F495872

General Info

Members Datasets Scaffolds Average Seq Length
1843 535 1843 100

Family's Representative Sequence

Representative Sequence 3300048915|Ga0496112_0606487|Ga0496112_0606487_308_607
Length 99
Sequence VSRSVKKGPFVEDSLKKKIETLNSRNEKKVVKTWSRPSVILPIMVGHTIAVHDGRRHVPVFITENMVGHRLGEFAATRTFKGHGRGAAAETATTVKAGA

Samples

Sample ID Description Type Environment
1 3300003371 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM Metagenome Rhizosphere
2 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
22 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
35 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
36 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
37 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
38 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
39 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
40 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
41 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
42 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
43 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
44 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
45 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
46 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
47 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
48 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
49 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
50 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
51 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
52 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
53 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
54 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
55 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
56 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
57 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
58 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
59 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
60 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
61 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
62 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
63 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
64 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
65 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
66 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
67 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
68 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
69 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
70 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
71 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
72 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
73 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
74 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
75 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
76 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
77 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
78 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
79 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
80 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
81 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
82 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
83 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
84 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
85 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
86 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
87 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
88 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
89 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
90 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
91 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
92 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
93 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
94 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
95 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
96 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
97 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
98 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
99 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
100 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
101 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
102 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
103 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
104 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
105 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
106 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
107 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
108 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
109 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
110 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
111 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
112 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
113 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
114 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
115 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
116 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
117 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
118 3300012482 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.130510 Metagenome Rhizosphere
119 3300012494 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 Metagenome Rhizosphere
120 3300012495 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 Metagenome Rhizosphere
121 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
122 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
123 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
124 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
125 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
126 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
127 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
128 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
129 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
130 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
131 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
132 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
133 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
134 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
135 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
136 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
137 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
138 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
139 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
140 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
141 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
142 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
143 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
144 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
211 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
212 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
213 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
214 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
215 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
216 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
217 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
218 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
219 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
220 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
221 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
222 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
223 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
224 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
225 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
229 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
230 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
231 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
232 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
233 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
234 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
235 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
236 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
237 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
238 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
239 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
240 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
241 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
242 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
243 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
244 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
245 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
246 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
247 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
248 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
249 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
250 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
251 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
252 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
253 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
254 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
255 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
256 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
257 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
258 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
259 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
260 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
261 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
262 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
263 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
264 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
265 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
266 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
267 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
268 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
269 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
270 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
271 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
272 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
273 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
274 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
275 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
276 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
277 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
278 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
279 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
280 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
281 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
282 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
283 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
