300046463 Ga0495653_0018692 Ga0495653_0018692_1536_1991 151
1682 3300046473 Ga0495582_0023268 Ga0495582_0023268_2325_2780 151
1683 3300046473 Ga0495582_0046015 Ga0495582_0046015_588_1043 151
1684 3300046474 Ga0495605_0280662 Ga0495605_0280662_82_537 151
1685 3300046476 Ga0495662_0048399 Ga0495662_0048399_207_662 151
1686 3300046499 Ga0495594_0015194 Ga0495594_0015194_1240_1695 151
1687 3300046501 Ga0495607_0024108 Ga0495607_0024108_2199_2654 151
1688 3300046511 Ga0495608_0004665 Ga0495608_0004665_7236_7691 151
1689 3300046514 Ga0495618_0463737 Ga0495618_0463737_169_624 151
1690 3300046516 Ga0495628_0013184 Ga0495628_0013184_265_720 151
1691 3300046516 Ga0495628_0034488 Ga0495628_0034488_396_851 151
1692 3300046529 Ga0495652_0029748 Ga0495652_0029748_994_1449 151
1693 3300046529 Ga0495652_0075183 Ga0495652_0075183_1086_1541 151
1694 3300046531 Ga0495665_0015123 Ga0495665_0015123_56_511 151
1695 3300046533 Ga0495640_0006556 Ga0495640_0006556_8590_9045 151
1696 3300046536 Ga0495587_0007411 Ga0495587_0007411_3304_3759 151
1697 3300046536 Ga0495587_0152242 Ga0495587_0152242_633_1088 151
1698 3300046543 Ga0495645_0005931 Ga0495645_0005931_7062_7517 151
1699 3300046559 Ga0495667_0004216 Ga0495667_0004216_2809_3264 151
1700 3300046559 Ga0495667_0144154 Ga0495667_0144154_419_874 151
1701 3300046642 Ga0495634_0333887 Ga0495634_0333887_210_665 151
1702 3300046663 Ga0495635_0003618 Ga0495635_0003618_7035_7490 151
1703 3300046663 Ga0495635_0052067 Ga0495635_0052067_552_1007 151
1704 3300046664 Ga0495659_0182825 Ga0495659_0182825_319_774 151
1705 3300046674 Ga0495588_0047824 Ga0495588_0047824_363_818 151
1706 3300046675 Ga0495657_0009824 Ga0495657_0009824_2276_2731 151
1707 3300046675 Ga0495657_0060377 Ga0495657_0060377_1072_1527 151
1708 3300046678 Ga0495599_0017759 Ga0495599_0017759_2896_3351 151
1709 3300046678 Ga0495599_0092006 Ga0495599_0092006_661_1116 151
1710 3300046679 Ga0495623_0129740 Ga0495623_0129740_974_1429 151
1711 3300046680 Ga0495646_0017015 Ga0495646_0017015_524_979 151
1712 3300046680 Ga0495646_0116458 Ga0495646_0116458_896_1351 151
1713 3300046680 Ga0495646_0559598 Ga0495646_0559598_35_490 151
1714 3300046681 Ga0495647_0000220 Ga0495647_0000220_14648_15103 151
1715 3300046681 Ga0495647_0193524 Ga0495647_0193524_160_615 151
1716 3300046683 Ga0495658_0004011 Ga0495658_0004011_1028_1483 151
1717 3300046809 Ga0495600_0009218 Ga0495600_0009218_3495_3950 151
1718 3300047315 Ga0495581_0208007 Ga0495581_0208007_587_1042 151
1719 3300047317 Ga0495604_0008225 Ga0495604_0008225_5567_6022 151
1720 3300047317 Ga0495604_0054808 Ga0495604_0054808_2390_2845 151
1721 3300047319 Ga0495674_0095121 Ga0495674_0095121_67_522 151
1722 3300047319 Ga0495674_0837281 Ga0495674_0837281_97_552 151
1723 3300047321 Ga0495676_0259927 Ga0495676_0259927_219_674 151
1724 3300047322 Ga0495680_0017205 Ga0495680_0017205_3870_4325 151
1725 3300047322 Ga0495680_0047548 Ga0495680_0047548_2565_3020 151
1726 3300047322 Ga0495680_0128632 Ga0495680_0128632_10_465 151
1727 3300047444 Ga0495675_0011758 Ga0495675_0011758_3509_3964 151
1728 3300047444 Ga0495675_0041487 Ga0495675_0041487_1429_1884 151
