F495802
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1822 | 488 | 3645 | 256 |
Family's Representative Sequence
| Representative Sequence | 3300026088|Ga0207641_10638083|Ga0207641_106380832 |
| Length | 275 |
| Sequence | MDFDDLLFQTNILLRDFPDVLLKYQDKFRYIEEGEGEPLVLLHGLFGALSNFKDLIEYFRHHNKVVVPMLPLFELDILHTSVGGLAKFVHRFIESRGYRDVHLMGNSLGGHVALIHILKHPERIKSLILTGSSGLFENGMGDSYPKRGDYDYIKRKTELTFYDPKMATKELVDEIFEITNNRLKVIKTIALAKSAIRNNLGEELNQIKQPTLLVWGNNDTITPPFVAREFNRLIPNSELHFIDKCGHAPMMEVPDEFNTILHKFLKKQNEPATVA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 4 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 5 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 6 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 7 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 8 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 9 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 10 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 11 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 12 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 13 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 14 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 15 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 16 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 17 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 18 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 19 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 20 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 21 | 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 22 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 23 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 24 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 25 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 26 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 27 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 28 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 32 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 35 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 37 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 39 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 41 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 52 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 60 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 61 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 62 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 64 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 65 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 66 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 67 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 69 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 73 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 74 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 76 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 77 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 78 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 80 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 81 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 82 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 83 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 84 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 85 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 86 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 87 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 88 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 89 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 90 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 91 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 92 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 93 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 94 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 95 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 96 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 98 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 99 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 100 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 101 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 102 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 103 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 104 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 132 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 136 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 137 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 138 | 3300015682 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 | Metagenome | Rhizosphere |
| 139 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 141 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 142 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 143 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 144 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 145 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 146 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 147 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 148 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 149 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 150 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 151 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 152 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 153 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 154 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 156 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 157 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 158 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 159 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 160 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 161 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 162 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 221 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 225 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 226 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 227 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 228 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 229 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 230 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 231 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 232 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 233 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 234 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 235 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 236 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 237 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 238 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 239 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 240 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 241 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 242 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 243 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 244 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 245 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 246 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 247 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 248 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 249 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 250 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 251 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 252 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 253 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 254 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 255 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 256 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 257 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 258 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 259 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 260 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 261 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 262 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 263 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 264 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 265 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 266 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 267 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 268 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 269 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 270 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 271 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 272 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 273 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 274 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 275 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 276 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 277 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 278 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 279 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 280 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 281 | 3300042124 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 | Metagenome | Rhizosphere |
| 282 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 283 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 284 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 285 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 286 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 287 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 288 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 289 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 290 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 291 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 292 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 293 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 294 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 295 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 296 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 297 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 298 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 299 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 300 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 301 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 302 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 303 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 356 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 357 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 358 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 359 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 360 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 361 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 362 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 363 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 364 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 365 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 366 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300049514 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought | Metagenome | Rhizosphere |
| 369 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 370 | 3300049551 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 371 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 372 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 373 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 374 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 375 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 376 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 377 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 378 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 379 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 380 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 381 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 382 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 383 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 384 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 385 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 386 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 387 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 388 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 389 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 390 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 391 | 3300049680 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought | Metagenome | Rhizosphere |
| 392 | 3300049682 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought | Metagenome | Rhizosphere |
| 393 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 394 | 3300049703 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control | Metagenome | Rhizosphere |
| 395 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 396 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 397 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 398 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 399 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 400 | 3300049767 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought | Metagenome | Rhizosphere |
| 401 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 402 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 403 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 404 | 3300050005 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought | Metagenome | Rhizosphere |
| 405 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 406 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 407 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 408 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 409 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 410 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 411 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 412 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 413 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 414 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 415 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 416 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 417 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 418 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 419 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 420 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 421 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 422 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 423 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 424 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 425 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 426 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 427 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 428 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 429 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 430 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 431 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 432 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 433 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 434 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 435 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 436 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 437 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 438 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 439 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 440 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 441 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 442 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 443 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 444 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 445 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 446 | 3300059631 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 168R_SD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 447 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 448 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 449 | 2522125168 | Dyadobacter beijingensis DSM 21582 | Isolate | Rhizosphere |
| 450 | 2585427687 | Pedobacter borealis DSM 19626 | Isolate | Rhizosphere |
| 451 | 2599185184 | Mucilaginibacter sp. NFR10 | Isolate | Rhizoplane |
| 452 | 2738541278 | Niastella sp. CF465 | Isolate | Unclassified |
| 453 | 2738541283 | Pedobacter sp. OK701 | Isolate | Unclassified |
| 454 | 2738541284 | Pedobacter sp. YR016 | Isolate | Unclassified |
| 455 | 2738541302 | Pedobacter sp. CF074 | Isolate | Unclassified |
| 456 | 2738543023 | Pedobacter sp. OK628 | Isolate | Unclassified |
| 457 | 2739367651 | Pedobacter sp. OK291 | Isolate | Unclassified |
| 458 | 2739367656 | Pedobacter sp. CF523 | Isolate | Unclassified |
| 459 | 2739367663 | Pedobacter sp. YR510 | Isolate | Unclassified |
| 460 | 2775506987 | Pedobacter ginsengisoli T01R-27 | Isolate | Unclassified |
| 461 | 2818991437 | Pedobacter terrae 518 | Isolate | Unclassified |
| 462 | 2818991444 | Filimonas endophytica 3197 | Isolate | Unclassified |
| 463 | 2840677318 | Chitinophaga alhagiae T22 | Isolate | Unclassified |
| 464 | 2842722452 | Pedobacter sp. R-72249 | Isolate | Unclassified |
| 465 | 2842903701 | Olivibacter sp. R-72191 | Isolate | Unclassified |
| 466 | 2842909656 | Pedobacter sp. R-72393 | Isolate | Unclassified |
| 467 | 2849281842 | Pedobacter sp. AK013 | Isolate | Rhizosphere |
| 468 | 2852623160 | Mucilaginibacter sp. AK015 | Isolate | Rhizosphere |
| 469 | 2852627209 | Pedobacter sp. AK017 | Isolate | Rhizosphere |
| 470 | 2857627736 | Pedobacter sp. R-74587 | Isolate | Unclassified |
| 471 | 2883068021 | Chitinophaga rhizosphaerae T16R-86 | Isolate | Rhizosphere |
| 472 | 2884933994 | Mucilaginibacter sp. 14171R-50 | Isolate | Rhizosphere |
| 473 | 2895498888 | Pseudoxanthomonas sp. SGD-10 | Isolate | Rhizosphere |
| 474 | 2896085136 | Chitinophaga alhagiae T22 | Isolate | Unclassified |
| 475 | 2902048731 | Pedobacter ureilyticus THG-T11 | Isolate | Rhizosphere |
| 476 | 2904445276 | Pedobacter terrae 1734 | Isolate | Rhizosphere |
| 477 | 2911138879 | Spirosoma sp. KUDC1026 | Isolate | Rhizosphere |
| 478 | 2914759650 | Rhizosphaericola mali | Isolate | Rhizosphere |
| 479 | 2919186247 | Pedobacter africanus 2697 | Isolate | Rhizosphere |
| 480 | 2919437846 | Mucilaginibacter pocheonensis 3262 | Isolate | Rhizosphere |
| 481 | 2928078545 | Mucilaginibacter rubeus 1215 | Isolate | Unclassified |
| 482 | 2928147474 | Mucilaginibacter rubeus 2025 | Isolate | Unclassified |
| 483 | 2929154850 | Filimonas sp. R-72421 Hybrid assembly | Isolate | Unclassified |
| 484 | 2932082852 | Mucilaginibacter sp. 3215 | Isolate | Rhizosphere |
| 485 | 2939664404 | Pedobacter africanus 2990 | Isolate | Rhizosphere |
| 486 | 2945997725 | Pedobacter sp. W3I1 | Isolate | Rhizosphere |
| 487 | 2954016120 | Flavobacterium sp. W4I14 | Isolate | Rhizosphere |
| 488 | 2977232053 | Mucilaginibacter terrae SORGH_AS 422 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.26 |
| Metatranscriptomes | 0.49 |
| Isolates | 2.25 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.38 |
| Nodule | 0 |
| Rhizoplane | 0.77 |
| Rhizosphere | 89.02 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 14.27 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0207641_10638083 | 3300026088 | Bacteria | 1045 |
| 2 | SwRhRL2b_contig_900390 | 2162886007 | Bacteria | 3160 |
| 3 | ARcpr5yngRDRAFT_c004046 | 3300000043 | Bacteria | 1403 |
| 4 | JGI24736J21556_1011832 | 3300001904 | Bacteria | 1417 |
| 5 | JGI24735J21928_10000013 | 3300002067 | Bacteria | 208663 |
| 6 | JGI24744J21845_10004274 | 3300002077 | Bacteria | 2948 |
| 7 | JGI24744J21845_10007841 | 3300002077 | Bacteria | 2204 |
| 8 | JGI24751J29686_10000514 | 3300002459 | Bacteria | 11195 |
| 9 | JGI25162J39368_1000011 | 3300002737 | Bacteria | 379156 |
| 10 | JGI25162J39368_1000107 | 3300002737 | Bacteria | 90782 |
| 11 | JGI25162J39368_1001539 | 3300002737 | Bacteria | 11872 |
| 12 | JGI25150J39212_1000014 | 3300002774 | Bacteria | 170955 |
| 13 | JGI25159J45721_1031796 | 3300002987 | Unclassified | 841 |
| 14 | JGI25151J46595_10000042 | 3300003187 | Bacteria | 170955 |
| 15 | JGI25165J46597_1000157 | 3300003214 | Bacteria | 108987 |
| 16 | JGI25153J46596_10000009 | 3300003215 | Bacteria | 340925 |
| 17 | rootH1_10057698 | 3300003316 | Bacteria | 4718 |
| 18 | rootH1_10069966 | 3300003316 | Bacteria | 11095 |
| 19 | rootH1_10072769 | 3300003316 | Bacteria | 2126 |
| 20 | rootH2_10005336 | 3300003320 | Bacteria | 90063 |
| 21 | rootH2_10089486 | 3300003320 | Bacteria | 11519 |
| 22 | rootH2_10135214 | 3300003320 | Bacteria | 1020 |
| 23 | rootH2_10135408 | 3300003320 | Bacteria | 8807 |
| 24 | rootH2_10239708 | 3300003320 | Bacteria | 3298 |
| 25 | rootL2_10011714 | 3300003322 | Bacteria | 7320 |
| 26 | rootL2_10034522 | 3300003322 | Bacteria | 1219 |
| 27 | rootL2_10062555 | 3300003322 | Bacteria | 13427 |
| 28 | rootL2_10072205 | 3300003322 | Bacteria | 3733 |
| 29 | rootL2_10082704 | 3300003322 | Unclassified | 1177 |
| 30 | rootL2_10242251 | 3300003322 | Bacteria | 2836 |
| 31 | rootL2_10291845 | 3300003322 | Bacteria | 1848 |
| 32 | rootH1_10045017 | 3300003323 | Bacteria | 20986 |
| 33 | rootH1_10055568 | 3300003316 | Bacteria | 3133 |
| 34 | rootH1_10055568 | 3300003323 | Bacteria | 17832 |
| 35 | rootH1_10067100 | 3300003323 | Unclassified | 1783 |
| 36 | rootH1_10122117 | 3300003323 | Bacteria | 6475 |
| 37 | rootH1_10160751 | 3300003323 | Bacteria | 5256 |
| 38 | rootH1_10163117 | 3300003323 | Bacteria | 3031 |
| 39 | rootH1_10176161 | 3300003323 | Bacteria | 1179 |
| 40 | rootH1_10323063 | 3300003323 | Unclassified | 1415 |
| 41 | JGI25160J50197_1001629 | 3300003354 | Bacteria | 11019 |
| 42 | JGI25160J50197_1011154 | 3300003354 | Unclassified | 3204 |
| 43 | Ga0055536_1000019 | 3300003781 | Bacteria | 203087 |
| 44 | Ga0055530_10000770 | 3300003791 | Bacteria | 26722 |
| 45 | Ga0058859_10680689 | 3300004798 | Bacteria | 1151 |
| 46 | Ga0065165_1000861 | 3300005262 | Bacteria | 39684 |
| 47 | Ga0065714_10003901 | 3300005288 | Bacteria | 12762 |
| 48 | Ga0065714_10005215 | 3300005288 | Bacteria | 4077 |
| 49 | Ga0065714_10010117 | 3300005288 | Bacteria | 2461 |
| 50 | Ga0065714_10023653 | 3300005288 | Bacteria | 1307 |
| 51 | Ga0065714_10072146 | 3300005288 | Bacteria | 3335 |
| 52 | Ga0065714_10084798 | 3300005288 | Bacteria | 2170 |
| 53 | Ga0065704_10000301 | 3300005289 | Bacteria | 42046 |
| 54 | Ga0065704_10008634 | 3300005289 | Bacteria | 2581 |
| 55 | Ga0065704_10111806 | 3300005289 | Unclassified | 1948 |
| 56 | Ga0065704_10256341 | 3300005289 | Bacteria | 974 |
| 57 | Ga0065712_10177389 | 3300005290 | Bacteria | 1210 |
| 58 | Ga0065715_10095897 | 3300005293 | Bacteria | 3984 |
| 59 | Ga0065715_10106495 | 3300005293 | Bacteria | 2818 |
| 60 | Ga0065715_10172051 | 3300005293 | Bacteria | 1538 |
| 61 | Ga0065707_10101033 | 3300005295 | Unclassified | 2889 |
| 62 | Ga0070658_10000028 | 3300005327 | Bacteria | 157278 |
| 63 | Ga0070658_10016538 | 3300005327 | Bacteria | 5903 |
| 64 | Ga0070658_10039485 | 3300005327 | Unclassified | 3808 |
| 65 | Ga0070658_10061402 | 3300005327 | Bacteria | 3062 |
| 66 | Ga0070658_10119415 | 3300005327 | Bacteria | 2190 |
| 67 | Ga0070658_10141055 | 3300005327 | Bacteria | 2013 |
| 68 | Ga0070658_10340798 | 3300005327 | Bacteria | 1282 |
| 69 | Ga0070676_10005029 | 3300005328 | Bacteria | 7006 |
| 70 | Ga0070676_10005673 | 3300005328 | Bacteria | 6646 |
| 71 | Ga0070676_10014015 | 3300005328 | Bacteria | 4399 |
| 72 | Ga0070676_10014253 | 3300005328 | Bacteria | 4367 |
| 73 | Ga0070676_10112938 | 3300005328 | Bacteria | 1694 |
| 74 | Ga0070676_10182001 | 3300005328 | Bacteria | 1367 |
| 75 | Ga0070683_100012644 | 3300005329 | Bacteria | 7338 |
| 76 | Ga0070683_100024392 | 3300005329 | Bacteria | 5417 |
| 77 | Ga0070683_100061333 | 3300005329 | Unclassified | 3497 |
| 78 | Ga0070683_100068007 | 3300005329 | Bacteria | 3318 |
| 79 | Ga0070683_100091702 | 3300005329 | Unclassified | 2853 |