284 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
285 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
286 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
287 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
288 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
289 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
290 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
291 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
292 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
293 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
294 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
295 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
296 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
297 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
298 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
299 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
300 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
301 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
302 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
303 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
304 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
305 3300038698 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot15 Metagenome Rhizosphere
306 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
307 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
308 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
309 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
310 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
311 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
312 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
313 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
314 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
315 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
316 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
317 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
318 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
319 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
320 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
321 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
322 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
323 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
324 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
325 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
326 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
327 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
328 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
329 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
330 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
331 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
332 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
333 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
334 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
335 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
336 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
337 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
338 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
339 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
340 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
341 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
342 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
343 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
344 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
345 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
346 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
347 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
348 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
349 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
350 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
351 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
352 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
353 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
354 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
355 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
356 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
357 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
358 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
359 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
360 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
361 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
362 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
363 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
364 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
365 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
366 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
367 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
368 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
369 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
370 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
371 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
372 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
373 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
374 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
375 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
376 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
377 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
378 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
379 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
380 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
381 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
382 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
383 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
384 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
385 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
386 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
387 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
388 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
389 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
390 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
391 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
392 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
393 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
394 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
395 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
396 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
397 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
398 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
399 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
400 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
401 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
402 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
403 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
404 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
405 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
406 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
407 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
408 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
409 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
410 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
411 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
412 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
413 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
414 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
415 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
416 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
417 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
418 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
419 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
420 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
421 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
422 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
423 3300049526 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control Metagenome Rhizosphere
424 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
425 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
426 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
427 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
428 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
429 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
430 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
431 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
432 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
433 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
434 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
435 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
436 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
437 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
438 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
439 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
440 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
441 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
442 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
443 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
444 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
445 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
446 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
447 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
448 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
449 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
450 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
451 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
452 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
453 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
454 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
455 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
456 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
457 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
458 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
459 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
460 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
461 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
462 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
463 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
464 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
465 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
466 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
467 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
468 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
469 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
470 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
471 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