1729 3300047471 Ga0495684_0063368 Ga0495684_0063368_802_1257 151
1730 3300047471 Ga0495684_0188675 Ga0495684_0188675_716_1171 151
1731 3300047673 Ga0495593_0023958 Ga0495593_0023958_2037_2492 151
1732 3300048088 Ga0495602_0014308 Ga0495602_0014308_5800_6255 151
1733 3300048088 Ga0495602_0034153 Ga0495602_0034153_987_1442 151
1734 3300048089 Ga0495614_0061324 Ga0495614_0061324_281_736 151
1735 3300048903 Ga0496100_0027290 Ga0496100_0027290_1987_2442 151
1736 3300048904 Ga0496101_0411671 Ga0496101_0411671_587_1042 151
1737 3300048904 Ga0496101_0485678 Ga0496101_0485678_45_500 151
1738 3300048904 Ga0496101_0692796 Ga0496101_0692796_45_500 151
1739 3300048905 Ga0496102_0039370 Ga0496102_0039370_2100_2555 151
1740 3300048905 Ga0496102_0054108 Ga0496102_0054108_82_537 151
1741 3300048905 Ga0496102_0657070 Ga0496102_0657070_472_927 151
1742 3300048905 Ga0496102_1376915 Ga0496102_1376915_125_580 151
1743 3300048906 Ga0496103_0200419 Ga0496103_0200419_402_857 151
1744 3300048906 Ga0496103_0249421 Ga0496103_0249421_389_844 151
1745 3300048907 Ga0496104_0023486 Ga0496104_0023486_419_874 151
1746 3300048907 Ga0496104_0103787 Ga0496104_0103787_2058_2513 151
1747 3300048907 Ga0496104_0730453 Ga0496104_0730453_398_853 151
1748 3300048907 Ga0496104_1553632 Ga0496104_1553632_65_520 151
1749 3300048908 Ga0496105_0001001 Ga0496105_0001001_12821_13276 151
1750 3300048908 Ga0496105_0020521 Ga0496105_0020521_634_1089 151
1751 3300048908 Ga0496105_0183889 Ga0496105_0183889_525_980 151
1752 3300048909 Ga0496106_0029044 Ga0496106_0029044_294_749 151
1753 3300048909 Ga0496106_0785924 Ga0496106_0785924_93_548 151
1754 3300048909 Ga0496106_1448966 Ga0496106_1448966_53_508 151
1755 3300048910 Ga0496107_0042962 Ga0496107_0042962_58_513 151
1756 3300048910 Ga0496107_0299646 Ga0496107_0299646_556_1011 151
1757 3300048910 Ga0496107_0386184 Ga0496107_0386184_294_749 151
1758 3300048910 Ga0496107_0482802 Ga0496107_0482802_44_499 151
1759 3300048911 Ga0496108_0035528 Ga0496108_0035528_1703_2158 151
1760 3300048911 Ga0496108_0612506 Ga0496108_0612506_218_673 151
1761 3300048912 Ga0496109_0061064 Ga0496109_0061064_1303_1758 151
1762 3300048912 Ga0496109_0125137 Ga0496109_0125137_1633_2088 151
1763 3300048912 Ga0496109_0158313 Ga0496109_0158313_45_500 151
1764 3300048912 Ga0496109_0801996 Ga0496109_0801996_80_535 151
1765 3300048913 Ga0496110_0004745 Ga0496110_0004745_9270_9725 151
1766 3300048913 Ga0496110_0025359 Ga0496110_0025359_3069_3524 151
1767 3300048913 Ga0496110_0078466 Ga0496110_0078466_1611_2066 151
1768 3300048914 Ga0496111_0003290 Ga0496111_0003290_6787_7242 151
1769 3300048915 Ga0496112_0220137 Ga0496112_0220137_87_542 151
1770 3300048915 Ga0496112_0302187 Ga0496112_0302187_815_1270 151
1771 3300048915 Ga0496112_0362358 Ga0496112_0362358_892_1347 151
1772 3300048915 Ga0496112_0376706 Ga0496112_0376706_861_1316 151
1773 3300048915 Ga0496112_0390944 Ga0496112_0390944_294_749 151
1774 3300048915 Ga0496112_1168289 Ga0496112_1168289_123_578 151
1775 3300048916 Ga0496113_0000277 Ga0496113_0000277_1021_1476 151
1776 3300048916 Ga0496113_0041229 Ga0496113_0041229_670_1125 151