| 80 | Ga0070683_100508679 | 3300005329 | Bacteria | 1151 |
| 81 | Ga0070690_100003978 | 3300005330 | Bacteria | 8171 |
| 82 | Ga0070690_100080114 | 3300005330 | Bacteria | 2135 |
| 83 | Ga0070690_100143156 | 3300005330 | Bacteria | 1624 |
| 84 | Ga0070690_100251784 | 3300005330 | Bacteria | 1249 |
| 85 | Ga0070690_100413144 | 3300005330 | Unclassified | 993 |
| 86 | Ga0070670_100008722 | 3300005331 | Bacteria | 8653 |
| 87 | Ga0070670_100021006 | 3300005331 | Bacteria | 5614 |
| 88 | Ga0070670_100034177 | 3300005331 | Unclassified | 4376 |
| 89 | Ga0070670_100060961 | 3300005331 | Bacteria | 3239 |
| 90 | Ga0070670_100101396 | 3300005331 | Bacteria | 2478 |
| 91 | Ga0070670_100110243 | 3300005331 | Bacteria | 2371 |
| 92 | Ga0070670_100118791 | 3300005331 | Bacteria | 2280 |
| 93 | Ga0070670_100212704 | 3300005331 | Bacteria | 1681 |
| 94 | Ga0070670_100300395 | 3300005331 | Bacteria | 1404 |
| 95 | Ga0070670_100305544 | 3300005331 | Bacteria | 1392 |
| 96 | Ga0070677_10004025 | 3300005333 | Bacteria | 4774 |
| 97 | Ga0070677_10035856 | 3300005333 | Bacteria | 1925 |
| 98 | Ga0068869_100002953 | 3300005334 | Bacteria | 10326 |
| 99 | Ga0068869_100003332 | 3300005334 | Bacteria | 9813 |
| 100 | Ga0068869_100003776 | 3300005334 | Bacteria | 9329 |
| 101 | Ga0068869_100004072 | 3300005334 | Bacteria | 9047 |
| 102 | Ga0068869_100007583 | 3300005334 | Bacteria | 6942 |
| 103 | Ga0068869_100010195 | 3300005334 | Bacteria | 6119 |
| 104 | Ga0068869_100010840 | 3300005334 | Bacteria | 5960 |
| 105 | Ga0068869_100071129 | 3300005334 | Bacteria | 2575 |
| 106 | Ga0068869_100095762 | 3300005334 | Unclassified | 2240 |
| 107 | Ga0068869_100132311 | 3300005334 | Bacteria | 1919 |
| 108 | Ga0068869_100172610 | 3300005334 | Unclassified | 1690 |
| 109 | Ga0068869_100209447 | 3300005334 | Bacteria | 1540 |
| 110 | Ga0070666_10000106 | 3300005335 | Bacteria | 57218 |
| 111 | Ga0070666_10002796 | 3300005335 | Bacteria | 10542 |
| 112 | Ga0070666_10010770 | 3300005335 | Bacteria | 5722 |
| 113 | Ga0070666_10027835 | 3300005335 | Bacteria | 3705 |
| 114 | Ga0070666_10077510 | 3300005335 | Bacteria | 2269 |
| 115 | Ga0070666_10139090 | 3300005335 | Unclassified | 1691 |
| 116 | Ga0070666_10210467 | 3300005335 | Bacteria | 1369 |
| 117 | Ga0070666_10223584 | 3300005335 | Bacteria | 1328 |
| 118 | Ga0070680_100016902 | 3300005336 | Bacteria | 5743 |
| 119 | Ga0070680_100079143 | 3300005336 | Bacteria | 2709 |
| 120 | Ga0070680_100093643 | 3300005336 | Unclassified | 2489 |
| 121 | Ga0070680_100139222 | 3300005336 | Bacteria | 2034 |
| 122 | Ga0070682_100000019 | 3300005337 | Bacteria | 220844 |
| 123 | Ga0070682_100009574 | 3300005337 | Bacteria | 5485 |
| 124 | Ga0070682_100016818 | 3300005337 | Bacteria | 4256 |
| 125 | Ga0070682_100043551 | 3300005337 | Bacteria | 2776 |
| 126 | Ga0070682_100075427 | 3300005337 | Bacteria | 2169 |
| 127 | Ga0070682_100337389 | 3300005337 | Unclassified | 1119 |
| 128 | Ga0068868_100000112 | 3300005338 | Bacteria | 50817 |
| 129 | Ga0068868_100006802 | 3300005338 | Bacteria | 8119 |
| 130 | Ga0068868_100007286 | 3300005338 | Bacteria | 7868 |
| 131 | Ga0068868_100012873 | 3300005338 | Bacteria | 6120 |
| 132 | Ga0068868_100013907 | 3300005338 | Bacteria | 5918 |
| 133 | Ga0068868_100019003 | 3300005338 | Bacteria | 5143 |
| 134 | Ga0068868_100031334 | 3300005338 | Bacteria | 4084 |
| 135 | Ga0068868_100055050 | 3300005338 | Bacteria | 3138 |
| 136 | Ga0068868_100158563 | 3300005338 | Bacteria | 1867 |
| 137 | Ga0068868_100179422 | 3300005338 | Unclassified | 1756 |
| 138 | Ga0070660_100008501 | 3300005339 | Bacteria | 7183 |
| 139 | Ga0070660_100024596 | 3300005339 | Bacteria | 4468 |
| 140 | Ga0070660_100025079 | 3300005339 | Bacteria | 4430 |
| 141 | Ga0070660_100030203 | 3300005339 | Bacteria | 4064 |
| 142 | Ga0070660_100263205 | 3300005339 | Bacteria | 1408 |
| 143 | Ga0070689_100019767 | 3300005340 | Bacteria | 4984 |
| 144 | Ga0070689_100067244 | 3300005340 | Bacteria | 2793 |
| 145 | Ga0070689_100124129 | 3300005340 | Bacteria | 2065 |
| 146 | Ga0070691_10016281 | 3300005341 | Unclassified | 3416 |
| 147 | Ga0070691_10079580 | 3300005341 | Bacteria | 1602 |
| 148 | Ga0070687_100251787 | 3300005343 | Unclassified | 1098 |
| 149 | Ga0070661_100007958 | 3300005344 | Bacteria | 7321 |
| 150 | Ga0070661_100008722 | 3300005344 | Bacteria | 7018 |
| 151 | Ga0070661_100034349 | 3300005344 | Bacteria | 3677 |
| 152 | Ga0070661_100174991 | 3300005344 | Unclassified | 1631 |
| 153 | Ga0070692_10128107 | 3300005345 | Bacteria | 1423 |
| 154 | Ga0070692_10155983 | 3300005345 | Bacteria | 1304 |
| 155 | Ga0070668_100000518 | 3300005347 | Bacteria | 25501 |
| 156 | Ga0070668_100029487 | 3300005347 | Bacteria | 4168 |
| 157 | Ga0070668_100044040 | 3300005347 | Bacteria | 3422 |
| 158 | Ga0070668_100047046 | 3300005347 | Bacteria | 3316 |
| 159 | Ga0070668_100087339 | 3300005347 | Bacteria | 2453 |
| 160 | Ga0070668_100429418 | 3300005347 | Bacteria | 1132 |
| 161 | Ga0070669_100007803 | 3300005353 | Bacteria | 7647 |
| 162 | Ga0070669_100010226 | 3300005353 | Bacteria | 6665 |
| 163 | Ga0070669_100039836 | 3300005353 | Bacteria | 3415 |
| 164 | Ga0070669_100075618 | 3300005353 | Bacteria | 2498 |
| 165 | Ga0070669_100182959 | 3300005353 | Bacteria | 1640 |
| 166 | Ga0070669_100232433 | 3300005353 | Unclassified | 1462 |
| 167 | Ga0070669_100234426 | 3300005353 | Bacteria | 1456 |
| 168 | Ga0070675_100008660 | 3300005354 | Bacteria | 7900 |
| 169 | Ga0070675_100039942 | 3300005354 | Unclassified | 3830 |
| 170 | Ga0070675_100157982 | 3300005354 | Bacteria | 1948 |
| 171 | Ga0070675_100807236 | 3300005354 | Unclassified | 858 |
| 172 | Ga0070671_100012602 | 3300005355 | Bacteria | 6811 |
| 173 | Ga0070671_100013595 | 3300005355 | Bacteria | 6565 |
| 174 | Ga0070671_100023118 | 3300005355 | Bacteria | 5082 |
| 175 | Ga0070671_100036023 | 3300005355 | Bacteria | 4102 |
| 176 | Ga0070671_100046263 | 3300005355 | Bacteria | 3619 |
| 177 | Ga0070671_100066579 | 3300005355 | Bacteria | 3002 |
| 178 | Ga0070671_100107672 | 3300005355 | Bacteria | 2340 |
| 179 | Ga0070671_100120675 | 3300005355 | Unclassified | 2206 |
| 180 | Ga0070674_100010772 | 3300005356 | Bacteria | 5544 |
| 181 | Ga0070674_100492620 | 3300005356 | Bacteria | 1019 |
| 182 | Ga0070674_100525397 | 3300005356 | Bacteria | 989 |
| 183 | Ga0070673_100000916 | 3300005364 | Bacteria | 16669 |
| 184 | Ga0070673_100001100 | 3300005364 | Bacteria | 15481 |
| 185 | Ga0070673_100001738 | 3300005364 | Bacteria | 12969 |
| 186 | Ga0070673_100015805 | 3300005364 | Bacteria | 5316 |
| 187 | Ga0070673_100022702 | 3300005364 | Unclassified | 4571 |
| 188 | Ga0070673_100026755 | 3300005364 | Bacteria | 4265 |
| 189 | Ga0070673_100029457 | 3300005364 | Bacteria | 4094 |
| 190 | Ga0070673_100058990 | 3300005364 | Bacteria | 3037 |
| 191 | Ga0070673_100189874 | 3300005364 | Bacteria | 1764 |
| 192 | Ga0070673_100298128 | 3300005364 | Unclassified | 1418 |
| 193 | Ga0070673_100408999 | 3300005364 | Unclassified | 1215 |
| 194 | Ga0070688_100001727 | 3300005365 | Bacteria | 10890 |
| 195 | Ga0070688_100069096 | 3300005365 | Bacteria | 2254 |
| 196 | Ga0070688_100193069 | 3300005365 | Bacteria | 1420 |
| 197 | Ga0070688_100200837 | 3300005365 | Bacteria | 1395 |
| 198 | Ga0070659_100000648 | 3300005366 | Bacteria | 25427 |
| 199 | Ga0070659_100007387 | 3300005366 | Bacteria | 7983 |
| 200 | Ga0070659_100020487 | 3300005366 | Bacteria | 5024 |
| 201 | Ga0070659_100033730 | 3300005366 | Bacteria | 3979 |
| 202 | Ga0070659_100037729 | 3300005366 | Bacteria | 3767 |
| 203 | Ga0070659_100051464 | 3300005366 | Bacteria | 3238 |
| 204 | Ga0070659_100075065 | 3300005366 | Bacteria | 2694 |
| 205 | Ga0070659_100135643 | 3300005366 | Unclassified | 2001 |
| 206 | Ga0070659_100142698 | 3300005366 | Unclassified | 1950 |
| 207 | Ga0070667_100001056 | 3300005367 | Bacteria | 25169 |
| 208 | Ga0070667_100005421 | 3300005367 | Bacteria | 10659 |
| 209 | Ga0070667_100017871 | 3300005367 | Bacteria | 5878 |
| 210 | Ga0070667_100018530 | 3300005367 | Bacteria | 5775 |
| 211 | Ga0070667_100023305 | 3300005367 | Bacteria | 5135 |
| 212 | Ga0070667_100047560 | 3300005367 | Bacteria | 3609 |
| 213 | Ga0070667_100057251 | 3300005367 | Bacteria | 3294 |
| 214 | Ga0070667_100065006 | 3300005367 | Unclassified | 3097 |
| 215 | Ga0070667_100113747 | 3300005367 | Unclassified | 2349 |
| 216 | Ga0070667_100157688 | 3300005367 | Unclassified | 1997 |
| 217 | Ga0070667_100311192 | 3300005367 | Bacteria | 1420 |
| 218 | Ga0070667_100374647 | 3300005367 | Bacteria | 1292 |
| 219 | Ga0070667_100655185 | 3300005367 | Bacteria | 970 |
| 220 | Ga0070701_10226615 | 3300005438 | Bacteria | 1117 |
| 221 | Ga0070700_100132413 | 3300005441 | Bacteria | 1684 |
| 222 | Ga0070700_100454781 | 3300005441 | Bacteria | 975 |
| 223 | Ga0070663_100019054 | 3300005455 | Bacteria | 4513 |
| 224 | Ga0070663_100036245 | 3300005455 | Bacteria | 3426 |
| 225 | Ga0070663_100589676 | 3300005455 | Bacteria | 933 |
| 226 | Ga0070678_100010010 | 3300005456 | Bacteria | 5769 |
| 227 | Ga0070678_100011580 | 3300005456 | Bacteria | 5447 |
| 228 | Ga0070678_100031450 | 3300005456 | Bacteria | 3662 |
| 229 | Ga0070678_100156646 | 3300005456 | Bacteria | 1841 |
| 230 | Ga0070678_100197839 | 3300005456 | Bacteria | 1657 |
| 231 | Ga0070678_100206875 | 3300005456 | Unclassified | 1623 |
| 232 | Ga0070678_100265143 | 3300005456 | Bacteria | 1446 |
| 233 | Ga0070678_100631427 | 3300005456 | Bacteria | 959 |
| 234 | Ga0070662_100000014 | 3300005457 | Bacteria | 110124 |
| 235 | Ga0070662_100003721 | 3300005457 | Bacteria | 9544 |
| 236 | Ga0070662_100004869 | 3300005457 | Bacteria | 8519 |
| 237 | Ga0070662_100010077 | 3300005457 | Bacteria | 6191 |
| 238 | Ga0070662_100060152 | 3300005457 | Bacteria | 2769 |
| 239 | Ga0070662_100082916 | 3300005457 | Unclassified | 2392 |
| 240 | Ga0070662_100094047 | 3300005457 | Bacteria | 2256 |
| 241 | Ga0070662_100167404 | 3300005457 | Bacteria | 1723 |
| 242 | Ga0070662_100196833 | 3300005457 | Unclassified | 1597 |
| 243 | Ga0070662_100725614 | 3300005457 | Bacteria | 842 |
| 244 | Ga0070681_10026227 | 3300005458 | Bacteria | 5858 |
| 245 | Ga0070681_10040908 | 3300005458 | Bacteria | 4644 |
| 246 | Ga0070681_10042951 | 3300005458 | Bacteria | 4529 |
| 247 | Ga0070681_10269908 | 3300005458 | Bacteria | 1613 |
| 248 | Ga0070681_10327177 | 3300005458 | Unclassified | 1442 |
| 249 | Ga0070681_10333205 | 3300005458 | Bacteria | 1427 |
| 250 | Ga0068867_100003104 | 3300005459 | Bacteria | 11707 |
| 251 | Ga0068867_100004645 | 3300005459 | Bacteria | 9662 |
| 252 | Ga0068867_100006101 | 3300005459 | Bacteria | 8530 |
| 253 | Ga0068867_100016823 | 3300005459 | Bacteria | 5197 |
| 254 | Ga0068867_100059953 | 3300005459 | Bacteria | 2822 |
| 255 | Ga0068867_100074124 | 3300005459 | Bacteria | 2550 |
| 256 | Ga0068867_100080230 | 3300005459 | Bacteria | 2457 |
| 257 | Ga0068867_100091712 | 3300005459 | Unclassified | 2307 |
| 258 | Ga0068867_100108638 | 3300005459 | Unclassified | 2128 |
| 259 | Ga0068867_100121853 | 3300005459 | Bacteria | 2017 |
| 260 | Ga0068867_100121971 | 3300005459 | Unclassified | 2016 |
| 261 | Ga0068867_100249064 | 3300005459 | Bacteria | 1444 |
| 262 | Ga0068867_100291561 | 3300005459 | Unclassified | 1342 |
| 263 | Ga0068867_100448211 | 3300005459 | Unclassified | 1099 |
| 264 | Ga0070685_10018286 | 3300005466 | Bacteria | 3767 |
| 265 | Ga0070685_10028761 | 3300005466 | Unclassified | 3083 |
| 266 | Ga0070685_10041717 | 3300005466 | Bacteria | 2616 |
| 267 | Ga0070685_10047750 | 3300005466 | Unclassified | 2463 |
| 268 | Ga0070685_10091132 | 3300005466 | Bacteria | 1845 |
| 269 | Ga0070685_10211309 | 3300005466 | Bacteria | 1267 |
| 270 | Ga0070685_10275069 | 3300005466 | Unclassified | 1125 |
| 271 | Ga0070707_100156482 | 3300005468 | Unclassified | 2220 |
| 272 | Ga0070698_100004078 | 3300005471 | Bacteria | 16046 |
| 273 | Ga0070698_100004771 | 3300005471 | Bacteria | 14879 |
| 274 | Ga0070698_100150268 | 3300005471 | Bacteria | 2277 |
| 275 | Ga0070698_100150886 | 3300005471 | Unclassified | 2272 |
| 276 | Ga0070698_100153895 | 3300005471 | Bacteria | 2245 |
| 277 | Ga0070679_100000398 | 3300005530 | Bacteria | 37016 |
| 278 | Ga0070679_100000665 | 3300005530 | Bacteria | 29299 |
| 279 | Ga0070679_100009345 | 3300005530 | Bacteria | 9269 |
| 280 | Ga0070679_100015562 | 3300005530 | Bacteria | 7309 |
| 281 | Ga0070679_100023731 | 3300005530 | Bacteria | 6009 |
| 282 | Ga0070679_100036142 | 3300005530 | Unclassified | 4901 |
| 283 | Ga0070679_100207788 | 3300005530 | Bacteria | 1922 |
| 284 | Ga0070679_100266331 | 3300005530 | Bacteria | 1668 |
| 285 | Ga0070684_100010524 | 3300005535 | Bacteria | 7331 |
| 286 | Ga0070684_100019072 | 3300005535 | Bacteria | 5669 |
| 287 | Ga0070684_100038020 | 3300005535 | Bacteria | 4132 |
| 288 | Ga0070684_100246944 | 3300005535 | Bacteria | 1631 |
| 289 | Ga0070684_100446368 | 3300005535 | Bacteria | 1195 |
| 290 | Ga0068853_100000765 | 3300005539 | Bacteria | 22316 |
| 291 | Ga0068853_100003733 | 3300005539 | Bacteria | 11684 |
| 292 | Ga0068853_100005178 | 3300005539 | Bacteria | 10198 |
| 293 | Ga0068853_100008103 | 3300005539 | Bacteria | 8433 |
| 294 | Ga0068853_100009588 | 3300005539 | Bacteria | 7802 |
| 295 | Ga0068853_100013232 | 3300005539 | Bacteria | 6734 |
| 296 | Ga0068853_100015866 | 3300005539 | Bacteria | 6187 |
| 297 | Ga0068853_100021279 | 3300005539 | Bacteria | 5405 |
| 298 | Ga0068853_100034294 | 3300005539 | Bacteria | 4308 |
| 299 | Ga0068853_100043349 | 3300005539 | Bacteria | 3849 |
| 300 | Ga0068853_100051118 | 3300005539 | Bacteria | 3557 |
| 301 | Ga0068853_100055941 | 3300005539 | Bacteria | 3401 |
| 302 | Ga0068853_100079204 | 3300005539 | Bacteria | 2873 |
| 303 | Ga0068853_100081751 | 3300005539 | Bacteria | 2829 |
| 304 | Ga0068853_100113513 | 3300005539 | Bacteria | 2409 |
| 305 | Ga0068853_100131697 | 3300005539 | Unclassified | 2239 |
| 306 | Ga0068853_100140342 | 3300005539 | Unclassified | 2169 |
| 307 | Ga0068853_100140592 | 3300005539 | Bacteria | 2167 |
| 308 | Ga0068853_100146098 | 3300005539 | Unclassified | 2125 |
| 309 | Ga0068853_100156483 | 3300005539 | Bacteria | 2054 |
| 310 | Ga0068853_100163298 | 3300005539 | Bacteria | 2011 |
| 311 | Ga0068853_100176648 | 3300005539 | Bacteria | 1935 |
| 312 | Ga0068853_100198696 | 3300005539 | Bacteria | 1824 |
| 313 | Ga0070672_100000020 | 3300005543 | Bacteria | 69277 |
| 314 | Ga0070672_100010475 | 3300005543 | Bacteria | 6430 |
| 315 | Ga0070672_100017526 | 3300005543 | Bacteria | 5158 |
| 316 | Ga0070672_100040151 | 3300005543 | Bacteria | 3588 |
| 317 | Ga0070672_100144244 | 3300005543 | Unclassified | 1966 |
| 318 | Ga0070672_100154946 | 3300005543 | Unclassified | 1897 |
| 319 | Ga0070672_100352143 | 3300005543 | Bacteria | 1255 |
| 320 | Ga0070672_100493660 | 3300005543 | Bacteria | 1058 |
| 321 | Ga0070686_100052359 | 3300005544 | Bacteria | 2603 |
| 322 | Ga0070686_100069177 | 3300005544 | Unclassified | 2305 |
| 323 | Ga0070686_100092819 | 3300005544 | Unclassified | 2022 |
| 324 | Ga0070686_100220174 | 3300005544 | Unclassified | 1371 |
| 325 | Ga0070686_100251170 | 3300005544 | Unclassified | 1292 |
| 326 | Ga0070686_100261922 | 3300005544 | Unclassified | 1268 |
| 327 | Ga0070696_100185057 | 3300005546 | Bacteria | 1547 |
| 328 | Ga0070693_100193804 | 3300005547 | Bacteria | 1316 |
| 329 | Ga0070665_100000032 | 3300005548 | Bacteria | 333352 |
| 330 | Ga0070665_100004608 | 3300005548 | Bacteria | 14413 |
| 331 | Ga0070665_100009875 | 3300005548 | Bacteria | 9649 |
| 332 | Ga0070665_100036978 | 3300005548 | Bacteria | 4910 |
| 333 | Ga0070665_100281435 | 3300005548 | Unclassified | 1665 |
| 334 | Ga0070704_100250240 | 3300005549 | Unclassified | 1455 |
| 335 | Ga0068855_100000043 | 3300005563 | Bacteria | 149118 |
| 336 | Ga0068855_100000517 | 3300005563 | Bacteria | 47550 |
| 337 | Ga0068855_100003465 | 3300005563 | Bacteria | 19312 |
| 338 | Ga0068855_100006600 | 3300005563 | Bacteria | 14106 |
| 339 | Ga0068855_100007632 | 3300005563 | Bacteria | 13082 |
| 340 | Ga0068855_100026529 | 3300005563 | Bacteria | 6931 |
| 341 | Ga0068855_100037770 | 3300005563 | Bacteria | 5741 |
| 342 | Ga0068855_100071980 | 3300005563 | Bacteria | 4019 |
| 343 | Ga0068855_100077688 | 3300005563 | Unclassified | 3852 |
| 344 | Ga0068855_100130689 | 3300005563 | Unclassified | 2868 |
| 345 | Ga0068855_100131777 | 3300005563 | Bacteria | 2854 |
| 346 | Ga0068855_100243761 | 3300005563 | Bacteria | 2007 |
| 347 | Ga0068855_100255644 | 3300005563 | Bacteria | 1953 |
| 348 | Ga0068855_100274720 | 3300005563 | Bacteria | 1873 |
| 349 | Ga0070664_100004753 | 3300005564 | Bacteria | 10893 |
| 350 | Ga0070664_100014024 | 3300005564 | Bacteria | 6536 |
| 351 | Ga0070664_100025338 | 3300005564 | Bacteria | 4915 |
| 352 | Ga0070664_100060340 | 3300005564 | Unclassified | 3229 |
| 353 | Ga0070664_100064447 | 3300005564 | Bacteria | 3125 |
| 354 | Ga0070664_100117547 | 3300005564 | Unclassified | 2325 |
| 355 | Ga0070664_100168759 | 3300005564 | Bacteria | 1940 |
| 356 | Ga0068857_100005247 | 3300005577 | Bacteria | 11033 |
| 357 | Ga0068857_100019273 | 3300005577 | Bacteria | 5990 |
| 358 | Ga0068857_100022072 | 3300005577 | Bacteria | 5600 |
| 359 | Ga0068857_100046329 | 3300005577 | Bacteria | 3859 |
| 360 | Ga0068857_100084855 | 3300005577 | Bacteria | 2830 |
| 361 | Ga0068857_100093940 | 3300005577 | Bacteria | 2685 |
| 362 | Ga0068857_100201857 | 3300005577 | Bacteria | 1813 |
| 363 | Ga0068857_100239235 | 3300005577 | Bacteria | 1662 |
| 364 | Ga0068857_100265379 | 3300005577 | Bacteria | 1577 |
| 365 | Ga0068857_100418582 | 3300005577 | Bacteria | 1249 |
| 366 | Ga0068854_100004832 | 3300005578 | Bacteria | 8502 |
| 367 | Ga0068854_100014650 | 3300005578 | Bacteria | 5172 |
| 368 | Ga0068854_100026428 | 3300005578 | Bacteria | 3990 |
| 369 | Ga0068854_100061532 | 3300005578 | Bacteria | 2720 |
| 370 | Ga0068854_100084423 | 3300005578 | Bacteria | 2350 |
| 371 | Ga0068854_100117771 | 3300005578 | Bacteria | 2012 |
| 372 | Ga0068854_100296895 | 3300005578 | Bacteria | 1306 |
| 373 | Ga0068856_100000960 | 3300005614 | Bacteria | 30788 |
| 374 | Ga0068856_100010180 | 3300005614 | Bacteria | 9141 |
| 375 | Ga0068856_100010333 | 3300005614 | Bacteria | 9068 |
| 376 | Ga0068856_100027529 | 3300005614 | Bacteria | 5545 |
| 377 | Ga0068856_100050889 | 3300005614 | Bacteria | 4085 |
| 378 | Ga0068856_100166108 | 3300005614 | Bacteria | 2218 |
| 379 | Ga0070702_100015101 | 3300005615 | Bacteria | 3935 |
| 380 | Ga0070702_100016189 | 3300005615 | Unclassified | 3822 |
| 381 | Ga0068852_100000744 | 3300005616 | Bacteria | 21378 |
| 382 | Ga0068852_100003125 | 3300005616 | Bacteria | 11534 |
| 383 | Ga0068852_100011448 | 3300005616 | Bacteria | 6679 |
| 384 | Ga0068852_100016745 | 3300005616 | Bacteria | 5728 |
| 385 | Ga0068852_100025634 | 3300005616 | Bacteria | 4781 |
| 386 | Ga0068852_100030572 | 3300005616 | Unclassified | 4436 |
| 387 | Ga0068852_100039952 | 3300005616 | Bacteria | 3954 |
| 388 | Ga0068852_100044878 | 3300005616 | Bacteria | 3757 |
| 389 | Ga0068852_100046203 | 3300005616 | Bacteria | 3709 |
| 390 | Ga0068852_100059484 | 3300005616 | Unclassified | 3314 |
| 391 | Ga0068852_100060932 | 3300005616 | Bacteria | 3277 |
| 392 | Ga0068852_100098257 | 3300005616 | Bacteria | 2636 |
| 393 | Ga0068852_100290605 | 3300005616 | Bacteria | 1579 |
| 394 | Ga0068852_100694246 | 3300005616 | Unclassified | 1027 |
| 395 | Ga0068852_101032766 | 3300005616 | Bacteria | 841 |
| 396 | Ga0068859_100000024 | 3300005617 | Bacteria | 217931 |
| 397 | Ga0068859_100005138 | 3300005617 | Bacteria | 13287 |
| 398 | Ga0068859_100011212 | 3300005617 | Bacteria | 9013 |
| 399 | Ga0068859_100015329 | 3300005617 | Bacteria | 7698 |
| 400 | Ga0068859_100017243 | 3300005617 | Bacteria | 7252 |
| 401 | Ga0068859_100056651 | 3300005617 | Bacteria | 3946 |
| 402 | Ga0068859_100077822 | 3300005617 | Unclassified | 3358 |
| 403 | Ga0068859_100115801 | 3300005617 | Bacteria | 2745 |
| 404 | Ga0068859_100163857 | 3300005617 | Bacteria | 2302 |
| 405 | Ga0068859_100251807 | 3300005617 | Bacteria | 1857 |
| 406 | Ga0068859_100307533 | 3300005617 | Bacteria | 1678 |
| 407 | Ga0068859_100321072 | 3300005617 | Unclassified | 1642 |
| 408 | Ga0068859_100364454 | 3300005617 | Bacteria | 1540 |
| 409 | Ga0068859_100454948 | 3300005617 | Bacteria | 1376 |
| 410 | Ga0068859_100583039 | 3300005617 | Bacteria | 1212 |
| 411 | Ga0068864_100000392 | 3300005618 | Bacteria | 38124 |
| 412 | Ga0068864_100001230 | 3300005618 | Bacteria | 21292 |
| 413 | Ga0068864_100004478 | 3300005618 | Bacteria | 11483 |
| 414 | Ga0068864_100010987 | 3300005618 | Bacteria | 7487 |
| 415 | Ga0068864_100066233 | 3300005618 | Bacteria | 3135 |
| 416 | Ga0068864_100078396 | 3300005618 | Bacteria | 2891 |
| 417 | Ga0068864_100105531 | 3300005618 | Bacteria | 2504 |
| 418 | Ga0068864_100144940 | 3300005618 | Bacteria | 2146 |
| 419 | Ga0068864_100342511 | 3300005618 | Bacteria | 1409 |
| 420 | Ga0068864_100801446 | 3300005618 | Bacteria | 926 |
| 421 | Ga0068866_10003950 | 3300005718 | Bacteria | 6091 |
| 422 | Ga0068866_10004497 | 3300005718 | Bacteria | 5715 |
| 423 | Ga0068866_10026702 | 3300005718 | Bacteria | 2731 |
| 424 | Ga0068866_10108849 | 3300005718 | Bacteria | 1542 |
| 425 | Ga0068861_100001296 | 3300005719 | Bacteria | 15630 |
| 426 | Ga0068861_100002876 | 3300005719 | Bacteria | 11343 |
| 427 | Ga0068861_100011713 | 3300005719 | Bacteria | 6104 |
| 428 | Ga0068861_100255305 | 3300005719 | Bacteria | 1498 |
| 429 | Ga0068861_100745992 | 3300005719 | Bacteria | 914 |
| 430 | Ga0068851_10002179 | 3300005834 | Bacteria | 8611 |
| 431 | Ga0068851_10028869 | 3300005834 | Unclassified | 2742 |
| 432 | Ga0068851_10033944 | 3300005834 | Unclassified | 2545 |
| 433 | Ga0068851_10139084 | 3300005834 | Bacteria | 1319 |
| 434 | Ga0068851_10236759 | 3300005834 | Unclassified | 1031 |
| 435 | Ga0068870_10099579 | 3300005840 | Bacteria | 1640 |
| 436 | Ga0068870_10161340 | 3300005840 | Bacteria | 1330 |
| 437 | Ga0068863_100002032 | 3300005841 | Bacteria | 20050 |
| 438 | Ga0068863_100041019 | 3300005841 | Bacteria | 4401 |
| 439 | Ga0068863_100044019 | 3300005841 | Bacteria | 4238 |
| 440 | Ga0068863_100081367 | 3300005841 | Bacteria | 3068 |
| 441 | Ga0068863_100162063 | 3300005841 | Unclassified | 2143 |
| 442 | Ga0068863_100176131 | 3300005841 | Unclassified | 2053 |
| 443 | Ga0068863_100222387 | 3300005841 | Bacteria | 1819 |
| 444 | Ga0068863_100355858 | 3300005841 | Bacteria | 1426 |
| 445 | Ga0068863_100613425 | 3300005841 | Bacteria | 1077 |
| 446 | Ga0068863_100637392 | 3300005841 | Bacteria | 1056 |
| 447 | Ga0068858_100000342 | 3300005842 | Bacteria | 49465 |
| 448 | Ga0068858_100001879 | 3300005842 | Bacteria | 21434 |
| 449 | Ga0068858_100040620 | 3300005842 | Bacteria | 4315 |
| 450 | Ga0068858_100073111 | 3300005842 | Unclassified | 3183 |
| 451 | Ga0068858_100084635 | 3300005842 | Bacteria | 2950 |
| 452 | Ga0068858_100242229 | 3300005842 | Unclassified | 1711 |
| 453 | Ga0068858_100322335 | 3300005842 | Unclassified | 1477 |
| 454 | Ga0068858_100341294 | 3300005842 | Bacteria | 1434 |
| 455 | Ga0068858_100344609 | 3300005842 | Unclassified | 1426 |
| 456 | Ga0068858_100376464 | 3300005842 | Bacteria | 1362 |
| 457 | Ga0068860_100001341 | 3300005843 | Bacteria | 26789 |
| 458 | Ga0068860_100001513 | 3300005843 | Bacteria | 25039 |
| 459 | Ga0068860_100004887 | 3300005843 | Bacteria | 13659 |
| 460 | Ga0068860_100008647 | 3300005843 | Bacteria | 10144 |
| 461 | Ga0068860_100008887 | 3300005843 | Bacteria | 10010 |
| 462 | Ga0068860_100012453 | 3300005843 | Bacteria | 8375 |
| 463 | Ga0068860_100041777 | 3300005843 | Unclassified | 4381 |
| 464 | Ga0068860_100056124 | 3300005843 | Bacteria | 3746 |
| 465 | Ga0068860_100061958 | 3300005843 | Bacteria | 3554 |
| 466 | Ga0068860_100145406 | 3300005843 | Unclassified | 2281 |
| 467 | Ga0068860_100266244 | 3300005843 | Bacteria | 1672 |
| 468 | Ga0068860_100302123 | 3300005843 | Bacteria | 1568 |
| 469 | Ga0068860_100544434 | 3300005843 | Bacteria | 1162 |
| 470 | Ga0068862_100001074 | 3300005844 | Bacteria | 26203 |
| 471 | Ga0068862_100029514 | 3300005844 | Bacteria | 4621 |
| 472 | Ga0068862_100481473 | 3300005844 | Bacteria | 1175 |
| 473 | Ga0068862_100617136 | 3300005844 | Bacteria | 1043 |