472 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
473 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
474 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
475 3300049685 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control Metagenome Rhizosphere
476 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
477 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
478 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
479 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
480 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
481 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
482 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
483 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
484 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
485 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
486 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
487 3300049757 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control Metagenome Rhizosphere
488 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
489 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
490 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
491 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
492 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
493 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
494 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
495 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
496 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
497 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
498 3300049771 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control Metagenome Rhizosphere
499 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
500 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
501 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
502 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
503 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
504 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
505 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
506 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
507 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
508 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
509 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
510 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
511 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
512 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
513 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
514 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
515 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
516 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
517 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
518 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
519 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
520 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
521 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
522 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
523 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
524 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
525 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
526 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
527 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
528 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
529 3300059625 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 151R_CD_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
530 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
531 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
532 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
533 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
534 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
535 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.21
Metatranscriptomes 1.79
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.15
Rhizosphere 95.98
Stem 0
Stem Tuber 0
Unclassified 0.87

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI26145J50221_1006158 3300003371 Bacteria 1002
2 Ga0058863_10086968 3300004799 Bacteria 3231
3 Ga0058861_11789312 3300004800 Bacteria 647
4 Ga0058862_12643353 3300004803 Bacteria 986
5 Ga0065712_10074846 3300005290 Bacteria 3994
6 Ga0065712_10439994 3300005290 Bacteria 695
7 Ga0065712_10815210 3300005290 Bacteria 505
8 Ga0065715_10057212 3300005293 Bacteria 946
9 Ga0065715_10116004 3300005293 Bacteria 2395
10 Ga0065715_10299813 3300005293 Bacteria 1044
11 Ga0065715_10811487 3300005293 Bacteria 606
12 Ga0065707_10432448 3300005295 Bacteria 819
13 Ga0065707_10717645 3300005295 Bacteria 608
14 Ga0070658_10171352 3300005327 Bacteria 1823
15 Ga0070658_10561985 3300005327 Bacteria 987
16 Ga0070658_11648416 3300005327 Bacteria 555
17 Ga0070658_11812599 3300005327 Bacteria 528
18 Ga0070676_10010363 3300005328 Bacteria 5055
19 Ga0070676_10089561 3300005328 Bacteria 1882
20 Ga0070676_10624397 3300005328 Bacteria 779
21 Ga0070683_100003340 3300005329 Bacteria 12981
22 Ga0070683_100058071 3300005329 Bacteria 3595
23 Ga0070683_100071412 3300005329 Bacteria 3239
24 Ga0070683_100366719 3300005329 Bacteria 1372
25 Ga0070683_100862286 3300005329 Bacteria 868
26 Ga0070683_100935969 3300005329 Bacteria 831
27 Ga0070683_101036957 3300005329 Bacteria 788
28 Ga0070683_101164768 3300005329 Bacteria 741
29 Ga0070683_101170690 3300005329 Bacteria 739
30 Ga0070690_100021133 3300005330 Bacteria 3971
31 Ga0070690_100086374 3300005330 Bacteria 2059
32 Ga0070690_100216988 3300005330 Bacteria 1338
33 Ga0070670_100240332 3300005331 Bacteria 1577
34 Ga0070670_100322579 3300005331 Bacteria 1353
35 Ga0070670_100727273 3300005331 Bacteria 893
36 Ga0070670_100806131 3300005331 Bacteria 848
37 Ga0070677_10078225 3300005333 Bacteria 1409
38 Ga0070677_10528114 3300005333 Bacteria 644
39 Ga0068869_100874259 3300005334 Bacteria 776
40 Ga0068869_100892987 3300005334 Bacteria 769
41 Ga0068869_100907740 3300005334 Bacteria 763
42 Ga0068869_100984090 3300005334 Bacteria 734
43 Ga0068869_100984138 3300005334 Bacteria 734
44 Ga0070666_10093653 3300005335 Bacteria 2065
45 Ga0070666_10215569 3300005335 Bacteria 1353
46 Ga0070666_10327378 3300005335 Bacteria 1094
47 Ga0070666_10847074 3300005335 Bacteria 674
48 Ga0070680_100003421 3300005336 Bacteria 11843
49 Ga0070680_100011604 3300005336 Bacteria 6824
50 Ga0070680_100048050 3300005336 Bacteria 3477
51 Ga0070680_100103171 3300005336 Bacteria 2369
52 Ga0070680_100119665 3300005336 Bacteria 2197
53 Ga0070680_100156870 3300005336 Bacteria 1912
54 Ga0070680_100163795 3300005336 Bacteria 1869
55 Ga0070680_100321809 3300005336 Bacteria 1313
56 Ga0070680_100369443 3300005336 Bacteria 1220
57 Ga0070680_100464968 3300005336 Bacteria 1081
58 Ga0070680_100466058 3300005336 Bacteria 1079
59 Ga0070680_101315673 3300005336 Bacteria 625
60 Ga0070682_100029919 3300005337 Bacteria 3282
61 Ga0070682_100060558 3300005337 Bacteria 2394
62 Ga0070682_100203345 3300005337 Bacteria 1398
63 Ga0070682_100307437 3300005337 Bacteria 1166
64 Ga0070682_100309796 3300005337 Bacteria 1162
65 Ga0070682_101120793 3300005337 Bacteria 660
66 Ga0068868_100013085 3300005338 Bacteria 6075
67 Ga0068868_100141727 3300005338 Bacteria 1973
68 Ga0068868_100320488 3300005338 Bacteria 1320
69 Ga0068868_100783022 3300005338 Bacteria 859
70 Ga0068868_101742480 3300005338 Bacteria 588
71 Ga0070660_100100995 3300005339 Bacteria 2285
72 Ga0070660_100250698 3300005339 Bacteria 1444
73 Ga0070660_100293209 3300005339 Bacteria 1332
74 Ga0070660_101042557 3300005339 Bacteria 691
75 Ga0070660_101050711 3300005339 Bacteria 689
76 Ga0070660_101184695 3300005339 Bacteria 647
77 Ga0070689_100012783 3300005340 Bacteria 6060
78 Ga0070689_100031628 3300005340 Bacteria 4023
79 Ga0070689_100038522 3300005340 Bacteria 3658
80 Ga0070689_100118383 3300005340 Bacteria 2113
81 Ga0070689_101465145 3300005340 Bacteria 618
82 Ga0070691_10028966 3300005341 Bacteria 2590
83 Ga0070691_10186317 3300005341 Bacteria 1083
84 Ga0070691_10272178 3300005341 Bacteria 916
85 Ga0070687_100018908 3300005343 Bacteria 3196
86 Ga0070687_100038862 3300005343 Bacteria 2388
87 Ga0070687_100623865 3300005343 Bacteria 744
88 Ga0070661_100028453 3300005344 Bacteria 4031
89 Ga0070661_100029610 3300005344 Bacteria 3952
90 Ga0070661_100034455 3300005344 Bacteria 3671
91 Ga0070661_100323146 3300005344 Bacteria 1205
92 Ga0070661_100383300 3300005344 Bacteria 1109
93 Ga0070661_100459024 3300005344 Bacteria 1014
94 Ga0070661_100512303 3300005344 Bacteria 961
95 Ga0070661_101477934 3300005344 Bacteria 573
96 Ga0070661_101593807 3300005344 Bacteria 552
97 Ga0070661_101786665 3300005344 Bacteria 522
98 Ga0070692_10085682 3300005345 Bacteria 1704
99 Ga0070692_10152386 3300005345 Bacteria 1318
100 Ga0070692_10236677 3300005345 Bacteria 1086
101 Ga0070692_10595750 3300005345 Bacteria 730
102 Ga0070692_11148700 3300005345 Bacteria 551
103 Ga0070668_100254925 3300005347 Bacteria 1457
104 Ga0070668_100802060 3300005347 Bacteria 836
105 Ga0070668_101483884 3300005347 Bacteria 620
106 Ga0070669_100025980 3300005353 Bacteria 4211
107 Ga0070669_100182704 3300005353 Bacteria 1641
108 Ga0070669_100218637 3300005353 Bacteria 1506
109 Ga0070669_100571542 3300005353 Bacteria 944
110 Ga0070675_100303016 3300005354 Bacteria 1408
111 Ga0070675_100374469 3300005354 Bacteria 1266
112 Ga0070675_101472671 3300005354 Bacteria 628
113 Ga0070675_101610651 3300005354 Bacteria 599
114 Ga0070675_101702594 3300005354 Bacteria 582
115 Ga0070671_100079081 3300005355 Bacteria 2748
116 Ga0070671_100159410 3300005355 Bacteria 1907
117 Ga0070671_100181105 3300005355 Bacteria 1784
118 Ga0070671_101392007 3300005355 Bacteria 620
119 Ga0070671_101835633 3300005355 Bacteria 539
120 Ga0070674_100075414 3300005356 Bacteria 2395
121 Ga0070674_101764079 3300005356 Bacteria 561
122 Ga0070674_101938091 3300005356 Bacteria 536
123 Ga0070673_100003685 3300005364 Bacteria 9600
124 Ga0070673_100024226 3300005364 Bacteria 4447
125 Ga0070673_100153788 3300005364 Bacteria 1950
126 Ga0070673_100499084 3300005364 Bacteria 1100
127 Ga0070673_102163037 3300005364 Bacteria 529
128 Ga0070688_100024866 3300005365 Bacteria 3539
129 Ga0070688_100028355 3300005365 Bacteria 3341
130 Ga0070688_100394857 3300005365 Bacteria 1022
131 Ga0070659_100058242 3300005366 Bacteria 3048
132 Ga0070659_100108977 3300005366 Bacteria 2234
133 Ga0070659_100116694 3300005366 Bacteria 2158
134 Ga0070659_100245326 3300005366 Bacteria 1483
135 Ga0070659_100601719 3300005366 Bacteria 945
136 Ga0070659_100915992 3300005366 Bacteria 767
137 Ga0070659_101134747 3300005366 Bacteria 690
138 Ga0070659_101444930 3300005366 Bacteria 612
139 Ga0070667_100043630 3300005367 Bacteria 3764
140 Ga0070667_100093065 3300005367 Bacteria 2595
141 Ga0070667_100611410 3300005367 Bacteria 1005
142 Ga0070703_10122590 3300005406 Bacteria 945
143 Ga0070709_10006385 3300005434 Bacteria 6421
144 Ga0070709_10036785 3300005434 Bacteria 2985
145 Ga0070709_10171398 3300005434 Bacteria 1517
146 Ga0070714_100000411 3300005435 Bacteria 31485