1777 3300048917 Ga0496114_0018702 Ga0496114_0018702_2731_3186 151
1778 3300048917 Ga0496114_0098458 Ga0496114_0098458_93_548 151
1779 3300048917 Ga0496114_1447964 Ga0496114_1447964_70_525 151
1780 3300048918 Ga0496115_0013992 Ga0496115_0013992_3369_3824 151
1781 3300048918 Ga0496115_0123264 Ga0496115_0123264_30_485 151
1782 3300048918 Ga0496115_0325938 Ga0496115_0325938_94_549 151
1783 3300048928 Ga0496125_0251464 Ga0496125_0251464_334_789 151
1784 3300049572 Ga0501036_0232539 Ga0501036_0232539_366_821 151
1785 3300049581 Ga0501047_0028483 Ga0501047_0028483_3103_3564 151
1786 3300049589 Ga0501073_0515186 Ga0501073_0515186_308_769 151
1787 3300049591 Ga0501075_0286039 Ga0501075_0286039_146_601 151
1788 3300049592 Ga0501076_0068824 Ga0501076_0068824_1103_1558 151
1789 3300049593 Ga0501077_0504767 Ga0501077_0504767_233_688 151
1790 3300049741 Ga0501079_0923396 Ga0501079_0923396_128_583 151
1791 3300049743 Ga0501081_0306076 Ga0501081_0306076_381_836 151
1792 3300049823 Ga0501044_0051105 Ga0501044_0051105_1504_1965 151
1793 3300050507 nmdc:mga05p37_17594_c1 nmdc:mga05p37_17594_c1_433_888 151
1794 3300050509 nmdc:mga0qj67_48091_c1 nmdc:mga0qj67_48091_c1_520_975 151
1795 3300050511 nmdc:mga08y16_180705_c1 nmdc:mga08y16_180705_c1_520_975 151
1796 3300050511 nmdc:mga08y16_247628_c1 nmdc:mga08y16_247628_c1_934_1389 151
1797 3300050511 nmdc:mga08y16_74850_c1 nmdc:mga08y16_74850_c1_2251_2706 151
1798 3300050512 nmdc:mga0n895_242733_c1 nmdc:mga0n895_242733_c1_392_847 151
1799 3300050512 nmdc:mga0n895_289544_c1 nmdc:mga0n895_289544_c1_98_553 151
1800 3300050512 nmdc:mga0n895_35605_c1 nmdc:mga0n895_35605_c1_3250_3705 151
1801 3300050512 nmdc:mga0n895_6700_c1 nmdc:mga0n895_6700_c1_8929_9384 151
1802 3300050512 nmdc:mga0n895_890954_c1 nmdc:mga0n895_890954_c1_16_471 151
1803 3300050513 nmdc:mga0rr50_274071_c1 nmdc:mga0rr50_274071_c1_221_676 151
1804 3300050513 nmdc:mga0rr50_39027_c1 nmdc:mga0rr50_39027_c1_1433_1888 151
1805 3300050513 nmdc:mga0rr50_512446_c1 nmdc:mga0rr50_512446_c1_62_517 151
1806 3300050513 nmdc:mga0rr50_8249_c1 nmdc:mga0rr50_8249_c1_685_1140 151
1807 3300050514 nmdc:mga08x19_78337_c1 nmdc:mga08x19_78337_c1_983_1438 151
1808 3300050515 nmdc:mga0a205_261161_c1 nmdc:mga0a205_261161_c1_498_953 151
1809 3300050515 nmdc:mga0a205_87055_c1 nmdc:mga0a205_87055_c1_2202_2657 151
1810 3300050515 nmdc:mga0a205_92285_c1 nmdc:mga0a205_92285_c1_2271_2726 151
1811 3300053077 Ga0495601_0000047 Ga0495601_0000047_12280_12735 151
1812 3300053077 Ga0495601_0018096 Ga0495601_0018096_208_663 151
1813 3300053078 Ga0495612_0000445 Ga0495612_0000445_12046_12501 151
1814 3300053078 Ga0495612_0002406 Ga0495612_0002406_5147_5602 151
1815 3300053084 Ga0495595_0019108 Ga0495595_0019108_2008_2463 151
1816 3300053084 Ga0495595_0020883 Ga0495595_0020883_1739_2194 151
1817 3300053085 Ga0495619_0000122 Ga0495619_0000122_30574_31029 151
1818 3300053085 Ga0495619_0000740 Ga0495619_0000740_4261_4716 151
1819 3300053085 Ga0495619_0010941 Ga0495619_0010941_2639_3094 151
1820 3300054114 Ga0501084_0162844 Ga0501084_0162844_137_592 151
1821 3300061734 Ga0530510_0675163 Ga0530510_0675163_276_731 151