| 474 | Ga0081540_1002949 | 3300005983 | Bacteria | 13669 |
| 475 | Ga0081539_10001169 | 3300005985 | Bacteria | 47510 |
| 476 | Ga0070717_10230034 | 3300006028 | Bacteria | 1632 |
| 477 | Ga0070715_10004258 | 3300006163 | Bacteria | 4670 |
| 478 | Ga0070715_10023552 | 3300006163 | Bacteria | 2414 |
| 479 | Ga0070716_100154275 | 3300006173 | Unclassified | 1481 |
| 480 | Ga0075366_10001935 | 3300006195 | Bacteria | 10467 |
| 481 | Ga0075366_10061467 | 3300006195 | Bacteria | 2232 |
| 482 | Ga0075366_10249471 | 3300006195 | Bacteria | 1082 |
| 483 | Ga0075366_10270045 | 3300006195 | Bacteria | 1039 |
| 484 | Ga0075366_10352545 | 3300006195 | Bacteria | 903 |
| 485 | Ga0097621_100000710 | 3300006237 | Bacteria | 23372 |
| 486 | Ga0097621_100001338 | 3300006237 | Bacteria | 16956 |
| 487 | Ga0097621_100004240 | 3300006237 | Bacteria | 9963 |
| 488 | Ga0097621_100009001 | 3300006237 | Bacteria | 7226 |
| 489 | Ga0097621_100012836 | 3300006237 | Bacteria | 6223 |
| 490 | Ga0097621_100038073 | 3300006237 | Bacteria | 3859 |
| 491 | Ga0097621_100138438 | 3300006237 | Bacteria | 2078 |
| 492 | Ga0097621_100193520 | 3300006237 | Unclassified | 1762 |
| 493 | Ga0097621_100251141 | 3300006237 | Unclassified | 1549 |
| 494 | Ga0097621_100282872 | 3300006237 | Bacteria | 1460 |
| 495 | Ga0097621_100300793 | 3300006237 | Bacteria | 1417 |
| 496 | Ga0097621_100453595 | 3300006237 | Bacteria | 1155 |
| 497 | Ga0068871_100000044 | 3300006358 | Bacteria | 67105 |
| 498 | Ga0068871_100000294 | 3300006358 | Bacteria | 34890 |
| 499 | Ga0068871_100008618 | 3300006358 | Bacteria | 7334 |
| 500 | Ga0068871_100015163 | 3300006358 | Bacteria | 5761 |
| 501 | Ga0068871_100024438 | 3300006358 | Bacteria | 4686 |
| 502 | Ga0068871_100026066 | 3300006358 | Bacteria | 4557 |
| 503 | Ga0068871_100026333 | 3300006358 | Bacteria | 4537 |
| 504 | Ga0068871_100038510 | 3300006358 | Bacteria | 3820 |
| 505 | Ga0068871_100232381 | 3300006358 | Bacteria | 1601 |
| 506 | Ga0068871_100258066 | 3300006358 | Unclassified | 1520 |
| 507 | Ga0068871_100341523 | 3300006358 | Unclassified | 1322 |
| 508 | Ga0075428_100006050 | 3300006844 | Bacteria | 13444 |
| 509 | Ga0075428_100161324 | 3300006844 | Bacteria | 2433 |
| 510 | Ga0075428_100419177 | 3300006844 | Unclassified | 1434 |
| 511 | Ga0075430_100001157 | 3300006846 | Bacteria | 21067 |
| 512 | Ga0075430_100365311 | 3300006846 | Unclassified | 1192 |
| 513 | Ga0075431_100003874 | 3300006847 | Bacteria | 14558 |
| 514 | Ga0075431_100010980 | 3300006847 | Bacteria | 9115 |
| 515 | Ga0075434_100109091 | 3300006871 | Bacteria | 2778 |
| 516 | Ga0075429_100001234 | 3300006880 | Bacteria | 20728 |
| 517 | Ga0075429_100019684 | 3300006880 | Bacteria | 5851 |
| 518 | Ga0075429_100062699 | 3300006880 | Bacteria | 3239 |
| 519 | Ga0068865_100000909 | 3300006881 | Bacteria | 16785 |
| 520 | Ga0068865_100002711 | 3300006881 | Bacteria | 10509 |
| 521 | Ga0068865_100003364 | 3300006881 | Bacteria | 9579 |
| 522 | Ga0068865_100033276 | 3300006881 | Bacteria | 3451 |
| 523 | Ga0068865_100185736 | 3300006881 | Bacteria | 1604 |
| 524 | Ga0068865_100195359 | 3300006881 | Bacteria | 1568 |
| 525 | Ga0068865_100205761 | 3300006881 | Bacteria | 1531 |
| 526 | Ga0068865_100286916 | 3300006881 | Bacteria | 1312 |
| 527 | Ga0068865_100326345 | 3300006881 | Bacteria | 1236 |
| 528 | Ga0097620_100000024 | 3300006931 | Bacteria | 217931 |
| 529 | Ga0097620_100005138 | 3300006931 | Bacteria | 13287 |
| 530 | Ga0097620_100011212 | 3300006931 | Bacteria | 9013 |
| 531 | Ga0097620_100015329 | 3300006931 | Bacteria | 7698 |
| 532 | Ga0097620_100017242 | 3300006931 | Bacteria | 7252 |
| 533 | Ga0097620_100056649 | 3300006931 | Bacteria | 3946 |
| 534 | Ga0097620_100077818 | 3300006931 | Unclassified | 3358 |
| 535 | Ga0097620_100115799 | 3300006931 | Bacteria | 2745 |
| 536 | Ga0097620_100163864 | 3300006931 | Bacteria | 2302 |
| 537 | Ga0097620_100251820 | 3300006931 | Bacteria | 1857 |
| 538 | Ga0097620_100307525 | 3300006931 | Bacteria | 1678 |
| 539 | Ga0097620_100321095 | 3300006931 | Unclassified | 1642 |
| 540 | Ga0097620_100364462 | 3300006931 | Bacteria | 1540 |
| 541 | Ga0097620_100454925 | 3300006931 | Bacteria | 1376 |
| 542 | Ga0097620_100583096 | 3300006931 | Bacteria | 1212 |
| 543 | Ga0105244_10089637 | 3300009036 | Bacteria | 1514 |
| 544 | Ga0105240_10000103 | 3300009093 | Bacteria | 172981 |
| 545 | Ga0105240_10000800 | 3300009093 | Bacteria | 56989 |
| 546 | Ga0105240_10001677 | 3300009093 | Bacteria | 37580 |
| 547 | Ga0105240_10001787 | 3300009093 | Bacteria | 36277 |
| 548 | Ga0105240_10004962 | 3300009093 | Bacteria | 20004 |
| 549 | Ga0105240_10018800 | 3300009093 | Bacteria | 9258 |
| 550 | Ga0105240_10027308 | 3300009093 | Bacteria | 7475 |
| 551 | Ga0105240_10065900 | 3300009093 | Bacteria | 4495 |
| 552 | Ga0105240_10078823 | 3300009093 | Bacteria | 4055 |
| 553 | Ga0105240_10084323 | 3300009093 | Bacteria | 3896 |
| 554 | Ga0105240_10106027 | 3300009093 | Bacteria | 3410 |
| 555 | Ga0105240_10144220 | 3300009093 | Bacteria | 2843 |
| 556 | Ga0105240_10165337 | 3300009093 | Bacteria | 2625 |
| 557 | Ga0105240_10204965 | 3300009093 | Unclassified | 2309 |
| 558 | Ga0105240_10210860 | 3300009093 | Bacteria | 2270 |
| 559 | Ga0105240_10394345 | 3300009093 | Bacteria | 1560 |
| 560 | Ga0105240_10441456 | 3300009093 | Bacteria | 1458 |
| 561 | Ga0105240_10686775 | 3300009093 | Bacteria | 1119 |
| 562 | Ga0105240_10697802 | 3300009093 | Bacteria | 1108 |
| 563 | Ga0111539_10000458 | 3300009094 | Bacteria | 51231 |
| 564 | Ga0111539_10011561 | 3300009094 | Bacteria | 11079 |
| 565 | Ga0111539_10244806 | 3300009094 | Bacteria | 2088 |
| 566 | Ga0111539_10291175 | 3300009094 | Bacteria | 1900 |
| 567 | Ga0105245_10062678 | 3300009098 | Bacteria | 3355 |
| 568 | Ga0105245_10294763 | 3300009098 | Bacteria | 1590 |
| 569 | Ga0105245_10303081 | 3300009098 | Bacteria | 1568 |
| 570 | Ga0105245_10741268 | 3300009098 | Bacteria | 1018 |
| 571 | Ga0105247_10011352 | 3300009101 | Bacteria | 5372 |
| 572 | Ga0105247_10040947 | 3300009101 | Bacteria | 2833 |
| 573 | Ga0105247_10073788 | 3300009101 | Bacteria | 2139 |
| 574 | Ga0105247_10160789 | 3300009101 | Bacteria | 1487 |
| 575 | Ga0114129_10011078 | 3300009147 | Bacteria | 12846 |
| 576 | Ga0114129_10046449 | 3300009147 | Bacteria | 6102 |
| 577 | Ga0114129_10117314 | 3300009147 | Bacteria | 3668 |
| 578 | Ga0105243_10153696 | 3300009148 | Bacteria | 1977 |
| 579 | Ga0105241_10000777 | 3300009174 | Bacteria | 24263 |
| 580 | Ga0105241_10001809 | 3300009174 | Bacteria | 16223 |
| 581 | Ga0105241_10002168 | 3300009174 | Bacteria | 14785 |
| 582 | Ga0105241_10006662 | 3300009174 | Bacteria | 8499 |
| 583 | Ga0105241_10061480 | 3300009174 | Unclassified | 2892 |
| 584 | Ga0105241_10074809 | 3300009174 | Bacteria | 2638 |
| 585 | Ga0105241_10122217 | 3300009174 | Bacteria | 2098 |
| 586 | Ga0105241_10151185 | 3300009174 | Bacteria | 1899 |
| 587 | Ga0105241_10706185 | 3300009174 | Unclassified | 921 |
| 588 | Ga0105242_10010519 | 3300009176 | Bacteria | 7103 |
| 589 | Ga0105242_10015262 | 3300009176 | Bacteria | 5966 |
| 590 | Ga0105242_10023480 | 3300009176 | Bacteria | 4859 |
| 591 | Ga0105242_10026092 | 3300009176 | Bacteria | 4629 |
| 592 | Ga0105242_10026677 | 3300009176 | Bacteria | 4580 |
| 593 | Ga0105242_10064176 | 3300009176 | Bacteria | 3026 |
| 594 | Ga0105242_10151950 | 3300009176 | Unclassified | 2019 |
| 595 | Ga0105242_10159749 | 3300009176 | Bacteria | 1971 |
| 596 | Ga0105242_10365793 | 3300009176 | Bacteria | 1336 |
| 597 | Ga0105242_10529103 | 3300009176 | Unclassified | 1126 |
| 598 | Ga0105248_10045826 | 3300009177 | Bacteria | 4902 |
| 599 | Ga0105248_10321779 | 3300009177 | Unclassified | 1742 |
| 600 | Ga0105237_10000578 | 3300009545 | Bacteria | 51257 |
| 601 | Ga0105237_10003264 | 3300009545 | Bacteria | 19375 |
| 602 | Ga0105237_10005389 | 3300009545 | Bacteria | 14455 |
| 603 | Ga0105237_10007421 | 3300009545 | Bacteria | 12004 |
| 604 | Ga0105237_10007918 | 3300009545 | Bacteria | 11581 |
| 605 | Ga0105237_10011343 | 3300009545 | Bacteria | 9430 |
| 606 | Ga0105237_10014149 | 3300009545 | Bacteria | 8352 |
| 607 | Ga0105237_10020903 | 3300009545 | Bacteria | 6738 |
| 608 | Ga0105237_10027910 | 3300009545 | Bacteria | 5753 |
| 609 | Ga0105237_10030381 | 3300009545 | Bacteria | 5488 |
| 610 | Ga0105237_10035118 | 3300009545 | Bacteria | 5075 |
| 611 | Ga0105237_10039752 | 3300009545 | Bacteria | 4747 |
| 612 | Ga0105237_10158977 | 3300009545 | Bacteria | 2257 |
| 613 | Ga0105237_10594553 | 3300009545 | Bacteria | 1113 |
| 614 | Ga0105238_10000592 | 3300009551 | Bacteria | 38095 |
| 615 | Ga0105238_10039464 | 3300009551 | Bacteria | 4788 |
| 616 | Ga0105238_10042180 | 3300009551 | Bacteria | 4621 |
| 617 | Ga0105238_10048733 | 3300009551 | Bacteria | 4268 |
| 618 | Ga0105238_10074203 | 3300009551 | Bacteria | 3395 |
| 619 | Ga0105249_10001375 | 3300009553 | Bacteria | 21278 |
| 620 | Ga0105249_10001970 | 3300009553 | Bacteria | 17816 |
| 621 | Ga0105249_10025557 | 3300009553 | Bacteria | 5317 |
| 622 | Ga0105249_10026752 | 3300009553 | Bacteria | 5202 |
| 623 | Ga0105249_10054779 | 3300009553 | Bacteria | 3647 |
| 624 | Ga0105249_10059532 | 3300009553 | Bacteria | 3503 |
| 625 | Ga0105249_10066344 | 3300009553 | Bacteria | 3322 |
| 626 | Ga0105249_10074491 | 3300009553 | Bacteria | 3142 |
| 627 | Ga0105249_10182862 | 3300009553 | Bacteria | 2041 |
| 628 | Ga0105249_10245008 | 3300009553 | Bacteria | 1774 |
| 629 | Ga0105249_10474469 | 3300009553 | Bacteria | 1293 |
| 630 | Ga0105249_10614255 | 3300009553 | Unclassified | 1143 |
| 631 | Ga0105239_10000001 | 3300010375 | Bacteria | 617353 |
| 632 | Ga0105239_10000007 | 3300010375 | Bacteria | 385297 |
| 633 | Ga0105239_10000180 | 3300010375 | Bacteria | 91772 |
| 634 | Ga0105239_10000212 | 3300010375 | Bacteria | 85747 |
| 635 | Ga0105239_10000352 | 3300010375 | Bacteria | 67522 |
| 636 | Ga0105239_10000992 | 3300010375 | Bacteria | 39769 |
| 637 | Ga0105239_10001405 | 3300010375 | Bacteria | 32195 |
| 638 | Ga0105239_10007439 | 3300010375 | Bacteria | 12564 |
| 639 | Ga0105239_10016055 | 3300010375 | Bacteria | 8287 |
| 640 | Ga0105239_10056681 | 3300010375 | Bacteria | 4298 |
| 641 | Ga0105239_10073160 | 3300010375 | Bacteria | 3768 |
| 642 | Ga0105239_10076740 | 3300010375 | Unclassified | 3676 |
| 643 | Ga0105239_10213948 | 3300010375 | Bacteria | 2161 |
| 644 | Ga0105246_10051377 | 3300011119 | Bacteria | 2831 |
| 645 | Ga0105246_10105345 | 3300011119 | Bacteria | 2061 |
| 646 | Ga0105246_10409043 | 3300011119 | Bacteria | 1129 |
| 647 | Ga0157373_10000245 | 3300013100 | Bacteria | 44563 |
| 648 | Ga0157373_10002264 | 3300013100 | Bacteria | 14590 |
| 649 | Ga0157373_10002904 | 3300013100 | Bacteria | 12977 |
| 650 | Ga0157373_10003171 | 3300013100 | Bacteria | 12427 |
| 651 | Ga0157373_10005746 | 3300013100 | Bacteria | 9286 |
| 652 | Ga0157373_10011196 | 3300013100 | Bacteria | 6601 |
| 653 | Ga0157373_10020458 | 3300013100 | Bacteria | 4810 |
| 654 | Ga0157373_10026338 | 3300013100 | Bacteria | 4201 |
| 655 | Ga0157373_10029204 | 3300013100 | Bacteria | 3974 |
| 656 | Ga0157373_10080241 | 3300013100 | Unclassified | 2301 |
| 657 | Ga0157373_10100605 | 3300013100 | Unclassified | 2034 |
| 658 | Ga0157373_10106476 | 3300013100 | Bacteria | 1972 |
| 659 | Ga0157373_10196846 | 3300013100 | Bacteria | 1420 |
| 660 | Ga0157373_10355366 | 3300013100 | Bacteria | 1045 |
| 661 | Ga0157371_10000418 | 3300013102 | Bacteria | 52571 |
| 662 | Ga0157371_10000851 | 3300013102 | Bacteria | 34883 |
| 663 | Ga0157371_10002731 | 3300013102 | Bacteria | 16625 |
| 664 | Ga0157371_10002946 | 3300013102 | Bacteria | 15852 |
| 665 | Ga0157371_10005012 | 3300013102 | Bacteria | 11348 |
| 666 | Ga0157371_10008478 | 3300013102 | Bacteria | 8183 |
| 667 | Ga0157371_10008985 | 3300013102 | Bacteria | 7902 |
| 668 | Ga0157371_10012488 | 3300013102 | Bacteria | 6490 |
| 669 | Ga0157371_10018679 | 3300013102 | Bacteria | 5123 |
| 670 | Ga0157371_10041568 | 3300013102 | Bacteria | 3280 |
| 671 | Ga0157371_10041592 | 3300013102 | Bacteria | 3279 |
| 672 | Ga0157371_10054941 | 3300013102 | Bacteria | 2826 |
| 673 | Ga0157371_10092815 | 3300013102 | Unclassified | 2139 |
| 674 | Ga0157371_10105367 | 3300013102 | Unclassified | 2001 |
| 675 | Ga0157371_10140079 | 3300013102 | Unclassified | 1723 |
| 676 | Ga0157371_10173572 | 3300013102 | Unclassified | 1541 |
| 677 | Ga0157371_10233015 | 3300013102 | Bacteria | 1324 |
| 678 | Ga0157371_10321193 | 3300013102 | Bacteria | 1124 |
| 679 | Ga0157371_10442554 | 3300013102 | Bacteria | 955 |
| 680 | Ga0157371_10459164 | 3300013102 | Bacteria | 937 |
| 681 | Ga0157370_10000197 | 3300013104 | Bacteria | 75846 |
| 682 | Ga0157370_10001620 | 3300013104 | Bacteria | 27815 |
| 683 | Ga0157370_10001816 | 3300013104 | Bacteria | 26328 |
| 684 | Ga0157370_10002183 | 3300013104 | Bacteria | 23875 |
| 685 | Ga0157370_10002188 | 3300013104 | Bacteria | 23838 |
| 686 | Ga0157370_10006873 | 3300013104 | Bacteria | 12456 |
| 687 | Ga0157370_10017062 | 3300013104 | Bacteria | 7336 |
| 688 | Ga0157370_10030722 | 3300013104 | Bacteria | 5262 |
| 689 | Ga0157370_10045646 | 3300013104 | Bacteria | 4202 |
| 690 | Ga0157370_10060798 | 3300013104 | Bacteria | 3586 |
| 691 | Ga0157370_10066900 | 3300013104 | Bacteria | 3397 |
| 692 | Ga0157370_10079953 | 3300013104 | Bacteria | 3078 |
| 693 | Ga0157370_10129166 | 3300013104 | Bacteria | 2358 |
| 694 | Ga0157370_10144531 | 3300013104 | Bacteria | 2215 |
| 695 | Ga0157370_10151989 | 3300013104 | Bacteria | 2154 |
| 696 | Ga0157370_10173586 | 3300013104 | Bacteria | 2003 |
| 697 | Ga0157370_10214603 | 3300013104 | Bacteria | 1783 |
| 698 | Ga0157370_10367379 | 3300013104 | Bacteria | 1326 |
| 699 | Ga0157369_10000031 | 3300013105 | Bacteria | 203214 |
| 700 | Ga0157369_10020641 | 3300013105 | Bacteria | 7367 |
| 701 | Ga0157369_10041671 | 3300013105 | Bacteria | 5011 |
| 702 | Ga0157369_10041955 | 3300013105 | Bacteria | 4993 |
| 703 | Ga0157369_10069522 | 3300013105 | Unclassified | 3783 |
| 704 | Ga0157369_10120236 | 3300013105 | Unclassified | 2787 |
| 705 | Ga0157369_10123745 | 3300013105 | Bacteria | 2743 |
| 706 | Ga0157369_10194621 | 3300013105 | Unclassified | 2130 |
| 707 | Ga0157369_10363349 | 3300013105 | Bacteria | 1503 |
| 708 | Ga0157369_10486176 | 3300013105 | Bacteria | 1277 |
| 709 | Ga0157369_10640308 | 3300013105 | Bacteria | 1097 |
| 710 | Ga0157374_10000914 | 3300013296 | Bacteria | 25675 |
| 711 | Ga0157374_10001221 | 3300013296 | Bacteria | 21951 |
| 712 | Ga0157374_10008347 | 3300013296 | Bacteria | 8843 |
| 713 | Ga0157374_10013769 | 3300013296 | Bacteria | 7064 |
| 714 | Ga0157374_10024325 | 3300013296 | Bacteria | 5429 |
| 715 | Ga0157374_10033177 | 3300013296 | Bacteria | 4709 |
| 716 | Ga0157374_10052361 | 3300013296 | Bacteria | 3802 |
| 717 | Ga0157374_10052861 | 3300013296 | Bacteria | 3786 |
| 718 | Ga0157374_10056468 | 3300013296 | Bacteria | 3665 |
| 719 | Ga0157374_10123615 | 3300013296 | Bacteria | 2500 |
| 720 | Ga0157374_10204708 | 3300013296 | Bacteria | 1934 |
| 721 | Ga0157374_10358487 | 3300013296 | Bacteria | 1450 |
| 722 | Ga0157374_10471158 | 3300013296 | Unclassified | 1258 |
| 723 | Ga0157374_10753713 | 3300013296 | Bacteria | 988 |
| 724 | Ga0157378_10003529 | 3300013297 | Bacteria | 13868 |
| 725 | Ga0157378_10014484 | 3300013297 | Bacteria | 6904 |
| 726 | Ga0157378_10020345 | 3300013297 | Bacteria | 5838 |
| 727 | Ga0157378_10027912 | 3300013297 | Bacteria | 4977 |
| 728 | Ga0157378_10053119 | 3300013297 | Bacteria | 3607 |
| 729 | Ga0157378_10070381 | 3300013297 | Unclassified | 3141 |
| 730 | Ga0157378_10097250 | 3300013297 | Bacteria | 2683 |
| 731 | Ga0157378_10108892 | 3300013297 | Bacteria | 2537 |
| 732 | Ga0157378_10120313 | 3300013297 | Unclassified | 2419 |
| 733 | Ga0157378_10132069 | 3300013297 | Unclassified | 2312 |
| 734 | Ga0157378_10198577 | 3300013297 | Bacteria | 1896 |
| 735 | Ga0157378_10356474 | 3300013297 | Bacteria | 1430 |
| 736 | Ga0157378_10407866 | 3300013297 | Bacteria | 1340 |
| 737 | Ga0163162_10000010 | 3300013306 | Bacteria | 302032 |
| 738 | Ga0163162_10000093 | 3300013306 | Bacteria | 82738 |
| 739 | Ga0163162_10000131 | 3300013306 | Bacteria | 67924 |
| 740 | Ga0163162_10000154 | 3300013306 | Bacteria | 63581 |
| 741 | Ga0163162_10000189 | 3300013306 | Bacteria | 56954 |
| 742 | Ga0163162_10001288 | 3300013306 | Bacteria | 23443 |
| 743 | Ga0163162_10001546 | 3300013306 | Bacteria | 21488 |
| 744 | Ga0163162_10004949 | 3300013306 | Bacteria | 12838 |
| 745 | Ga0163162_10010730 | 3300013306 | Bacteria | 8912 |
| 746 | Ga0163162_10011210 | 3300013306 | Bacteria | 8739 |
| 747 | Ga0163162_10011453 | 3300013306 | Bacteria | 8649 |
| 748 | Ga0163162_10034902 | 3300013306 | Bacteria | 5007 |
| 749 | Ga0163162_10107364 | 3300013306 | Bacteria | 2887 |
| 750 | Ga0163162_10131816 | 3300013306 | Bacteria | 2608 |
| 751 | Ga0163162_10133746 | 3300013306 | Bacteria | 2590 |
| 752 | Ga0163162_10139229 | 3300013306 | Unclassified | 2539 |
| 753 | Ga0163162_10399787 | 3300013306 | Bacteria | 1506 |
| 754 | Ga0163162_10729791 | 3300013306 | Bacteria | 1111 |
| 755 | Ga0163162_11081636 | 3300013306 | Bacteria | 908 |
| 756 | Ga0157372_10000073 | 3300013307 | Bacteria | 107356 |
| 757 | Ga0157372_10000173 | 3300013307 | Bacteria | 71416 |
| 758 | Ga0157372_10002062 | 3300013307 | Bacteria | 21839 |
| 759 | Ga0157372_10003396 | 3300013307 | Bacteria | 17186 |
| 760 | Ga0157372_10013408 | 3300013307 | Bacteria | 8753 |
| 761 | Ga0157372_10043627 | 3300013307 | Bacteria | 4966 |
| 762 | Ga0157372_10046553 | 3300013307 | Bacteria | 4815 |
| 763 | Ga0157372_10050546 | 3300013307 | Bacteria | 4624 |
| 764 | Ga0157372_10052360 | 3300013307 | Bacteria | 4545 |
| 765 | Ga0157372_10068835 | 3300013307 | Bacteria | 3980 |
| 766 | Ga0157372_10086369 | 3300013307 | Bacteria | 3559 |
| 767 | Ga0157372_10112740 | 3300013307 | Bacteria | 3116 |
| 768 | Ga0157372_10140801 | 3300013307 | Bacteria | 2779 |
| 769 | Ga0157372_10143555 | 3300013307 | Bacteria | 2753 |
| 770 | Ga0157372_10154478 | 3300013307 | Unclassified | 2650 |
| 771 | Ga0157372_10171083 | 3300013307 | Bacteria | 2513 |
| 772 | Ga0157372_10177767 | 3300013307 | Bacteria | 2463 |
| 773 | Ga0157372_10180428 | 3300013307 | Bacteria | 2444 |
| 774 | Ga0157372_10208694 | 3300013307 | Bacteria | 2263 |
| 775 | Ga0157372_10218144 | 3300013307 | Unclassified | 2211 |
| 776 | Ga0157372_10247343 | 3300013307 | Bacteria | 2069 |
| 777 | Ga0157372_10317509 | 3300013307 | Bacteria | 1814 |
| 778 | Ga0157372_10401987 | 3300013307 | Bacteria | 1596 |
| 779 | Ga0157372_10628770 | 3300013307 | Bacteria | 1251 |
| 780 | Ga0157372_10799020 | 3300013307 | Unclassified | 1096 |
| 781 | Ga0157372_10882867 | 3300013307 | Bacteria | 1038 |
| 782 | Ga0157372_11045018 | 3300013307 | Bacteria | 945 |
| 783 | Ga0157372_11287192 | 3300013307 | Bacteria | 844 |
| 784 | Ga0157375_10000850 | 3300013308 | Bacteria | 26585 |
| 785 | Ga0157375_10001388 | 3300013308 | Bacteria | 20910 |
| 786 | Ga0157375_10001823 | 3300013308 | Bacteria | 18281 |
| 787 | Ga0157375_10006292 | 3300013308 | Bacteria | 10341 |
| 788 | Ga0157375_10006520 | 3300013308 | Bacteria | 10157 |
| 789 | Ga0157375_10013251 | 3300013308 | Bacteria | 7331 |
| 790 | Ga0157375_10021961 | 3300013308 | Bacteria | 5867 |
| 791 | Ga0157375_10043902 | 3300013308 | Bacteria | 4338 |
| 792 | Ga0157375_10071904 | 3300013308 | Bacteria | 3474 |
| 793 | Ga0157375_10110719 | 3300013308 | Bacteria | 2843 |
| 794 | Ga0157375_10134957 | 3300013308 | Bacteria | 2590 |
| 795 | Ga0157375_10167443 | 3300013308 | Bacteria | 2343 |
| 796 | Ga0157375_10201446 | 3300013308 | Bacteria | 2147 |
| 797 | Ga0157375_10366265 | 3300013308 | Bacteria | 1607 |
| 798 | Ga0157375_10376650 | 3300013308 | Bacteria | 1586 |
| 799 | Ga0157375_10422202 | 3300013308 | Bacteria | 1499 |
| 800 | Ga0157375_10552617 | 3300013308 | Unclassified | 1313 |
| 801 | Ga0157375_10915224 | 3300013308 | Bacteria | 1020 |
| 802 | Ga0163163_10000471 | 3300014325 | Bacteria | 36731 |
| 803 | Ga0163163_10000825 | 3300014325 | Bacteria | 26376 |
| 804 | Ga0163163_10002272 | 3300014325 | Bacteria | 16213 |
| 805 | Ga0163163_10009933 | 3300014325 | Bacteria | 8533 |
| 806 | Ga0163163_10080403 | 3300014325 | Unclassified | 3259 |
| 807 | Ga0163163_10101861 | 3300014325 | Bacteria | 2894 |
| 808 | Ga0157380_10003936 | 3300014326 | Bacteria | 10251 |
| 809 | Ga0157380_10018266 | 3300014326 | Bacteria | 5203 |
| 810 | Ga0157380_10023605 | 3300014326 | Bacteria | 4642 |
| 811 | Ga0157380_10073624 | 3300014326 | Bacteria | 2770 |
| 812 | Ga0157380_10154016 | 3300014326 | Unclassified | 1990 |
| 813 | Ga0157380_10425108 | 3300014326 | Bacteria | 1268 |
| 814 | Ga0182008_10000024 | 3300014497 | Bacteria | 199978 |
| 815 | Ga0182008_10000082 | 3300014497 | Bacteria | 74716 |
| 816 | Ga0182008_10000503 | 3300014497 | Bacteria | 29456 |
| 817 | Ga0182008_10006487 | 3300014497 | Bacteria | 6533 |
| 818 | Ga0182008_10012897 | 3300014497 | Bacteria | 4400 |
| 819 | Ga0182008_10022002 | 3300014497 | Bacteria | 3268 |
| 820 | Ga0157377_10001438 | 3300014745 | Bacteria | 10284 |
| 821 | Ga0157377_10009315 | 3300014745 | Bacteria | 4811 |
| 822 | Ga0157377_10013943 | 3300014745 | Bacteria | 4080 |
| 823 | Ga0157377_10018718 | 3300014745 | Bacteria | 3605 |
| 824 | Ga0157377_10039544 | 3300014745 | Bacteria | 2609 |
| 825 | Ga0157377_10171509 | 3300014745 | Bacteria | 1357 |
| 826 | Ga0157377_10374994 | 3300014745 | Unclassified | 962 |
| 827 | Ga0157379_10001930 | 3300014968 | Bacteria | 17154 |
| 828 | Ga0157379_10005329 | 3300014968 | Bacteria | 11050 |
| 829 | Ga0157379_10056117 | 3300014968 | Unclassified | 3520 |
| 830 | Ga0157379_10068332 | 3300014968 | Bacteria | 3177 |
| 831 | Ga0157379_10069695 | 3300014968 | Bacteria | 3145 |
| 832 | Ga0157379_10123724 | 3300014968 | Bacteria | 2327 |
| 833 | Ga0157379_10143965 | 3300014968 | Bacteria | 2149 |
| 834 | Ga0157379_10185128 | 3300014968 | Bacteria | 1882 |
| 835 | Ga0157379_10261167 | 3300014968 | Bacteria | 1574 |
| 836 | Ga0157376_10000916 | 3300014969 | Bacteria | 19135 |
| 837 | Ga0157376_10001409 | 3300014969 | Bacteria | 15807 |
| 838 | Ga0157376_10006039 | 3300014969 | Bacteria | 8512 |
| 839 | Ga0157376_10287865 | 3300014969 | Unclassified | 1550 |
| 840 | Ga0157376_10775446 | 3300014969 | Bacteria | 970 |
| 841 | Ga0157376_10901861 | 3300014969 | Unclassified | 902 |
| 842 | Ga0182006_1000373 | 3300015261 | Bacteria | 37119 |
| 843 | Ga0182006_1002727 | 3300015261 | Bacteria | 9466 |
| 844 | Ga0182006_1004126 | 3300015261 | Bacteria | 7220 |
| 845 | Ga0182006_1005808 | 3300015261 | Bacteria | 5816 |
| 846 | Ga0182006_1009924 | 3300015261 | Bacteria | 4256 |
| 847 | Ga0182006_1048129 | 3300015261 | Bacteria | 1650 |
| 848 | Ga0182007_10000002 | 3300015262 | Bacteria | 564661 |
| 849 | Ga0182007_10004523 | 3300015262 | Bacteria | 6288 |
| 850 | Ga0182007_10005822 | 3300015262 | Bacteria | 5358 |
| 851 | Ga0182007_10061891 | 3300015262 | Bacteria | 1227 |
| 852 | Ga0182005_1050424 | 3300015265 | Bacteria | 1131 |
| 853 | Ga0183373_1004 | 3300015682 | Bacteria | 537398 |
| 854 | Ga0163161_10000856 | 3300017792 | Bacteria | 23716 |
| 855 | Ga0163161_10001255 | 3300017792 | Bacteria | 18992 |
| 856 | Ga0163161_10001554 | 3300017792 | Bacteria | 16943 |
| 857 | Ga0163161_10014039 | 3300017792 | Bacteria | 5577 |
| 858 | Ga0163161_10022880 | 3300017792 | Bacteria | 4403 |
| 859 | Ga0163161_10024488 | 3300017792 | Bacteria | 4264 |
| 860 | Ga0163161_10028422 | 3300017792 | Unclassified | 3972 |
| 861 | Ga0163161_10045950 | 3300017792 | Bacteria | 3150 |
| 862 | Ga0163161_10072869 | 3300017792 | Bacteria | 2516 |
| 863 | Ga0163161_10078048 | 3300017792 | Bacteria | 2433 |
| 864 | Ga0163161_10107048 | 3300017792 | Bacteria | 2087 |
| 865 | Ga0163161_10110034 | 3300017792 | Bacteria | 2059 |
| 866 | Ga0163161_10150859 | 3300017792 | Bacteria | 1766 |
| 867 | Ga0163161_10234859 | 3300017792 | Bacteria | 1424 |
| 868 | Ga0163161_10381861 | 3300017792 | Bacteria | 1126 |
| 869 | Ga0163161_10641440 | 3300017792 | Bacteria | 879 |
| 870 | Ga0206351_10266021 | 3300020077 | Bacteria | 1126 |
| 871 | Ga0206352_10171243 | 3300020078 | Unclassified | 2308 |
| 872 | Ga0154015_1198199 | 3300020610 | Bacteria | 1536 |
| 873 | Ga0154015_1441652 | 3300020610 | Bacteria | 1196 |