147 Ga0070714_100139880 3300005435 Bacteria 2171
148 Ga0070714_100462329 3300005435 Bacteria 1206
149 Ga0070714_100710189 3300005435 Bacteria 970
150 Ga0070713_100065550 3300005436 Bacteria 3051
151 Ga0070713_100583856 3300005436 Bacteria 1060
152 Ga0070713_101027119 3300005436 Bacteria 796
153 Ga0070713_101642690 3300005436 Bacteria 624
154 Ga0070710_10128761 3300005437 Bacteria 1541
155 Ga0070701_10062320 3300005438 Bacteria 1969
156 Ga0070701_10624172 3300005438 Bacteria 716
157 Ga0070711_100034546 3300005439 Bacteria 3373
158 Ga0070711_100079312 3300005439 Bacteria 2335
159 Ga0070705_100020535 3300005440 Bacteria 3499
160 Ga0070705_100090555 3300005440 Bacteria 1904
161 Ga0070705_100169323 3300005440 Bacteria 1469
162 Ga0070705_101704231 3300005440 Bacteria 533
163 Ga0070700_100195386 3300005441 Bacteria 1417
164 Ga0070700_101012060 3300005441 Bacteria 684
165 Ga0070694_100555824 3300005444 Bacteria 919
166 Ga0070694_100825210 3300005444 Bacteria 761
167 Ga0070694_100977120 3300005444 Bacteria 702
168 Ga0070694_101097517 3300005444 Bacteria 664
169 Ga0070708_100001661 3300005445 Bacteria 17067
170 Ga0070708_100003800 3300005445 Bacteria 11845
171 Ga0070708_100018839 3300005445 Bacteria 5782
172 Ga0070708_100020893 3300005445 Bacteria 5528
173 Ga0070708_100055604 3300005445 Bacteria 3519
174 Ga0070708_100335677 3300005445 Bacteria 1424
175 Ga0070708_100338186 3300005445 Bacteria 1418
176 Ga0070708_100366252 3300005445 Bacteria 1358
177 Ga0070708_101042104 3300005445 Bacteria 767
178 Ga0070708_101463714 3300005445 Bacteria 637
179 Ga0070663_100005346 3300005455 Bacteria 7621
180 Ga0070663_100094822 3300005455 Bacteria 2217
181 Ga0070663_100798646 3300005455 Bacteria 809
182 Ga0070663_101530009 3300005455 Bacteria 593
183 Ga0070678_100053888 3300005456 Bacteria 2927
184 Ga0070678_100352274 3300005456 Bacteria 1266
185 Ga0070662_100054587 3300005457 Bacteria 2896
186 Ga0070662_100198764 3300005457 Bacteria 1589
187 Ga0070662_100251955 3300005457 Bacteria 1420
188 Ga0070662_100452728 3300005457 Bacteria 1065
189 Ga0070662_100704165 3300005457 Bacteria 855
190 Ga0070681_10035181 3300005458 Bacteria 5031
191 Ga0070681_10044619 3300005458 Bacteria 4438
192 Ga0070681_10053922 3300005458 Bacteria 4006
193 Ga0070681_10078280 3300005458 Bacteria 3263
194 Ga0070681_10116033 3300005458 Bacteria 2615
195 Ga0070681_10160574 3300005458 Bacteria 2171
196 Ga0070681_10171280 3300005458 Bacteria 2093
197 Ga0070681_10225090 3300005458 Bacteria 1790
198 Ga0070681_10227553 3300005458 Bacteria 1779
199 Ga0070681_10415728 3300005458 Bacteria 1256
200 Ga0070681_10477193 3300005458 Bacteria 1160
201 Ga0070681_10498751 3300005458 Bacteria 1130
202 Ga0070681_10758644 3300005458 Bacteria 887
203 Ga0070681_11130055 3300005458 Bacteria 705
204 Ga0070681_11251139 3300005458 Bacteria 664
205 Ga0068867_100093589 3300005459 Bacteria 2284
206 Ga0068867_100262442 3300005459 Bacteria 1409
207 Ga0068867_100786095 3300005459 Bacteria 847
208 Ga0068867_101256728 3300005459 Bacteria 682
209 Ga0068867_101331788 3300005459 Bacteria 664
210 Ga0070685_10028108 3300005466 Bacteria 3114
211 Ga0070685_10117314 3300005466 Bacteria 1648
212 Ga0070685_10262680 3300005466 Bacteria 1149
213 Ga0070706_100006592 3300005467 Bacteria 10949
214 Ga0070706_100115208 3300005467 Bacteria 2503
215 Ga0070706_100171538 3300005467 Bacteria 2026
216 Ga0070706_100188726 3300005467 Bacteria 1926
217 Ga0070706_100354241 3300005467 Bacteria 1368
218 Ga0070706_100502739 3300005467 Bacteria 1128
219 Ga0070707_100016356 3300005468 Bacteria 6962
220 Ga0070707_100019047 3300005468 Bacteria 6463
221 Ga0070707_100198999 3300005468 Bacteria 1953
222 Ga0070707_100439225 3300005468 Bacteria 1265
223 Ga0070707_100939600 3300005468 Bacteria 829
224 Ga0070707_100948615 3300005468 Bacteria 825
225 Ga0070707_100995176 3300005468 Bacteria 804
226 Ga0070698_100001954 3300005471 Bacteria 22884
227 Ga0070698_100024253 3300005471 Bacteria 6330
228 Ga0070698_100030896 3300005471 Bacteria 5554
229 Ga0070698_100052230 3300005471 Bacteria 4160
230 Ga0070698_100466389 3300005471 Bacteria 1199
231 Ga0070698_102150056 3300005471 Bacteria 512
232 Ga0070699_100003912 3300005518 Bacteria 13158
233 Ga0070699_100071160 3300005518 Bacteria 3025
234 Ga0070699_100096501 3300005518 Bacteria 2589
235 Ga0070699_100243299 3300005518 Bacteria 1607
236 Ga0070699_100244307 3300005518 Bacteria 1603
237 Ga0070699_100314429 3300005518 Bacteria 1406
238 Ga0070699_100484652 3300005518 Bacteria 1122
239 Ga0070699_100864240 3300005518 Bacteria 828
240 Ga0070699_100922820 3300005518 Bacteria 800
241 Ga0070699_101175842 3300005518 Bacteria 704
242 Ga0070699_101184395 3300005518 Bacteria 701
243 Ga0070699_101192268 3300005518 Bacteria 698
244 Ga0070699_101674234 3300005518 Bacteria 583
245 Ga0070679_100014655 3300005530 Bacteria 7534
246 Ga0070679_100019482 3300005530 Bacteria 6597
247 Ga0070679_100045568 3300005530 Bacteria 4370
248 Ga0070679_100052627 3300005530 Bacteria 4054
249 Ga0070679_100091847 3300005530 Bacteria 3023
250 Ga0070679_100165137 3300005530 Bacteria 2187
251 Ga0070679_100243051 3300005530 Bacteria 1757
252 Ga0070679_100249770 3300005530 Bacteria 1730
253 Ga0070679_100321944 3300005530 Bacteria 1495
254 Ga0070679_100443075 3300005530 Bacteria 1243
255 Ga0070679_100609953 3300005530 Bacteria 1034
256 Ga0070684_100005718 3300005535 Bacteria 9552
257 Ga0070684_100041533 3300005535 Bacteria 3965
258 Ga0070684_100152966 3300005535 Bacteria 2091
259 Ga0070684_100172651 3300005535 Bacteria 1964
260 Ga0070684_100298128 3300005535 Bacteria 1479
261 Ga0070684_100349691 3300005535 Bacteria 1359
262 Ga0070684_100585927 3300005535 Bacteria 1036
263 Ga0070684_100611370 3300005535 Bacteria 1014
264 Ga0070684_100976783 3300005535 Bacteria 794
265 Ga0070684_101063874 3300005535 Bacteria 760
266 Ga0070697_100034669 3300005536 Bacteria 4070
267 Ga0070697_100159646 3300005536 Bacteria 1904
268 Ga0070697_100173667 3300005536 Bacteria 1825
269 Ga0070697_100255073 3300005536 Bacteria 1500
270 Ga0070697_100308839 3300005536 Bacteria 1360
271 Ga0070697_100352424 3300005536 Bacteria 1271
272 Ga0070697_101146138 3300005536 Bacteria 692
273 Ga0068853_100040762 3300005539 Bacteria 3963
274 Ga0068853_100176850 3300005539 Bacteria 1933
275 Ga0068853_100203663 3300005539 Bacteria 1801
276 Ga0068853_100246394 3300005539 Bacteria 1639
277 Ga0068853_100355905 3300005539 Bacteria 1363
278 Ga0068853_101652526 3300005539 Bacteria 621
279 Ga0070672_100038933 3300005543 Bacteria 3637
280 Ga0070672_100061495 3300005543 Bacteria 2960
281 Ga0070672_100079274 3300005543 Bacteria 2628
282 Ga0070672_100308147 3300005543 Bacteria 1343
283 Ga0070672_100322927 3300005543 Bacteria 1312
284 Ga0070672_102016100 3300005543 Bacteria 520
285 Ga0070686_100247099 3300005544 Bacteria 1301
286 Ga0070686_100365031 3300005544 Bacteria 1089
287 Ga0070686_100481563 3300005544 Bacteria 960
288 Ga0070695_100006011 3300005545 Bacteria 7165
289 Ga0070695_100006164 3300005545 Bacteria 7087
290 Ga0070695_100081722 3300005545 Bacteria 2139
291 Ga0070695_100210430 3300005545 Bacteria 1395
292 Ga0070695_100294995 3300005545 Bacteria 1196
293 Ga0070695_101000870 3300005545 Bacteria 680
294 Ga0070696_100014069 3300005546 Bacteria 5371
295 Ga0070696_100064301 3300005546 Bacteria 2570
296 Ga0070696_100199231 3300005546 Bacteria 1494
297 Ga0070696_100287300 3300005546 Bacteria 1255
298 Ga0070696_100345231 3300005546 Bacteria 1151
299 Ga0070696_100640509 3300005546 Bacteria 861
300 Ga0070696_100698752 3300005546 Bacteria 826
301 Ga0070696_101931493 3300005546 Bacteria 512
302 Ga0070693_100000799 3300005547 Bacteria 13905
303 Ga0070693_100133923 3300005547 Bacteria 1552
304 Ga0070693_100610723 3300005547 Bacteria 788
305 Ga0070693_100700302 3300005547 Bacteria 741
306 Ga0070693_100877039 3300005547 Bacteria 671
307 Ga0070665_100124547 3300005548 Bacteria 2579
308 Ga0070665_101359628 3300005548 Bacteria 720
309 Ga0070665_102322188 3300005548 Unclassified 539
310 Ga0070704_100129452 3300005549 Bacteria 1953
311 Ga0070704_100324442 3300005549 Bacteria 1291
312 Ga0070704_100337516 3300005549 Bacteria 1268
313 Ga0070704_100347075 3300005549 Bacteria 1252
314 Ga0070704_100529683 3300005549 Bacteria 1027
315 Ga0068855_100033387 3300005563 Bacteria 6141
316 Ga0068855_100389264 3300005563 Bacteria 1529
317 Ga0068855_100533266 3300005563 Bacteria 1272
318 Ga0068855_100817487 3300005563 Bacteria 989
319 Ga0068855_101726342 3300005563 Bacteria 638
320 Ga0068855_101906615 3300005563 Bacteria 602
321 Ga0070664_100008033 3300005564 Bacteria 8527
322 Ga0070664_100229505 3300005564 Bacteria 1664
323 Ga0070664_100276901 3300005564 Bacteria 1512
324 Ga0070664_100312256 3300005564 Bacteria 1423
325 Ga0070664_100385803 3300005564 Bacteria 1279
326 Ga0070664_100616820 3300005564 Bacteria 1007
327 Ga0070664_100678751 3300005564 Bacteria 959
328 Ga0070664_100738379 3300005564 Bacteria 918
329 Ga0070664_102173296 3300005564 Bacteria 527
330 Ga0068857_100009735 3300005577 Bacteria 8348
331 Ga0068857_100024265 3300005577 Bacteria 5337
332 Ga0068857_100205597 3300005577 Bacteria 1796
333 Ga0068857_100306504 3300005577 Bacteria 1464
334 Ga0068854_100008727 3300005578 Bacteria 6524
335 Ga0068854_100013720 3300005578 Bacteria 5325
336 Ga0068854_100069785 3300005578 Bacteria 2567
337 Ga0068854_100168844 3300005578 Bacteria 1701
338 Ga0068854_100999751 3300005578 Bacteria 740
339 Ga0068854_101564314 3300005578 Bacteria 600
340 Ga0068856_100073182 3300005614 Bacteria 3393
341 Ga0068856_100776822 3300005614 Bacteria 978
342 Ga0068856_100902275 3300005614 Bacteria 903
343 Ga0070702_100251803 3300005615 Bacteria 1198
344 Ga0070702_100499928 3300005615 Bacteria 893
345 Ga0070702_100565489 3300005615 Bacteria 847
346 Ga0070702_101245784 3300005615 Bacteria 602
347 Ga0070702_101297416 3300005615 Bacteria 591
348 Ga0068852_100026550 3300005616 Bacteria 4709
349 Ga0068852_100029132 3300005616 Bacteria 4530
350 Ga0068852_100241182 3300005616 Bacteria 1727
351 Ga0068852_100495111 3300005616 Bacteria 1216
352 Ga0068852_100622674 3300005616 Bacteria 1085
353 Ga0068852_101294854 3300005616 Bacteria 750
354 Ga0068852_102534548 3300005616 Bacteria 533
355 Ga0068859_100039441 3300005617 Bacteria 4737
356 Ga0068859_100216391 3300005617 Bacteria 2003
357 Ga0068859_100351569 3300005617 Bacteria 1569
358 Ga0068859_100624071 3300005617 Bacteria 1170
359 Ga0068859_100725038 3300005617 Unclassified 1084
360 Ga0068864_100207043 3300005618 Bacteria 1805
361 Ga0068864_100277387 3300005618 Bacteria 1563
362 Ga0068864_100736050 3300005618 Bacteria 965
363 Ga0068866_10025649 3300005718 Bacteria 2773
364 Ga0068866_10131416 3300005718 Bacteria 1424
365 Ga0068866_10854617 3300005718 Bacteria 637
366 Ga0068866_11036562 3300005718 Bacteria 585
367 Ga0068861_100234025 3300005719 Bacteria 1559
368 Ga0068861_100912461 3300005719 Bacteria 833
369 Ga0068851_10620593 3300005834 Bacteria 659
370 Ga0068870_10011998 3300005840 Bacteria 4034
371 Ga0068870_10270076 3300005840 Bacteria 1062
372 Ga0068870_10446384 3300005840 Bacteria 852
373 Ga0068863_100037716 3300005841 Bacteria 4599