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02472

ExbD

Biopolymer transport protein ExbD/TolR

25

153

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
8p9r-assembly1.cif.gz_B structure of the periplasmic domain of exbd from e. coli in complex with tonb 0.9176 68 141
8p9r-assembly1.cif.gz_B structure of the periplasmic domain of exbd from e. coli in complex with tonb 0.8944 68 141
8pek-assembly1.cif.gz_B structure of the dimeric, periplasmic domain of exbd 0.7752 53 141
2pfu-assembly1.cif.gz_A nmr structure determination of the periplasmic domain of exbd from e.coli 0.7653 67 151
5by4-assembly1.cif.gz_A-2 structure and function of the escherichia coli tol-pal stator protein tolr 0.7646 66 143
ID Description Score Start End Superfamily
2pfuA01 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5; 0.8405 69 140 3.30.420.270
2pfuA01 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5; 0.8303 69 140 3.30.420.270
af_Q8CG27_49_184_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.7735 106 143 3.30.420.40
af_Q2G056_117_224_3.40.50.2020 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.7609 109 142 3.40.50.2020
af_Q2FV38_1_194_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.7366 109 142 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A660QA23-F1-model_v4 Biopolymer transporter ExbD 0.8279 68 142 GO:0005886
GO:0015031
GO:0022857
AF-F0CAJ8-F1-model_v4 deleted 0.8057 69 141
AF-A0A660QA23-F1-model_v4 Biopolymer transporter ExbD 0.8007 68 142 GO:0005886
GO:0015031
GO:0022857
AF-A0A350P316-F1-model_v4 Biopolymer transporter ExbD 0.7831 50 142 GO:0005886
GO:0015031
GO:0022857
AF-A0A2V9XR31-F1-model_v4 Biopolymer transporter ExbD 0.7806 61 151 GO:0005886
GO:0015031
GO:0022857

Feature Viewer

pLDDT pTM Quality
74.87 0.5 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map