| 874 | Ga0213872_10006185 | 3300021361 | Bacteria | 6044 |
| 875 | Ga0213876_10023559 | 3300021384 | Bacteria | 3252 |
| 876 | Ga0224712_10035334 | 3300022467 | Bacteria | 1844 |
| 877 | Ga0209436_103559 | 3300025208 | Unclassified | 4092 |
| 878 | Ga0207427_100025 | 3300025231 | Bacteria | 433726 |
| 879 | Ga0209437_100010 | 3300025233 | Bacteria | 838447 |
| 880 | Ga0209437_100017 | 3300025233 | Bacteria | 694471 |
| 881 | Ga0209437_100148 | 3300025233 | Bacteria | 158795 |
| 882 | Ga0207425_1000023 | 3300025245 | Bacteria | 341339 |
| 883 | Ga0209646_1001012 | 3300025246 | Bacteria | 8602 |
| 884 | Ga0209026_1000430 | 3300025250 | Bacteria | 35017 |
| 885 | Ga0209026_1000498 | 3300025250 | Bacteria | 28577 |
| 886 | Ga0209026_1005565 | 3300025250 | Bacteria | 3350 |
| 887 | Ga0209129_1000032 | 3300025258 | Bacteria | 341150 |
| 888 | Ga0209129_1006980 | 3300025258 | Bacteria | 3483 |
| 889 | Ga0209233_1000017 | 3300025261 | Bacteria | 898076 |
| 890 | Ga0209233_1001847 | 3300025261 | Bacteria | 8130 |
| 891 | Ga0207666_1005382 | 3300025271 | Unclassified | 1635 |
| 892 | Ga0209455_1000682 | 3300025272 | Bacteria | 20151 |
| 893 | Ga0209130_1002864 | 3300025284 | Bacteria | 7976 |
| 894 | Ga0209676_1000009 | 3300025292 | Bacteria | 981719 |
| 895 | Ga0209676_1000363 | 3300025292 | Bacteria | 85613 |
| 896 | Ga0209025_1000047 | 3300025294 | Bacteria | 341150 |
| 897 | Ga0209758_1000145 | 3300025297 | Bacteria | 170553 |
| 898 | Ga0209050_1000094 | 3300025298 | Bacteria | 242893 |
| 899 | Ga0209050_1029027 | 3300025298 | Bacteria | 1780 |
| 900 | Ga0207426_1000059 | 3300025302 | Bacteria | 363842 |
| 901 | Ga0207426_1000234 | 3300025302 | Bacteria | 126926 |
| 902 | Ga0207426_1039841 | 3300025302 | Bacteria | 1468 |
| 903 | Ga0207697_10012795 | 3300025315 | Unclassified | 3511 |
| 904 | Ga0207697_10042239 | 3300025315 | Unclassified | 1873 |
| 905 | Ga0207697_10044972 | 3300025315 | Bacteria | 1817 |
| 906 | Ga0207697_10115793 | 3300025315 | Bacteria | 1151 |
| 907 | Ga0207697_10166184 | 3300025315 | Unclassified | 964 |
| 908 | Ga0207656_10010545 | 3300025321 | Bacteria | 3466 |
| 909 | Ga0207656_10021255 | 3300025321 | Unclassified | 2591 |
| 910 | Ga0207656_10039145 | 3300025321 | Unclassified | 2004 |
| 911 | Ga0207656_10126649 | 3300025321 | Bacteria | 1193 |
| 912 | Ga0207656_10139579 | 3300025321 | Bacteria | 1142 |
| 913 | Ga0207682_10029174 | 3300025893 | Unclassified | 2205 |
| 914 | Ga0207682_10058426 | 3300025893 | Bacteria | 1610 |
| 915 | Ga0207642_10025354 | 3300025899 | Unclassified | 2397 |
| 916 | Ga0207710_10002076 | 3300025900 | Bacteria | 9496 |
| 917 | Ga0207710_10027249 | 3300025900 | Bacteria | 2473 |
| 918 | Ga0207680_10000024 | 3300025903 | Bacteria | 82106 |
| 919 | Ga0207680_10000907 | 3300025903 | Bacteria | 13999 |
| 920 | Ga0207680_10061670 | 3300025903 | Bacteria | 2288 |
| 921 | Ga0207680_10091551 | 3300025903 | Bacteria | 1935 |
| 922 | Ga0207680_10225739 | 3300025903 | Bacteria | 1285 |
| 923 | Ga0207647_10000358 | 3300025904 | Bacteria | 37132 |
| 924 | Ga0207647_10000680 | 3300025904 | Bacteria | 26722 |
| 925 | Ga0207647_10002110 | 3300025904 | Bacteria | 15216 |
| 926 | Ga0207647_10023206 | 3300025904 | Bacteria | 4108 |
| 927 | Ga0207647_10023686 | 3300025904 | Bacteria | 4056 |
| 928 | Ga0207647_10095624 | 3300025904 | Bacteria | 1769 |
| 929 | Ga0207647_10113164 | 3300025904 | Bacteria | 1604 |
| 930 | Ga0207647_10113581 | 3300025904 | Bacteria | 1601 |
| 931 | Ga0207647_10173695 | 3300025904 | Unclassified | 1254 |
| 932 | Ga0207645_10004249 | 3300025907 | Bacteria | 10636 |
| 933 | Ga0207645_10006511 | 3300025907 | Bacteria | 8370 |
| 934 | Ga0207645_10008865 | 3300025907 | Bacteria | 6987 |
| 935 | Ga0207645_10021055 | 3300025907 | Bacteria | 4257 |
| 936 | Ga0207645_10036497 | 3300025907 | Bacteria | 3155 |
| 937 | Ga0207645_10143436 | 3300025907 | Bacteria | 1557 |
| 938 | Ga0207645_10154702 | 3300025907 | Bacteria | 1498 |
| 939 | Ga0207643_10004405 | 3300025908 | Bacteria | 7574 |
| 940 | Ga0207643_10008664 | 3300025908 | Bacteria | 5457 |
| 941 | Ga0207643_10160761 | 3300025908 | Unclassified | 1351 |
| 942 | Ga0207705_10000045 | 3300025909 | Bacteria | 180625 |
| 943 | Ga0207705_10009444 | 3300025909 | Bacteria | 7092 |
| 944 | Ga0207705_10011675 | 3300025909 | Bacteria | 6346 |
| 945 | Ga0207705_10051441 | 3300025909 | Bacteria | 2965 |
| 946 | Ga0207705_10175968 | 3300025909 | Bacteria | 1613 |
| 947 | Ga0207705_10247490 | 3300025909 | Bacteria | 1359 |
| 948 | Ga0207705_10411428 | 3300025909 | Bacteria | 1046 |
| 949 | Ga0207705_10493114 | 3300025909 | Bacteria | 951 |
| 950 | Ga0207654_10000945 | 3300025911 | Bacteria | 15957 |
| 951 | Ga0207654_10001057 | 3300025911 | Bacteria | 14992 |
| 952 | Ga0207654_10002875 | 3300025911 | Bacteria | 8737 |
| 953 | Ga0207654_10011519 | 3300025911 | Bacteria | 4513 |
| 954 | Ga0207654_10027133 | 3300025911 | Bacteria | 3110 |
| 955 | Ga0207654_10047562 | 3300025911 | Bacteria | 2451 |
| 956 | Ga0207707_10000785 | 3300025912 | Bacteria | 31123 |
| 957 | Ga0207707_10002289 | 3300025912 | Bacteria | 17267 |
| 958 | Ga0207707_10015783 | 3300025912 | Bacteria | 6585 |
| 959 | Ga0207707_10109062 | 3300025912 | Bacteria | 2420 |
| 960 | Ga0207707_10145017 | 3300025912 | Unclassified | 2075 |
| 961 | Ga0207707_10238445 | 3300025912 | Bacteria | 1581 |
| 962 | Ga0207707_10399063 | 3300025912 | Unclassified | 1181 |
| 963 | Ga0207695_10000019 | 3300025913 | Bacteria | 732137 |
| 964 | Ga0207695_10000087 | 3300025913 | Bacteria | 276412 |
| 965 | Ga0207695_10000863 | 3300025913 | Bacteria | 55452 |
| 966 | Ga0207695_10004265 | 3300025913 | Bacteria | 19632 |
| 967 | Ga0207695_10004821 | 3300025913 | Bacteria | 18242 |
| 968 | Ga0207695_10032498 | 3300025913 | Bacteria | 5710 |
| 969 | Ga0207695_10051405 | 3300025913 | Unclassified | 4328 |
| 970 | Ga0207695_10087504 | 3300025913 | Bacteria | 3138 |
| 971 | Ga0207695_10176783 | 3300025913 | Bacteria | 2057 |
| 972 | Ga0207695_10308142 | 3300025913 | Bacteria | 1474 |
| 973 | Ga0207695_10447819 | 3300025913 | Bacteria | 1174 |
| 974 | Ga0207671_10003252 | 3300025914 | Bacteria | 16346 |
| 975 | Ga0207671_10006450 | 3300025914 | Bacteria | 10444 |
| 976 | Ga0207671_10007651 | 3300025914 | Bacteria | 9333 |
| 977 | Ga0207671_10008745 | 3300025914 | Bacteria | 8532 |
| 978 | Ga0207671_10017925 | 3300025914 | Bacteria | 5446 |
| 979 | Ga0207671_10022639 | 3300025914 | Unclassified | 4747 |
| 980 | Ga0207671_10036181 | 3300025914 | Bacteria | 3660 |
| 981 | Ga0207671_10110205 | 3300025914 | Bacteria | 2094 |
| 982 | Ga0207671_10148648 | 3300025914 | Bacteria | 1809 |
| 983 | Ga0207671_10269052 | 3300025914 | Bacteria | 1342 |
| 984 | Ga0207671_10492185 | 3300025914 | Unclassified | 978 |
| 985 | Ga0207660_10012376 | 3300025917 | Bacteria | 5581 |
| 986 | Ga0207660_10032056 | 3300025917 | Bacteria | 3624 |
| 987 | Ga0207660_10040413 | 3300025917 | Bacteria | 3265 |
| 988 | Ga0207660_10407469 | 3300025917 | Bacteria | 1095 |
| 989 | Ga0207662_10022900 | 3300025918 | Bacteria | 3585 |
| 990 | Ga0207662_10342869 | 3300025918 | Bacteria | 1002 |
| 991 | Ga0207657_10009277 | 3300025919 | Bacteria | 9911 |
| 992 | Ga0207657_10028323 | 3300025919 | Bacteria | 5112 |
| 993 | Ga0207657_10040503 | 3300025919 | Bacteria | 4127 |
| 994 | Ga0207657_10057355 | 3300025919 | Bacteria | 3356 |
| 995 | Ga0207657_10078928 | 3300025919 | Bacteria | 2770 |
| 996 | Ga0207657_10091876 | 3300025919 | Bacteria | 2530 |
| 997 | Ga0207657_10113207 | 3300025919 | Bacteria | 2239 |
| 998 | Ga0207657_10196814 | 3300025919 | Unclassified | 1623 |
| 999 | Ga0207657_10569962 | 3300025919 | Bacteria | 884 |
| 1000 | Ga0207649_10001875 | 3300025920 | Bacteria | 11999 |
| 1001 | Ga0207649_10005900 | 3300025920 | Bacteria | 6641 |
| 1002 | Ga0207649_10060515 | 3300025920 | Unclassified | 2380 |
| 1003 | Ga0207652_10000103 | 3300025921 | Bacteria | 91988 |
| 1004 | Ga0207652_10001257 | 3300025921 | Bacteria | 22555 |
| 1005 | Ga0207652_10002683 | 3300025921 | Bacteria | 14930 |
| 1006 | Ga0207652_10004292 | 3300025921 | Bacteria | 11623 |
| 1007 | Ga0207652_10034573 | 3300025921 | Bacteria | 4260 |
| 1008 | Ga0207652_10055658 | 3300025921 | Unclassified | 3403 |
| 1009 | Ga0207652_10060901 | 3300025921 | Bacteria | 3258 |
| 1010 | Ga0207652_10195098 | 3300025921 | Bacteria | 1821 |
| 1011 | Ga0207652_10417910 | 3300025921 | Bacteria | 1210 |
| 1012 | Ga0207646_10164022 | 3300025922 | Unclassified | 2006 |
| 1013 | Ga0207681_10010220 | 3300025923 | Bacteria | 5747 |
| 1014 | Ga0207681_10097147 | 3300025923 | Bacteria | 2116 |
| 1015 | Ga0207681_10140772 | 3300025923 | Bacteria | 1796 |
| 1016 | Ga0207681_10206168 | 3300025923 | Bacteria | 1512 |
| 1017 | Ga0207681_10213768 | 3300025923 | Unclassified | 1488 |
| 1018 | Ga0207694_10011375 | 3300025924 | Bacteria | 6717 |
| 1019 | Ga0207694_10058055 | 3300025924 | Bacteria | 3010 |
| 1020 | Ga0207650_10033682 | 3300025925 | Unclassified | 3711 |
| 1021 | Ga0207650_10045601 | 3300025925 | Bacteria | 3225 |
| 1022 | Ga0207650_10050701 | 3300025925 | Bacteria | 3070 |
| 1023 | Ga0207650_10094946 | 3300025925 | Bacteria | 2285 |
| 1024 | Ga0207650_10122960 | 3300025925 | Bacteria | 2023 |
| 1025 | Ga0207650_10140567 | 3300025925 | Unclassified | 1898 |
| 1026 | Ga0207650_10150375 | 3300025925 | Bacteria | 1837 |
| 1027 | Ga0207650_10242466 | 3300025925 | Bacteria | 1457 |
| 1028 | Ga0207650_10311268 | 3300025925 | Bacteria | 1288 |
| 1029 | Ga0207650_10405853 | 3300025925 | Unclassified | 1128 |
| 1030 | Ga0207659_10028297 | 3300025926 | Bacteria | 3807 |
| 1031 | Ga0207659_10052832 | 3300025926 | Bacteria | 2896 |
| 1032 | Ga0207659_10056781 | 3300025926 | Bacteria | 2805 |
| 1033 | Ga0207659_10307547 | 3300025926 | Bacteria | 1304 |
| 1034 | Ga0207687_10260785 | 3300025927 | Bacteria | 1381 |
| 1035 | Ga0207687_10463974 | 3300025927 | Bacteria | 1052 |
| 1036 | Ga0207644_10027212 | 3300025931 | Unclassified | 3950 |
| 1037 | Ga0207644_10052954 | 3300025931 | Bacteria | 2919 |
| 1038 | Ga0207644_10064041 | 3300025931 | Bacteria | 2671 |
| 1039 | Ga0207644_10077611 | 3300025931 | Bacteria | 2446 |
| 1040 | Ga0207644_10136589 | 3300025931 | Bacteria | 1883 |
| 1041 | Ga0207644_10157937 | 3300025931 | Unclassified | 1760 |
| 1042 | Ga0207644_10174594 | 3300025931 | Unclassified | 1680 |
| 1043 | Ga0207644_10460216 | 3300025931 | Bacteria | 1046 |
| 1044 | Ga0207690_10000766 | 3300025932 | Bacteria | 20779 |
| 1045 | Ga0207690_10005287 | 3300025932 | Bacteria | 7612 |
| 1046 | Ga0207690_10022304 | 3300025932 | Bacteria | 3936 |
| 1047 | Ga0207690_10025950 | 3300025932 | Bacteria | 3686 |
| 1048 | Ga0207690_10034698 | 3300025932 | Bacteria | 3252 |
| 1049 | Ga0207690_10079990 | 3300025932 | Unclassified | 2279 |
| 1050 | Ga0207690_10112549 | 3300025932 | Unclassified | 1963 |
| 1051 | Ga0207690_10199973 | 3300025932 | Bacteria | 1517 |
| 1052 | Ga0207706_10000057 | 3300025933 | Bacteria | 112805 |
| 1053 | Ga0207706_10013742 | 3300025933 | Bacteria | 7347 |
| 1054 | Ga0207706_10015669 | 3300025933 | Bacteria | 6851 |
| 1055 | Ga0207706_10032770 | 3300025933 | Bacteria | 4625 |
| 1056 | Ga0207706_10041077 | 3300025933 | Bacteria | 4101 |
| 1057 | Ga0207706_10041917 | 3300025933 | Bacteria | 4056 |
| 1058 | Ga0207706_10045347 | 3300025933 | Unclassified | 3896 |
| 1059 | Ga0207706_10051782 | 3300025933 | Bacteria | 3625 |
| 1060 | Ga0207706_10096309 | 3300025933 | Bacteria | 2603 |
| 1061 | Ga0207686_10001595 | 3300025934 | Bacteria | 12714 |
| 1062 | Ga0207686_10012459 | 3300025934 | Unclassified | 4678 |
| 1063 | Ga0207686_10123301 | 3300025934 | Unclassified | 1767 |
| 1064 | Ga0207686_10219974 | 3300025934 | Bacteria | 1371 |
| 1065 | Ga0207709_10218812 | 3300025935 | Unclassified | 1372 |
| 1066 | Ga0207709_10546443 | 3300025935 | Unclassified | 910 |
| 1067 | Ga0207670_10040768 | 3300025936 | Bacteria | 3049 |
| 1068 | Ga0207670_10046370 | 3300025936 | Bacteria | 2887 |
| 1069 | Ga0207670_10061173 | 3300025936 | Bacteria | 2569 |
| 1070 | Ga0207669_10029049 | 3300025937 | Bacteria | 3051 |
| 1071 | Ga0207669_10141837 | 3300025937 | Unclassified | 1669 |
| 1072 | Ga0207669_10210636 | 3300025937 | Bacteria | 1418 |
| 1073 | Ga0207669_10334663 | 3300025937 | Bacteria | 1163 |
| 1074 | Ga0207669_10342008 | 3300025937 | Bacteria | 1153 |
| 1075 | Ga0207704_10000266 | 3300025938 | Bacteria | 25142 |
| 1076 | Ga0207704_10005149 | 3300025938 | Bacteria | 6020 |
| 1077 | Ga0207704_10019491 | 3300025938 | Bacteria | 3564 |
| 1078 | Ga0207704_10027744 | 3300025938 | Bacteria | 3130 |
| 1079 | Ga0207704_10028606 | 3300025938 | Bacteria | 3095 |
| 1080 | Ga0207704_10080944 | 3300025938 | Bacteria | 2099 |
| 1081 | Ga0207704_10398916 | 3300025938 | Bacteria | 1085 |
| 1082 | Ga0207665_10076711 | 3300025939 | Bacteria | 2292 |
| 1083 | Ga0207691_10000322 | 3300025940 | Bacteria | 47690 |
| 1084 | Ga0207691_10013189 | 3300025940 | Bacteria | 7912 |
| 1085 | Ga0207691_10022737 | 3300025940 | Bacteria | 5910 |
| 1086 | Ga0207691_10035059 | 3300025940 | Bacteria | 4662 |
| 1087 | Ga0207691_10042771 | 3300025940 | Bacteria | 4175 |
| 1088 | Ga0207691_10056700 | 3300025940 | Bacteria | 3568 |
| 1089 | Ga0207691_10057182 | 3300025940 | Bacteria | 3551 |
| 1090 | Ga0207691_10129274 | 3300025940 | Bacteria | 2232 |
| 1091 | Ga0207691_10218260 | 3300025940 | Unclassified | 1654 |
| 1092 | Ga0207691_10551051 | 3300025940 | Unclassified | 978 |
| 1093 | Ga0207711_10560098 | 3300025941 | Unclassified | 1066 |
| 1094 | Ga0207689_10002373 | 3300025942 | Bacteria | 17589 |
| 1095 | Ga0207689_10004255 | 3300025942 | Bacteria | 13015 |
| 1096 | Ga0207689_10005993 | 3300025942 | Bacteria | 10751 |
| 1097 | Ga0207689_10006451 | 3300025942 | Bacteria | 10371 |
| 1098 | Ga0207689_10012780 | 3300025942 | Bacteria | 7173 |
| 1099 | Ga0207689_10013331 | 3300025942 | Bacteria | 7013 |
| 1100 | Ga0207689_10014390 | 3300025942 | Bacteria | 6730 |
| 1101 | Ga0207689_10015849 | 3300025942 | Bacteria | 6384 |
| 1102 | Ga0207689_10017568 | 3300025942 | Bacteria | 6046 |
| 1103 | Ga0207689_10018768 | 3300025942 | Bacteria | 5832 |
| 1104 | Ga0207689_10021517 | 3300025942 | Bacteria | 5423 |
| 1105 | Ga0207689_10022338 | 3300025942 | Bacteria | 5320 |
| 1106 | Ga0207689_10031594 | 3300025942 | Bacteria | 4407 |
| 1107 | Ga0207689_10124311 | 3300025942 | Bacteria | 2122 |
| 1108 | Ga0207689_10216840 | 3300025942 | Unclassified | 1581 |
| 1109 | Ga0207689_10311971 | 3300025942 | Unclassified | 1304 |
| 1110 | Ga0207661_10001968 | 3300025944 | Bacteria | 14142 |
| 1111 | Ga0207661_10010454 | 3300025944 | Bacteria | 6681 |
| 1112 | Ga0207661_10019341 | 3300025944 | Bacteria | 5075 |
| 1113 | Ga0207661_10034779 | 3300025944 | Bacteria | 3922 |
| 1114 | Ga0207661_10064761 | 3300025944 | Unclassified | 2964 |
| 1115 | Ga0207661_10125085 | 3300025944 | Bacteria | 2195 |
| 1116 | Ga0207661_10565966 | 3300025944 | Bacteria | 1042 |
| 1117 | Ga0207679_10000223 | 3300025945 | Bacteria | 44739 |
| 1118 | Ga0207679_10001672 | 3300025945 | Bacteria | 13821 |
| 1119 | Ga0207679_10020334 | 3300025945 | Bacteria | 4479 |
| 1120 | Ga0207679_10028022 | 3300025945 | Bacteria | 3904 |
| 1121 | Ga0207667_10000015 | 3300025949 | Bacteria | 417534 |
| 1122 | Ga0207667_10000644 | 3300025949 | Bacteria | 45263 |
| 1123 | Ga0207667_10003221 | 3300025949 | Bacteria | 20157 |
| 1124 | Ga0207667_10009488 | 3300025949 | Bacteria | 11459 |
| 1125 | Ga0207667_10030806 | 3300025949 | Bacteria | 5798 |
| 1126 | Ga0207667_10056376 | 3300025949 | Bacteria | 4128 |
| 1127 | Ga0207667_10060374 | 3300025949 | Bacteria | 3969 |
| 1128 | Ga0207667_10065419 | 3300025949 | Bacteria | 3792 |
| 1129 | Ga0207667_10107856 | 3300025949 | Bacteria | 2873 |
| 1130 | Ga0207667_10125592 | 3300025949 | Bacteria | 2643 |
| 1131 | Ga0207667_10221630 | 3300025949 | Bacteria | 1938 |
| 1132 | Ga0207667_10323234 | 3300025949 | Bacteria | 1576 |
| 1133 | Ga0207667_10398347 | 3300025949 | Bacteria | 1402 |
| 1134 | Ga0207651_10007850 | 3300025960 | Bacteria | 5713 |
| 1135 | Ga0207651_10014436 | 3300025960 | Bacteria | 4561 |
| 1136 | Ga0207651_10029097 | 3300025960 | Bacteria | 3496 |
| 1137 | Ga0207651_10042377 | 3300025960 | Bacteria | 3029 |
| 1138 | Ga0207651_10051187 | 3300025960 | Unclassified | 2808 |
| 1139 | Ga0207651_10130067 | 3300025960 | Bacteria | 1925 |
| 1140 | Ga0207651_10181632 | 3300025960 | Bacteria | 1669 |
| 1141 | Ga0207651_10253036 | 3300025960 | Unclassified | 1442 |
| 1142 | Ga0207651_10424240 | 3300025960 | Unclassified | 1136 |
| 1143 | Ga0207651_10596466 | 3300025960 | Bacteria | 965 |
| 1144 | Ga0207651_10654532 | 3300025960 | Unclassified | 922 |
| 1145 | Ga0207712_10002565 | 3300025961 | Bacteria | 11677 |
| 1146 | Ga0207712_10005545 | 3300025961 | Bacteria | 7964 |
| 1147 | Ga0207712_10011918 | 3300025961 | Bacteria | 5544 |
| 1148 | Ga0207712_10025662 | 3300025961 | Bacteria | 3918 |
| 1149 | Ga0207712_10046585 | 3300025961 | Bacteria | 3006 |
| 1150 | Ga0207712_10074204 | 3300025961 | Bacteria | 2455 |
| 1151 | Ga0207712_10280329 | 3300025961 | Bacteria | 1360 |
| 1152 | Ga0207668_10000475 | 3300025972 | Bacteria | 25151 |
| 1153 | Ga0207668_10036554 | 3300025972 | Bacteria | 3278 |
| 1154 | Ga0207668_10204089 | 3300025972 | Bacteria | 1576 |
| 1155 | Ga0207668_10207663 | 3300025972 | Bacteria | 1564 |
| 1156 | Ga0207668_10620326 | 3300025972 | Unclassified | 944 |
| 1157 | Ga0207640_10002135 | 3300025981 | Bacteria | 10617 |
| 1158 | Ga0207640_10095408 | 3300025981 | Bacteria | 2071 |
| 1159 | Ga0207640_10112020 | 3300025981 | Bacteria | 1936 |
| 1160 | Ga0207640_10134143 | 3300025981 | Bacteria | 1794 |
| 1161 | Ga0207640_10195321 | 3300025981 | Unclassified | 1529 |
| 1162 | Ga0207640_10206176 | 3300025981 | Bacteria | 1494 |
| 1163 | Ga0207640_10258312 | 3300025981 | Bacteria | 1356 |
| 1164 | Ga0207658_10002470 | 3300025986 | Bacteria | 13496 |
| 1165 | Ga0207658_10008454 | 3300025986 | Bacteria | 7006 |
| 1166 | Ga0207658_10012330 | 3300025986 | Bacteria | 5835 |
| 1167 | Ga0207658_10012528 | 3300025986 | Bacteria | 5793 |
| 1168 | Ga0207658_10034411 | 3300025986 | Bacteria | 3622 |
| 1169 | Ga0207658_10182935 | 3300025986 | Unclassified | 1736 |
| 1170 | Ga0207658_10188642 | 3300025986 | Unclassified | 1712 |
| 1171 | Ga0207658_10222666 | 3300025986 | Unclassified | 1588 |
| 1172 | Ga0207658_10366099 | 3300025986 | Bacteria | 1259 |
| 1173 | Ga0207677_10000863 | 3300026023 | Bacteria | 17337 |
| 1174 | Ga0207677_10002657 | 3300026023 | Bacteria | 9412 |
| 1175 | Ga0207677_10007297 | 3300026023 | Bacteria | 6102 |
| 1176 | Ga0207677_10007663 | 3300026023 | Bacteria | 5992 |
| 1177 | Ga0207677_10035820 | 3300026023 | Bacteria | 3227 |
| 1178 | Ga0207677_10051804 | 3300026023 | Bacteria | 2784 |
| 1179 | Ga0207677_10057073 | 3300026023 | Bacteria | 2679 |
| 1180 | Ga0207677_10076732 | 3300026023 | Bacteria | 2380 |
| 1181 | Ga0207703_10000814 | 3300026035 | Bacteria | 30775 |
| 1182 | Ga0207703_10068179 | 3300026035 | Unclassified | 2931 |
| 1183 | Ga0207703_10125988 | 3300026035 | Bacteria | 2205 |
| 1184 | Ga0207703_10625764 | 3300026035 | Bacteria | 1019 |
| 1185 | Ga0207639_10004988 | 3300026041 | Bacteria | 8940 |
| 1186 | Ga0207639_10005319 | 3300026041 | Bacteria | 8693 |
| 1187 | Ga0207639_10005473 | 3300026041 | Bacteria | 8582 |
| 1188 | Ga0207639_10008068 | 3300026041 | Bacteria | 7199 |
| 1189 | Ga0207639_10009288 | 3300026041 | Bacteria | 6780 |
| 1190 | Ga0207639_10011449 | 3300026041 | Bacteria | 6162 |
| 1191 | Ga0207639_10015980 | 3300026041 | Bacteria | 5301 |
| 1192 | Ga0207639_10031117 | 3300026041 | Bacteria | 3919 |
| 1193 | Ga0207639_10033500 | 3300026041 | Bacteria | 3790 |
| 1194 | Ga0207639_10042980 | 3300026041 | Bacteria | 3390 |
| 1195 | Ga0207639_10057505 | 3300026041 | Bacteria | 2986 |
| 1196 | Ga0207639_10095718 | 3300026041 | Bacteria | 2387 |
| 1197 | Ga0207639_10097453 | 3300026041 | Bacteria | 2368 |
| 1198 | Ga0207639_10107882 | 3300026041 | Unclassified | 2263 |
| 1199 | Ga0207639_10125427 | 3300026041 | Bacteria | 2117 |
| 1200 | Ga0207639_10132910 | 3300026041 | Unclassified | 2062 |
| 1201 | Ga0207639_10251336 | 3300026041 | Bacteria | 1542 |
| 1202 | Ga0207639_10557432 | 3300026041 | Bacteria | 1053 |
| 1203 | Ga0207678_10032708 | 3300026067 | Bacteria | 4533 |
| 1204 | Ga0207678_10366102 | 3300026067 | Unclassified | 1245 |
| 1205 | Ga0207708_10112481 | 3300026075 | Unclassified | 2115 |
| 1206 | Ga0207702_10000165 | 3300026078 | Bacteria | 79066 |
| 1207 | Ga0207702_10019965 | 3300026078 | Bacteria | 5550 |
| 1208 | Ga0207702_10135571 | 3300026078 | Bacteria | 2221 |
| 1209 | Ga0207702_10156603 | 3300026078 | Bacteria | 2077 |
| 1210 | Ga0207702_10317660 | 3300026078 | Bacteria | 1482 |
| 1211 | Ga0207702_10344598 | 3300026078 | Bacteria | 1424 |
| 1212 | Ga0207641_10000058 | 3300026088 | Bacteria | 166385 |
| 1213 | Ga0207641_10003931 | 3300026088 | Bacteria | 12996 |
| 1214 | Ga0207641_10005737 | 3300026088 | Bacteria | 10545 |
| 1215 | Ga0207641_10017416 | 3300026088 | Bacteria | 5882 |
| 1216 | Ga0207641_10041507 | 3300026088 | Bacteria | 3856 |
| 1217 | Ga0207641_10059311 | 3300026088 | Bacteria | 3258 |
| 1218 | Ga0207641_10065270 | 3300026088 | Bacteria | 3113 |
| 1219 | Ga0207641_10121696 | 3300026088 | Unclassified | 2330 |
| 1220 | Ga0207641_10319375 | 3300026088 | Unclassified | 1472 |
| 1221 | Ga0207641_10321659 | 3300026088 | Unclassified | 1467 |
| 1222 | Ga0207648_10000820 | 3300026089 | Bacteria | 35151 |
| 1223 | Ga0207648_10003208 | 3300026089 | Bacteria | 17220 |
| 1224 | Ga0207648_10004484 | 3300026089 | Bacteria | 14324 |
| 1225 | Ga0207648_10007640 | 3300026089 | Bacteria | 10592 |
| 1226 | Ga0207648_10012664 | 3300026089 | Bacteria | 7885 |
| 1227 | Ga0207648_10017326 | 3300026089 | Bacteria | 6560 |
| 1228 | Ga0207648_10037211 | 3300026089 | Bacteria | 4286 |
| 1229 | Ga0207648_10052616 | 3300026089 | Bacteria | 3561 |
| 1230 | Ga0207648_10087459 | 3300026089 | Bacteria | 2720 |
| 1231 | Ga0207648_10121269 | 3300026089 | Bacteria | 2299 |
| 1232 | Ga0207648_10172746 | 3300026089 | Bacteria | 1911 |
| 1233 | Ga0207648_10191482 | 3300026089 | Bacteria | 1813 |
| 1234 | Ga0207648_10385588 | 3300026089 | Bacteria | 1268 |
| 1235 | Ga0207676_10004821 | 3300026095 | Bacteria | 9570 |
| 1236 | Ga0207676_10008428 | 3300026095 | Bacteria | 7329 |
| 1237 | Ga0207676_10012530 | 3300026095 | Bacteria | 6079 |
| 1238 | Ga0207676_10027108 | 3300026095 | Bacteria | 4264 |
| 1239 | Ga0207676_10071782 | 3300026095 | Bacteria | 2781 |
| 1240 | Ga0207676_10084729 | 3300026095 | Unclassified | 2584 |
| 1241 | Ga0207676_10102365 | 3300026095 | Bacteria | 2377 |
| 1242 | Ga0207676_10193088 | 3300026095 | Unclassified | 1793 |
| 1243 | Ga0207676_10525211 | 3300026095 | Bacteria | 1127 |
| 1244 | Ga0207674_10031003 | 3300026116 | Bacteria | 5619 |
| 1245 | Ga0207674_10031084 | 3300026116 | Bacteria | 5610 |
| 1246 | Ga0207674_10061629 | 3300026116 | Unclassified | 3789 |
| 1247 | Ga0207674_10075106 | 3300026116 | Bacteria | 3390 |
| 1248 | Ga0207674_10085770 | 3300026116 | Bacteria | 3143 |
| 1249 | Ga0207674_10093977 | 3300026116 | Bacteria | 2986 |
| 1250 | Ga0207674_10109546 | 3300026116 | Bacteria | 2738 |
| 1251 | Ga0207674_10157689 | 3300026116 | Unclassified | 2225 |
| 1252 | Ga0207674_10176620 | 3300026116 | Bacteria | 2088 |
| 1253 | Ga0207674_10265145 | 3300026116 | Bacteria | 1665 |
| 1254 | Ga0207675_100000646 | 3300026118 | Bacteria | 34270 |
| 1255 | Ga0207675_100002881 | 3300026118 | Bacteria | 16915 |
| 1256 | Ga0207675_100014651 | 3300026118 | Bacteria | 7310 |
| 1257 | Ga0207675_100108878 | 3300026118 | Bacteria | 2613 |
| 1258 | Ga0207675_100159933 | 3300026118 | Bacteria | 2148 |
| 1259 | Ga0207675_100197471 | 3300026118 | Bacteria | 1931 |
| 1260 | Ga0207675_100223013 | 3300026118 | Bacteria | 1817 |
| 1261 | Ga0207675_100315104 | 3300026118 | Unclassified | 1526 |
| 1262 | Ga0207675_100325210 | 3300026118 | Bacteria | 1502 |
| 1263 | Ga0207683_10012841 | 3300026121 | Bacteria | 7149 |
| 1264 | Ga0207683_10020499 | 3300026121 | Bacteria | 5654 |
| 1265 | Ga0207683_10030804 | 3300026121 | Unclassified | 4651 |
| 1266 | Ga0207683_10165220 | 3300026121 | Bacteria | 2003 |
| 1267 | Ga0207698_10003833 | 3300026142 | Bacteria | 9103 |
| 1268 | Ga0207698_10006479 | 3300026142 | Bacteria | 7308 |