374 Ga0068863_100119013 3300005841 Bacteria 2517
375 Ga0068863_100223270 3300005841 Bacteria 1816
376 Ga0068863_100276028 3300005841 Bacteria 1627
377 Ga0068863_100284520 3300005841 Bacteria 1602
378 Ga0068863_100525038 3300005841 Bacteria 1167
379 Ga0068863_101634340 3300005841 Bacteria 654
380 Ga0068863_102623373 3300005841 Bacteria 513
381 Ga0068858_100393383 3300005842 Bacteria 1331
382 Ga0068858_100400542 3300005842 Bacteria 1319
383 Ga0068858_101117216 3300005842 Bacteria 774
384 Ga0068858_101182529 3300005842 Bacteria 751
385 Ga0068860_100530559 3300005843 Bacteria 1178
386 Ga0068860_100708526 3300005843 Bacteria 1017
387 Ga0068862_100513910 3300005844 Bacteria 1139
388 Ga0068862_100624739 3300005844 Bacteria 1037
389 Ga0068862_101218995 3300005844 Bacteria 751
390 Ga0081455_10243169 3300005937 Bacteria 1321
391 Ga0081455_10245504 3300005937 Bacteria 1313
392 Ga0081538_10078237 3300005981 Bacteria 1776
393 Ga0081539_10023333 3300005985 Bacteria 4055
394 Ga0081539_10215463 3300005985 Bacteria 877
395 Ga0075432_10303059 3300006058 Bacteria 664
396 Ga0070715_10091235 3300006163 Bacteria 1402
397 Ga0070715_10614808 3300006163 Bacteria 639
398 Ga0070715_10781552 3300006163 Bacteria 578
399 Ga0070716_100014957 3300006173 Bacteria 3982
400 Ga0070716_100120125 3300006173 Bacteria 1644
401 Ga0070716_100185223 3300006173 Bacteria 1371
402 Ga0070712_100150856 3300006175 Bacteria 1784
403 Ga0070712_100602962 3300006175 Bacteria 930
404 Ga0070712_101180134 3300006175 Bacteria 666
405 Ga0097621_100072407 3300006237 Bacteria 2850
406 Ga0097621_100114591 3300006237 Bacteria 2281
407 Ga0097621_101288906 3300006237 Bacteria 690
408 Ga0068871_100188895 3300006358 Bacteria 1774
409 Ga0068871_100349234 3300006358 Bacteria 1308
410 Ga0068871_100524840 3300006358 Bacteria 1070
411 Ga0068871_100790188 3300006358 Unclassified 874
412 Ga0075428_100483856 3300006844 Bacteria 1325
413 Ga0075428_101106268 3300006844 Bacteria 837
414 Ga0075428_102713510 3300006844 Bacteria 505
415 Ga0075430_100388623 3300006846 Bacteria 1151
416 Ga0075430_101203605 3300006846 Bacteria 624
417 Ga0075431_100066106 3300006847 Bacteria 3732
418 Ga0075431_100132267 3300006847 Bacteria 2573
419 Ga0075431_100445223 3300006847 Bacteria 1292
420 Ga0075431_100446411 3300006847 Bacteria 1290
421 Ga0075431_100679135 3300006847 Bacteria 1009
422 Ga0075433_10014445 3300006852 Bacteria 6452
423 Ga0075433_10017586 3300006852 Bacteria 5928
424 Ga0075433_10048621 3300006852 Bacteria 3689
425 Ga0075433_10082656 3300006852 Bacteria 2832
426 Ga0075433_10453291 3300006852 Bacteria 1131
427 Ga0075433_10475033 3300006852 Bacteria 1101
428 Ga0075434_100039856 3300006871 Bacteria 4652
429 Ga0075434_100056118 3300006871 Bacteria 3914
430 Ga0075434_100293178 3300006871 Bacteria 1647
431 Ga0075434_100411482 3300006871 Bacteria 1373
432 Ga0075434_100623359 3300006871 Bacteria 1097
433 Ga0075434_100881444 3300006871 Bacteria 910
434 Ga0075429_100019213 3300006880 Bacteria 5920
435 Ga0075429_100181478 3300006880 Bacteria 1844
436 Ga0075429_100278121 3300006880 Bacteria 1466
437 Ga0075429_101064640 3300006880 Bacteria 707
438 Ga0068865_100094461 3300006881 Bacteria 2176
439 Ga0068865_100136783 3300006881 Bacteria 1842
440 Ga0068865_100273628 3300006881 Bacteria 1342
441 Ga0068865_100787660 3300006881 Bacteria 819
442 Ga0068865_100999212 3300006881 Bacteria 732
443 Ga0075436_100000105 3300006914 Bacteria 50007
444 Ga0075436_100011027 3300006914 Bacteria 6202
445 Ga0075436_100034048 3300006914 Bacteria 3511
446 Ga0075436_100145157 3300006914 Bacteria 1668
447 Ga0075436_100293565 3300006914 Bacteria 1164
448 Ga0075436_100506269 3300006914 Bacteria 884
449 Ga0097620_100039441 3300006931 Bacteria 4737
450 Ga0097620_100216397 3300006931 Bacteria 2003
451 Ga0097620_100351562 3300006931 Bacteria 1569
452 Ga0097620_100624048 3300006931 Bacteria 1170
453 Ga0097620_100725107 3300006931 Unclassified 1084
454 Ga0075435_100039577 3300007076 Bacteria 3762
455 Ga0075435_100093480 3300007076 Bacteria 2485
456 Ga0075435_100458431 3300007076 Bacteria 1100
457 Ga0075435_101173550 3300007076 Bacteria 672
458 Ga0075435_101207494 3300007076 Bacteria 662
459 Ga0075435_101501941 3300007076 Bacteria 591
460 Ga0099794_10232222 3300007265 Bacteria 949
461 Ga0099794_10235798 3300007265 Bacteria 942
462 Ga0099794_10805773 3300007265 Bacteria 502
463 Ga0099795_10031621 3300007788 Bacteria 1824
464 Ga0105240_10101231 3300009093 Bacteria 3505
465 Ga0105240_10106067 3300009093 Bacteria 3409
466 Ga0105240_10377512 3300009093 Bacteria 1601
467 Ga0105240_11405854 3300009093 Bacteria 733
468 Ga0105240_12715848 3300009093 Bacteria 510
469 Ga0111539_10250172 3300009094 Bacteria 2064
470 Ga0111539_10296278 3300009094 Bacteria 1882
471 Ga0111539_10875500 3300009094 Bacteria 1045
472 Ga0111539_12150536 3300009094 Bacteria 647
473 Ga0105245_10094704 3300009098 Bacteria 2753
474 Ga0105245_10155732 3300009098 Bacteria 2164
475 Ga0105245_10219981 3300009098 Bacteria 1832
476 Ga0105245_10429375 3300009098 Bacteria 1326
477 Ga0105245_10470338 3300009098 Bacteria 1269
478 Ga0105245_10564960 3300009098 Bacteria 1161
479 Ga0105245_11336780 3300009098 Bacteria 766
480 Ga0105245_11604509 3300009098 Bacteria 702
481 Ga0105247_10723337 3300009101 Bacteria 752
482 Ga0114129_10032671 3300009147 Bacteria 7353
483 Ga0114129_10074165 3300009147 Bacteria 4740
484 Ga0114129_10442964 3300009147 Bacteria 1705
485 Ga0114129_10603869 3300009147 Bacteria 1421
486 Ga0114129_10768010 3300009147 Bacteria 1232
487 Ga0114129_10794816 3300009147 Bacteria 1207
488 Ga0114129_10971514 3300009147 Bacteria 1071
489 Ga0105243_10345671 3300009148 Bacteria 1364
490 Ga0105243_10657686 3300009148 Bacteria 1016
491 Ga0105243_10911407 3300009148 Bacteria 875
492 Ga0105243_12099905 3300009148 Bacteria 601
493 Ga0105243_12447293 3300009148 Bacteria 561
494 Ga0105241_10146778 3300009174 Bacteria 1925
495 Ga0105241_10357475 3300009174 Bacteria 1270
496 Ga0105242_10149144 3300009176 Bacteria 2038
497 Ga0105242_11282820 3300009176 Bacteria 755
498 Ga0105248_10122714 3300009177 Bacteria 2931
499 Ga0105248_10322129 3300009177 Bacteria 1741
500 Ga0105248_10673931 3300009177 Bacteria 1167
501 Ga0105248_11222903 3300009177 Bacteria 849
502 Ga0105248_11563113 3300009177 Bacteria 747
503 Ga0105248_12130074 3300009177 Bacteria 638
504 Ga0105248_12276975 3300009177 Bacteria 617
505 Ga0105237_10688214 3300009545 Bacteria 1029
506 Ga0105237_11180422 3300009545 Bacteria 772
507 Ga0105238_10074647 3300009551 Bacteria 3383
508 Ga0105238_10911998 3300009551 Bacteria 897
509 Ga0105238_11817297 3300009551 Bacteria 641
510 Ga0105249_10747690 3300009553 Bacteria 1040
511 Ga0105249_10974948 3300009553 Bacteria 916
512 Ga0105239_10977094 3300010375 Bacteria 973
513 Ga0105239_11728858 3300010375 Bacteria 724
514 Ga0105239_13235952 3300010375 Bacteria 530
515 Ga0105246_10135906 3300011119 Bacteria 1843
516 Ga0157318_1028166 3300012482 Bacteria 541
517 Ga0157341_1042080 3300012494 Bacteria 532
518 Ga0157323_1004571 3300012495 Bacteria 891
519 Ga0157339_1028615 3300012505 Bacteria 639
520 Ga0157342_1020734 3300012507 Bacteria 762
521 Ga0157316_1015673 3300012510 Bacteria 770
522 Ga0157373_10075094 3300013100 Bacteria 2385
523 Ga0157373_10107506 3300013100 Bacteria 1961
524 Ga0157373_10134672 3300013100 Bacteria 1737
525 Ga0157373_10261289 3300013100 Bacteria 1225
526 Ga0157371_10502250 3300013102 Bacteria 896
527 Ga0157371_11376732 3300013102 Bacteria 547
528 Ga0157370_10006391 3300013104 Bacteria 13004
529 Ga0157370_10051328 3300013104 Bacteria 3939
530 Ga0157370_10284510 3300013104 Bacteria 1527
531 Ga0157370_10885631 3300013104 Bacteria 810
532 Ga0157370_11354269 3300013104 Bacteria 641
533 Ga0157370_11584828 3300013104 Bacteria 588
534 Ga0157369_10129033 3300013105 Bacteria 2680
535 Ga0157369_10360263 3300013105 Bacteria 1510
536 Ga0157369_10966313 3300013105 Bacteria 873
537 Ga0157369_11050120 3300013105 Bacteria 833
538 Ga0157369_12520277 3300013105 Bacteria 521
539 Ga0157374_10841745 3300013296 Bacteria 934
540 Ga0157374_10938383 3300013296 Bacteria 884
541 Ga0157374_11612879 3300013296 Bacteria 673
542 Ga0157374_11672773 3300013296 Bacteria 661
543 Ga0157378_10107312 3300013297 Bacteria 2555
544 Ga0157378_10168578 3300013297 Bacteria 2052
545 Ga0157378_10392433 3300013297 Bacteria 1365
546 Ga0157378_10924224 3300013297 Bacteria 904
547 Ga0157378_11111228 3300013297 Bacteria 828
548 Ga0157378_11206617 3300013297 Bacteria 796
549 Ga0157378_11286448 3300013297 Bacteria 772
550 Ga0157378_11793893 3300013297 Bacteria 662
551 Ga0157378_12350404 3300013297 Bacteria 585
552 Ga0157378_12778686 3300013297 Bacteria 542
553 Ga0163162_10771069 3300013306 Bacteria 1080
554 Ga0163162_10942245 3300013306 Bacteria 975
555 Ga0163162_11353130 3300013306 Bacteria 810
556 Ga0163162_12210203 3300013306 Bacteria 632
557 Ga0163162_12562676 3300013306 Bacteria 587
558 Ga0157372_10353040 3300013307 Bacteria 1713
559 Ga0157372_10360783 3300013307 Bacteria 1693
560 Ga0157372_10398247 3300013307 Bacteria 1604
561 Ga0157372_10437193 3300013307 Bacteria 1525
562 Ga0157372_10438515 3300013307 Bacteria 1522
563 Ga0157372_10707076 3300013307 Bacteria 1173
564 Ga0157372_11176516 3300013307 Bacteria 886
565 Ga0157372_11335691 3300013307 Bacteria 827
566 Ga0157372_11876377 3300013307 Bacteria 689
567 Ga0157372_12916985 3300013307 Bacteria 547
568 Ga0157372_13205857 3300013307 Bacteria 522
569 Ga0157375_10470699 3300013308 Unclassified 1422
570 Ga0157375_10773256 3300013308 Bacteria 1110
571 Ga0157375_12065547 3300013308 Bacteria 678
572 Ga0163163_10308590 3300014325 Bacteria 1635
573 Ga0163163_10308637 3300014325 Bacteria 1635
574 Ga0163163_10395870 3300014325 Bacteria 1439
575 Ga0163163_10833141 3300014325 Bacteria 986
576 Ga0163163_11090999 3300014325 Bacteria 861
577 Ga0157380_11276920 3300014326 Bacteria 781
578 Ga0157380_13177473 3300014326 Bacteria 524
579 Ga0182008_10006718 3300014497 Bacteria 6404
580 Ga0157377_10220127 3300014745 Bacteria 1215
581 Ga0157379_10648203 3300014968 Bacteria 989
582 Ga0157379_11019995 3300014968 Bacteria 789
583 Ga0157379_11275611 3300014968 Bacteria 709
584 Ga0157379_11425219 3300014968 Bacteria 672
585 Ga0157379_12463332 3300014968 Bacteria 520
586 Ga0157376_10346309 3300014969 Bacteria 1421
587 Ga0157376_10688632 3300014969 Bacteria 1026
588 Ga0157376_10976839 3300014969 Bacteria 868
589 Ga0157376_12139206 3300014969 Bacteria 598
590 Ga0157376_13037862 3300014969 Bacteria 508
591 Ga0182007_10245076 3300015262 Bacteria 641
592 Ga0163161_10184027 3300017792 Bacteria 1603
593 Ga0163161_10551308 3300017792 Unclassified 945
594 Ga0163161_12037071 3300017792 Bacteria 510
595 Ga0206356_11621450 3300020070 Bacteria 820
596 Ga0206349_1309757 3300020075 Bacteria 563
597 Ga0213876_10010709 3300021384 Bacteria 4913
598 Ga0213876_10244513 3300021384 Bacteria 953
599 Ga0213876_10253805 3300021384 Bacteria 935
600 Ga0207666_1023196 3300025271 Bacteria 922
601 Ga0207697_10011385 3300025315 Bacteria 3763
602 Ga0207656_10283209 3300025321 Bacteria 818
603 Ga0207682_10016764 3300025893 Bacteria 2859