| 1269 | Ga0207698_10015545 | 3300026142 | Bacteria | 5099 |
| 1270 | Ga0207698_10020442 | 3300026142 | Unclassified | 4557 |
| 1271 | Ga0207698_10033537 | 3300026142 | Bacteria | 3732 |
| 1272 | Ga0207698_10047101 | 3300026142 | Bacteria | 3262 |
| 1273 | Ga0207698_10090718 | 3300026142 | Bacteria | 2500 |
| 1274 | Ga0207698_10119163 | 3300026142 | Unclassified | 2230 |
| 1275 | Ga0207698_10125088 | 3300026142 | Unclassified | 2185 |
| 1276 | Ga0207698_10144799 | 3300026142 | Unclassified | 2053 |
| 1277 | Ga0207698_10162772 | 3300026142 | Bacteria | 1954 |
| 1278 | Ga0207698_10175937 | 3300026142 | Bacteria | 1890 |
| 1279 | Ga0207698_10419937 | 3300026142 | Bacteria | 1283 |
| 1280 | Ga0209968_1004926 | 3300027526 | Bacteria | 2003 |
| 1281 | Ga0207428_10074553 | 3300027907 | Bacteria | 2661 |
| 1282 | Ga0207428_10086053 | 3300027907 | Bacteria | 2447 |
| 1283 | Ga0268266_10000030 | 3300028379 | Bacteria | 417120 |
| 1284 | Ga0268266_10003162 | 3300028379 | Bacteria | 16711 |
| 1285 | Ga0268266_10061888 | 3300028379 | Bacteria | 3228 |
| 1286 | Ga0268266_10525811 | 3300028379 | Unclassified | 1131 |
| 1287 | Ga0268265_10003417 | 3300028380 | Bacteria | 11428 |
| 1288 | Ga0268265_10005499 | 3300028380 | Bacteria | 8648 |
| 1289 | Ga0268265_10012001 | 3300028380 | Bacteria | 5863 |
| 1290 | Ga0268265_10043777 | 3300028380 | Bacteria | 3330 |
| 1291 | Ga0268265_10112713 | 3300028380 | Bacteria | 2224 |
| 1292 | Ga0268265_10137972 | 3300028380 | Bacteria | 2037 |
| 1293 | Ga0268264_10001732 | 3300028381 | Bacteria | 20053 |
| 1294 | Ga0268264_10003381 | 3300028381 | Bacteria | 13781 |
| 1295 | Ga0268264_10004437 | 3300028381 | Bacteria | 11970 |
| 1296 | Ga0268264_10011514 | 3300028381 | Bacteria | 7306 |
| 1297 | Ga0268264_10016463 | 3300028381 | Bacteria | 6055 |
| 1298 | Ga0268264_10021945 | 3300028381 | Bacteria | 5210 |
| 1299 | Ga0268264_10040321 | 3300028381 | Bacteria | 3859 |
| 1300 | Ga0268264_10054278 | 3300028381 | Bacteria | 3346 |
| 1301 | Ga0268264_10185596 | 3300028381 | Bacteria | 1892 |
| 1302 | Ga0268264_10341907 | 3300028381 | Bacteria | 1422 |
| 1303 | Ga0268264_10392779 | 3300028381 | Unclassified | 1331 |
| 1304 | Ga0268264_11011648 | 3300028381 | Bacteria | 838 |
| 1305 | Ga0307517_10001481 | 3300028786 | Bacteria | 39285 |
| 1306 | Ga0307517_10022273 | 3300028786 | Bacteria | 7945 |
| 1307 | Ga0307517_10113502 | 3300028786 | Bacteria | 2045 |
| 1308 | Ga0307515_10000001 | 3300028794 | Bacteria | 4259510 |
| 1309 | Ga0307515_10000012 | 3300028794 | Bacteria | 582232 |
| 1310 | Ga0307515_10000059 | 3300028794 | Bacteria | 257520 |
| 1311 | Ga0307515_10000349 | 3300028794 | Bacteria | 114163 |
| 1312 | Ga0307515_10000376 | 3300028794 | Bacteria | 109190 |
| 1313 | Ga0307515_10005206 | 3300028794 | Bacteria | 26435 |
| 1314 | Ga0307515_10040038 | 3300028794 | Bacteria | 7424 |
| 1315 | Ga0307515_10263621 | 3300028794 | Unclassified | 1455 |
| 1316 | Ga0307511_10000076 | 3300030521 | Bacteria | 82520 |
| 1317 | Ga0316177_1015993 | 3300030731 | Bacteria | 3065 |
| 1318 | Ga0316177_1087909 | 3300030731 | Bacteria | 967 |
| 1319 | Ga0316176_1026788 | 3300030732 | Bacteria | 12096 |
| 1320 | Ga0316183_1099321 | 3300030742 | Bacteria | 18877 |
| 1321 | Ga0316181_1156971 | 3300030744 | Bacteria | 5606 |
| 1322 | Ga0316181_1210309 | 3300030744 | Bacteria | 1947 |
| 1323 | Ga0316182_1096864 | 3300030745 | Bacteria | 2018 |
| 1324 | Ga0265320_10093821 | 3300031240 | Bacteria | 1388 |
| 1325 | Ga0265331_10081425 | 3300031250 | Unclassified | 1503 |
| 1326 | Ga0265327_10000013 | 3300031251 | Bacteria | 519549 |
| 1327 | Ga0265327_10000031 | 3300031251 | Bacteria | 325718 |
| 1328 | Ga0265327_10000137 | 3300031251 | Bacteria | 160704 |
| 1329 | Ga0265327_10013169 | 3300031251 | Bacteria | 5512 |
| 1330 | Ga0265327_10013842 | 3300031251 | Bacteria | 5327 |
| 1331 | Ga0265327_10071989 | 3300031251 | Bacteria | 1728 |
| 1332 | Ga0307513_10219831 | 3300031456 | Bacteria | 1722 |
| 1333 | Ga0307509_10044062 | 3300031507 | Bacteria | 4822 |
| 1334 | Ga0307509_10064621 | 3300031507 | Bacteria | 3848 |
| 1335 | Ga0307509_10126854 | 3300031507 | Bacteria | 2516 |
| 1336 | Ga0307509_10256229 | 3300031507 | Bacteria | 1529 |
| 1337 | Ga0307509_10261765 | 3300031507 | Bacteria | 1504 |
| 1338 | Ga0307408_100000541 | 3300031548 | Bacteria | 32578 |
| 1339 | Ga0307408_100003308 | 3300031548 | Bacteria | 11082 |
| 1340 | Ga0307408_100018035 | 3300031548 | Bacteria | 4735 |
| 1341 | Ga0307408_100049099 | 3300031548 | Bacteria | 3029 |
| 1342 | Ga0307508_10006441 | 3300031616 | Bacteria | 11041 |
| 1343 | Ga0307508_10270277 | 3300031616 | Bacteria | 1294 |
| 1344 | Ga0265314_10088042 | 3300031711 | Bacteria | 2029 |
| 1345 | Ga0307516_10003288 | 3300031730 | Bacteria | 20916 |
| 1346 | Ga0307516_10129055 | 3300031730 | Bacteria | 2310 |
| 1347 | Ga0307516_10247622 | 3300031730 | Bacteria | 1478 |
| 1348 | Ga0307405_10000015 | 3300031731 | Bacteria | 206299 |
| 1349 | Ga0307405_10015968 | 3300031731 | Bacteria | 4082 |
| 1350 | Ga0307405_10024515 | 3300031731 | Bacteria | 3447 |
| 1351 | Ga0307405_10498241 | 3300031731 | Bacteria | 976 |
| 1352 | Ga0307413_10123252 | 3300031824 | Bacteria | 1760 |
| 1353 | Ga0307413_10177719 | 3300031824 | Bacteria | 1514 |
| 1354 | Ga0307407_10000027 | 3300031903 | Bacteria | 107307 |
| 1355 | Ga0307412_10000030 | 3300031911 | Bacteria | 208541 |
| 1356 | Ga0307412_10012923 | 3300031911 | Bacteria | 4880 |
| 1357 | Ga0307412_10039962 | 3300031911 | Bacteria | 3033 |
| 1358 | Ga0307412_10128525 | 3300031911 | Bacteria | 1837 |
| 1359 | Ga0307412_10492401 | 3300031911 | Bacteria | 1019 |
| 1360 | Ga0307416_100000002 | 3300032002 | Bacteria | 509907 |
| 1361 | Ga0307416_100056158 | 3300032002 | Bacteria | 3176 |
| 1362 | Ga0307416_100246061 | 3300032002 | Bacteria | 1737 |
| 1363 | Ga0307414_10000262 | 3300032004 | Bacteria | 33057 |
| 1364 | Ga0307414_10006046 | 3300032004 | Bacteria | 6714 |
| 1365 | Ga0307414_10019408 | 3300032004 | Bacteria | 4213 |
| 1366 | Ga0307414_10027138 | 3300032004 | Bacteria | 3696 |
| 1367 | Ga0307414_10037255 | 3300032004 | Bacteria | 3254 |
| 1368 | Ga0307414_10066410 | 3300032004 | Unclassified | 2579 |
| 1369 | Ga0307414_10128998 | 3300032004 | Bacteria | 1959 |
| 1370 | Ga0307414_10130002 | 3300032004 | Unclassified | 1953 |
| 1371 | Ga0307414_10211709 | 3300032004 | Bacteria | 1585 |
| 1372 | Ga0307414_10620892 | 3300032004 | Bacteria | 972 |
| 1373 | Ga0307507_10003702 | 3300033179 | Bacteria | 28885 |
| 1374 | Ga0307507_10115244 | 3300033179 | Unclassified | 2175 |
| 1375 | Ga0307510_10000464 | 3300033180 | Bacteria | 39482 |
| 1376 | Ga0373950_0027934 | 3300034818 | Bacteria | 1032 |
| 1377 | Ga0373934_0045137 | 3300035086 | Unclassified | 1742 |
| 1378 | Ga0373943_0057217 | 3300035170 | Unclassified | 1937 |
| 1379 | Ga0373946_0029924 | 3300035171 | Bacteria | 2171 |
| 1380 | Ga0373955_0009887 | 3300035172 | Bacteria | 4488 |
| 1381 | Ga0373935_0150339 | 3300035692 | Bacteria | 1580 |
| 1382 | Ga0373933_0062135 | 3300035724 | Unclassified | 2255 |
| 1383 | Ga0373933_0156255 | 3300035724 | Bacteria | 1447 |
| 1384 | Ga0373947_0386689 | 3300035725 | Bacteria | 942 |
| 1385 | Ga0373937_0016924 | 3300036401 | Bacteria | 6483 |
| 1386 | Ga0373925_0214204 | 3300037068 | Bacteria | 1535 |
| 1387 | Ga0373925_0358037 | 3300037068 | Unclassified | 1186 |
| 1388 | Ga0373925_0466509 | 3300037068 | Bacteria | 1035 |
| 1389 | Ga0395899_0000001 | 3300037312 | Bacteria | 1750322 |
| 1390 | Ga0395899_0000887 | 3300037312 | Bacteria | 28407 |
| 1391 | Ga0395899_0007044 | 3300037312 | Bacteria | 8701 |
| 1392 | Ga0395899_0007705 | 3300037312 | Bacteria | 8302 |
| 1393 | Ga0395899_0020100 | 3300037312 | Bacteria | 5067 |
| 1394 | Ga0395899_0037069 | 3300037312 | Bacteria | 3656 |
| 1395 | Ga0395899_0055058 | 3300037312 | Bacteria | 2942 |
| 1396 | Ga0395899_0067028 | 3300037312 | Bacteria | 2634 |
| 1397 | Ga0395899_0078418 | 3300037312 | Unclassified | 2407 |
| 1398 | Ga0395900_0000143 | 3300037418 | Bacteria | 120234 |
| 1399 | Ga0395900_0000684 | 3300037418 | Bacteria | 45221 |
| 1400 | Ga0395900_0003189 | 3300037418 | Bacteria | 17771 |
| 1401 | Ga0395900_0006556 | 3300037418 | Bacteria | 12124 |
| 1402 | Ga0395900_0039835 | 3300037418 | Bacteria | 4842 |
| 1403 | Ga0395900_0114735 | 3300037418 | Bacteria | 2764 |
| 1404 | Ga0395898_0001240 | 3300037466 | Bacteria | 38058 |
| 1405 | Ga0395898_0004789 | 3300037466 | Bacteria | 14725 |
| 1406 | Ga0395898_0136633 | 3300037466 | Bacteria | 2347 |
| 1407 | Ga0395898_0187493 | 3300037466 | Bacteria | 1976 |
| 1408 | Ga0395898_0238196 | 3300037466 | Bacteria | 1735 |
| 1409 | Ga0395898_0325443 | 3300037466 | Bacteria | 1466 |
| 1410 | Ga0395905_0000175 | 3300037471 | Bacteria | 104024 |
| 1411 | Ga0395905_0000981 | 3300037471 | Bacteria | 36581 |
| 1412 | Ga0395905_0002365 | 3300037471 | Bacteria | 21010 |
| 1413 | Ga0395905_0005773 | 3300037471 | Bacteria | 12580 |
| 1414 | Ga0395905_0246718 | 3300037471 | Bacteria | 1668 |
| 1415 | Ga0395901_0000313 | 3300038443 | Bacteria | 59766 |
| 1416 | Ga0395901_0000995 | 3300038443 | Bacteria | 30617 |
| 1417 | Ga0395901_0004445 | 3300038443 | Bacteria | 14139 |
| 1418 | Ga0395901_0009480 | 3300038443 | Bacteria | 9877 |
| 1419 | Ga0395901_0010499 | 3300038443 | Bacteria | 9381 |
| 1420 | Ga0395901_0021527 | 3300038443 | Bacteria | 6607 |
| 1421 | Ga0395901_0045853 | 3300038443 | Bacteria | 4539 |
| 1422 | Ga0395901_0455660 | 3300038443 | Bacteria | 1307 |
| 1423 | Ga0436365_0782007 | 3300039437 | Bacteria | 1906 |
| 1424 | Ga0436365_0943390 | 3300039437 | Bacteria | 13925 |
| 1425 | Ga0436365_1630471 | 3300039437 | Bacteria | 1924 |
| 1426 | Ga0436361_1115729 | 3300039447 | Bacteria | 13860 |
| 1427 | Ga0439436_0000160 | 3300041404 | Bacteria | 15790 |
| 1428 | Ga0439439_0052951 | 3300041406 | Bacteria | 1066 |
| 1429 | Ga0439453_0008644 | 3300041408 | Bacteria | 1639 |
| 1430 | Ga0451787_841972 | 3300041441 | Bacteria | 1044 |
| 1431 | Ga0451795_0318958 | 3300041456 | Bacteria | 1000 |
| 1432 | Ga0451802_0264569 | 3300041460 | Bacteria | 1236 |
| 1433 | Ga0451802_1472217 | 3300041460 | Bacteria | 1482 |
| 1434 | Ga0451804_0820654 | 3300041463 | Bacteria | 1163 |
| 1435 | Ga0451841_1351513 | 3300041498 | Bacteria | 926 |
| 1436 | Ga0451853_3193490 | 3300041512 | Bacteria | 1537 |
| 1437 | Ga0439431_0009310 | 3300041997 | Bacteria | 2217 |
| 1438 | Ga0439441_001534 | 3300042001 | Unclassified | 3055 |
| 1439 | Ga0439445_0029071 | 3300042004 | Unclassified | 1427 |
| 1440 | Ga0439449_0006413 | 3300042007 | Bacteria | 4500 |
| 1441 | Ga0439455_0038536 | 3300042012 | Bacteria | 1216 |
| 1442 | Ga0439462_0004351 | 3300042015 | Bacteria | 3449 |
| 1443 | Ga0439462_0040408 | 3300042015 | Bacteria | 1244 |
| 1444 | Ga0450922_007563 | 3300042124 | Bacteria | 1020 |
| 1445 | Ga0450894_011061 | 3300042131 | Bacteria | 1173 |
| 1446 | Ga0450898_000823 | 3300042134 | Bacteria | 3844 |
| 1447 | Ga0450898_022155 | 3300042134 | Bacteria | 1123 |
| 1448 | Ga0439446_0034792 | 3300042156 | Unclassified | 1467 |
| 1449 | Ga0439434_0007850 | 3300042435 | Unclassified | 3127 |
| 1450 | Ga0439434_0037469 | 3300042435 | Bacteria | 1485 |
| 1451 | Ga0439460_0032113 | 3300042461 | Bacteria | 1502 |
| 1452 | Ga0451577_0012474 | 3300042876 | Bacteria | 7978 |
| 1453 | Ga0451577_0107849 | 3300042876 | Bacteria | 2490 |
| 1454 | Ga0451577_0687026 | 3300042876 | Bacteria | 927 |
| 1455 | Ga0466969_0057063 | 3300044656 | Bacteria | 1904 |
| 1456 | Ga0466972_0000049 | 3300044658 | Bacteria | 118829 |
| 1457 | Ga0466972_0000146 | 3300044658 | Bacteria | 57580 |
| 1458 | Ga0466972_0000641 | 3300044658 | Bacteria | 16866 |
| 1459 | Ga0466972_0006223 | 3300044658 | Bacteria | 5998 |
| 1460 | Ga0453683_0016564 | 3300044673 | Bacteria | 4755 |
| 1461 | Ga0453683_0126061 | 3300044673 | Unclassified | 1612 |
| 1462 | Ga0453683_0267404 | 3300044673 | Unclassified | 1091 |
| 1463 | Ga0466965_0154913 | 3300044683 | Bacteria | 1199 |
| 1464 | Ga0466966_0000015 | 3300044684 | Bacteria | 127402 |
| 1465 | Ga0466961_0085905 | 3300044693 | Bacteria | 1989 |
| 1466 | Ga0466961_0120018 | 3300044693 | Bacteria | 1651 |
| 1467 | Ga0453684_0027037 | 3300044712 | Bacteria | 8251 |
| 1468 | Ga0453684_0054484 | 3300044712 | Bacteria | 5209 |
| 1469 | Ga0453684_0073768 | 3300044712 | Unclassified | 4300 |
| 1470 | Ga0453684_0143209 | 3300044712 | Bacteria | 2851 |
| 1471 | Ga0453684_0309874 | 3300044712 | Bacteria | 1792 |
| 1472 | Ga0466971_0056363 | 3300044719 | Bacteria | 1773 |
| 1473 | Ga0466971_0152248 | 3300044719 | Unclassified | 1080 |
| 1474 | Ga0466968_0022170 | 3300044735 | Bacteria | 2580 |
| 1475 | Ga0466970_0015947 | 3300044765 | Bacteria | 3868 |
| 1476 | Ga0466957_0000381 | 3300044842 | Bacteria | 21723 |
| 1477 | Ga0466957_0012327 | 3300044842 | Bacteria | 4949 |
| 1478 | Ga0466957_0062028 | 3300044842 | Bacteria | 2296 |
| 1479 | Ga0466960_0093469 | 3300044901 | Bacteria | 1537 |
| 1480 | Ga0466959_0000030 | 3300045049 | Bacteria | 111343 |
| 1481 | Ga0466959_0057437 | 3300045049 | Bacteria | 2837 |
| 1482 | Ga0466959_0151381 | 3300045049 | Unclassified | 1635 |
| 1483 | Ga0466959_0560120 | 3300045049 | Unclassified | 770 |
| 1484 | Ga0451576_0130745 | 3300045051 | Unclassified | 2617 |
| 1485 | Ga0451576_0475321 | 3300045051 | Bacteria | 1313 |
| 1486 | Ga0451576_0812298 | 3300045051 | Unclassified | 982 |
| 1487 | Ga0466967_0248632 | 3300045976 | Bacteria | 1698 |
| 1488 | Ga0466967_0844880 | 3300045976 | Bacteria | 910 |
| 1489 | Ga0495627_104413 | 3300046453 | Bacteria | 807 |
| 1490 | Ga0495629_0020111 | 3300046459 | Bacteria | 4767 |
| 1491 | Ga0495638_0111546 | 3300046460 | Bacteria | 1624 |
| 1492 | Ga0495638_0117585 | 3300046460 | Bacteria | 1573 |
| 1493 | Ga0495651_0330405 | 3300046462 | Bacteria | 1013 |
| 1494 | Ga0495650_0000162 | 3300046471 | Bacteria | 148927 |
| 1495 | Ga0495650_0045261 | 3300046471 | Bacteria | 1854 |
| 1496 | Ga0495582_0091006 | 3300046473 | Bacteria | 1701 |
| 1497 | Ga0495662_0165709 | 3300046476 | Bacteria | 1089 |
| 1498 | Ga0495585_0000100 | 3300046492 | Bacteria | 91669 |
| 1499 | Ga0495585_0000153 | 3300046492 | Bacteria | 74267 |
| 1500 | Ga0495585_0000853 | 3300046492 | Bacteria | 26111 |
| 1501 | Ga0495585_0186983 | 3300046492 | Bacteria | 1062 |
| 1502 | Ga0495607_0154217 | 3300046501 | Bacteria | 1173 |
| 1503 | Ga0495583_0017756 | 3300046506 | Bacteria | 3767 |
| 1504 | Ga0495606_0000033 | 3300046507 | Bacteria | 247739 |
| 1505 | Ga0495606_0005624 | 3300046507 | Bacteria | 11905 |
| 1506 | Ga0495606_0013056 | 3300046507 | Bacteria | 6599 |
| 1507 | Ga0495606_0016861 | 3300046507 | Bacteria | 5548 |
| 1508 | Ga0495608_0117296 | 3300046511 | Unclassified | 1708 |
| 1509 | Ga0495610_0000768 | 3300046512 | Bacteria | 30249 |
| 1510 | Ga0495610_0002306 | 3300046512 | Bacteria | 16113 |
| 1511 | Ga0495610_0009518 | 3300046512 | Bacteria | 6131 |
| 1512 | Ga0495616_0003449 | 3300046513 | Bacteria | 10118 |
| 1513 | Ga0495616_0006594 | 3300046513 | Bacteria | 7014 |
| 1514 | Ga0495618_0016132 | 3300046514 | Unclassified | 4566 |
| 1515 | Ga0495628_0216836 | 3300046516 | Unclassified | 1438 |
| 1516 | Ga0495630_0017644 | 3300046517 | Bacteria | 5232 |
| 1517 | Ga0495630_0042346 | 3300046517 | Unclassified | 3400 |
| 1518 | Ga0495631_0006431 | 3300046518 | Bacteria | 6062 |
| 1519 | Ga0495632_0025276 | 3300046519 | Unclassified | 3144 |
| 1520 | Ga0495637_0048334 | 3300046520 | Bacteria | 1792 |
| 1521 | Ga0495644_0004653 | 3300046523 | Bacteria | 5393 |
| 1522 | Ga0495648_0013944 | 3300046524 | Bacteria | 5913 |
| 1523 | Ga0495648_0048233 | 3300046524 | Bacteria | 2624 |
| 1524 | Ga0495648_0067829 | 3300046524 | Bacteria | 2084 |
| 1525 | Ga0495663_0072881 | 3300046525 | Bacteria | 1096 |
| 1526 | Ga0495652_0326599 | 3300046529 | Bacteria | 1106 |
| 1527 | Ga0495654_0030700 | 3300046530 | Bacteria | 2733 |
| 1528 | Ga0495654_0076653 | 3300046530 | Bacteria | 1575 |
| 1529 | Ga0495640_0220929 | 3300046533 | Bacteria | 1195 |
| 1530 | Ga0495586_0034603 | 3300046535 | Bacteria | 2714 |
| 1531 | Ga0495587_0023448 | 3300046536 | Unclassified | 3792 |
| 1532 | Ga0495587_0119968 | 3300046536 | Bacteria | 1507 |
| 1533 | Ga0495609_0004780 | 3300046538 | Bacteria | 7312 |
| 1534 | Ga0495609_0028955 | 3300046538 | Bacteria | 2524 |
| 1535 | Ga0495609_0031055 | 3300046538 | Bacteria | 2430 |
| 1536 | Ga0495633_0000389 | 3300046558 | Bacteria | 46261 |
| 1537 | Ga0495633_0011583 | 3300046558 | Bacteria | 4746 |
| 1538 | Ga0495633_0021524 | 3300046558 | Bacteria | 3224 |
| 1539 | Ga0495667_0292027 | 3300046559 | Bacteria | 1034 |
| 1540 | Ga0495668_0000009 | 3300046616 | Bacteria | 492623 |
| 1541 | Ga0495668_0000121 | 3300046616 | Bacteria | 116234 |
| 1542 | Ga0495668_0001043 | 3300046616 | Bacteria | 29368 |
| 1543 | Ga0495634_0030005 | 3300046642 | Unclassified | 3760 |
| 1544 | Ga0495634_0085542 | 3300046642 | Bacteria | 2055 |
| 1545 | Ga0495625_0000131 | 3300046660 | Bacteria | 117738 |
| 1546 | Ga0495625_0000951 | 3300046660 | Bacteria | 38714 |
| 1547 | Ga0495625_0001562 | 3300046660 | Bacteria | 27264 |
| 1548 | Ga0495625_0012472 | 3300046660 | Bacteria | 6886 |
| 1549 | Ga0495625_0016203 | 3300046660 | Bacteria | 5872 |
| 1550 | Ga0495625_0023966 | 3300046660 | Bacteria | 4654 |
| 1551 | Ga0495625_0028787 | 3300046660 | Bacteria | 4161 |
| 1552 | Ga0495625_0047135 | 3300046660 | Bacteria | 3108 |
| 1553 | Ga0495635_0217823 | 3300046663 | Unclassified | 1292 |
| 1554 | Ga0495661_0018305 | 3300046665 | Bacteria | 4609 |
| 1555 | Ga0495647_0067788 | 3300046681 | Bacteria | 1422 |
| 1556 | Ga0495658_0048820 | 3300046683 | Bacteria | 2388 |
| 1557 | Ga0495658_0112207 | 3300046683 | Bacteria | 1640 |
| 1558 | Ga0495658_0127114 | 3300046683 | Unclassified | 1548 |
| 1559 | Ga0495669_0092746 | 3300046684 | Unclassified | 1396 |
| 1560 | Ga0495613_0275641 | 3300046689 | Bacteria | 1169 |
| 1561 | Ga0495613_0309616 | 3300046689 | Unclassified | 1092 |
| 1562 | Ga0495670_0010108 | 3300046691 | Bacteria | 4641 |
| 1563 | Ga0495670_0075781 | 3300046691 | Bacteria | 1708 |
| 1564 | Ga0495671_0147908 | 3300046692 | Bacteria | 1144 |
| 1565 | Ga0495649_0000009 | 3300046694 | Bacteria | 451725 |
| 1566 | Ga0495600_0048821 | 3300046809 | Unclassified | 2761 |
| 1567 | Ga0495660_0006541 | 3300046810 | Bacteria | 6886 |
| 1568 | Ga0495660_0164436 | 3300046810 | Bacteria | 1086 |
| 1569 | Ga0495672_0073342 | 3300047320 | Bacteria | 1931 |
| 1570 | Ga0495680_0050171 | 3300047322 | Unclassified | 3264 |
| 1571 | Ga0495683_0041431 | 3300047323 | Unclassified | 2324 |
| 1572 | Ga0495687_001889 | 3300047443 | Bacteria | 18066 |
| 1573 | Ga0495687_004330 | 3300047443 | Bacteria | 9657 |
| 1574 | Ga0495684_0162552 | 3300047471 | Unclassified | 1665 |
| 1575 | Ga0495686_0000005 | 3300047472 | Bacteria | 827143 |
| 1576 | Ga0495686_0000365 | 3300047472 | Bacteria | 73281 |
| 1577 | Ga0495686_0000843 | 3300047472 | Bacteria | 39372 |
| 1578 | Ga0495686_0000973 | 3300047472 | Bacteria | 35208 |
| 1579 | Ga0495686_0008772 | 3300047472 | Bacteria | 7368 |
| 1580 | Ga0495686_0010545 | 3300047472 | Bacteria | 6566 |
| 1581 | Ga0495686_0015477 | 3300047472 | Bacteria | 5206 |
| 1582 | Ga0495686_0064154 | 3300047472 | Bacteria | 2274 |
| 1583 | Ga0495686_0266028 | 3300047472 | Bacteria | 958 |
| 1584 | Ga0495602_0102640 | 3300048088 | Bacteria | 2343 |
| 1585 | Ga0496101_0399871 | 3300048904 | Bacteria | 1082 |
| 1586 | Ga0496104_0324376 | 3300048907 | Unclassified | 1453 |
| 1587 | Ga0496108_0106115 | 3300048911 | Bacteria | 2399 |
| 1588 | Ga0496108_0111916 | 3300048911 | Unclassified | 2336 |
| 1589 | Ga0496110_0065825 | 3300048913 | Bacteria | 3204 |
| 1590 | Ga0496113_0233418 | 3300048916 | Unclassified | 1467 |
| 1591 | Ga0496114_0078693 | 3300048917 | Bacteria | 2782 |
| 1592 | Ga0496114_0118899 | 3300048917 | Unclassified | 2271 |
| 1593 | Ga0496122_0000869 | 3300048925 | Bacteria | 56890 |
| 1594 | Ga0496123_0004125 | 3300048926 | Bacteria | 15552 |
| 1595 | Ga0496124_0021144 | 3300048927 | Bacteria | 5999 |
| 1596 | Ga0496124_0029360 | 3300048927 | Bacteria | 4902 |
| 1597 | Ga0496125_0134431 | 3300048928 | Bacteria | 1733 |
| 1598 | Ga0496126_0207146 | 3300048929 | Unclassified | 1653 |
| 1599 | Ga0495678_004234 | 3300049459 | Bacteria | 8417 |
| 1600 | Ga0495678_007273 | 3300049459 | Bacteria | 5763 |
| 1601 | Ga0495682_0039100 | 3300049460 | Bacteria | 1742 |
| 1602 | Ga0501291_016456 | 3300049514 | Bacteria | 1130 |
| 1603 | Ga0501312_003267 | 3300049528 | Bacteria | 1829 |
| 1604 | Ga0501335_007048 | 3300049551 | Bacteria | 1032 |
| 1605 | Ga0501031_0015181 | 3300049568 | Bacteria | 5001 |
| 1606 | Ga0501031_0031393 | 3300049568 | Bacteria | 3465 |
| 1607 | Ga0501031_0236319 | 3300049568 | Bacteria | 1188 |
| 1608 | Ga0501032_0000817 | 3300049569 | Bacteria | 25273 |
| 1609 | Ga0501032_0002512 | 3300049569 | Bacteria | 14333 |
| 1610 | Ga0501032_0002569 | 3300049569 | Bacteria | 14207 |
| 1611 | Ga0501032_0169165 | 3300049569 | Unclassified | 1433 |
| 1612 | Ga0501032_0288523 | 3300049569 | Bacteria | 1062 |
| 1613 | Ga0501033_0000004 | 3300049570 | Bacteria | 441310 |
| 1614 | Ga0501033_0071834 | 3300049570 | Bacteria | 2542 |
| 1615 | Ga0501033_0135840 | 3300049570 | Unclassified | 1779 |
| 1616 | Ga0501034_0000709 | 3300049571 | Bacteria | 50589 |
| 1617 | Ga0501034_0009937 | 3300049571 | Bacteria | 9945 |
| 1618 | Ga0501034_0017803 | 3300049571 | Bacteria | 7289 |
| 1619 | Ga0501034_0021380 | 3300049571 | Bacteria | 6596 |
| 1620 | Ga0501034_0023872 | 3300049571 | Bacteria | 6226 |
| 1621 | Ga0501034_0060569 | 3300049571 | Bacteria | 3802 |
| 1622 | Ga0501034_0064590 | 3300049571 | Bacteria | 3674 |
| 1623 | Ga0501034_0176773 | 3300049571 | Unclassified | 2100 |
| 1624 | Ga0501034_0190011 | 3300049571 | Unclassified | 2016 |
| 1625 | Ga0501036_0001790 | 3300049572 | Bacteria | 16682 |
| 1626 | Ga0501036_0003646 | 3300049572 | Bacteria | 12314 |
| 1627 | Ga0501036_0027902 | 3300049572 | Bacteria | 4772 |
| 1628 | Ga0501036_0317033 | 3300049572 | Unclassified | 1303 |
| 1629 | Ga0501037_0003854 | 3300049573 | Bacteria | 10888 |
| 1630 | Ga0501037_0006833 | 3300049573 | Bacteria | 8334 |
| 1631 | Ga0501037_0050842 | 3300049573 | Unclassified | 3032 |
| 1632 | Ga0501037_0138878 | 3300049573 | Unclassified | 1740 |
| 1633 | Ga0501038_0010410 | 3300049574 | Bacteria | 8503 |
| 1634 | Ga0501038_0011039 | 3300049574 | Bacteria | 8247 |
| 1635 | Ga0501038_0017411 | 3300049574 | Bacteria | 6495 |
| 1636 | Ga0501038_0069951 | 3300049574 | Bacteria | 2980 |
| 1637 | Ga0501038_0221080 | 3300049574 | Bacteria | 1511 |
| 1638 | Ga0501038_0449725 | 3300049574 | Bacteria | 991 |
| 1639 | Ga0501039_0000948 | 3300049575 | Bacteria | 21101 |
| 1640 | Ga0501039_0005375 | 3300049575 | Bacteria | 9683 |
| 1641 | Ga0501039_0152770 | 3300049575 | Unclassified | 1813 |
| 1642 | Ga0501043_0000465 | 3300049579 | Bacteria | 36212 |
| 1643 | Ga0501043_0030261 | 3300049579 | Bacteria | 4254 |
| 1644 | Ga0501043_0030395 | 3300049579 | Bacteria | 4245 |
| 1645 | Ga0501043_0033741 | 3300049579 | Bacteria | 4027 |
| 1646 | Ga0501043_0043756 | 3300049579 | Bacteria | 3520 |
| 1647 | Ga0501043_0100396 | 3300049579 | Bacteria | 2275 |
| 1648 | Ga0501046_0002298 | 3300049580 | Bacteria | 18017 |
| 1649 | Ga0501046_0043520 | 3300049580 | Unclassified | 3575 |
| 1650 | Ga0501046_0173032 | 3300049580 | Bacteria | 1619 |
| 1651 | Ga0501047_0004399 | 3300049581 | Bacteria | 13262 |
| 1652 | Ga0501047_0007344 | 3300049581 | Bacteria | 10361 |
| 1653 | Ga0501047_0050199 | 3300049581 | Bacteria | 4029 |
| 1654 | Ga0501047_0059951 | 3300049581 | Bacteria | 3674 |
| 1655 | Ga0501047_0154927 | 3300049581 | Unclassified | 2165 |
| 1656 | Ga0501047_0161178 | 3300049581 | Bacteria | 2115 |
| 1657 | Ga0501048_0293929 | 3300049582 | Bacteria | 1155 |
| 1658 | Ga0501067_0022764 | 3300049583 | Bacteria | 3468 |
| 1659 | Ga0501067_0024112 | 3300049583 | Bacteria | 3373 |
| 1660 | Ga0501069_0179676 | 3300049585 | Bacteria | 1223 |
| 1661 | Ga0501070_0005280 | 3300049586 | Bacteria | 11020 |
| 1662 | Ga0501070_0026373 | 3300049586 | Bacteria | 4876 |
| 1663 | Ga0501070_0030351 | 3300049586 | Bacteria | 4529 |
| 1664 | Ga0501071_0138288 | 3300049587 | Bacteria | 1813 |
| 1665 | Ga0501072_0154798 | 3300049588 | Bacteria | 1828 |
| 1666 | Ga0501073_0001470 | 3300049589 | Bacteria | 17454 |
| 1667 | Ga0501073_0010241 | 3300049589 | Bacteria | 6888 |