604 Ga0207692_10077555 3300025898 Bacteria 1768
605 Ga0207642_10008208 3300025899 Bacteria 3569
606 Ga0207642_10469862 3300025899 Bacteria 765
607 Ga0207642_10568459 3300025899 Bacteria 702
608 Ga0207642_10642395 3300025899 Bacteria 664
609 Ga0207688_10027380 3300025901 Bacteria 3136
610 Ga0207688_10684318 3300025901 Bacteria 648
611 Ga0207680_10025729 3300025903 Bacteria 3250
612 Ga0207680_10125424 3300025903 Bacteria 1685
613 Ga0207680_10351990 3300025903 Bacteria 1035
614 Ga0207685_10030303 3300025905 Bacteria 1924
615 Ga0207699_10001230 3300025906 Bacteria 12159
616 Ga0207699_10044660 3300025906 Bacteria 2580
617 Ga0207699_10127954 3300025906 Bacteria 1652
618 Ga0207699_10560054 3300025906 Bacteria 830
619 Ga0207645_10018114 3300025907 Bacteria 4642
620 Ga0207645_10185904 3300025907 Bacteria 1364
621 Ga0207645_10193216 3300025907 Bacteria 1338
622 Ga0207643_10003364 3300025908 Bacteria 8615
623 Ga0207643_10281215 3300025908 Bacteria 1032
624 Ga0207705_10027229 3300025909 Bacteria 4075
625 Ga0207705_10029211 3300025909 Bacteria 3930
626 Ga0207705_10031424 3300025909 Bacteria 3790
627 Ga0207705_10278431 3300025909 Bacteria 1280
628 Ga0207705_10461503 3300025909 Bacteria 985
629 Ga0207705_10694084 3300025909 Bacteria 791
630 Ga0207684_10022976 3300025910 Bacteria 5326
631 Ga0207684_10199408 3300025910 Bacteria 1726
632 Ga0207684_10321730 3300025910 Bacteria 1333
633 Ga0207684_10460484 3300025910 Bacteria 1091
634 Ga0207684_10466072 3300025910 Bacteria 1084
635 Ga0207684_11038716 3300025910 Bacteria 684
636 Ga0207654_10028743 3300025911 Bacteria 3034
637 Ga0207707_10004257 3300025912 Bacteria 12664
638 Ga0207707_10020853 3300025912 Bacteria 5725
639 Ga0207707_10041250 3300025912 Bacteria 4031
640 Ga0207707_10068861 3300025912 Bacteria 3084
641 Ga0207707_10075446 3300025912 Bacteria 2942
642 Ga0207707_10097923 3300025912 Bacteria 2564
643 Ga0207707_10627301 3300025912 Bacteria 908
644 Ga0207707_10784898 3300025912 Bacteria 794
645 Ga0207707_10861232 3300025912 Bacteria 751
646 Ga0207707_11104162 3300025912 Bacteria 646
647 Ga0207695_10004617 3300025913 Bacteria 18682
648 Ga0207695_10013424 3300025913 Bacteria 9771
649 Ga0207695_10070341 3300025913 Bacteria 3578
650 Ga0207695_10226195 3300025913 Bacteria 1777
651 Ga0207671_10127670 3300025914 Bacteria 1950
652 Ga0207671_11569578 3300025914 Bacteria 507
653 Ga0207693_10130240 3300025915 Bacteria 1977
654 Ga0207693_10177031 3300025915 Bacteria 1678
655 Ga0207693_10182171 3300025915 Bacteria 1653
656 Ga0207693_10361372 3300025915 Bacteria 1136
657 Ga0207693_10440034 3300025915 Bacteria 1019
658 Ga0207693_10488937 3300025915 Bacteria 961
659 Ga0207663_10008487 3300025916 Bacteria 5375
660 Ga0207663_10073763 3300025916 Bacteria 2210
661 Ga0207663_10511946 3300025916 Bacteria 934
662 Ga0207663_10892089 3300025916 Bacteria 711
663 Ga0207660_10004139 3300025917 Bacteria 9438
664 Ga0207660_10032435 3300025917 Bacteria 3605
665 Ga0207660_10044376 3300025917 Bacteria 3128
666 Ga0207660_10046045 3300025917 Bacteria 3077
667 Ga0207660_10088243 3300025917 Bacteria 2293
668 Ga0207660_10097907 3300025917 Bacteria 2187
669 Ga0207660_10168557 3300025917 Bacteria 1694
670 Ga0207660_10478573 3300025917 Bacteria 1009
671 Ga0207660_10681750 3300025917 Bacteria 838
672 Ga0207660_11266911 3300025917 Bacteria 599
673 Ga0207662_10007104 3300025918 Bacteria 6083
674 Ga0207662_10037541 3300025918 Bacteria 2835
675 Ga0207662_10185746 3300025918 Bacteria 1339
676 Ga0207662_10247582 3300025918 Bacteria 1169
677 Ga0207662_10304538 3300025918 Bacteria 1060
678 Ga0207662_10722687 3300025918 Bacteria 699
679 Ga0207657_10001138 3300025919 Bacteria 28229
680 Ga0207657_10047239 3300025919 Bacteria 3765
681 Ga0207657_10133641 3300025919 Bacteria 2032
682 Ga0207657_10281579 3300025919 Bacteria 1320
683 Ga0207657_10553571 3300025919 Bacteria 899
684 Ga0207649_10025188 3300025920 Bacteria 3466
685 Ga0207649_10032190 3300025920 Bacteria 3124
686 Ga0207649_10058649 3300025920 Bacteria 2411
687 Ga0207649_10118913 3300025920 Bacteria 1778
688 Ga0207649_10167119 3300025920 Bacteria 1529
689 Ga0207649_10178625 3300025920 Bacteria 1484
690 Ga0207649_10525517 3300025920 Bacteria 903
691 Ga0207649_10526993 3300025920 Bacteria 901
692 Ga0207649_11091551 3300025920 Bacteria 629
693 Ga0207652_10011077 3300025921 Bacteria 7269
694 Ga0207652_10012004 3300025921 Bacteria 6992
695 Ga0207652_10042922 3300025921 Bacteria 3850
696 Ga0207652_10065009 3300025921 Bacteria 3157
697 Ga0207652_10093206 3300025921 Bacteria 2650
698 Ga0207652_10180913 3300025921 Bacteria 1895
699 Ga0207652_10261717 3300025921 Bacteria 1560
700 Ga0207652_10261985 3300025921 Bacteria 1559
701 Ga0207652_10324641 3300025921 Bacteria 1390
702 Ga0207652_10444285 3300025921 Bacteria 1169
703 Ga0207652_10539114 3300025921 Bacteria 1049
704 Ga0207652_10917515 3300025921 Bacteria 773
705 Ga0207652_10968089 3300025921 Bacteria 749
706 Ga0207646_10019243 3300025922 Bacteria 6348
707 Ga0207646_10035672 3300025922 Bacteria 4491
708 Ga0207646_10103586 3300025922 Bacteria 2552
709 Ga0207646_10409012 3300025922 Bacteria 1225
710 Ga0207646_10473825 3300025922 Bacteria 1129
711 Ga0207646_10536794 3300025922 Bacteria 1052
712 Ga0207646_11799240 3300025922 Bacteria 524
713 Ga0207681_10068781 3300025923 Bacteria 2461
714 Ga0207681_10085457 3300025923 Bacteria 2239
715 Ga0207681_10205225 3300025923 Bacteria 1515
716 Ga0207681_10544386 3300025923 Bacteria 955
717 Ga0207681_10545758 3300025923 Bacteria 953
718 Ga0207694_10026946 3300025924 Bacteria 4377
719 Ga0207694_10248765 3300025924 Bacteria 1454
720 Ga0207694_10275749 3300025924 Bacteria 1380
721 Ga0207694_10843780 3300025924 Bacteria 774
722 Ga0207650_10010393 3300025925 Bacteria 6382
723 Ga0207650_10249865 3300025925 Bacteria 1435
724 Ga0207650_11374444 3300025925 Bacteria 601
725 Ga0207659_10022346 3300025926 Bacteria 4211
726 Ga0207659_10208752 3300025926 Bacteria 1564
727 Ga0207659_10218655 3300025926 Bacteria 1530
728 Ga0207659_10497834 3300025926 Bacteria 1031
729 Ga0207659_11195230 3300025926 Bacteria 654
730 Ga0207659_11694803 3300025926 Bacteria 538
731 Ga0207687_10075869 3300025927 Bacteria 2414
732 Ga0207687_10136950 3300025927 Bacteria 1853
733 Ga0207687_10400629 3300025927 Bacteria 1129
734 Ga0207687_11183420 3300025927 Bacteria 657
735 Ga0207687_11722786 3300025927 Bacteria 537
736 Ga0207700_10087723 3300025928 Bacteria 2447
737 Ga0207700_10483316 3300025928 Bacteria 1094
738 Ga0207664_10000099 3300025929 Bacteria 80206
739 Ga0207664_10012437 3300025929 Bacteria 6084
740 Ga0207664_10420601 3300025929 Bacteria 1190
741 Ga0207664_11970421 3300025929 Bacteria 507
742 Ga0207644_10227703 3300025931 Bacteria 1480
743 Ga0207644_10490086 3300025931 Bacteria 1013
744 Ga0207644_10860658 3300025931 Bacteria 759
745 Ga0207644_11627165 3300025931 Bacteria 541
746 Ga0207690_10070701 3300025932 Bacteria 2405
747 Ga0207690_10076401 3300025932 Bacteria 2325
748 Ga0207690_10207916 3300025932 Bacteria 1490
749 Ga0207706_10075992 3300025933 Bacteria 2955
750 Ga0207706_10150224 3300025933 Bacteria 2049
751 Ga0207706_10535245 3300025933 Bacteria 1009
752 Ga0207706_10556469 3300025933 Bacteria 987
753 Ga0207706_11007915 3300025933 Bacteria 699
754 Ga0207706_11353459 3300025933 Bacteria 586
755 Ga0207686_10060773 3300025934 Bacteria 2393
756 Ga0207686_11131820 3300025934 Bacteria 639
757 Ga0207686_11331536 3300025934 Bacteria 590
758 Ga0207709_10081832 3300025935 Bacteria 2083
759 Ga0207709_11327797 3300025935 Bacteria 595
760 Ga0207670_10004353 3300025936 Bacteria 7611
761 Ga0207670_10018648 3300025936 Bacteria 4224
762 Ga0207670_10107499 3300025936 Bacteria 2003
763 Ga0207670_10301182 3300025936 Bacteria 1255
764 Ga0207670_11139326 3300025936 Bacteria 659
765 Ga0207670_11928134 3300025936 Bacteria 502
766 Ga0207669_10346609 3300025937 Bacteria 1146
767 Ga0207669_10350187 3300025937 Bacteria 1141
768 Ga0207669_11052314 3300025937 Bacteria 685
769 Ga0207704_10040337 3300025938 Bacteria 2727
770 Ga0207704_11302836 3300025938 Bacteria 621
771 Ga0207704_11365406 3300025938 Bacteria 607
772 Ga0207665_10021871 3300025939 Bacteria 4206
773 Ga0207665_10024947 3300025939 Bacteria 3943
774 Ga0207665_10097926 3300025939 Bacteria 2043
775 Ga0207665_10197621 3300025939 Bacteria 1464
776 Ga0207665_11293580 3300025939 Bacteria 581
777 Ga0207691_10032808 3300025940 Bacteria 4839
778 Ga0207691_10046795 3300025940 Bacteria 3973
779 Ga0207691_10153386 3300025940 Bacteria 2025
780 Ga0207691_10322355 3300025940 Bacteria 1325
781 Ga0207711_10183645 3300025941 Bacteria 1903
782 Ga0207711_11200148 3300025941 Bacteria 700
783 Ga0207711_11895670 3300025941 Bacteria 539
784 Ga0207711_12060576 3300025941 Bacteria 513
785 Ga0207689_10019641 3300025942 Bacteria 5694
786 Ga0207689_10053633 3300025942 Bacteria 3322
787 Ga0207689_10123876 3300025942 Bacteria 2126
788 Ga0207661_10001907 3300025944 Bacteria 14301
789 Ga0207661_10004866 3300025944 Bacteria 9413
790 Ga0207661_10047859 3300025944 Bacteria 3396
791 Ga0207661_10179812 3300025944 Bacteria 1847
792 Ga0207661_11788099 3300025944 Bacteria 560
793 Ga0207679_10002650 3300025945 Bacteria 11044
794 Ga0207679_10192419 3300025945 Bacteria 1697
795 Ga0207679_10218788 3300025945 Bacteria 1601
796 Ga0207679_10314992 3300025945 Bacteria 1353
797 Ga0207679_10316793 3300025945 Bacteria 1349
798 Ga0207679_10741175 3300025945 Bacteria 893
799 Ga0207679_10752364 3300025945 Bacteria 886
800 Ga0207679_10822952 3300025945 Bacteria 847
801 Ga0207679_10872568 3300025945 Bacteria 822
802 Ga0207679_11249370 3300025945 Bacteria 682
803 Ga0207679_11269312 3300025945 Bacteria 676
804 Ga0207679_12086469 3300025945 Bacteria 515
805 Ga0207679_12138210 3300025945 Bacteria 508
806 Ga0207667_10034763 3300025949 Bacteria 5409
807 Ga0207667_10658021 3300025949 Bacteria 1053
808 Ga0207667_11478457 3300025949 Bacteria 651
809 Ga0207667_12081101 3300025949 Bacteria 526
810 Ga0207651_10021908 3300025960 Bacteria 3893
811 Ga0207651_10036217 3300025960 Bacteria 3219
812 Ga0207651_10071067 3300025960 Bacteria 2465
813 Ga0207651_10128156 3300025960 Bacteria 1937
814 Ga0207651_10173474 3300025960 Bacteria 1703
815 Ga0207712_10675161 3300025961 Bacteria 900
816 Ga0207668_10281849 3300025972 Bacteria 1363
817 Ga0207668_10808508 3300025972 Bacteria 830
818 Ga0207640_10001854 3300025981 Bacteria 11325
819 Ga0207640_10129033 3300025981 Bacteria 1825
820 Ga0207640_10238690 3300025981 Bacteria 1403
821 Ga0207640_10280376 3300025981 Bacteria 1309
822 Ga0207640_10583783 3300025981 Bacteria 944
823 Ga0207640_10719024 3300025981 Bacteria 858
824 Ga0207658_11026684 3300025986 Bacteria 752
825 Ga0207658_12005943 3300025986 Bacteria 527
826 Ga0207677_10012623 3300026023 Bacteria 4866
827 Ga0207677_10058774 3300026023 Bacteria 2649
828 Ga0207677_10092972 3300026023 Bacteria 2197
829 Ga0207677_10216912 3300026023 Bacteria 1532
830 Ga0207677_10287200 3300026023 Bacteria 1353
831 Ga0207677_10416302 3300026023 Bacteria 1143
832 Ga0207703_11017431 3300026035 Bacteria 795
833 Ga0207703_12206895 3300026035 Bacteria 526
834 Ga0207639_10002689 3300026041 Bacteria 11930
835 Ga0207639_10051893 3300026041 Bacteria 3122
836 Ga0207639_10204557 3300026041 Bacteria 1695
837 Ga0207639_10217878 3300026041 Bacteria 1647
838 Ga0207639_10798015 3300026041 Bacteria 880
839 Ga0207639_11176347 3300026041 Bacteria 720
840 Ga0207639_11760032 3300026041 Bacteria 580
841 Ga0207678_10012023 3300026067 Bacteria 7601
842 Ga0207678_10076305 3300026067 Bacteria 2871
843 Ga0207678_11960182 3300026067 Bacteria 510
844 Ga0207708_10112088 3300026075 Bacteria 2118
845 Ga0207708_10156616 3300026075 Bacteria 1796
846 Ga0207708_10614938 3300026075 Bacteria 922
847 Ga0207708_10795262 3300026075 Bacteria 814
848 Ga0207708_11220680 3300026075 Bacteria 658
849 Ga0207708_12019120 3300026075 Bacteria 505
850 Ga0207702_10036288 3300026078 Bacteria 4123
851 Ga0207702_10086091 3300026078 Bacteria 2740
852 Ga0207702_10249947 3300026078 Bacteria 1665
853 Ga0207702_10868485 3300026078 Bacteria 893
854 Ga0207702_11628407 3300026078 Bacteria 639
855 Ga0207641_10070450 3300026088 Bacteria 3004
856 Ga0207641_10281147 3300026088 Bacteria 1565
857 Ga0207641_10464731 3300026088 Bacteria 1224
858 Ga0207641_10611440 3300026088 Bacteria 1068
859 Ga0207641_11270260 3300026088 Bacteria 736
860 Ga0207648_10048391 3300026089 Bacteria 3722
861 Ga0207648_10097740 3300026089 Bacteria 2569
862 Ga0207648_10203821 3300026089 Bacteria 1755
863 Ga0207648_10306254 3300026089 Bacteria 1426
864 Ga0207648_10654520 3300026089 Bacteria 971
865 Ga0207676_10180609 3300026095 Bacteria 1847
866 Ga0207676_10297097 3300026095 Bacteria 1473
867 Ga0207676_11001064 3300026095 Bacteria 823
868 Ga0207676_11162364 3300026095 Bacteria 764
869 Ga0207676_11353882 3300026095 Bacteria 707
870 Ga0207674_10048180 3300026116 Bacteria 4363
871 Ga0207674_10082972 3300026116 Bacteria 3205
872 Ga0207674_10100870 3300026116 Bacteria 2868
873 Ga0207674_10101100 3300026116 Bacteria 2864
874 Ga0207674_10168287 3300026116 Bacteria 2145
875 Ga0207674_10268372 3300026116 Bacteria 1654
876 Ga0207674_11749475 3300026116 Bacteria 589
877 Ga0207675_100316888 3300026118 Bacteria 1522
878 Ga0207683_10028596 3300026121 Bacteria 4822
879 Ga0207683_10035142 3300026121 Bacteria 4359
880 Ga0207683_10127379 3300026121 Bacteria 2289
881 Ga0207683_10618670 3300026121 Bacteria 1003
882 Ga0207698_10038152 3300026142 Bacteria 3547
883 Ga0207698_10046102 3300026142 Bacteria 3289
884 Ga0207698_10601353 3300026142 Bacteria 1084
885 Ga0207698_11574528 3300026142 Bacteria 672
886 Ga0207698_11688725 3300026142 Bacteria 649
887 Ga0207698_12636717 3300026142 Bacteria 512
888 Ga0209973_1018244 3300027252 Bacteria 908
889 Ga0209973_1021955 3300027252 Bacteria 854
890 Ga0209967_1084390 3300027364 Bacteria 500
891 Ga0209984_1013486 3300027424 Bacteria 1073
892 Ga0209984_1054251 3300027424 Bacteria 589
893 Ga0209995_1003150 3300027471 Bacteria 2621
894 Ga0209995_1009325 3300027471 Bacteria 1586
895 Ga0209968_1003096 3300027526 Bacteria 2493
896 Ga0209999_1002599 3300027543 Bacteria 3194
897 Ga0209999_1091843 3300027543 Bacteria 589
898 Ga0209999_1124806 3300027543 Bacteria 505
899 Ga0209982_1017982 3300027552 Bacteria 1080
900 Ga0209970_1024737 3300027614 Bacteria 1027
901 Ga0209970_1052785 3300027614 Bacteria 737
902 Ga0210002_1043222 3300027617 Bacteria 768
903 Ga0210002_1082987 3300027617 Bacteria 572
904 Ga0209983_1000810 3300027665 Bacteria 6831
905 Ga0209983_1018496 3300027665 Bacteria 1447
906 Ga0209983_1019830 3300027665 Bacteria 1399
907 Ga0209971_1020116 3300027682 Bacteria 1586
908 Ga0209966_1000982 3300027695 Bacteria 5325
909 Ga0209966_1108664 3300027695 Bacteria 631
910 Ga0209998_10003458 3300027717 Bacteria 3451
911 Ga0209998_10080529 3300027717 Bacteria 789
912 Ga0209974_10007380 3300027876 Bacteria 3789
913 Ga0209974_10007508 3300027876 Bacteria 3752
914 Ga0207428_10011903 3300027907 Bacteria 7658
915 Ga0207428_10193964 3300027907 Bacteria 1530
916 Ga0207428_10276111 3300027907 Bacteria 1248
917 Ga0207428_10401508 3300027907 Bacteria 1003
918 Ga0268266_10142482 3300028379 Bacteria 2152
919 Ga0268266_10237157 3300028379 Bacteria 1682
920 Ga0268265_10067252 3300028380 Bacteria 2773
921 Ga0268265_10415410 3300028380 Bacteria 1248
922 Ga0268265_10574631 3300028380 Bacteria 1073
923 Ga0268265_10859804 3300028380 Bacteria 888
924 Ga0268265_11001979 3300028380 Bacteria 825
925 Ga0268264_10221374 3300028381 Bacteria 1742
926 Ga0268264_10630454 3300028381 Bacteria 1059
927 Ga0265323_10056890 3300028653 Bacteria 1370
928 Ga0265338_10051633 3300028800 Bacteria 3699
929 Ga0316182_1255157 3300030745 Bacteria 836
930 Ga0265320_10064432 3300031240 Unclassified 1741
931 Ga0265327_10087014 3300031251 Bacteria 1531
932 Ga0265316_10934161 3300031344 Bacteria 605
933 Ga0307408_100016817 3300031548 Bacteria 4889
934 Ga0307408_100019763 3300031548 Bacteria 4537
935 Ga0307408_100046769 3300031548 Bacteria 3096
936 Ga0307408_100052712 3300031548 Bacteria 2935
937 Ga0307408_100062503 3300031548 Bacteria 2721
938 Ga0307408_100099262 3300031548 Bacteria 2215
939 Ga0307408_100153960 3300031548 Bacteria 1818
940 Ga0307408_100223526 3300031548 Bacteria 1538
941 Ga0307408_100406940 3300031548 Bacteria 1170
942 Ga0307408_100424859 3300031548 Bacteria 1147
943 Ga0307408_100713907 3300031548 Bacteria 902
944 Ga0307408_100864679 3300031548 Bacteria 825
945 Ga0307408_101332649 3300031548 Bacteria 674
946 Ga0265313_10145536 3300031595 Bacteria 1016
947 Ga0316575_10039695 3300031665 Bacteria 1859
948 Ga0316575_10385885 3300031665 Bacteria 599
949 Ga0316579_10001157 3300031691 Bacteria 9386
950 Ga0265314_10001956 3300031711 Bacteria 21935
951 Ga0265342_10633398 3300031712 Bacteria 538
952 Ga0316576_10004863 3300031727 Bacteria 8124
953 Ga0316576_10044118 3300031727 Bacteria 3220
954 Ga0316578_10001113 3300031728 Bacteria 10503
955 Ga0307405_10003326 3300031731 Bacteria 7362
956 Ga0307405_10004504 3300031731 Bacteria 6595
957 Ga0307405_10081500 3300031731 Bacteria 2115
958 Ga0307405_10083760 3300031731 Bacteria 2091
959 Ga0307405_10100967 3300031731 Bacteria 1935
960 Ga0307405_10107686 3300031731 Bacteria 1882
961 Ga0307405_10116149 3300031731 Bacteria 1822
962 Ga0307405_10152371 3300031731 Bacteria 1627
963 Ga0307405_10250335 3300031731 Bacteria 1318
964 Ga0307405_11012285 3300031731 Bacteria 709
965 Ga0307405_11208907 3300031731 Bacteria 654
966 Ga0307405_11333273 3300031731 Bacteria 625
967 Ga0316577_10008737 3300031733 Bacteria 5430
968 Ga0316577_10076737 3300031733 Bacteria 1866
969 Ga0307413_10001842 3300031824 Bacteria 8343
970 Ga0307413_10002091 3300031824 Bacteria 7997
971 Ga0307413_10006358 3300031824 Bacteria 5383
972 Ga0307413_10031527 3300031824 Bacteria 2992
973 Ga0307413_10055726 3300031824 Bacteria 2407
974 Ga0307413_10067122 3300031824 Bacteria 2241
975 Ga0307413_10074613 3300031824 Bacteria 2149
976 Ga0307413_10079652 3300031824 Bacteria 2095
977 Ga0307413_10203183 3300031824 Bacteria 1432
978 Ga0307413_10316330 3300031824 Bacteria 1190
979 Ga0307413_10701827 3300031824 Bacteria 840
980 Ga0307413_10760750 3300031824 Bacteria 811
981 Ga0307413_10957308 3300031824 Bacteria 731
982 Ga0307413_11250943 3300031824 Bacteria 647
983 Ga0307413_11340826 3300031824 Bacteria 627
984 Ga0307413_11758549 3300031824 Bacteria 554
985 Ga0307410_10000285 3300031852 Bacteria 19565
986 Ga0307410_10000967 3300031852 Bacteria 12342
987 Ga0307410_10022252 3300031852 Bacteria 3914
988 Ga0307410_10022355 3300031852 Bacteria 3907
989 Ga0307410_10054575 3300031852 Bacteria 2709
990 Ga0307410_10057005 3300031852 Bacteria 2658
991 Ga0307410_10067694 3300031852 Bacteria 2464
992 Ga0307410_10109480 3300031852 Bacteria 1996
993 Ga0307410_10126427 3300031852 Bacteria 1872
994 Ga0307410_10654568 3300031852 Bacteria 881
995 Ga0307410_10712613 3300031852 Bacteria 847
996 Ga0307410_10869233 3300031852 Bacteria 771
997 Ga0307410_10958461 3300031852 Bacteria 736
998 Ga0307410_11030798 3300031852 Bacteria 711
999 Ga0307406_10009039 3300031901 Bacteria 5572
1000 Ga0307406_10030981 3300031901 Bacteria 3253
1001 Ga0307406_10074742 3300031901 Bacteria 2232
1002 Ga0307406_10102636 3300031901 Bacteria 1951
1003 Ga0307406_10139031 3300031901 Bacteria 1716
1004 Ga0307406_10208490 3300031901 Bacteria 1444
1005 Ga0307406_10257460 3300031901 Bacteria 1318
1006 Ga0307406_10392032 3300031901 Bacteria 1098
1007 Ga0307406_10824787 3300031901 Bacteria 784
1008 Ga0307406_11310203 3300031901 Bacteria 632
1009 Ga0307406_11468420 3300031901 Bacteria 599
1010 Ga0307407_10005111 3300031903 Bacteria 5655
1011 Ga0307407_10005124 3300031903 Bacteria 5650
1012 Ga0307407_10044520 3300031903 Bacteria 2502
1013 Ga0307407_10122956 3300031903 Bacteria 1648
1014 Ga0307407_10241220 3300031903 Bacteria 1233
1015 Ga0307407_10500819 3300031903 Bacteria 890
1016 Ga0307407_10543982 3300031903 Bacteria 857
1017 Ga0307407_10568148 3300031903 Bacteria 840
1018 Ga0307407_10942719 3300031903 Bacteria 664
1019 Ga0307407_10954127 3300031903 Bacteria 660
1020 Ga0307407_11254962 3300031903 Bacteria 580
1021 Ga0307412_10005885 3300031911 Bacteria 6908
1022 Ga0307412_10007821 3300031911 Bacteria 6085
1023 Ga0307412_10016367 3300031911 Bacteria 4416
1024 Ga0307412_10060199 3300031911 Bacteria 2548
1025 Ga0307412_10075320 3300031911 Bacteria 2315
1026 Ga0307412_10094473 3300031911 Bacteria 2100
1027 Ga0307412_10139932 3300031911 Bacteria 1771
1028 Ga0307412_10202806 3300031911 Bacteria 1507
1029 Ga0307412_10361947 3300031911 Bacteria 1168
1030 Ga0307412_10791122 3300031911 Bacteria 822
1031 Ga0307412_10863760 3300031911 Bacteria 790
1032 Ga0307412_11152646 3300031911 Bacteria 692
1033 Ga0307412_11837595 3300031911 Bacteria 558
1034 Ga0307409_100005454 3300031995 Bacteria 7326
1035 Ga0307409_100008795 3300031995 Bacteria 6156
1036 Ga0307409_100032235 3300031995 Bacteria 3796
1037 Ga0307409_100047584 3300031995 Bacteria 3256
1038 Ga0307409_100055663 3300031995 Bacteria 3055
1039 Ga0307409_100079063 3300031995 Bacteria 2648
1040 Ga0307409_100079067 3300031995 Bacteria 2648
1041 Ga0307409_100172626 3300031995 Bacteria 1904
1042 Ga0307409_100487723 3300031995 Bacteria 1197
1043 Ga0307409_100541231 3300031995 Bacteria 1141
1044 Ga0307409_100655432 3300031995 Bacteria 1044
1045 Ga0307409_100810599 3300031995 Bacteria 944
1046 Ga0307409_101036773 3300031995 Bacteria 839
1047 Ga0307409_101214543 3300031995 Bacteria 777
1048 Ga0307409_101843172 3300031995 Bacteria 634
1049 Ga0307409_102131522 3300031995 Bacteria 590
1050 Ga0307416_100003682 3300032002 Bacteria 9079
1051 Ga0307416_100009003 3300032002 Bacteria 6494
1052 Ga0307416_100016074 3300032002 Bacteria 5188
1053 Ga0307416_100092060 3300032002 Bacteria 2606
1054 Ga0307416_100113896 3300032002 Bacteria 2391
1055 Ga0307416_100116989 3300032002 Bacteria 2365
1056 Ga0307416_100118263 3300032002 Bacteria 2355
1057 Ga0307416_100417503 3300032002 Bacteria 1385
1058 Ga0307416_100491460 3300032002 Bacteria 1289
1059 Ga0307416_100535955 3300032002 Bacteria 1241
1060 Ga0307416_100538135 3300032002 Bacteria 1239
1061 Ga0307416_100612039 3300032002 Bacteria 1170
1062 Ga0307416_100650942 3300032002 Bacteria 1138
1063 Ga0307416_100833658 3300032002 Bacteria 1019