| 1668 | Ga0501074_0000494 | 3300049590 | Bacteria | 24088 |
| 1669 | Ga0501074_0068923 | 3300049590 | Bacteria | 2543 |
| 1670 | Ga0501223_000671 | 3300049663 | Bacteria | 8175 |
| 1671 | Ga0501250_004252 | 3300049680 | Bacteria | 1416 |
| 1672 | Ga0501252_001538 | 3300049682 | Bacteria | 2148 |
| 1673 | Ga0501257_018556 | 3300049686 | Bacteria | 1623 |
| 1674 | Ga0501219_000429 | 3300049703 | Bacteria | 6863 |
| 1675 | Ga0501225_0045419 | 3300049705 | Bacteria | 1216 |
| 1676 | Ga0501079_0108510 | 3300049741 | Bacteria | 2155 |
| 1677 | Ga0501080_0048629 | 3300049742 | Unclassified | 3947 |
| 1678 | Ga0501080_0051600 | 3300049742 | Bacteria | 3827 |
| 1679 | Ga0501080_0081953 | 3300049742 | Bacteria | 2997 |
| 1680 | Ga0501080_0163918 | 3300049742 | Unclassified | 2052 |
| 1681 | Ga0501080_0550579 | 3300049742 | Bacteria | 1027 |
| 1682 | Ga0501083_0004351 | 3300049744 | Bacteria | 9976 |
| 1683 | Ga0501083_0043155 | 3300049744 | Bacteria | 3055 |
| 1684 | Ga0501241_010045 | 3300049758 | Bacteria | 1722 |
| 1685 | Ga0501270_015694 | 3300049767 | Bacteria | 1085 |
| 1686 | Ga0501035_0002001 | 3300049822 | Bacteria | 20361 |
| 1687 | Ga0501035_0012389 | 3300049822 | Bacteria | 7883 |
| 1688 | Ga0501035_0081321 | 3300049822 | Bacteria | 2859 |
| 1689 | Ga0501035_0088522 | 3300049822 | Bacteria | 2728 |
| 1690 | Ga0501035_0122658 | 3300049822 | Bacteria | 2270 |
| 1691 | Ga0501035_0212910 | 3300049822 | Unclassified | 1653 |
| 1692 | Ga0501035_0223392 | 3300049822 | Unclassified | 1607 |
| 1693 | Ga0501044_0001393 | 3300049823 | Bacteria | 28337 |
| 1694 | Ga0501044_0007592 | 3300049823 | Bacteria | 11921 |
| 1695 | Ga0501044_0012072 | 3300049823 | Bacteria | 9357 |
| 1696 | Ga0501044_0012302 | 3300049823 | Bacteria | 9266 |
| 1697 | Ga0501044_0015990 | 3300049823 | Bacteria | 8073 |
| 1698 | Ga0501044_0074210 | 3300049823 | Bacteria | 3457 |
| 1699 | Ga0501044_0077143 | 3300049823 | Bacteria | 3380 |
| 1700 | Ga0501044_0091250 | 3300049823 | Bacteria | 3073 |
| 1701 | Ga0501044_0332222 | 3300049823 | Bacteria | 1442 |
| 1702 | Ga0501045_0000121 | 3300049824 | Bacteria | 40474 |
| 1703 | Ga0501284_00002 | 3300050005 | Bacteria | 220402 |
| 1704 | nmdc:mga0k408_111640_c1 | 3300050493 | Bacteria | 1616 |
| 1705 | nmdc:mga0k408_16428_c1 | 3300050493 | Unclassified | 4108 |
| 1706 | nmdc:mga0k408_16961_c1 | 3300050493 | Bacteria | 2108 |
| 1707 | nmdc:mga0k408_17298_c2 | 3300050493 | Bacteria | 1734 |
| 1708 | nmdc:mga0k408_1783_c1 | 3300050493 | Bacteria | 11536 |
| 1709 | nmdc:mga0k408_2480_c1 | 3300050493 | Bacteria | 9815 |
| 1710 | nmdc:mga0k408_803_c1 | 3300050493 | Bacteria | 17292 |
| 1711 | nmdc:mga05p37_1790_c1 | 3300050507 | Bacteria | 11844 |
| 1712 | nmdc:mga05p37_192611_c1 | 3300050507 | Unclassified | 2474 |
| 1713 | nmdc:mga09592_17522_c1 | 3300050508 | Bacteria | 5869 |
| 1714 | nmdc:mga09592_226044_c1 | 3300050508 | Unclassified | 1621 |
| 1715 | nmdc:mga09592_260887_c1 | 3300050508 | Bacteria | 1502 |
| 1716 | nmdc:mga09592_2958_c1 | 3300050508 | Bacteria | 13771 |
| 1717 | nmdc:mga09592_403000_c1 | 3300050508 | Unclassified | 1182 |
| 1718 | nmdc:mga0qj67_34856_c1 | 3300050509 | Bacteria | 3933 |
| 1719 | nmdc:mga0qj67_87151_c1 | 3300050509 | Bacteria | 2505 |
| 1720 | nmdc:mga06r32_662613_c1 | 3300050510 | Unclassified | 1011 |
| 1721 | nmdc:mga06r32_714193_c1 | 3300050510 | Unclassified | 967 |
| 1722 | nmdc:mga06r32_8304_c1 | 3300050510 | Bacteria | 9348 |
| 1723 | nmdc:mga08y16_314925_c1 | 3300050511 | Bacteria | 1611 |
| 1724 | nmdc:mga08y16_71119_c1 | 3300050511 | Bacteria | 3626 |
| 1725 | nmdc:mga08y16_7939_c1 | 3300050511 | Bacteria | 11107 |
| 1726 | nmdc:mga0n895_108422_c1 | 3300050512 | Bacteria | 2791 |
| 1727 | Ga0500578_0000063 | 3300053086 | Bacteria | 117869 |
| 1728 | Ga0500578_0036846 | 3300053086 | Bacteria | 3141 |
| 1729 | Ga0500644_0005907 | 3300053088 | Bacteria | 3110 |
| 1730 | Ga0500644_0097116 | 3300053088 | Unclassified | 1113 |
| 1731 | Ga0500646_0001109 | 3300053090 | Bacteria | 7315 |
| 1732 | Ga0500583_0000076 | 3300053092 | Bacteria | 59162 |
| 1733 | Ga0500583_0074734 | 3300053092 | Bacteria | 1626 |
| 1734 | Ga0500651_0000455 | 3300053093 | Bacteria | 21853 |
| 1735 | Ga0500651_0097400 | 3300053093 | Bacteria | 1807 |
| 1736 | Ga0500651_0211007 | 3300053093 | Bacteria | 1142 |
| 1737 | Ga0500651_0240862 | 3300053093 | Bacteria | 1055 |
| 1738 | Ga0500650_0017765 | 3300053098 | Bacteria | 3075 |
| 1739 | Ga0500650_0246764 | 3300053098 | Bacteria | 802 |
| 1740 | Ga0500555_007087 | 3300053103 | Bacteria | 3187 |
| 1741 | Ga0500556_0082967 | 3300053104 | Bacteria | 1214 |
| 1742 | Ga0500562_000013 | 3300053108 | Bacteria | 150003 |
| 1743 | Ga0500569_002068 | 3300053109 | Bacteria | 3904 |
| 1744 | Ga0500594_0003368 | 3300053118 | Bacteria | 3504 |
| 1745 | Ga0500608_001288 | 3300053122 | Bacteria | 8923 |
| 1746 | Ga0500614_018600 | 3300053123 | Bacteria | 1582 |
| 1747 | Ga0500618_000012 | 3300053125 | Bacteria | 185382 |
| 1748 | Ga0500618_004252 | 3300053125 | Bacteria | 4639 |
| 1749 | Ga0500618_024837 | 3300053125 | Bacteria | 1441 |
| 1750 | Ga0500642_0014246 | 3300053130 | Bacteria | 2952 |
| 1751 | Ga0500652_002332 | 3300053131 | Bacteria | 5709 |
| 1752 | Ga0500658_0045976 | 3300053134 | Bacteria | 1766 |
| 1753 | Ga0500658_0086335 | 3300053134 | Bacteria | 1350 |
| 1754 | Ga0500559_0014490 | 3300053136 | Bacteria | 3332 |
| 1755 | Ga0500561_0014213 | 3300053137 | Bacteria | 1743 |
| 1756 | Ga0500568_0000080 | 3300053139 | Bacteria | 92694 |
| 1757 | Ga0500573_0060852 | 3300053140 | Bacteria | 2163 |
| 1758 | Ga0500577_0015622 | 3300053142 | Bacteria | 2376 |
| 1759 | Ga0500588_0005030 | 3300053146 | Bacteria | 2908 |
| 1760 | Ga0500588_0155901 | 3300053146 | Unclassified | 828 |
| 1761 | Ga0500589_149285 | 3300053147 | Bacteria | 953 |
| 1762 | Ga0500604_0014652 | 3300053151 | Bacteria | 2137 |
| 1763 | Ga0500616_0029782 | 3300053153 | Bacteria | 3002 |
| 1764 | Ga0500616_0045449 | 3300053153 | Unclassified | 2340 |
| 1765 | Ga0500616_0077228 | 3300053153 | Bacteria | 1682 |
| 1766 | Ga0500616_0134940 | 3300053153 | Unclassified | 1161 |
| 1767 | Ga0500622_0000005 | 3300053156 | Bacteria | 502443 |
| 1768 | Ga0500622_0000242 | 3300053156 | Bacteria | 56575 |
| 1769 | Ga0500622_0000838 | 3300053156 | Bacteria | 26284 |
| 1770 | Ga0500622_0133575 | 3300053156 | Bacteria | 1190 |
| 1771 | Ga0500622_0135983 | 3300053156 | Bacteria | 1177 |
| 1772 | Ga0500624_000118 | 3300053157 | Bacteria | 35980 |
| 1773 | Ga0500633_0002655 | 3300053160 | Bacteria | 3730 |
| 1774 | Ga0500636_0184278 | 3300053177 | Bacteria | 1118 |
| 1775 | Ga0500636_0219123 | 3300053177 | Bacteria | 993 |
| 1776 | Ga0500637_0052899 | 3300053178 | Bacteria | 2317 |
| 1777 | Ga0500611_000060 | 3300053727 | Bacteria | 47744 |
| 1778 | Ga0500645_007254 | 3300053730 | Bacteria | 3877 |
| 1779 | Ga0501084_0003712 | 3300054114 | Bacteria | 12398 |
| 1780 | Ga0587130_000922 | 3300059631 | Bacteria | 2053 |
| 1781 | Ga0501082_0018747 | 3300060353 | Bacteria | 5962 |
| 1782 | Ga0466962_0013263 | 3300061719 | Bacteria | 3963 |
| 1783 | 2522553646 | 2522125168 | Bacteria | 7376607 |
| 1784 | 2586206295 | 2585427687 | Bacteria | 5544917 |
| 1785 | 2599480397 | 2599185184 | Bacteria | 6430550 |
| 1786 | 2738725593 | 2738541278 | Bacteria | 9755573 |
| 1787 | 2738726804 | 2738541278 | Bacteria | 9755573 |
| 1788 | 2738755417 | 2738541283 | Bacteria | 7222293 |
| 1789 | 2738763528 | 2738541284 | Bacteria | 5199923 |
| 1790 | 2738856156 | 2738541302 | Bacteria | 5944758 |
| 1791 | 2739303250 | 2738543023 | Bacteria | 6767879 |
| 1792 | 2739588283 | 2739367651 | Bacteria | 6359826 |
| 1793 | 2739613944 | 2739367656 | Bacteria | 5152243 |
| 1794 | 2739648559 | 2739367663 | Bacteria | 5040914 |
| 1795 | 2776615034 | 2775506987 | Bacteria | 5373360 |
| 1796 | 2819546261 | 2818991437 | Bacteria | 5805520 |
| 1797 | 2819585683 | 2818991444 | Bacteria | 6968812 |
| 1798 | 2840678479 | 2840677318 | Bacteria | 2664183 |
| 1799 | 2842723910 | 2842722452 | Bacteria | 6263924 |
| 1800 | 2842908811 | 2842903701 | Bacteria | 6986368 |
| 1801 | 2842912358 | 2842909656 | Bacteria | 6185908 |
| 1802 | 2849282791 | 2849281842 | Bacteria | 6065644 |
| 1803 | 2852624814 | 2852623160 | Bacteria | 4376875 |
| 1804 | 2852629509 | 2852627209 | Bacteria | 5896285 |
| 1805 | 2857629299 | 2857627736 | Bacteria | 5625397 |
| 1806 | 2883071396 | 2883068021 | Bacteria | 6192739 |
| 1807 | 2884936304 | 2884933994 | Bacteria | 4535041 |
| 1808 | 2895501071 | 2895498888 | Bacteria | 5283788 |
| 1809 | 2896086297 | 2896085136 | Bacteria | 6129793 |
| 1810 | 2902049882 | 2902048731 | Bacteria | 4976191 |
| 1811 | 2904446532 | 2904445276 | Bacteria | 5310396 |
| 1812 | 2911143537 | 2911138879 | Bacteria | 5811561 |
| 1813 | 2914762857 | 2914759650 | Bacteria | 4701441 |
| 1814 | 2919190268 | 2919186247 | Bacteria | 6244071 |
| 1815 | 2919438299 | 2919437846 | Bacteria | 6199444 |
| 1816 | 2928083362 | 2928078545 | Bacteria | 6534839 |
| 1817 | 2928151376 | 2928147474 | Bacteria | 6512076 |
| 1818 | 2929159591 | 2929154850 | Bacteria | 6753285 |
| 1819 | 2932087293 | 2932082852 | Bacteria | 6563563 |
| 1820 | 2939668549 | 2939664404 | Bacteria | 6364494 |
| 1821 | 2945999344 | 2945997725 | Bacteria | 6404843 |
| 1822 | 2954021742 | 2954016120 | Bacteria | 6446024 |
| 1823 | 2977232945 | 2977232053 | Bacteria | 5485925 |
| 1824 | Ga0207641_10638083 | |||
| 1825 | SwRhRL2b_contig_900390 | |||
| 1826 | ARcpr5yngRDRAFT_c004046 | |||
| 1827 | JGI24736J21556_1011832 | |||
| 1828 | JGI24735J21928_10000013 | |||
| 1829 | JGI24744J21845_10004274 | |||
| 1830 | JGI24744J21845_10007841 | |||
| 1831 | JGI24751J29686_10000514 | |||
| 1832 | JGI25162J39368_1000011 | |||
| 1833 | JGI25162J39368_1000107 | |||
| 1834 | JGI25162J39368_1001539 | |||
| 1835 | JGI25150J39212_1000014 | |||
| 1836 | JGI25159J45721_1031796 | |||
| 1837 | JGI25151J46595_10000042 | |||
| 1838 | JGI25165J46597_1000157 | |||
| 1839 | JGI25153J46596_10000009 | |||
| 1840 | rootH1_10057698 | |||
| 1841 | rootH1_10069966 | |||
| 1842 | rootH1_10072769 | |||
| 1843 | rootH2_10005336 | |||
| 1844 | rootH2_10089486 | |||
| 1845 | rootH2_10135214 | |||
| 1846 | rootH2_10135408 | |||
| 1847 | rootH2_10239708 | |||
| 1848 | rootL2_10011714 | |||
| 1849 | rootL2_10034522 | |||
| 1850 | rootL2_10062555 | |||
| 1851 | rootL2_10072205 | |||
| 1852 | rootL2_10082704 | |||
| 1853 | rootL2_10242251 | |||
| 1854 | rootL2_10291845 | |||
| 1855 | rootH1_10045017 | |||
| 1856 | rootH1_10055568 | |||
| 1857 | rootH1_10067100 | |||
| 1858 | rootH1_10122117 | |||
| 1859 | rootH1_10160751 | |||
| 1860 | rootH1_10163117 | |||
| 1861 | rootH1_10176161 | |||
| 1862 | rootH1_10323063 | |||
| 1863 | JGI25160J50197_1001629 | |||
| 1864 | JGI25160J50197_1011154 | |||
| 1865 | Ga0055536_1000019 | |||
| 1866 | Ga0055530_10000770 | |||
| 1867 | Ga0058859_10680689 | |||
| 1868 | Ga0065165_1000861 | |||
| 1869 | Ga0065714_10003901 | |||
| 1870 | Ga0065714_10005215 | |||
| 1871 | Ga0065714_10010117 | |||
| 1872 | Ga0065714_10023653 | |||
| 1873 | Ga0065714_10072146 | |||
| 1874 | Ga0065714_10084798 | |||
| 1875 | Ga0065704_10000301 | |||
| 1876 | Ga0065704_10008634 | |||
| 1877 | Ga0065704_10111806 | |||
| 1878 | Ga0065704_10256341 | |||
| 1879 | Ga0065712_10177389 | |||
| 1880 | Ga0065715_10095897 | |||
| 1881 | Ga0065715_10106495 | |||
| 1882 | Ga0065715_10172051 | |||
| 1883 | Ga0065707_10101033 | |||
| 1884 | Ga0070658_10000028 | |||
| 1885 | Ga0070658_10016538 | |||
| 1886 | Ga0070658_10039485 | |||
| 1887 | Ga0070658_10061402 | |||
| 1888 | Ga0070658_10119415 | |||
| 1889 | Ga0070658_10141055 | |||
| 1890 | Ga0070658_10340798 | |||
| 1891 | Ga0070676_10005029 | |||
| 1892 | Ga0070676_10005673 | |||
| 1893 | Ga0070676_10014015 | |||
| 1894 | Ga0070676_10014253 | |||
| 1895 | Ga0070676_10112938 | |||
| 1896 | Ga0070676_10182001 | |||
| 1897 | Ga0070683_100012644 | |||
| 1898 | Ga0070683_100024392 | |||
| 1899 | Ga0070683_100061333 | |||
| 1900 | Ga0070683_100068007 | |||
| 1901 | Ga0070683_100091702 | |||
| 1902 | Ga0070683_100508679 | |||
| 1903 | Ga0070690_100003978 | |||
| 1904 | Ga0070690_100080114 | |||
| 1905 | Ga0070690_100143156 | |||
| 1906 | Ga0070690_100251784 | |||
| 1907 | Ga0070690_100413144 | |||
| 1908 | Ga0070670_100008722 | |||
| 1909 | Ga0070670_100021006 | |||
| 1910 | Ga0070670_100034177 | |||
| 1911 | Ga0070670_100060961 | |||
| 1912 | Ga0070670_100101396 | |||
| 1913 | Ga0070670_100110243 | |||
| 1914 | Ga0070670_100118791 | |||
| 1915 | Ga0070670_100212704 | |||
| 1916 | Ga0070670_100300395 | |||
| 1917 | Ga0070670_100305544 | |||
| 1918 | Ga0070677_10004025 | |||
| 1919 | Ga0070677_10035856 | |||
| 1920 | Ga0068869_100002953 | |||
| 1921 | Ga0068869_100003332 | |||
| 1922 | Ga0068869_100003776 | |||
| 1923 | Ga0068869_100004072 | |||
| 1924 | Ga0068869_100007583 | |||
| 1925 | Ga0068869_100010195 | |||
| 1926 | Ga0068869_100010840 | |||
| 1927 | Ga0068869_100071129 | |||
| 1928 | Ga0068869_100095762 | |||
| 1929 | Ga0068869_100132311 | |||
| 1930 | Ga0068869_100172610 | |||
| 1931 | Ga0068869_100209447 | |||
| 1932 | Ga0070666_10000106 | |||
| 1933 | Ga0070666_10002796 | |||
| 1934 | Ga0070666_10010770 | |||
| 1935 | Ga0070666_10027835 | |||
| 1936 | Ga0070666_10077510 | |||
| 1937 | Ga0070666_10139090 | |||
| 1938 | Ga0070666_10210467 | |||
| 1939 | Ga0070666_10223584 | |||
| 1940 | Ga0070680_100016902 | |||
| 1941 | Ga0070680_100079143 | |||
| 1942 | Ga0070680_100093643 | |||
| 1943 | Ga0070680_100139222 | |||
| 1944 | Ga0070682_100000019 | |||
| 1945 | Ga0070682_100009574 | |||
| 1946 | Ga0070682_100016818 | |||
| 1947 | Ga0070682_100043551 | |||
| 1948 | Ga0070682_100075427 | |||
| 1949 | Ga0070682_100337389 | |||
| 1950 | Ga0068868_100000112 | |||
| 1951 | Ga0068868_100006802 | |||
| 1952 | Ga0068868_100007286 | |||
| 1953 | Ga0068868_100012873 | |||
| 1954 | Ga0068868_100013907 | |||
| 1955 | Ga0068868_100019003 | |||
| 1956 | Ga0068868_100031334 | |||
| 1957 | Ga0068868_100055050 | |||
| 1958 | Ga0068868_100158563 | |||
| 1959 | Ga0068868_100179422 | |||
| 1960 | Ga0070660_100008501 | |||
| 1961 | Ga0070660_100024596 | |||
| 1962 | Ga0070660_100025079 | |||
| 1963 | Ga0070660_100030203 | |||
| 1964 | Ga0070660_100263205 | |||
| 1965 | Ga0070689_100019767 | |||
| 1966 | Ga0070689_100067244 | |||
| 1967 | Ga0070689_100124129 | |||
| 1968 | Ga0070691_10016281 | |||
| 1969 | Ga0070691_10079580 | |||
| 1970 | Ga0070687_100251787 | |||
| 1971 | Ga0070661_100007958 | |||
| 1972 | Ga0070661_100008722 | |||
| 1973 | Ga0070661_100034349 | |||
| 1974 | Ga0070661_100174991 | |||
| 1975 | Ga0070692_10128107 | |||
| 1976 | Ga0070692_10155983 | |||
| 1977 | Ga0070668_100000518 | |||
| 1978 | Ga0070668_100029487 | |||
| 1979 | Ga0070668_100044040 | |||
| 1980 | Ga0070668_100047046 | |||
| 1981 | Ga0070668_100087339 | |||
| 1982 | Ga0070668_100429418 | |||
| 1983 | Ga0070669_100007803 | |||
| 1984 | Ga0070669_100010226 | |||
| 1985 | Ga0070669_100039836 | |||
| 1986 | Ga0070669_100075618 | |||
| 1987 | Ga0070669_100182959 | |||
| 1988 | Ga0070669_100232433 | |||
| 1989 | Ga0070669_100234426 | |||
| 1990 | Ga0070675_100008660 | |||
| 1991 | Ga0070675_100039942 | |||
| 1992 | Ga0070675_100157982 | |||
| 1993 | Ga0070675_100807236 | |||
| 1994 | Ga0070671_100012602 | |||
| 1995 | Ga0070671_100013595 | |||
| 1996 | Ga0070671_100023118 | |||
| 1997 | Ga0070671_100036023 | |||
| 1998 | Ga0070671_100046263 | |||
| 1999 | Ga0070671_100066579 | |||
| 2000 | Ga0070671_100107672 | |||
| 2001 | Ga0070671_100120675 | |||
| 2002 | Ga0070674_100010772 | |||
| 2003 | Ga0070674_100492620 | |||
| 2004 | Ga0070674_100525397 | |||
| 2005 | Ga0070673_100000916 | |||
| 2006 | Ga0070673_100001100 | |||
| 2007 | Ga0070673_100001738 | |||
| 2008 | Ga0070673_100015805 | |||
| 2009 | Ga0070673_100022702 | |||
| 2010 | Ga0070673_100026755 | |||
| 2011 | Ga0070673_100029457 | |||
| 2012 | Ga0070673_100058990 | |||
| 2013 | Ga0070673_100189874 | |||
| 2014 | Ga0070673_100298128 | |||
| 2015 | Ga0070673_100408999 | |||
| 2016 | Ga0070688_100001727 | |||
| 2017 | Ga0070688_100069096 | |||
| 2018 | Ga0070688_100193069 | |||
| 2019 | Ga0070688_100200837 | |||
| 2020 | Ga0070659_100000648 | |||
| 2021 | Ga0070659_100007387 | |||
| 2022 | Ga0070659_100020487 | |||
| 2023 | Ga0070659_100033730 | |||
| 2024 | Ga0070659_100037729 | |||
| 2025 | Ga0070659_100051464 | |||
| 2026 | Ga0070659_100075065 | |||
| 2027 | Ga0070659_100135643 | |||
| 2028 | Ga0070659_100142698 | |||
| 2029 | Ga0070667_100001056 | |||
| 2030 | Ga0070667_100005421 | |||
| 2031 | Ga0070667_100017871 | |||
| 2032 | Ga0070667_100018530 | |||
| 2033 | Ga0070667_100023305 | |||
| 2034 | Ga0070667_100047560 | |||
| 2035 | Ga0070667_100057251 | |||
| 2036 | Ga0070667_100065006 | |||
| 2037 | Ga0070667_100113747 | |||
| 2038 | Ga0070667_100157688 | |||
| 2039 | Ga0070667_100311192 | |||
| 2040 | Ga0070667_100374647 | |||
| 2041 | Ga0070667_100655185 | |||
| 2042 | Ga0070701_10226615 | |||
| 2043 | Ga0070700_100132413 | |||
| 2044 | Ga0070700_100454781 | |||
| 2045 | Ga0070663_100019054 | |||
| 2046 | Ga0070663_100036245 | |||
| 2047 | Ga0070663_100589676 | |||
| 2048 | Ga0070678_100010010 | |||
| 2049 | Ga0070678_100011580 | |||
| 2050 | Ga0070678_100031450 | |||
| 2051 | Ga0070678_100156646 | |||
| 2052 | Ga0070678_100197839 | |||
| 2053 | Ga0070678_100206875 | |||
| 2054 | Ga0070678_100265143 | |||
| 2055 | Ga0070678_100631427 | |||
| 2056 | Ga0070662_100000014 | |||
| 2057 | Ga0070662_100003721 | |||
| 2058 | Ga0070662_100004869 | |||
| 2059 | Ga0070662_100010077 | |||
| 2060 | Ga0070662_100060152 | |||
| 2061 | Ga0070662_100082916 | |||
| 2062 | Ga0070662_100094047 | |||
| 2063 | Ga0070662_100167404 | |||
| 2064 | Ga0070662_100196833 | |||
| 2065 | Ga0070662_100725614 | |||
| 2066 | Ga0070681_10026227 | |||
| 2067 | Ga0070681_10040908 | |||
| 2068 | Ga0070681_10042951 | |||
| 2069 | Ga0070681_10269908 | |||
| 2070 | Ga0070681_10327177 | |||
| 2071 | Ga0070681_10333205 | |||
| 2072 | Ga0068867_100003104 | |||
| 2073 | Ga0068867_100004645 | |||
| 2074 | Ga0068867_100006101 | |||
| 2075 | Ga0068867_100016823 | |||
| 2076 | Ga0068867_100059953 | |||
| 2077 | Ga0068867_100074124 | |||
| 2078 | Ga0068867_100080230 | |||
| 2079 | Ga0068867_100091712 | |||
| 2080 | Ga0068867_100108638 | |||
| 2081 | Ga0068867_100121853 | |||
| 2082 | Ga0068867_100121971 | |||
| 2083 | Ga0068867_100249064 | |||
| 2084 | Ga0068867_100291561 | |||
| 2085 | Ga0068867_100448211 | |||
| 2086 | Ga0070685_10018286 | |||
| 2087 | Ga0070685_10028761 | |||
| 2088 | Ga0070685_10041717 | |||
| 2089 | Ga0070685_10047750 | |||
| 2090 | Ga0070685_10091132 | |||
| 2091 | Ga0070685_10211309 | |||
| 2092 | Ga0070685_10275069 | |||
| 2093 | Ga0070707_100156482 | |||
| 2094 | Ga0070698_100004078 | |||
| 2095 | Ga0070698_100004771 | |||
| 2096 | Ga0070698_100150268 | |||
| 2097 | Ga0070698_100150886 | |||
| 2098 | Ga0070698_100153895 | |||
| 2099 | Ga0070679_100000398 | |||
| 2100 | Ga0070679_100000665 | |||
| 2101 | Ga0070679_100009345 | |||
| 2102 | Ga0070679_100015562 | |||
| 2103 | Ga0070679_100023731 | |||
| 2104 | Ga0070679_100036142 | |||
| 2105 | Ga0070679_100207788 | |||
| 2106 | Ga0070679_100266331 | |||
| 2107 | Ga0070684_100010524 | |||
| 2108 | Ga0070684_100019072 | |||
| 2109 | Ga0070684_100038020 | |||
| 2110 | Ga0070684_100246944 | |||
| 2111 | Ga0070684_100446368 | |||
| 2112 | Ga0068853_100000765 | |||
| 2113 | Ga0068853_100003733 | |||
| 2114 | Ga0068853_100005178 | |||
| 2115 | Ga0068853_100008103 | |||
| 2116 | Ga0068853_100009588 | |||
| 2117 | Ga0068853_100013232 | |||
| 2118 | Ga0068853_100015866 | |||
| 2119 | Ga0068853_100021279 | |||
| 2120 | Ga0068853_100034294 | |||
| 2121 | Ga0068853_100043349 | |||
| 2122 | Ga0068853_100051118 | |||
| 2123 | Ga0068853_100055941 | |||
| 2124 | Ga0068853_100079204 | |||
| 2125 | Ga0068853_100081751 | |||
| 2126 | Ga0068853_100113513 | |||
| 2127 | Ga0068853_100131697 | |||
| 2128 | Ga0068853_100140342 | |||
| 2129 | Ga0068853_100140592 | |||
| 2130 | Ga0068853_100146098 | |||
| 2131 | Ga0068853_100156483 | |||
| 2132 | Ga0068853_100163298 | |||
| 2133 | Ga0068853_100176648 | |||
| 2134 | Ga0068853_100198696 | |||
| 2135 | Ga0070672_100000020 | |||
| 2136 | Ga0070672_100010475 | |||
| 2137 | Ga0070672_100017526 | |||
| 2138 | Ga0070672_100040151 | |||
| 2139 | Ga0070672_100144244 | |||
| 2140 | Ga0070672_100154946 | |||
| 2141 | Ga0070672_100352143 | |||
| 2142 | Ga0070672_100493660 | |||
| 2143 | Ga0070686_100052359 | |||
| 2144 | Ga0070686_100069177 | |||
| 2145 | Ga0070686_100092819 | |||
| 2146 | Ga0070686_100220174 | |||
| 2147 | Ga0070686_100251170 | |||
| 2148 | Ga0070686_100261922 | |||
| 2149 | Ga0070696_100185057 | |||
| 2150 | Ga0070693_100193804 | |||
| 2151 | Ga0070665_100000032 | |||
| 2152 | Ga0070665_100004608 | |||
| 2153 | Ga0070665_100009875 | |||
| 2154 | Ga0070665_100036978 | |||
| 2155 | Ga0070665_100281435 | |||
| 2156 | Ga0070704_100250240 | |||
| 2157 | Ga0068855_100000043 | |||
| 2158 | Ga0068855_100000517 | |||
| 2159 | Ga0068855_100003465 | |||
| 2160 | Ga0068855_100006600 | |||
| 2161 | Ga0068855_100007632 | |||
| 2162 | Ga0068855_100026529 | |||
| 2163 | Ga0068855_100037770 | |||
| 2164 | Ga0068855_100071980 | |||
| 2165 | Ga0068855_100077688 | |||
| 2166 | Ga0068855_100130689 | |||
| 2167 | Ga0068855_100131777 | |||
| 2168 | Ga0068855_100243761 | |||
| 2169 | Ga0068855_100255644 | |||
| 2170 | Ga0068855_100274720 | |||
| 2171 | Ga0070664_100004753 | |||
| 2172 | Ga0070664_100014024 | |||
| 2173 | Ga0070664_100025338 | |||
| 2174 | Ga0070664_100060340 | |||
| 2175 | Ga0070664_100064447 | |||
| 2176 | Ga0070664_100117547 | |||
| 2177 | Ga0070664_100168759 | |||
| 2178 | Ga0068857_100005247 | |||
| 2179 | Ga0068857_100019273 | |||
| 2180 | Ga0068857_100022072 | |||
| 2181 | Ga0068857_100046329 | |||
| 2182 | Ga0068857_100084855 | |||
| 2183 | Ga0068857_100093940 | |||
| 2184 | Ga0068857_100201857 | |||
| 2185 | Ga0068857_100239235 | |||
| 2186 | Ga0068857_100265379 | |||
| 2187 | Ga0068857_100418582 | |||
| 2188 | Ga0068854_100004832 | |||
| 2189 | Ga0068854_100014650 | |||
| 2190 | Ga0068854_100026428 | |||
| 2191 | Ga0068854_100061532 | |||
| 2192 | Ga0068854_100084423 | |||
| 2193 | Ga0068854_100117771 | |||
| 2194 | Ga0068854_100296895 | |||
| 2195 | Ga0068856_100000960 | |||
| 2196 | Ga0068856_100010180 | |||
| 2197 | Ga0068856_100010333 | |||
| 2198 | Ga0068856_100027529 | |||
| 2199 | Ga0068856_100050889 | |||
| 2200 | Ga0068856_100166108 | |||
| 2201 | Ga0070702_100015101 | |||
| 2202 | Ga0070702_100016189 | |||
| 2203 | Ga0068852_100000744 | |||
| 2204 | Ga0068852_100003125 | |||
| 2205 | Ga0068852_100011448 | |||
| 2206 | Ga0068852_100016745 | |||
| 2207 | Ga0068852_100025634 | |||
| 2208 | Ga0068852_100030572 | |||
| 2209 | Ga0068852_100039952 | |||
| 2210 | Ga0068852_100044878 | |||
| 2211 | Ga0068852_100046203 | |||
| 2212 | Ga0068852_100059484 | |||
| 2213 | Ga0068852_100060932 | |||
| 2214 | Ga0068852_100098257 | |||
| 2215 | Ga0068852_100290605 | |||
| 2216 | Ga0068852_100694246 | |||
| 2217 | Ga0068852_101032766 | |||
| 2218 | Ga0068859_100000024 | |||
| 2219 | Ga0068859_100005138 | |||
| 2220 | Ga0068859_100011212 | |||
| 2221 | Ga0068859_100015329 | |||
| 2222 | Ga0068859_100017243 | |||
| 2223 | Ga0068859_100056651 | |||
| 2224 | Ga0068859_100077822 | |||
| 2225 | Ga0068859_100115801 | |||
| 2226 | Ga0068859_100163857 | |||
| 2227 | Ga0068859_100251807 | |||
| 2228 | Ga0068859_100307533 | |||
| 2229 | Ga0068859_100321072 | |||
| 2230 | Ga0068859_100364454 | |||
| 2231 | Ga0068859_100454948 | |||
| 2232 | Ga0068859_100583039 | |||
| 2233 | Ga0068864_100000392 | |||
| 2234 | Ga0068864_100001230 | |||
| 2235 | Ga0068864_100004478 | |||
| 2236 | Ga0068864_100010987 | |||
| 2237 | Ga0068864_100066233 | |||
| 2238 | Ga0068864_100078396 | |||
| 2239 | Ga0068864_100105531 | |||
| 2240 | Ga0068864_100144940 | |||
| 2241 | Ga0068864_100342511 | |||
| 2242 | Ga0068864_100801446 | |||
| 2243 | Ga0068866_10003950 | |||
| 2244 | Ga0068866_10004497 | |||
| 2245 | Ga0068866_10026702 | |||
| 2246 | Ga0068866_10108849 | |||
| 2247 | Ga0068861_100001296 | |||
| 2248 | Ga0068861_100002876 | |||
| 2249 | Ga0068861_100011713 | |||
| 2250 | Ga0068861_100255305 | |||
| 2251 | Ga0068861_100745992 | |||
| 2252 | Ga0068851_10002179 | |||
| 2253 | Ga0068851_10028869 | |||
| 2254 | Ga0068851_10033944 | |||
| 2255 | Ga0068851_10139084 | |||
| 2256 | Ga0068851_10236759 | |||
| 2257 | Ga0068870_10099579 | |||
| 2258 | Ga0068870_10161340 | |||
| 2259 | Ga0068863_100002032 | |||
| 2260 | Ga0068863_100041019 | |||
| 2261 | Ga0068863_100044019 | |||
| 2262 | Ga0068863_100081367 | |||
| 2263 | Ga0068863_100162063 | |||
| 2264 | Ga0068863_100176131 | |||
| 2265 | Ga0068863_100222387 | |||
| 2266 | Ga0068863_100355858 | |||
| 2267 | Ga0068863_100613425 | |||
| 2268 | Ga0068863_100637392 | |||
| 2269 | Ga0068858_100000342 | |||
| 2270 | Ga0068858_100001879 | |||
| 2271 | Ga0068858_100040620 | |||
| 2272 | Ga0068858_100073111 | |||
| 2273 | Ga0068858_100084635 | |||
| 2274 | Ga0068858_100242229 | |||
| 2275 | Ga0068858_100322335 | |||
| 2276 | Ga0068858_100341294 | |||
| 2277 | Ga0068858_100344609 | |||
| 2278 | Ga0068858_100376464 | |||
| 2279 | Ga0068860_100001341 | |||
| 2280 | Ga0068860_100001513 | |||
| 2281 | Ga0068860_100004887 | |||
| 2282 | Ga0068860_100008647 | |||
| 2283 | Ga0068860_100008887 | |||
| 2284 | Ga0068860_100012453 | |||
| 2285 | Ga0068860_100041777 | |||
| 2286 | Ga0068860_100056124 | |||
| 2287 | Ga0068860_100061958 | |||
| 2288 | Ga0068860_100145406 | |||
| 2289 | Ga0068860_100266244 | |||
| 2290 | Ga0068860_100302123 | |||
| 2291 | Ga0068860_100544434 | |||
| 2292 | Ga0068862_100001074 | |||
| 2293 | Ga0068862_100029514 | |||
| 2294 | Ga0068862_100481473 | |||
| 2295 | Ga0068862_100617136 | |||
| 2296 | Ga0081540_1002949 | |||
| 2297 | Ga0081539_10001169 | |||
| 2298 | Ga0070717_10230034 | |||
| 2299 | Ga0070715_10004258 | |||
| 2300 | Ga0070715_10023552 | |||
| 2301 | Ga0070716_100154275 | |||
| 2302 | Ga0075366_10001935 | |||
| 2303 | Ga0075366_10061467 | |||
| 2304 | Ga0075366_10249471 | |||
| 2305 | Ga0075366_10270045 | |||
| 2306 | Ga0075366_10352545 | |||
| 2307 | Ga0097621_100000710 | |||
| 2308 | Ga0097621_100001338 | |||
| 2309 | Ga0097621_100004240 | |||
| 2310 | Ga0097621_100009001 | |||
| 2311 | Ga0097621_100012836 | |||
| 2312 | Ga0097621_100038073 | |||
| 2313 | Ga0097621_100138438 | |||
| 2314 | Ga0097621_100193520 | |||
| 2315 | Ga0097621_100251141 | |||
| 2316 | Ga0097621_100282872 | |||
| 2317 | Ga0097621_100300793 | |||
| 2318 | Ga0097621_100453595 | |||
| 2319 | Ga0068871_100000044 | |||
| 2320 | Ga0068871_100000294 | |||
| 2321 | Ga0068871_100008618 | |||
| 2322 | Ga0068871_100015163 | |||
| 2323 | Ga0068871_100024438 | |||
| 2324 | Ga0068871_100026066 | |||
| 2325 | Ga0068871_100026333 | |||
| 2326 | Ga0068871_100038510 | |||
| 2327 | Ga0068871_100232381 | |||
| 2328 | Ga0068871_100258066 | |||
| 2329 | Ga0068871_100341523 | |||
| 2330 | Ga0075428_100006050 | |||
| 2331 | Ga0075428_100161324 | |||
| 2332 | Ga0075428_100419177 | |||
| 2333 | Ga0075430_100001157 | |||
| 2334 | Ga0075430_100365311 | |||
| 2335 | Ga0075431_100003874 | |||
| 2336 | Ga0075431_100010980 | |||
| 2337 | Ga0075434_100109091 | |||
| 2338 | Ga0075429_100001234 | |||
| 2339 | Ga0075429_100019684 | |||
| 2340 | Ga0075429_100062699 | |||
| 2341 | Ga0068865_100000909 | |||
| 2342 | Ga0068865_100002711 | |||
| 2343 | Ga0068865_100003364 | |||
| 2344 | Ga0068865_100033276 | |||
| 2345 | Ga0068865_100185736 | |||
| 2346 | Ga0068865_100195359 | |||
| 2347 | Ga0068865_100205761 | |||
| 2348 | Ga0068865_100286916 | |||
| 2349 | Ga0068865_100326345 | |||
| 2350 | Ga0097620_100000024 | |||
| 2351 | Ga0097620_100005138 | |||
| 2352 | Ga0097620_100011212 | |||
| 2353 | Ga0097620_100015329 | |||
| 2354 | Ga0097620_100017242 | |||
| 2355 | Ga0097620_100056649 | |||
| 2356 | Ga0097620_100077818 | |||
| 2357 | Ga0097620_100115799 | |||
| 2358 | Ga0097620_100163864 | |||
| 2359 | Ga0097620_100251820 | |||
| 2360 | Ga0097620_100307525 | |||
| 2361 | Ga0097620_100321095 | |||
| 2362 | Ga0097620_100364462 | |||
| 2363 | Ga0097620_100454925 | |||
| 2364 | Ga0097620_100583096 | |||
| 2365 | Ga0105244_10089637 | |||
| 2366 | Ga0105240_10000103 | |||
| 2367 | Ga0105240_10000800 | |||
| 2368 | Ga0105240_10001677 | |||
| 2369 | Ga0105240_10001787 | |||
| 2370 | Ga0105240_10004962 | |||
| 2371 | Ga0105240_10018800 | |||
| 2372 | Ga0105240_10027308 | |||
| 2373 | Ga0105240_10065900 | |||
| 2374 | Ga0105240_10078823 | |||
| 2375 | Ga0105240_10084323 | |||
| 2376 | Ga0105240_10106027 | |||
| 2377 | Ga0105240_10144220 | |||
| 2378 | Ga0105240_10165337 | |||
| 2379 | Ga0105240_10204965 | |||
| 2380 | Ga0105240_10210860 | |||
| 2381 | Ga0105240_10394345 | |||
| 2382 | Ga0105240_10441456 | |||
| 2383 | Ga0105240_10686775 | |||
| 2384 | Ga0105240_10697802 | |||
| 2385 | Ga0111539_10000458 | |||
| 2386 | Ga0111539_10011561 | |||
| 2387 | Ga0111539_10244806 | |||
| 2388 | Ga0111539_10291175 | |||
| 2389 | Ga0105245_10062678 | |||
| 2390 | Ga0105245_10294763 | |||
| 2391 | Ga0105245_10303081 | |||
| 2392 | Ga0105245_10741268 | |||
| 2393 | Ga0105247_10011352 | |||
| 2394 | Ga0105247_10040947 | |||
| 2395 | Ga0105247_10073788 | |||
| 2396 | Ga0105247_10160789 | |||
| 2397 | Ga0114129_10011078 | |||
| 2398 | Ga0114129_10046449 | |||
| 2399 | Ga0114129_10117314 | |||
| 2400 | Ga0105243_10153696 | |||
| 2401 | Ga0105241_10000777 | |||
| 2402 | Ga0105241_10001809 | |||
| 2403 | Ga0105241_10002168 | |||
| 2404 | Ga0105241_10006662 | |||
| 2405 | Ga0105241_10061480 | |||
| 2406 | Ga0105241_10074809 | |||
| 2407 | Ga0105241_10122217 | |||
| 2408 | Ga0105241_10151185 | |||
| 2409 | Ga0105241_10706185 | |||
| 2410 | Ga0105242_10010519 | |||
| 2411 | Ga0105242_10015262 | |||
| 2412 | Ga0105242_10023480 | |||
| 2413 | Ga0105242_10026092 | |||
| 2414 | Ga0105242_10026677 | |||
| 2415 | Ga0105242_10064176 | |||
| 2416 | Ga0105242_10151950 | |||
| 2417 | Ga0105242_10159749 | |||
| 2418 | Ga0105242_10365793 | |||
| 2419 | Ga0105242_10529103 | |||
| 2420 | Ga0105248_10045826 | |||
| 2421 | Ga0105248_10321779 | |||
| 2422 | Ga0105237_10000578 | |||
| 2423 | Ga0105237_10003264 | |||
| 2424 | Ga0105237_10005389 | |||
| 2425 | Ga0105237_10007421 | |||
| 2426 | Ga0105237_10007918 | |||
| 2427 | Ga0105237_10011343 | |||
| 2428 | Ga0105237_10014149 | |||
| 2429 | Ga0105237_10020903 | |||
| 2430 | Ga0105237_10027910 | |||
| 2431 | Ga0105237_10030381 | |||
| 2432 | Ga0105237_10035118 | |||
| 2433 | Ga0105237_10039752 | |||
| 2434 | Ga0105237_10158977 | |||
| 2435 | Ga0105237_10594553 | |||
| 2436 | Ga0105238_10000592 | |||
| 2437 | Ga0105238_10039464 | |||
| 2438 | Ga0105238_10042180 | |||
| 2439 | Ga0105238_10048733 | |||
| 2440 | Ga0105238_10074203 | |||
| 2441 | Ga0105249_10001375 | |||
| 2442 | Ga0105249_10001970 | |||
| 2443 | Ga0105249_10025557 | |||
| 2444 | Ga0105249_10026752 | |||
| 2445 | Ga0105249_10054779 | |||
| 2446 | Ga0105249_10059532 | |||
| 2447 | Ga0105249_10066344 | |||
| 2448 | Ga0105249_10074491 | |||
| 2449 | Ga0105249_10182862 | |||
| 2450 | Ga0105249_10245008 | |||
| 2451 | Ga0105249_10474469 | |||
| 2452 | Ga0105249_10614255 | |||
| 2453 | Ga0105239_10000001 | |||
| 2454 | Ga0105239_10000007 | |||
| 2455 | Ga0105239_10000180 | |||
| 2456 | Ga0105239_10000212 | |||
| 2457 | Ga0105239_10000352 | |||
| 2458 | Ga0105239_10000992 | |||
| 2459 | Ga0105239_10001405 | |||
| 2460 | Ga0105239_10007439 | |||
| 2461 | Ga0105239_10016055 | |||
| 2462 | Ga0105239_10056681 | |||
| 2463 | Ga0105239_10073160 | |||
| 2464 | Ga0105239_10076740 | |||
| 2465 | Ga0105239_10213948 | |||
| 2466 | Ga0105246_10051377 | |||
| 2467 | Ga0105246_10105345 | |||
| 2468 | Ga0105246_10409043 | |||
| 2469 | Ga0157373_10000245 | |||
| 2470 | Ga0157373_10002264 | |||
| 2471 | Ga0157373_10002904 | |||
| 2472 | Ga0157373_10003171 | |||
| 2473 | Ga0157373_10005746 | |||
| 2474 | Ga0157373_10011196 | |||
| 2475 | Ga0157373_10020458 | |||
| 2476 | Ga0157373_10026338 | |||
| 2477 | Ga0157373_10029204 | |||
| 2478 | Ga0157373_10080241 | |||
| 2479 | Ga0157373_10100605 | |||
| 2480 | Ga0157373_10106476 | |||
| 2481 | Ga0157373_10196846 | |||
| 2482 | Ga0157373_10355366 | |||
| 2483 | Ga0157371_10000418 | |||
| 2484 | Ga0157371_10000851 | |||
| 2485 | Ga0157371_10002731 | |||
| 2486 | Ga0157371_10002946 | |||
| 2487 | Ga0157371_10005012 | |||
| 2488 | Ga0157371_10008478 | |||
| 2489 | Ga0157371_10008985 | |||
| 2490 | Ga0157371_10012488 | |||
| 2491 | Ga0157371_10018679 | |||
| 2492 | Ga0157371_10041568 | |||
| 2493 | Ga0157371_10041592 | |||
| 2494 | Ga0157371_10054941 | |||
| 2495 | Ga0157371_10092815 | |||
| 2496 | Ga0157371_10105367 | |||
| 2497 | Ga0157371_10140079 | |||
| 2498 | Ga0157371_10173572 | |||
| 2499 | Ga0157371_10233015 | |||
| 2500 | Ga0157371_10321193 | |||
| 2501 | Ga0157371_10442554 | |||
| 2502 | Ga0157371_10459164 | |||
| 2503 | Ga0157370_10000197 | |||
| 2504 | Ga0157370_10001620 | |||
| 2505 | Ga0157370_10001816 | |||
| 2506 | Ga0157370_10002183 | |||
| 2507 | Ga0157370_10002188 | |||
| 2508 | Ga0157370_10006873 | |||
| 2509 | Ga0157370_10017062 | |||
| 2510 | Ga0157370_10030722 | |||
| 2511 | Ga0157370_10045646 | |||
| 2512 | Ga0157370_10060798 | |||
| 2513 | Ga0157370_10066900 | |||
| 2514 | Ga0157370_10079953 | |||
| 2515 | Ga0157370_10129166 | |||
| 2516 | Ga0157370_10144531 | |||
| 2517 | Ga0157370_10151989 | |||
| 2518 | Ga0157370_10173586 | |||
| 2519 | Ga0157370_10214603 | |||
| 2520 | Ga0157370_10367379 | |||
| 2521 | Ga0157369_10000031 | |||
| 2522 | Ga0157369_10020641 | |||
| 2523 | Ga0157369_10041671 | |||
| 2524 | Ga0157369_10041955 | |||
| 2525 | Ga0157369_10069522 | |||
| 2526 | Ga0157369_10120236 | |||
| 2527 | Ga0157369_10123745 | |||
| 2528 | Ga0157369_10194621 | |||
| 2529 | Ga0157369_10363349 | |||
| 2530 | Ga0157369_10486176 | |||
| 2531 | Ga0157369_10640308 | |||
| 2532 | Ga0157374_10000914 | |||
| 2533 | Ga0157374_10001221 | |||
| 2534 | Ga0157374_10008347 | |||
| 2535 | Ga0157374_10013769 | |||
| 2536 | Ga0157374_10024325 | |||
| 2537 | Ga0157374_10033177 | |||
| 2538 | Ga0157374_10052361 | |||
| 2539 | Ga0157374_10052861 | |||
| 2540 | Ga0157374_10056468 | |||
| 2541 | Ga0157374_10123615 | |||
| 2542 | Ga0157374_10204708 | |||
| 2543 | Ga0157374_10358487 | |||
| 2544 | Ga0157374_10471158 | |||
| 2545 | Ga0157374_10753713 | |||
| 2546 | Ga0157378_10003529 | |||
| 2547 | Ga0157378_10014484 | |||
| 2548 | Ga0157378_10020345 | |||
| 2549 | Ga0157378_10027912 | |||
| 2550 | Ga0157378_10053119 | |||
| 2551 | Ga0157378_10070381 | |||
| 2552 | Ga0157378_10097250 | |||
| 2553 | Ga0157378_10108892 | |||
| 2554 | Ga0157378_10120313 | |||
| 2555 | Ga0157378_10132069 | |||
| 2556 | Ga0157378_10198577 | |||
| 2557 | Ga0157378_10356474 | |||
| 2558 | Ga0157378_10407866 | |||
| 2559 | Ga0163162_10000010 | |||
| 2560 | Ga0163162_10000093 | |||
| 2561 | Ga0163162_10000131 | |||
| 2562 | Ga0163162_10000154 | |||
| 2563 | Ga0163162_10000189 | |||
| 2564 | Ga0163162_10001288 | |||
| 2565 | Ga0163162_10001546 | |||
| 2566 | Ga0163162_10004949 | |||
| 2567 | Ga0163162_10010730 | |||
| 2568 | Ga0163162_10011210 | |||
| 2569 | Ga0163162_10011453 | |||
| 2570 | Ga0163162_10034902 | |||
| 2571 | Ga0163162_10107364 | |||
| 2572 | Ga0163162_10131816 | |||
| 2573 | Ga0163162_10133746 | |||
| 2574 | Ga0163162_10139229 | |||
| 2575 | Ga0163162_10399787 | |||
| 2576 | Ga0163162_10729791 | |||
| 2577 | Ga0163162_11081636 | |||
| 2578 | Ga0157372_10000073 | |||
| 2579 | Ga0157372_10000173 | |||
| 2580 | Ga0157372_10002062 | |||
| 2581 | Ga0157372_10003396 | |||
| 2582 | Ga0157372_10013408 | |||
| 2583 | Ga0157372_10043627 | |||
| 2584 | Ga0157372_10046553 | |||
| 2585 | Ga0157372_10050546 | |||
| 2586 | Ga0157372_10052360 | |||
| 2587 | Ga0157372_10068835 | |||
| 2588 | Ga0157372_10086369 | |||
| 2589 | Ga0157372_10112740 | |||
| 2590 | Ga0157372_10140801 | |||
| 2591 | Ga0157372_10143555 | |||
| 2592 | Ga0157372_10154478 | |||
| 2593 | Ga0157372_10171083 | |||
| 2594 | Ga0157372_10177767 | |||
| 2595 | Ga0157372_10180428 | |||
| 2596 | Ga0157372_10208694 | |||
| 2597 | Ga0157372_10218144 | |||
| 2598 | Ga0157372_10247343 | |||
| 2599 | Ga0157372_10317509 | |||
| 2600 | Ga0157372_10401987 | |||
| 2601 | Ga0157372_10628770 | |||
| 2602 | Ga0157372_10799020 | |||
| 2603 | Ga0157372_10882867 | |||
| 2604 | Ga0157372_11045018 | |||
| 2605 | Ga0157372_11287192 | |||
| 2606 | Ga0157375_10000850 | |||
| 2607 | Ga0157375_10001388 | |||
| 2608 | Ga0157375_10001823 | |||
| 2609 | Ga0157375_10006292 | |||
| 2610 | Ga0157375_10006520 | |||
| 2611 | Ga0157375_10013251 | |||
| 2612 | Ga0157375_10021961 | |||
| 2613 | Ga0157375_10043902 | |||
| 2614 | Ga0157375_10071904 | |||
| 2615 | Ga0157375_10110719 | |||
| 2616 | Ga0157375_10134957 | |||
| 2617 | Ga0157375_10167443 | |||
| 2618 | Ga0157375_10201446 | |||
| 2619 | Ga0157375_10366265 | |||
| 2620 | Ga0157375_10376650 | |||
| 2621 | Ga0157375_10422202 | |||
| 2622 | Ga0157375_10552617 | |||
| 2623 | Ga0157375_10915224 | |||
| 2624 | Ga0163163_10000471 | |||
| 2625 | Ga0163163_10000825 | |||
| 2626 | Ga0163163_10002272 | |||
| 2627 | Ga0163163_10009933 | |||
| 2628 | Ga0163163_10080403 | |||
| 2629 | Ga0163163_10101861 | |||
| 2630 | Ga0157380_10003936 | |||
| 2631 | Ga0157380_10018266 | |||
| 2632 | Ga0157380_10023605 | |||
| 2633 | Ga0157380_10073624 | |||
| 2634 | Ga0157380_10154016 | |||
| 2635 | Ga0157380_10425108 | |||
| 2636 | Ga0182008_10000024 | |||
| 2637 | Ga0182008_10000082 | |||
| 2638 | Ga0182008_10000503 | |||
| 2639 | Ga0182008_10006487 | |||
| 2640 | Ga0182008_10012897 | |||
| 2641 | Ga0182008_10022002 | |||
| 2642 | Ga0157377_10001438 | |||
| 2643 | Ga0157377_10009315 | |||
| 2644 | Ga0157377_10013943 | |||
| 2645 | Ga0157377_10018718 | |||
| 2646 | Ga0157377_10039544 | |||
| 2647 | Ga0157377_10171509 | |||
| 2648 | Ga0157377_10374994 | |||
| 2649 | Ga0157379_10001930 | |||
| 2650 | Ga0157379_10005329 | |||
| 2651 | Ga0157379_10056117 | |||
| 2652 | Ga0157379_10068332 | |||
| 2653 | Ga0157379_10069695 | |||
| 2654 | Ga0157379_10123724 | |||
| 2655 | Ga0157379_10143965 | |||
| 2656 | Ga0157379_10185128 | |||
| 2657 | Ga0157379_10261167 | |||
| 2658 | Ga0157376_10000916 | |||
| 2659 | Ga0157376_10001409 | |||
| 2660 | Ga0157376_10006039 | |||
| 2661 | Ga0157376_10287865 | |||
| 2662 | Ga0157376_10775446 | |||
| 2663 | Ga0157376_10901861 | |||
| 2664 | Ga0182006_1000373 | |||
| 2665 | Ga0182006_1002727 | |||
| 2666 | Ga0182006_1004126 | |||
| 2667 | Ga0182006_1005808 | |||
| 2668 | Ga0182006_1009924 | |||
| 2669 | Ga0182006_1048129 | |||
| 2670 | Ga0182007_10000002 | |||
| 2671 | Ga0182007_10004523 | |||
| 2672 | Ga0182007_10005822 | |||
| 2673 | Ga0182007_10061891 | |||
| 2674 | Ga0182005_1050424 | |||
| 2675 | Ga0183373_1004 | |||
| 2676 | Ga0163161_10000856 | |||
| 2677 | Ga0163161_10001255 | |||
| 2678 | Ga0163161_10001554 | |||
| 2679 | Ga0163161_10014039 | |||
| 2680 | Ga0163161_10022880 | |||
| 2681 | Ga0163161_10024488 | |||
| 2682 | Ga0163161_10028422 | |||
| 2683 | Ga0163161_10045950 | |||
| 2684 | Ga0163161_10072869 | |||
| 2685 | Ga0163161_10078048 | |||
| 2686 | Ga0163161_10107048 | |||
| 2687 | Ga0163161_10110034 | |||
| 2688 | Ga0163161_10150859 | |||
| 2689 | Ga0163161_10234859 | |||
| 2690 | Ga0163161_10381861 | |||
| 2691 | Ga0163161_10641440 | |||
| 2692 | Ga0206351_10266021 | |||
| 2693 | Ga0206352_10171243 | |||
| 2694 | Ga0154015_1198199 | |||
| 2695 | Ga0154015_1441652 | |||
| 2696 | Ga0213872_10006185 | |||
| 2697 | Ga0213876_10023559 | |||
| 2698 | Ga0224712_10035334 | |||
| 2699 | Ga0209436_103559 | |||
| 2700 | Ga0207427_100025 | |||
| 2701 | Ga0209437_100010 | |||
| 2702 | Ga0209437_100017 | |||
| 2703 | Ga0209437_100148 | |||
| 2704 | Ga0207425_1000023 | |||
| 2705 | Ga0209646_1001012 | |||
| 2706 | Ga0209026_1000430 | |||
| 2707 | Ga0209026_1000498 | |||
| 2708 | Ga0209026_1005565 | |||
| 2709 | Ga0209129_1000032 | |||
| 2710 | Ga0209129_1006980 | |||
| 2711 | Ga0209233_1000017 | |||
| 2712 | Ga0209233_1001847 | |||
| 2713 | Ga0207666_1005382 | |||
| 2714 | Ga0209455_1000682 | |||
| 2715 | Ga0209130_1002864 | |||
| 2716 | Ga0209676_1000009 | |||
| 2717 | Ga0209676_1000363 | |||
| 2718 | Ga0209025_1000047 | |||
| 2719 | Ga0209758_1000145 | |||
| 2720 | Ga0209050_1000094 | |||
| 2721 | Ga0209050_1029027 | |||
| 2722 | Ga0207426_1000059 | |||
| 2723 | Ga0207426_1000234 | |||
| 2724 | Ga0207426_1039841 | |||
| 2725 | Ga0207697_10012795 | |||
| 2726 | Ga0207697_10042239 | |||
| 2727 | Ga0207697_10044972 | |||
| 2728 | Ga0207697_10115793 | |||
| 2729 | Ga0207697_10166184 | |||
| 2730 | Ga0207656_10010545 | |||
| 2731 | Ga0207656_10021255 | |||
| 2732 | Ga0207656_10039145 | |||
| 2733 | Ga0207656_10126649 | |||
| 2734 | Ga0207656_10139579 | |||
| 2735 | Ga0207682_10029174 | |||
| 2736 | Ga0207682_10058426 | |||
| 2737 | Ga0207642_10025354 | |||
| 2738 | Ga0207710_10002076 | |||
| 2739 | Ga0207710_10027249 | |||
| 2740 | Ga0207680_10000024 | |||
| 2741 | Ga0207680_10000907 | |||
| 2742 | Ga0207680_10061670 | |||
| 2743 | Ga0207680_10091551 | |||
| 2744 | Ga0207680_10225739 | |||
| 2745 | Ga0207647_10000358 | |||
| 2746 | Ga0207647_10000680 | |||
| 2747 | Ga0207647_10002110 | |||
| 2748 | Ga0207647_10023206 | |||
| 2749 | Ga0207647_10023686 | |||
| 2750 | Ga0207647_10095624 | |||
| 2751 | Ga0207647_10113164 | |||
| 2752 | Ga0207647_10113581 | |||
| 2753 | Ga0207647_10173695 | |||
| 2754 | Ga0207645_10004249 | |||
| 2755 | Ga0207645_10006511 | |||
| 2756 | Ga0207645_10008865 | |||
| 2757 | Ga0207645_10021055 | |||
| 2758 | Ga0207645_10036497 | |||
| 2759 | Ga0207645_10143436 | |||
| 2760 | Ga0207645_10154702 | |||
| 2761 | Ga0207643_10004405 | |||
| 2762 | Ga0207643_10008664 | |||
| 2763 | Ga0207643_10160761 | |||
| 2764 | Ga0207705_10000045 | |||
| 2765 | Ga0207705_10009444 | |||
| 2766 | Ga0207705_10011675 | |||
| 2767 | Ga0207705_10051441 | |||
| 2768 | Ga0207705_10175968 | |||
| 2769 | Ga0207705_10247490 | |||
| 2770 | Ga0207705_10411428 | |||
| 2771 | Ga0207705_10493114 | |||
| 2772 | Ga0207654_10000945 | |||
| 2773 | Ga0207654_10001057 | |||
| 2774 | Ga0207654_10002875 | |||
| 2775 | Ga0207654_10011519 | |||
| 2776 | Ga0207654_10027133 | |||
| 2777 | Ga0207654_10047562 | |||
| 2778 | Ga0207707_10000785 | |||
| 2779 | Ga0207707_10002289 | |||
| 2780 | Ga0207707_10015783 | |||
| 2781 | Ga0207707_10109062 | |||
| 2782 | Ga0207707_10145017 | |||
| 2783 | Ga0207707_10238445 | |||
| 2784 | Ga0207707_10399063 | |||
| 2785 | Ga0207695_10000019 | |||
| 2786 | Ga0207695_10000087 | |||
| 2787 | Ga0207695_10000863 | |||
| 2788 | Ga0207695_10004265 | |||
| 2789 | Ga0207695_10004821 | |||
| 2790 | Ga0207695_10032498 | |||
| 2791 | Ga0207695_10051405 | |||
| 2792 | Ga0207695_10087504 | |||
| 2793 | Ga0207695_10176783 | |||
| 2794 | Ga0207695_10308142 | |||
| 2795 | Ga0207695_10447819 | |||
| 2796 | Ga0207671_10003252 | |||
| 2797 | Ga0207671_10006450 | |||
| 2798 | Ga0207671_10007651 | |||
| 2799 | Ga0207671_10008745 | |||
| 2800 | Ga0207671_10017925 | |||
| 2801 | Ga0207671_10022639 | |||
| 2802 | Ga0207671_10036181 | |||
| 2803 | Ga0207671_10110205 | |||
| 2804 | Ga0207671_10148648 | |||
| 2805 | Ga0207671_10269052 | |||
| 2806 | Ga0207671_10492185 | |||
| 2807 | Ga0207660_10012376 | |||
| 2808 | Ga0207660_10032056 | |||
| 2809 | Ga0207660_10040413 | |||
| 2810 | Ga0207660_10407469 | |||
| 2811 | Ga0207662_10022900 | |||
| 2812 | Ga0207662_10342869 | |||
| 2813 | Ga0207657_10009277 | |||
| 2814 | Ga0207657_10028323 | |||
| 2815 | Ga0207657_10040503 | |||
| 2816 | Ga0207657_10057355 | |||
| 2817 | Ga0207657_10078928 | |||
| 2818 | Ga0207657_10091876 | |||
| 2819 | Ga0207657_10113207 | |||
| 2820 | Ga0207657_10196814 | |||
| 2821 | Ga0207657_10569962 | |||
| 2822 | Ga0207649_10001875 | |||
| 2823 | Ga0207649_10005900 | |||
| 2824 | Ga0207649_10060515 | |||
| 2825 | Ga0207652_10000103 | |||
| 2826 | Ga0207652_10001257 | |||
| 2827 | Ga0207652_10002683 | |||
| 2828 | Ga0207652_10004292 | |||
| 2829 | Ga0207652_10034573 | |||
| 2830 | Ga0207652_10055658 | |||
| 2831 | Ga0207652_10060901 | |||
| 2832 | Ga0207652_10195098 | |||
| 2833 | Ga0207652_10417910 | |||
| 2834 | Ga0207646_10164022 | |||
| 2835 | Ga0207681_10010220 | |||
| 2836 | Ga0207681_10097147 | |||
| 2837 | Ga0207681_10140772 | |||
| 2838 | Ga0207681_10206168 | |||
| 2839 | Ga0207681_10213768 | |||
| 2840 | Ga0207694_10011375 | |||
| 2841 | Ga0207694_10058055 | |||
| 2842 | Ga0207650_10033682 | |||
| 2843 | Ga0207650_10045601 | |||
| 2844 | Ga0207650_10050701 | |||
| 2845 | Ga0207650_10094946 | |||
| 2846 | Ga0207650_10122960 | |||
| 2847 | Ga0207650_10140567 | |||
| 2848 | Ga0207650_10150375 | |||
| 2849 | Ga0207650_10242466 | |||
| 2850 | Ga0207650_10311268 | |||
| 2851 | Ga0207650_10405853 | |||
| 2852 | Ga0207659_10028297 | |||
| 2853 | Ga0207659_10052832 | |||
| 2854 | Ga0207659_10056781 | |||
| 2855 | Ga0207659_10307547 | |||
| 2856 | Ga0207687_10260785 | |||
| 2857 | Ga0207687_10463974 | |||
| 2858 | Ga0207644_10027212 | |||
| 2859 | Ga0207644_10052954 | |||
| 2860 | Ga0207644_10064041 | |||
| 2861 | Ga0207644_10077611 | |||
| 2862 | Ga0207644_10136589 | |||
| 2863 | Ga0207644_10157937 | |||
| 2864 | Ga0207644_10174594 | |||
| 2865 | Ga0207644_10460216 | |||
| 2866 | Ga0207690_10000766 | |||
| 2867 | Ga0207690_10005287 | |||
| 2868 | Ga0207690_10022304 | |||
| 2869 | Ga0207690_10025950 | |||
| 2870 | Ga0207690_10034698 | |||
| 2871 | Ga0207690_10079990 | |||
| 2872 | Ga0207690_10112549 | |||
| 2873 | Ga0207690_10199973 | |||
| 2874 | Ga0207706_10000057 | |||
| 2875 | Ga0207706_10013742 | |||
| 2876 | Ga0207706_10015669 | |||
| 2877 | Ga0207706_10032770 | |||
| 2878 | Ga0207706_10041077 | |||
| 2879 | Ga0207706_10041917 | |||
| 2880 | Ga0207706_10045347 | |||
| 2881 | Ga0207706_10051782 | |||
| 2882 | Ga0207706_10096309 | |||
| 2883 | Ga0207686_10001595 | |||
| 2884 | Ga0207686_10012459 | |||
| 2885 | Ga0207686_10123301 | |||
| 2886 | Ga0207686_10219974 | |||
| 2887 | Ga0207709_10218812 | |||
| 2888 | Ga0207709_10546443 | |||
| 2889 | Ga0207670_10040768 | |||
| 2890 | Ga0207670_10046370 | |||
| 2891 | Ga0207670_10061173 | |||
| 2892 | Ga0207669_10029049 | |||
| 2893 | Ga0207669_10141837 | |||
| 2894 | Ga0207669_10210636 | |||
| 2895 | Ga0207669_10334663 | |||
| 2896 | Ga0207669_10342008 | |||
| 2897 | Ga0207704_10000266 | |||
| 2898 | Ga0207704_10005149 | |||
| 2899 | Ga0207704_10019491 | |||
| 2900 | Ga0207704_10027744 | |||
| 2901 | Ga0207704_10028606 | |||
| 2902 | Ga0207704_10080944 | |||
| 2903 | Ga0207704_10398916 | |||
| 2904 | Ga0207665_10076711 | |||
| 2905 | Ga0207691_10000322 | |||
| 2906 | Ga0207691_10013189 | |||
| 2907 | Ga0207691_10022737 | |||
| 2908 | Ga0207691_10035059 | |||
| 2909 | Ga0207691_10042771 | |||
| 2910 | Ga0207691_10056700 | |||
| 2911 | Ga0207691_10057182 | |||
| 2912 | Ga0207691_10129274 | |||
| 2913 | Ga0207691_10218260 | |||
| 2914 | Ga0207691_10551051 | |||
| 2915 | Ga0207711_10560098 | |||
| 2916 | Ga0207689_10002373 | |||
| 2917 | Ga0207689_10004255 | |||
| 2918 | Ga0207689_10005993 | |||
| 2919 | Ga0207689_10006451 | |||
| 2920 | Ga0207689_10012780 | |||
| 2921 | Ga0207689_10013331 | |||
| 2922 | Ga0207689_10014390 | |||
| 2923 | Ga0207689_10015849 | |||
| 2924 | Ga0207689_10017568 | |||
| 2925 | Ga0207689_10018768 | |||
| 2926 | Ga0207689_10021517 | |||
| 2927 | Ga0207689_10022338 | |||
| 2928 | Ga0207689_10031594 | |||
| 2929 | Ga0207689_10124311 | |||
| 2930 | Ga0207689_10216840 | |||
| 2931 | Ga0207689_10311971 | |||
| 2932 | Ga0207661_10001968 | |||
| 2933 | Ga0207661_10010454 | |||
| 2934 | Ga0207661_10019341 | |||
| 2935 | Ga0207661_10034779 | |||
| 2936 | Ga0207661_10064761 | |||
| 2937 | Ga0207661_10125085 | |||
| 2938 | Ga0207661_10565966 | |||
| 2939 | Ga0207679_10000223 | |||
| 2940 | Ga0207679_10001672 | |||
| 2941 | Ga0207679_10020334 | |||
| 2942 | Ga0207679_10028022 | |||
| 2943 | Ga0207667_10000015 | |||
| 2944 | Ga0207667_10000644 | |||
| 2945 | Ga0207667_10003221 | |||
| 2946 | Ga0207667_10009488 | |||
| 2947 | Ga0207667_10030806 | |||
| 2948 | Ga0207667_10056376 | |||
| 2949 | Ga0207667_10060374 | |||
| 2950 | Ga0207667_10065419 | |||
| 2951 | Ga0207667_10107856 | |||
| 2952 | Ga0207667_10125592 | |||
| 2953 | Ga0207667_10221630 | |||
| 2954 | Ga0207667_10323234 | |||
| 2955 | Ga0207667_10398347 | |||
| 2956 | Ga0207651_10007850 | |||
| 2957 | Ga0207651_10014436 | |||
| 2958 | Ga0207651_10029097 | |||
| 2959 | Ga0207651_10042377 | |||
| 2960 | Ga0207651_10051187 | |||
| 2961 | Ga0207651_10130067 | |||
| 2962 | Ga0207651_10181632 | |||
| 2963 | Ga0207651_10253036 | |||
| 2964 | Ga0207651_10424240 | |||
| 2965 | Ga0207651_10596466 | |||
| 2966 | Ga0207651_10654532 | |||
| 2967 | Ga0207712_10002565 | |||
| 2968 | Ga0207712_10005545 | |||
| 2969 | Ga0207712_10011918 | |||
| 2970 | Ga0207712_10025662 | |||
| 2971 | Ga0207712_10046585 | |||
| 2972 | Ga0207712_10074204 | |||
| 2973 | Ga0207712_10280329 | |||
| 2974 | Ga0207668_10000475 | |||
| 2975 | Ga0207668_10036554 | |||
| 2976 | Ga0207668_10204089 | |||
| 2977 | Ga0207668_10207663 | |||
| 2978 | Ga0207668_10620326 | |||
| 2979 | Ga0207640_10002135 | |||
| 2980 | Ga0207640_10095408 | |||
| 2981 | Ga0207640_10112020 | |||
| 2982 | Ga0207640_10134143 | |||
| 2983 | Ga0207640_10195321 | |||
| 2984 | Ga0207640_10206176 | |||
| 2985 | Ga0207640_10258312 | |||
| 2986 | Ga0207658_10002470 | |||
| 2987 | Ga0207658_10008454 | |||
| 2988 | Ga0207658_10012330 | |||
| 2989 | Ga0207658_10012528 | |||
| 2990 | Ga0207658_10034411 | |||
| 2991 | Ga0207658_10182935 | |||
| 2992 | Ga0207658_10188642 | |||
| 2993 | Ga0207658_10222666 | |||
| 2994 | Ga0207658_10366099 | |||
| 2995 | Ga0207677_10000863 | |||
| 2996 | Ga0207677_10002657 | |||
| 2997 | Ga0207677_10007297 | |||
| 2998 | Ga0207677_10007663 | |||
| 2999 | Ga0207677_10035820 | |||
| 3000 | Ga0207677_10051804 | |||
| 3001 | Ga0207677_10057073 | |||
| 3002 | Ga0207677_10076732 | |||
| 3003 | Ga0207703_10000814 | |||
| 3004 | Ga0207703_10068179 | |||
| 3005 | Ga0207703_10125988 | |||
| 3006 | Ga0207703_10625764 | |||
| 3007 | Ga0207639_10004988 | |||
| 3008 | Ga0207639_10005319 | |||
| 3009 | Ga0207639_10005473 | |||
| 3010 | Ga0207639_10008068 | |||
| 3011 | Ga0207639_10009288 | |||
| 3012 | Ga0207639_10011449 | |||
| 3013 | Ga0207639_10015980 | |||
| 3014 | Ga0207639_10031117 | |||
| 3015 | Ga0207639_10033500 | |||
| 3016 | Ga0207639_10042980 | |||
| 3017 | Ga0207639_10057505 | |||
| 3018 | Ga0207639_10095718 | |||
| 3019 | Ga0207639_10097453 | |||
| 3020 | Ga0207639_10107882 | |||
| 3021 | Ga0207639_10125427 | |||
| 3022 | Ga0207639_10132910 | |||
| 3023 | Ga0207639_10251336 | |||
| 3024 | Ga0207639_10557432 | |||
| 3025 | Ga0207678_10032708 | |||
| 3026 | Ga0207678_10366102 | |||
| 3027 | Ga0207708_10112481 | |||
| 3028 | Ga0207702_10000165 | |||
| 3029 | Ga0207702_10019965 | |||
| 3030 | Ga0207702_10135571 | |||
| 3031 | Ga0207702_10156603 | |||
| 3032 | Ga0207702_10317660 | |||
| 3033 | Ga0207702_10344598 | |||
| 3034 | Ga0207641_10000058 | |||
| 3035 | Ga0207641_10003931 | |||
| 3036 | Ga0207641_10005737 | |||
| 3037 | Ga0207641_10017416 | |||
| 3038 | Ga0207641_10041507 | |||
| 3039 | Ga0207641_10059311 | |||
| 3040 | Ga0207641_10065270 | |||
| 3041 | Ga0207641_10121696 | |||
| 3042 | Ga0207641_10319375 | |||
| 3043 | Ga0207641_10321659 | |||
| 3044 | Ga0207648_10000820 | |||
| 3045 | Ga0207648_10003208 | |||
| 3046 | Ga0207648_10004484 | |||
| 3047 | Ga0207648_10007640 | |||
| 3048 | Ga0207648_10012664 | |||
| 3049 | Ga0207648_10017326 | |||
| 3050 | Ga0207648_10037211 | |||
| 3051 | Ga0207648_10052616 | |||
| 3052 | Ga0207648_10087459 | |||
| 3053 | Ga0207648_10121269 | |||
| 3054 | Ga0207648_10172746 | |||
| 3055 | Ga0207648_10191482 | |||
| 3056 | Ga0207648_10385588 | |||
| 3057 | Ga0207676_10004821 | |||
| 3058 | Ga0207676_10008428 | |||
| 3059 | Ga0207676_10012530 | |||
| 3060 | Ga0207676_10027108 | |||
| 3061 | Ga0207676_10071782 | |||
| 3062 | Ga0207676_10084729 | |||
| 3063 | Ga0207676_10102365 | |||
| 3064 | Ga0207676_10193088 | |||
| 3065 | Ga0207676_10525211 | |||
| 3066 | Ga0207674_10031003 | |||
| 3067 | Ga0207674_10031084 | |||
| 3068 | Ga0207674_10061629 | |||
| 3069 | Ga0207674_10075106 | |||
| 3070 | Ga0207674_10085770 | |||
| 3071 | Ga0207674_10093977 | |||
| 3072 | Ga0207674_10109546 | |||
| 3073 | Ga0207674_10157689 | |||
| 3074 | Ga0207674_10176620 | |||
| 3075 | Ga0207674_10265145 | |||
| 3076 | Ga0207675_100000646 | |||
| 3077 | Ga0207675_100002881 | |||
| 3078 | Ga0207675_100014651 | |||
| 3079 | Ga0207675_100108878 | |||
| 3080 | Ga0207675_100159933 | |||
| 3081 | Ga0207675_100197471 | |||
| 3082 | Ga0207675_100223013 | |||
| 3083 | Ga0207675_100315104 | |||
| 3084 | Ga0207675_100325210 | |||
| 3085 | Ga0207683_10012841 | |||
| 3086 | Ga0207683_10020499 | |||
| 3087 | Ga0207683_10030804 | |||
| 3088 | Ga0207683_10165220 | |||
| 3089 | Ga0207698_10003833 | |||
| 3090 | Ga0207698_10006479 | |||
| 3091 | Ga0207698_10015545 | |||
| 3092 | Ga0207698_10020442 | |||
| 3093 | Ga0207698_10033537 | |||
| 3094 | Ga0207698_10047101 | |||
| 3095 | Ga0207698_10090718 | |||
| 3096 | Ga0207698_10119163 | |||
| 3097 | Ga0207698_10125088 | |||
| 3098 | Ga0207698_10144799 | |||
| 3099 | Ga0207698_10162772 | |||
| 3100 | Ga0207698_10175937 | |||
| 3101 | Ga0207698_10419937 | |||
| 3102 | Ga0209968_1004926 | |||
| 3103 | Ga0207428_10074553 | |||
| 3104 | Ga0207428_10086053 | |||
| 3105 | Ga0268266_10000030 | |||
| 3106 | Ga0268266_10003162 | |||
| 3107 | Ga0268266_10061888 | |||
| 3108 | Ga0268266_10525811 | |||
| 3109 | Ga0268265_10003417 | |||
| 3110 | Ga0268265_10005499 | |||
| 3111 | Ga0268265_10012001 | |||
| 3112 | Ga0268265_10043777 | |||
| 3113 | Ga0268265_10112713 | |||
| 3114 | Ga0268265_10137972 | |||
| 3115 | Ga0268264_10001732 | |||
| 3116 | Ga0268264_10003381 | |||
| 3117 | Ga0268264_10004437 | |||
| 3118 | Ga0268264_10011514 | |||
| 3119 | Ga0268264_10016463 | |||
| 3120 | Ga0268264_10021945 | |||
| 3121 | Ga0268264_10040321 | |||
| 3122 | Ga0268264_10054278 | |||
| 3123 | Ga0268264_10185596 | |||
| 3124 | Ga0268264_10341907 | |||
| 3125 | Ga0268264_10392779 | |||
| 3126 | Ga0268264_11011648 | |||
| 3127 | Ga0307517_10001481 | |||
| 3128 | Ga0307517_10022273 | |||
| 3129 | Ga0307517_10113502 | |||
| 3130 | Ga0307515_10000001 | |||
| 3131 | Ga0307515_10000012 | |||
| 3132 | Ga0307515_10000059 | |||
| 3133 | Ga0307515_10000349 | |||
| 3134 | Ga0307515_10000376 | |||
| 3135 | Ga0307515_10005206 | |||
| 3136 | Ga0307515_10040038 | |||
| 3137 | Ga0307515_10263621 | |||
| 3138 | Ga0307511_10000076 | |||
| 3139 | Ga0316177_1015993 | |||
| 3140 | Ga0316177_1087909 | |||
| 3141 | Ga0316176_1026788 | |||
| 3142 | Ga0316183_1099321 | |||
| 3143 | Ga0316181_1156971 | |||
| 3144 | Ga0316181_1210309 | |||
| 3145 | Ga0316182_1096864 | |||
| 3146 | Ga0265320_10093821 | |||
| 3147 | Ga0265331_10081425 | |||
| 3148 | Ga0265327_10000013 | |||
| 3149 | Ga0265327_10000031 | |||
| 3150 | Ga0265327_10000137 | |||
| 3151 | Ga0265327_10013169 | |||
| 3152 | Ga0265327_10013842 | |||
| 3153 | Ga0265327_10071989 | |||
| 3154 | Ga0307513_10219831 | |||
| 3155 | Ga0307509_10044062 | |||
| 3156 | Ga0307509_10064621 | |||
| 3157 | Ga0307509_10126854 | |||
| 3158 | Ga0307509_10256229 | |||
| 3159 | Ga0307509_10261765 | |||
| 3160 | Ga0307408_100000541 | |||
| 3161 | Ga0307408_100003308 | |||
| 3162 | Ga0307408_100018035 | |||
| 3163 | Ga0307408_100049099 | |||
| 3164 | Ga0307508_10006441 | |||
| 3165 | Ga0307508_10270277 | |||
| 3166 | Ga0265314_10088042 | |||
| 3167 | Ga0307516_10003288 | |||
| 3168 | Ga0307516_10129055 | |||
| 3169 | Ga0307516_10247622 | |||
| 3170 | Ga0307405_10000015 | |||
| 3171 | Ga0307405_10015968 | |||
| 3172 | Ga0307405_10024515 | |||
| 3173 | Ga0307405_10498241 | |||
| 3174 | Ga0307413_10123252 | |||
| 3175 | Ga0307413_10177719 | |||
| 3176 | Ga0307407_10000027 | |||
| 3177 | Ga0307412_10000030 | |||
| 3178 | Ga0307412_10012923 | |||
| 3179 | Ga0307412_10039962 | |||
| 3180 | Ga0307412_10128525 | |||
| 3181 | Ga0307412_10492401 | |||
| 3182 | Ga0307416_100000002 | |||
| 3183 | Ga0307416_100056158 | |||
| 3184 | Ga0307416_100246061 | |||
| 3185 | Ga0307414_10000262 | |||
| 3186 | Ga0307414_10006046 | |||
| 3187 | Ga0307414_10019408 | |||
| 3188 | Ga0307414_10027138 | |||
| 3189 | Ga0307414_10037255 | |||
| 3190 | Ga0307414_10066410 | |||
| 3191 | Ga0307414_10128998 | |||
| 3192 | Ga0307414_10130002 | |||
| 3193 | Ga0307414_10211709 | |||
| 3194 | Ga0307414_10620892 | |||
| 3195 | Ga0307507_10003702 | |||
| 3196 | Ga0307507_10115244 | |||
| 3197 | Ga0307510_10000464 | |||
| 3198 | Ga0373950_0027934 | |||
| 3199 | Ga0373934_0045137 | |||
| 3200 | Ga0373943_0057217 | |||
| 3201 | Ga0373946_0029924 | |||
| 3202 | Ga0373955_0009887 | |||
| 3203 | Ga0373935_0150339 | |||
| 3204 | Ga0373933_0062135 | |||
| 3205 | Ga0373933_0156255 | |||
| 3206 | Ga0373947_0386689 | |||
| 3207 | Ga0373937_0016924 | |||
| 3208 | Ga0373925_0214204 | |||
| 3209 | Ga0373925_0358037 | |||
| 3210 | Ga0373925_0466509 | |||
| 3211 | Ga0395899_0000001 | |||
| 3212 | Ga0395899_0000887 | |||
| 3213 | Ga0395899_0007044 | |||
| 3214 | Ga0395899_0007705 | |||
| 3215 | Ga0395899_0020100 | |||
| 3216 | Ga0395899_0037069 | |||
| 3217 | Ga0395899_0055058 | |||
| 3218 | Ga0395899_0067028 | |||
| 3219 | Ga0395899_0078418 | |||
| 3220 | Ga0395900_0000143 | |||
| 3221 | Ga0395900_0000684 | |||
| 3222 | Ga0395900_0003189 | |||
| 3223 | Ga0395900_0006556 | |||
| 3224 | Ga0395900_0039835 | |||
| 3225 | Ga0395900_0114735 | |||
| 3226 | Ga0395898_0001240 | |||
| 3227 | Ga0395898_0004789 | |||
| 3228 | Ga0395898_0136633 | |||
| 3229 | Ga0395898_0187493 | |||
| 3230 | Ga0395898_0238196 | |||
| 3231 | Ga0395898_0325443 | |||
| 3232 | Ga0395905_0000175 | |||
| 3233 | Ga0395905_0000981 | |||
| 3234 | Ga0395905_0002365 | |||
| 3235 | Ga0395905_0005773 | |||
| 3236 | Ga0395905_0246718 | |||
| 3237 | Ga0395901_0000313 | |||
| 3238 | Ga0395901_0000995 | |||
| 3239 | Ga0395901_0004445 | |||
| 3240 | Ga0395901_0009480 | |||
| 3241 | Ga0395901_0010499 | |||
| 3242 | Ga0395901_0021527 | |||
| 3243 | Ga0395901_0045853 | |||
| 3244 | Ga0395901_0455660 | |||
| 3245 | Ga0436365_0782007 | |||
| 3246 | Ga0436365_0943390 | |||
| 3247 | Ga0436365_1630471 | |||
| 3248 | Ga0436361_1115729 | |||
| 3249 | Ga0439436_0000160 | |||
| 3250 | Ga0439439_0052951 | |||
| 3251 | Ga0439453_0008644 | |||
| 3252 | Ga0451787_841972 | |||
| 3253 | Ga0451795_0318958 | |||
| 3254 | Ga0451802_0264569 | |||
| 3255 | Ga0451802_1472217 | |||
| 3256 | Ga0451804_0820654 | |||
| 3257 | Ga0451841_1351513 | |||
| 3258 | Ga0451853_3193490 | |||
| 3259 | Ga0439431_0009310 | |||
| 3260 | Ga0439441_001534 | |||
| 3261 | Ga0439445_0029071 | |||
| 3262 | Ga0439449_0006413 | |||
| 3263 | Ga0439455_0038536 | |||
| 3264 | Ga0439462_0004351 | |||
| 3265 | Ga0439462_0040408 | |||
| 3266 | Ga0450922_007563 | |||
| 3267 | Ga0450894_011061 | |||
| 3268 | Ga0450898_000823 | |||
| 3269 | Ga0450898_022155 | |||
| 3270 | Ga0439446_0034792 | |||
| 3271 | Ga0439434_0007850 | |||
| 3272 | Ga0439434_0037469 | |||
| 3273 | Ga0439460_0032113 | |||
| 3274 | Ga0451577_0012474 | |||
| 3275 | Ga0451577_0107849 | |||
| 3276 | Ga0451577_0687026 | |||
| 3277 | Ga0466969_0057063 | |||
| 3278 | Ga0466972_0000049 | |||
| 3279 | Ga0466972_0000146 | |||
| 3280 | Ga0466972_0000641 | |||
| 3281 | Ga0466972_0006223 | |||
| 3282 | Ga0453683_0016564 | |||
| 3283 | Ga0453683_0126061 | |||
| 3284 | Ga0453683_0267404 | |||
| 3285 | Ga0466965_0154913 | |||
| 3286 | Ga0466966_0000015 | |||
| 3287 | Ga0466961_0085905 | |||
| 3288 | Ga0466961_0120018 | |||
| 3289 | Ga0453684_0027037 | |||
| 3290 | Ga0453684_0054484 | |||
| 3291 | Ga0453684_0073768 | |||
| 3292 | Ga0453684_0143209 | |||
| 3293 | Ga0453684_0309874 | |||
| 3294 | Ga0466971_0056363 | |||
| 3295 | Ga0466971_0152248 | |||
| 3296 | Ga0466968_0022170 | |||
| 3297 | Ga0466970_0015947 | |||
| 3298 | Ga0466957_0000381 | |||
| 3299 | Ga0466957_0012327 | |||
| 3300 | Ga0466957_0062028 | |||
| 3301 | Ga0466960_0093469 | |||
| 3302 | Ga0466959_0000030 | |||
| 3303 | Ga0466959_0057437 | |||
| 3304 | Ga0466959_0151381 | |||
| 3305 | Ga0466959_0560120 | |||
| 3306 | Ga0451576_0130745 | |||
| 3307 | Ga0451576_0475321 | |||
| 3308 | Ga0451576_0812298 | |||
| 3309 | Ga0466967_0248632 | |||
| 3310 | Ga0466967_0844880 | |||
| 3311 | Ga0495627_104413 | |||
| 3312 | Ga0495629_0020111 | |||
| 3313 | Ga0495638_0111546 | |||
| 3314 | Ga0495638_0117585 | |||
| 3315 | Ga0495651_0330405 | |||
| 3316 | Ga0495650_0000162 | |||
| 3317 | Ga0495650_0045261 | |||
| 3318 | Ga0495582_0091006 | |||
| 3319 | Ga0495662_0165709 | |||
| 3320 | Ga0495585_0000100 | |||
| 3321 | Ga0495585_0000153 | |||
| 3322 | Ga0495585_0000853 | |||
| 3323 | Ga0495585_0186983 | |||
| 3324 | Ga0495607_0154217 | |||
| 3325 | Ga0495583_0017756 | |||
| 3326 | Ga0495606_0000033 | |||
| 3327 | Ga0495606_0005624 | |||
| 3328 | Ga0495606_0013056 | |||
| 3329 | Ga0495606_0016861 | |||
| 3330 | Ga0495608_0117296 | |||
| 3331 | Ga0495610_0000768 | |||
| 3332 | Ga0495610_0002306 | |||
| 3333 | Ga0495610_0009518 | |||
| 3334 | Ga0495616_0003449 | |||
| 3335 | Ga0495616_0006594 | |||
| 3336 | Ga0495618_0016132 | |||
| 3337 | Ga0495628_0216836 | |||
| 3338 | Ga0495630_0017644 | |||
| 3339 | Ga0495630_0042346 | |||
| 3340 | Ga0495631_0006431 | |||
| 3341 | Ga0495632_0025276 | |||
| 3342 | Ga0495637_0048334 | |||
| 3343 | Ga0495644_0004653 | |||
| 3344 | Ga0495648_0013944 | |||
| 3345 | Ga0495648_0048233 | |||
| 3346 | Ga0495648_0067829 | |||
| 3347 | Ga0495663_0072881 | |||
| 3348 | Ga0495652_0326599 | |||
| 3349 | Ga0495654_0030700 | |||
| 3350 | Ga0495654_0076653 | |||
| 3351 | Ga0495640_0220929 | |||
| 3352 | Ga0495586_0034603 | |||
| 3353 | Ga0495587_0023448 | |||
| 3354 | Ga0495587_0119968 | |||
| 3355 | Ga0495609_0004780 | |||
| 3356 | Ga0495609_0028955 | |||
| 3357 | Ga0495609_0031055 | |||
| 3358 | Ga0495633_0000389 | |||
| 3359 | Ga0495633_0011583 | |||
| 3360 | Ga0495633_0021524 | |||
| 3361 | Ga0495667_0292027 | |||
| 3362 | Ga0495668_0000009 | |||
| 3363 | Ga0495668_0000121 | |||
| 3364 | Ga0495668_0001043 | |||
| 3365 | Ga0495634_0030005 | |||
| 3366 | Ga0495634_0085542 | |||
| 3367 | Ga0495625_0000131 | |||
| 3368 | Ga0495625_0000951 | |||
| 3369 | Ga0495625_0001562 | |||
| 3370 | Ga0495625_0012472 | |||
| 3371 | Ga0495625_0016203 | |||
| 3372 | Ga0495625_0023966 | |||
| 3373 | Ga0495625_0028787 | |||
| 3374 | Ga0495625_0047135 | |||
| 3375 | Ga0495635_0217823 | |||
| 3376 | Ga0495661_0018305 | |||
| 3377 | Ga0495647_0067788 | |||
| 3378 | Ga0495658_0048820 | |||
| 3379 | Ga0495658_0112207 | |||
| 3380 | Ga0495658_0127114 | |||
| 3381 | Ga0495669_0092746 | |||
| 3382 | Ga0495613_0275641 | |||
| 3383 | Ga0495613_0309616 | |||
| 3384 | Ga0495670_0010108 | |||
| 3385 | Ga0495670_0075781 | |||
| 3386 | Ga0495671_0147908 | |||
| 3387 | Ga0495649_0000009 | |||
| 3388 | Ga0495600_0048821 | |||
| 3389 | Ga0495660_0006541 | |||
| 3390 | Ga0495660_0164436 | |||
| 3391 | Ga0495672_0073342 | |||
| 3392 | Ga0495680_0050171 | |||
| 3393 | Ga0495683_0041431 | |||
| 3394 | Ga0495687_001889 | |||
| 3395 | Ga0495687_004330 | |||
| 3396 | Ga0495684_0162552 | |||
| 3397 | Ga0495686_0000005 | |||
| 3398 | Ga0495686_0000365 | |||
| 3399 | Ga0495686_0000843 | |||
| 3400 | Ga0495686_0000973 | |||
| 3401 | Ga0495686_0008772 | |||
| 3402 | Ga0495686_0010545 | |||
| 3403 | Ga0495686_0015477 | |||
| 3404 | Ga0495686_0064154 | |||
| 3405 | Ga0495686_0266028 | |||
| 3406 | Ga0495602_0102640 | |||
| 3407 | Ga0496101_0399871 | |||
| 3408 | Ga0496104_0324376 | |||
| 3409 | Ga0496108_0106115 | |||
| 3410 | Ga0496108_0111916 | |||
| 3411 | Ga0496110_0065825 | |||
| 3412 | Ga0496113_0233418 | |||
| 3413 | Ga0496114_0078693 | |||
| 3414 | Ga0496114_0118899 | |||
| 3415 | Ga0496122_0000869 | |||
| 3416 | Ga0496123_0004125 | |||
| 3417 | Ga0496124_0021144 | |||
| 3418 | Ga0496124_0029360 | |||
| 3419 | Ga0496125_0134431 | |||
| 3420 | Ga0496126_0207146 | |||
| 3421 | Ga0495678_004234 | |||
| 3422 | Ga0495678_007273 | |||
| 3423 | Ga0495682_0039100 | |||
| 3424 | Ga0501291_016456 | |||
| 3425 | Ga0501312_003267 | |||
| 3426 | Ga0501335_007048 | |||
| 3427 | Ga0501031_0015181 | |||
| 3428 | Ga0501031_0031393 | |||
| 3429 | Ga0501031_0236319 | |||
| 3430 | Ga0501032_0000817 | |||
| 3431 | Ga0501032_0002512 | |||
| 3432 | Ga0501032_0002569 | |||
| 3433 | Ga0501032_0169165 | |||
| 3434 | Ga0501032_0288523 | |||
| 3435 | Ga0501033_0000004 | |||
| 3436 | Ga0501033_0071834 | |||
| 3437 | Ga0501033_0135840 | |||
| 3438 | Ga0501034_0000709 | |||
| 3439 | Ga0501034_0009937 | |||
| 3440 | Ga0501034_0017803 | |||
| 3441 | Ga0501034_0021380 | |||
| 3442 | Ga0501034_0023872 | |||
| 3443 | Ga0501034_0060569 | |||
| 3444 | Ga0501034_0064590 | |||
| 3445 | Ga0501034_0176773 | |||
| 3446 | Ga0501034_0190011 | |||
| 3447 | Ga0501036_0001790 | |||
| 3448 | Ga0501036_0003646 | |||
| 3449 | Ga0501036_0027902 | |||
| 3450 | Ga0501036_0317033 | |||
| 3451 | Ga0501037_0003854 | |||
| 3452 | Ga0501037_0006833 | |||
| 3453 | Ga0501037_0050842 | |||
| 3454 | Ga0501037_0138878 | |||
| 3455 | Ga0501038_0010410 | |||
| 3456 | Ga0501038_0011039 | |||
| 3457 | Ga0501038_0017411 | |||
| 3458 | Ga0501038_0069951 | |||
| 3459 | Ga0501038_0221080 | |||
| 3460 | Ga0501038_0449725 | |||
| 3461 | Ga0501039_0000948 | |||
| 3462 | Ga0501039_0005375 | |||
| 3463 | Ga0501039_0152770 | |||
| 3464 | Ga0501043_0000465 | |||
| 3465 | Ga0501043_0030261 | |||
| 3466 | Ga0501043_0030395 | |||
| 3467 | Ga0501043_0033741 | |||
| 3468 | Ga0501043_0043756 | |||
| 3469 | Ga0501043_0100396 | |||
| 3470 | Ga0501046_0002298 | |||
| 3471 | Ga0501046_0043520 | |||
| 3472 | Ga0501046_0173032 | |||
| 3473 | Ga0501047_0004399 | |||
| 3474 | Ga0501047_0007344 | |||
| 3475 | Ga0501047_0050199 | |||
| 3476 | Ga0501047_0059951 | |||
| 3477 | Ga0501047_0154927 | |||
| 3478 | Ga0501047_0161178 | |||
| 3479 | Ga0501048_0293929 | |||
| 3480 | Ga0501067_0022764 | |||
| 3481 | Ga0501067_0024112 | |||
| 3482 | Ga0501069_0179676 | |||
| 3483 | Ga0501070_0005280 | |||
| 3484 | Ga0501070_0026373 | |||
| 3485 | Ga0501070_0030351 | |||
| 3486 | Ga0501071_0138288 | |||
| 3487 | Ga0501072_0154798 | |||
| 3488 | Ga0501073_0001470 | |||
| 3489 | Ga0501073_0010241 | |||
| 3490 | Ga0501074_0000494 | |||
| 3491 | Ga0501074_0068923 | |||
| 3492 | Ga0501223_000671 | |||
| 3493 | Ga0501250_004252 | |||
| 3494 | Ga0501252_001538 | |||
| 3495 | Ga0501257_018556 | |||
| 3496 | Ga0501219_000429 | |||
| 3497 | Ga0501225_0045419 | |||
| 3498 | Ga0501079_0108510 | |||
| 3499 | Ga0501080_0048629 | |||
| 3500 | Ga0501080_0051600 | |||
| 3501 | Ga0501080_0081953 | |||
| 3502 | Ga0501080_0163918 | |||
| 3503 | Ga0501080_0550579 | |||
| 3504 | Ga0501083_0004351 | |||
| 3505 | Ga0501083_0043155 | |||
| 3506 | Ga0501241_010045 | |||
| 3507 | Ga0501270_015694 | |||
| 3508 | Ga0501035_0002001 | |||
| 3509 | Ga0501035_0012389 | |||
| 3510 | Ga0501035_0081321 | |||
| 3511 | Ga0501035_0088522 | |||
| 3512 | Ga0501035_0122658 | |||
| 3513 | Ga0501035_0212910 | |||
| 3514 | Ga0501035_0223392 | |||
| 3515 | Ga0501044_0001393 | |||
| 3516 | Ga0501044_0007592 | |||
| 3517 | Ga0501044_0012072 | |||
| 3518 | Ga0501044_0012302 | |||
| 3519 | Ga0501044_0015990 | |||
| 3520 | Ga0501044_0074210 | |||
| 3521 | Ga0501044_0077143 | |||
| 3522 | Ga0501044_0091250 | |||
| 3523 | Ga0501044_0332222 | |||
| 3524 | Ga0501045_0000121 | |||
| 3525 | Ga0501284_00002 | |||
| 3526 | nmdc:mga0k408_111640_c1 | |||
| 3527 | nmdc:mga0k408_16428_c1 | |||
| 3528 | nmdc:mga0k408_16961_c1 | |||
| 3529 | nmdc:mga0k408_17298_c2 | |||
| 3530 | nmdc:mga0k408_1783_c1 | |||
| 3531 | nmdc:mga0k408_2480_c1 | |||
| 3532 | nmdc:mga0k408_803_c1 | |||
| 3533 | nmdc:mga05p37_1790_c1 | |||
| 3534 | nmdc:mga05p37_192611_c1 | |||
| 3535 | nmdc:mga09592_17522_c1 | |||
| 3536 | nmdc:mga09592_226044_c1 | |||
| 3537 | nmdc:mga09592_260887_c1 | |||
| 3538 | nmdc:mga09592_2958_c1 | |||
| 3539 | nmdc:mga09592_403000_c1 | |||
| 3540 | nmdc:mga0qj67_34856_c1 | |||
| 3541 | nmdc:mga0qj67_87151_c1 | |||
| 3542 | nmdc:mga06r32_662613_c1 | |||
| 3543 | nmdc:mga06r32_714193_c1 | |||
| 3544 | nmdc:mga06r32_8304_c1 | |||
| 3545 | nmdc:mga08y16_314925_c1 | |||
| 3546 | nmdc:mga08y16_71119_c1 | |||
| 3547 | nmdc:mga08y16_7939_c1 | |||
| 3548 | nmdc:mga0n895_108422_c1 | |||
| 3549 | Ga0500578_0000063 | |||
| 3550 | Ga0500578_0036846 | |||
| 3551 | Ga0500644_0005907 | |||
| 3552 | Ga0500644_0097116 | |||
| 3553 | Ga0500646_0001109 | |||
| 3554 | Ga0500583_0000076 | |||
| 3555 | Ga0500583_0074734 | |||
| 3556 | Ga0500651_0000455 | |||
| 3557 | Ga0500651_0097400 | |||
| 3558 | Ga0500651_0211007 | |||
| 3559 | Ga0500651_0240862 | |||
| 3560 | Ga0500650_0017765 | |||
| 3561 | Ga0500650_0246764 | |||
| 3562 | Ga0500555_007087 | |||
| 3563 | Ga0500556_0082967 | |||
| 3564 | Ga0500562_000013 | |||
| 3565 | Ga0500569_002068 | |||
| 3566 | Ga0500594_0003368 | |||
| 3567 | Ga0500608_001288 | |||
| 3568 | Ga0500614_018600 | |||
| 3569 | Ga0500618_000012 | |||
| 3570 | Ga0500618_004252 | |||
| 3571 | Ga0500618_024837 | |||
| 3572 | Ga0500642_0014246 | |||
| 3573 | Ga0500652_002332 | |||
| 3574 | Ga0500658_0045976 | |||
| 3575 | Ga0500658_0086335 | |||
| 3576 | Ga0500559_0014490 | |||
| 3577 | Ga0500561_0014213 | |||
| 3578 | Ga0500568_0000080 | |||
| 3579 | Ga0500573_0060852 | |||
| 3580 | Ga0500577_0015622 | |||
| 3581 | Ga0500588_0005030 | |||
| 3582 | Ga0500588_0155901 | |||
| 3583 | Ga0500589_149285 | |||
| 3584 | Ga0500604_0014652 | |||
| 3585 | Ga0500616_0029782 | |||
| 3586 | Ga0500616_0045449 | |||
| 3587 | Ga0500616_0077228 | |||
| 3588 | Ga0500616_0134940 | |||
| 3589 | Ga0500622_0000005 | |||
| 3590 | Ga0500622_0000242 | |||
| 3591 | Ga0500622_0000838 | |||
| 3592 | Ga0500622_0133575 | |||
| 3593 | Ga0500622_0135983 | |||
| 3594 | Ga0500624_000118 | |||
| 3595 | Ga0500633_0002655 | |||
| 3596 | Ga0500636_0184278 | |||
| 3597 | Ga0500636_0219123 | |||
| 3598 | Ga0500637_0052899 | |||
| 3599 | Ga0500611_000060 | |||
| 3600 | Ga0500645_007254 | |||
| 3601 | Ga0501084_0003712 | |||
| 3602 | Ga0587130_000922 | |||
| 3603 | Ga0501082_0018747 | |||
| 3604 | Ga0466962_0013263 | |||
| 3605 | 2522553646 | |||
| 3606 | 2586206295 | |||
| 3607 | 2599480397 | |||
| 3608 | 2738725593 | |||
| 3609 | 2738726804 | |||
| 3610 | 2738755417 | |||
| 3611 | 2738763528 | |||
| 3612 | 2738856156 | |||
| 3613 | 2739303250 | |||
| 3614 | 2739588283 | |||
| 3615 | 2739613944 | |||
| 3616 | 2739648559 | |||
| 3617 | 2776615034 | |||
| 3618 | 2819546261 | |||
| 3619 | 2819585683 | |||
| 3620 | 2840678479 | |||
| 3621 | 2842723910 | |||
| 3622 | 2842908811 | |||
| 3623 | 2842912358 | |||
| 3624 | 2849282791 | |||
| 3625 | 2852624814 | |||
| 3626 | 2852629509 | |||
| 3627 | 2857629299 | |||
| 3628 | 2883071396 | |||
| 3629 | 2884936304 | |||
| 3630 | 2895501071 | |||
| 3631 | 2896086297 | |||
| 3632 | 2902049882 | |||
| 3633 | 2904446532 | |||
| 3634 | 2911143537 | |||
| 3635 | 2914762857 | |||
| 3636 | 2919190268 | |||
| 3637 | 2919438299 | |||
| 3638 | 2928083362 | |||
| 3639 | 2928151376 | |||
| 3640 | 2929159591 | |||
| 3641 | 2932087293 | |||
| 3642 | 2939668549 | |||
| 3643 | 2945999344 | |||
| 3644 | 2954021742 | |||
| 3645 | 2977232945 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5jd6-assembly1.cif.gz_A | crystal structure of mgs-mche2, an alpha/beta hydrolase enzyme from the metagenome of sediments from the lagoon of mar chica, morocco | 0.9526 | 4 | 250 |
| 5jd6-assembly1.cif.gz_A | crystal structure of mgs-mche2, an alpha/beta hydrolase enzyme from the metagenome of sediments from the lagoon of mar chica, morocco | 0.9316 | 4 | 250 |
| 1iun-assembly1.cif.gz_B | meta-cleavage product hydrolase from pseudomonas fluorescens ip01 (cumd) s103a mutant hexagonal | 0.8825 | 3 | 250 |
| 4lyd-assembly1.cif.gz_A-2 | crystal structure of the s105a mutant of a c-c hydrolase, dxnb2 from sphingomonas wittichii rw1 | 0.8717 | 2 | 249 |
| 2d0d-assembly1.cif.gz_A-2 | crystal structure of a meta-cleavage product hydrolase (cumd) a129v mutant | 0.8686 | 3 | 250 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5jd6A00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.9526 | 4 | 250 | 3.40.50.1820 |
| 5jd6A00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.9316 | 4 | 250 | 3.40.50.1820 |
| af_A0A0P0WIT7_2_163_3.40.50.1820 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.8875 | 13 | 122 | 3.40.50.1820 |
| 1iunA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.8758 | 4 | 250 | 3.40.50.1820 |
| af_I1NID8_70_391_3.40.50.1820 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.8709 | 11 | 248 | 3.40.50.1820 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1Z8QAR2-F1-model_v4 | deleted | 0.9843 | 4 | 250 |
|
| AF-A0A4Q3EN68-F1-model_v4 | Alpha/beta hydrolase | 0.9771 | 128 | 251 |
GO:0016020
GO:0016787 |
| AF-A0A1Z8QAR2-F1-model_v4 | deleted | 0.9764 | 4 | 250 |
|
| AF-A0A7Y2ES60-F1-model_v4 | Alpha/beta hydrolase | 0.9737 | 1 | 251 |
GO:0016020
GO:0046464 GO:0047372 |
| AF-A0A368D063-F1-model_v4 | Alpha/beta fold hydrolase | 0.9708 | 2 | 250 |
GO:0016020
GO:0046464 GO:0047372 |