1064 Ga0307416_101065588 3300032002 Bacteria 912
1065 Ga0307416_101526866 3300032002 Bacteria 773
1066 Ga0307416_102777375 3300032002 Bacteria 585
1067 Ga0307414_10036134 3300032004 Bacteria 3295
1068 Ga0307414_10074656 3300032004 Bacteria 2457
1069 Ga0307414_10180246 3300032004 Bacteria 1698
1070 Ga0307414_10726338 3300032004 Bacteria 901
1071 Ga0307414_10756896 3300032004 Bacteria 883
1072 Ga0307414_10956519 3300032004 Bacteria 787
1073 Ga0307414_10986856 3300032004 Bacteria 775
1074 Ga0307411_10000568 3300032005 Bacteria 13149
1075 Ga0307411_10005072 3300032005 Bacteria 6412
1076 Ga0307411_10012793 3300032005 Bacteria 4598
1077 Ga0307411_10020764 3300032005 Bacteria 3828
1078 Ga0307411_10114848 3300032005 Bacteria 1935
1079 Ga0307411_10118769 3300032005 Bacteria 1908
1080 Ga0307411_10209710 3300032005 Bacteria 1503
1081 Ga0307411_10336063 3300032005 Bacteria 1226
1082 Ga0307411_10347332 3300032005 Bacteria 1208
1083 Ga0307411_10825064 3300032005 Bacteria 818
1084 Ga0307411_10889294 3300032005 Bacteria 790
1085 Ga0307415_100004310 3300032126 Bacteria 7364
1086 Ga0307415_100004471 3300032126 Bacteria 7257
1087 Ga0307415_100006886 3300032126 Bacteria 6172
1088 Ga0307415_100017495 3300032126 Bacteria 4301
1089 Ga0307415_100073037 3300032126 Bacteria 2418
1090 Ga0307415_100077926 3300032126 Bacteria 2355
1091 Ga0307415_100116777 3300032126 Bacteria 1991
1092 Ga0307415_100232082 3300032126 Bacteria 1487
1093 Ga0307415_100238109 3300032126 Bacteria 1470
1094 Ga0307415_100315483 3300032126 Bacteria 1301
1095 Ga0307415_100443838 3300032126 Bacteria 1120
1096 Ga0307415_101090887 3300032126 Bacteria 747
1097 Ga0316583_10001183 3300032133 Bacteria 8556
1098 Ga0316583_10017879 3300032133 Bacteria 2546
1099 Ga0316583_10084259 3300032133 Bacteria 1110
1100 Ga0316585_10001668 3300032137 Bacteria 5889
1101 Ga0316580_10001460 3300032139 Bacteria 6181
1102 Ga0316592_1120642 3300033524 Bacteria 609
1103 Ga0316588_1148391 3300033528 Bacteria 601
1104 Ga0316596_1039349 3300033541 Bacteria 1240
1105 Ga0373930_0074044 3300034816 Bacteria 778
1106 Ga0373948_0059906 3300034817 Bacteria 834
1107 Ga0373950_0080083 3300034818 Bacteria 681
1108 Ga0373958_0022561 3300034819 Bacteria 1177
1109 Ga0373958_0094801 3300034819 Bacteria 693
1110 Ga0373959_0006266 3300034820 Bacteria 1969
1111 Ga0373959_0013525 3300034820 Bacteria 1473
1112 Ga0373959_0078539 3300034820 Bacteria 757
1113 Ga0373938_0034724 3300034957 Bacteria 1097
1114 Ga0373938_0246200 3300034957 Bacteria 510
1115 Ga0373926_0269996 3300035083 Bacteria 661
1116 Ga0373928_0033370 3300035084 Bacteria 1151
1117 Ga0373928_0062653 3300035084 Bacteria 903
1118 Ga0373928_0154152 3300035084 Bacteria 638
1119 Ga0373929_0026783 3300035085 Bacteria 1207
1120 Ga0373929_0029820 3300035085 Bacteria 1160
1121 Ga0373929_0056692 3300035085 Bacteria 908
1122 Ga0373934_0141970 3300035086 Bacteria 982
1123 Ga0373934_0454027 3300035086 Bacteria 537
1124 Ga0373940_0074398 3300035088 Bacteria 994
1125 Ga0373944_0057368 3300035089 Bacteria 1241
1126 Ga0373949_0250311 3300035090 Bacteria 548
1127 Ga0373952_0021650 3300035092 Bacteria 1359
1128 Ga0373952_0022759 3300035092 Bacteria 1334
1129 Ga0373952_0044807 3300035092 Bacteria 1035
1130 Ga0373923_0036974 3300035111 Bacteria 1996
1131 Ga0373932_0170684 3300035112 Bacteria 758
1132 Ga0373939_0067213 3300035114 Bacteria 1157
1133 Ga0373939_0254051 3300035114 Bacteria 685
1134 Ga0373941_0017581 3300035115 Bacteria 1962
1135 Ga0373941_0232439 3300035115 Bacteria 713
1136 Ga0373945_0397345 3300035116 Bacteria 604
1137 Ga0373953_0014696 3300035117 Bacteria 2822
1138 Ga0373954_0236932 3300035118 Bacteria 898
1139 Ga0373956_0149048 3300035119 Bacteria 1100
1140 Ga0373956_0345775 3300035119 Bacteria 709
1141 Ga0373957_0106980 3300035120 Bacteria 1124
1142 Ga0373960_0040013 3300035121 Bacteria 1351
1143 Ga0373960_0121692 3300035121 Bacteria 867
1144 Ga0373960_0200705 3300035121 Bacteria 705
1145 Ga0373943_0015892 3300035170 Bacteria 3425
1146 Ga0373943_0407194 3300035170 Bacteria 786
1147 Ga0373946_0276367 3300035171 Bacteria 825
1148 Ga0373946_0676961 3300035171 Bacteria 538
1149 Ga0373955_0088617 3300035172 Bacteria 1760
1150 Ga0373942_0037456 3300035207 Bacteria 1311
1151 Ga0373942_0199256 3300035207 Bacteria 663
1152 Ga0373961_0000555 3300035241 Bacteria 14114
1153 Ga0373961_0036950 3300035241 Bacteria 1393
1154 Ga0373961_0314891 3300035241 Bacteria 582
1155 Ga0373962_0259282 3300035242 Bacteria 606
1156 Ga0316574_0007172 3300035398 Bacteria 6090
1157 Ga0316574_0331037 3300035398 Bacteria 966
1158 Ga0316574_0355322 3300035398 Bacteria 927
1159 Ga0373924_0040307 3300035410 Bacteria 1911
1160 Ga0373931_0065790 3300035691 Bacteria 1965
1161 Ga0373931_0113587 3300035691 Bacteria 1540
1162 Ga0373931_0233081 3300035691 Bacteria 1113
1163 Ga0373931_0424587 3300035691 Bacteria 846
1164 Ga0373931_0856974 3300035691 Bacteria 608
1165 Ga0373935_0058549 3300035692 Bacteria 2461
1166 Ga0373933_0002765 3300035724 Bacteria 9786
1167 Ga0373937_0001688 3300036401 Bacteria 18564
1168 Ga0373937_0063603 3300036401 Bacteria 3394
1169 Ga0373937_0245517 3300036401 Bacteria 1687
1170 Ga0373937_0517704 3300036401 Bacteria 1133
1171 Ga0373937_1029058 3300036401 Bacteria 772
1172 Ga0373937_1128300 3300036401 Bacteria 733
1173 Ga0373937_1565581 3300036401 Bacteria 606
1174 Ga0316582_0015599 3300036647 Bacteria 4351
1175 Ga0316582_0945318 3300036647 Unclassified 589
1176 Ga0316584_0007216 3300036712 Bacteria 7583
1177 Ga0373925_0078483 3300037068 Bacteria 2507
1178 Ga0373925_0176928 3300037068 Bacteria 1687
1179 Ga0373925_0292667 3300037068 Bacteria 1313
1180 Ga0373925_0487257 3300037068 Bacteria 1012
1181 Ga0395899_0151372 3300037312 Bacteria 1644
1182 Ga0395900_0024491 3300037418 Bacteria 6181
1183 Ga0395898_1598012 3300037466 Bacteria 576
1184 Ga0395905_0025260 3300037471 Bacteria 5602
1185 Ga0395905_0067530 3300037471 Bacteria 3349
1186 Ga0395905_1312912 3300037471 Bacteria 627
1187 Ga0395905_1736610 3300037471 Bacteria 529
1188 Ga0436364_0100568 3300037853 Bacteria 510
1189 Ga0436364_0390676 3300037853 Bacteria 919
1190 Ga0436364_1537478 3300037853 Bacteria 519
1191 Ga0395901_0001770 3300038443 Bacteria 22280
1192 Ga0242419_003585 3300038698 Bacteria 1056
1193 Ga0242420_050187 3300038996 Bacteria 814
1194 Ga0436365_0223155 3300039437 Bacteria 890
1195 Ga0436365_0234011 3300039437 Bacteria 932
1196 Ga0436365_0408308 3300039437 Bacteria 3423
1197 Ga0436365_1264253 3300039437 Bacteria 2413
1198 Ga0436365_1424311 3300039437 Bacteria 1839
1199 Ga0436365_1599614 3300039437 Bacteria 517
1200 Ga0439439_0048325 3300041406 Bacteria 1112
1201 Ga0439439_0178061 3300041406 Bacteria 612
1202 Ga0439453_0097394 3300041408 Bacteria 652
1203 Ga0451793_0749803 3300041452 Bacteria 2075
1204 Ga0451795_1463064 3300041456 Bacteria 634
1205 Ga0451802_1318879 3300041460 Bacteria 788
1206 Ga0451807_0674211 3300041486 Bacteria 3051
1207 Ga0451807_1934356 3300041486 Bacteria 718
1208 Ga0451807_2773123 3300041486 Bacteria 790
1209 Ga0451839_1015318 3300041496 Bacteria 506
1210 Ga0451845_0267143 3300041501 Bacteria 643
1211 Ga0451853_2480235 3300041512 Bacteria 901
1212 Ga0451853_2725406 3300041512 Bacteria 510
1213 Ga0439433_0143812 3300041999 Bacteria 611
1214 Ga0439432_163717 3300042006 Bacteria 650
1215 Ga0439449_0103716 3300042007 Bacteria 1052
1216 Ga0439455_0022797 3300042012 Bacteria 1504
1217 Ga0439456_080993 3300042013 Bacteria 725
1218 Ga0439446_0049325 3300042156 Bacteria 1255
1219 Ga0439446_0053270 3300042156 Bacteria 1212
1220 Ga0439446_0174111 3300042156 Bacteria 717
1221 Ga0439446_0346855 3300042156 Bacteria 528
1222 Ga0439434_0081628 3300042435 Bacteria 1026
1223 Ga0439434_0157571 3300042435 Bacteria 753
1224 Ga0439459_0037912 3300042438 Bacteria 1012
1225 Ga0451577_0049852 3300042876 Bacteria 3738
1226 Ga0451577_0208168 3300042876 Bacteria 1766
1227 Ga0451577_0391595 3300042876 Bacteria 1261
1228 Ga0453683_0012099 3300044673 Bacteria 5665
1229 Ga0453683_0182841 3300044673 Bacteria 1330
1230 Ga0453683_0714274 3300044673 Bacteria 657
1231 Ga0453683_0746648 3300044673 Bacteria 643
1232 Ga0466965_0134875 3300044683 Bacteria 1282
1233 Ga0466965_0435969 3300044683 Bacteria 728
1234 Ga0466961_0216372 3300044693 Bacteria 1182
1235 Ga0466963_0055834 3300044694 Bacteria 2627
1236 Ga0466964_0133383 3300044706 Bacteria 1134
1237 Ga0453684_0062783 3300044712 Bacteria 4756
1238 Ga0453684_0532052 3300044712 Bacteria 1297
1239 Ga0453684_0714362 3300044712 Bacteria 1088
1240 Ga0453684_1371210 3300044712 Bacteria 734
1241 Ga0453684_1964546 3300044712 Bacteria 590
1242 Ga0453684_2365960 3300044712 Bacteria 527
1243 Ga0466970_0649912 3300044765 Bacteria 613
1244 Ga0466957_0209596 3300044842 Bacteria 1283
1245 Ga0466960_0145973 3300044901 Bacteria 1260
1246 Ga0466960_0176826 3300044901 Bacteria 1155
1247 Ga0466959_0772507 3300045049 Bacteria 643
1248 Ga0466959_1022370 3300045049 Bacteria 550
1249 Ga0451576_0032102 3300045051 Bacteria 5596
1250 Ga0451576_0153457 3300045051 Bacteria 2402
1251 Ga0451576_0237355 3300045051 Bacteria 1904
1252 Ga0451576_0252033 3300045051 Bacteria 1845
1253 Ga0451576_0297024 3300045051 Bacteria 1689
1254 Ga0451576_0308436 3300045051 Bacteria 1655
1255 Ga0451576_0388486 3300045051 Bacteria 1463
1256 Ga0466958_0198001 3300045836 Bacteria 1278
1257 Ga0466958_0629169 3300045836 Bacteria 698
1258 Ga0466967_0277810 3300045976 Bacteria 1606
1259 Ga0466967_1060643 3300045976 Bacteria 807
1260 Ga0466967_1139939 3300045976 Bacteria 777
1261 Ga0495592_0402576 3300046454 Bacteria 866
1262 Ga0495592_0498975 3300046454 Bacteria 755
1263 Ga0495603_0021202 3300046455 Bacteria 3934
1264 Ga0495603_0043390 3300046455 Bacteria 2685
1265 Ga0495590_0238336 3300046457 Bacteria 675
1266 Ga0495629_0048696 3300046459 Bacteria 2971
1267 Ga0495629_0073936 3300046459 Bacteria 2380
1268 Ga0495629_0077215 3300046459 Bacteria 2325
1269 Ga0495629_0615914 3300046459 Bacteria 725
1270 Ga0495629_0678831 3300046459 Bacteria 685
1271 Ga0495651_0017188 3300046462 Bacteria 5605
1272 Ga0495651_0084014 3300046462 Bacteria 2399
1273 Ga0495651_0243225 3300046462 Bacteria 1233
1274 Ga0495653_0026437 3300046463 Bacteria 4653
1275 Ga0495580_0016230 3300046472 Bacteria 5595
1276 Ga0495580_0076246 3300046472 Bacteria 2339
1277 Ga0495580_0087356 3300046472 Bacteria 2172
1278 Ga0495580_0113415 3300046472 Bacteria 1883
1279 Ga0495582_0010686 3300046473 Bacteria 5050
1280 Ga0495582_0014832 3300046473 Bacteria 4282
1281 Ga0495582_0109507 3300046473 Bacteria 1551
1282 Ga0495582_0197880 3300046473 Bacteria 1147
1283 Ga0495605_0283024 3300046474 Bacteria 704
1284 Ga0495605_0494223 3300046474 Bacteria 500
1285 Ga0495639_0004714 3300046475 Bacteria 5862
1286 Ga0495639_0067391 3300046475 Bacteria 1648
1287 Ga0495662_0097571 3300046476 Bacteria 1436
1288 Ga0495662_0117049 3300046476 Bacteria 1307
1289 Ga0495664_0463726 3300046477 Bacteria 758
1290 Ga0495584_0592649 3300046491 Bacteria 565
1291 Ga0495594_0005611 3300046499 Bacteria 6449
1292 Ga0495594_0069873 3300046499 Bacteria 1951
1293 Ga0495594_0118996 3300046499 Bacteria 1492
1294 Ga0495596_0010087 3300046500 Bacteria 4131
1295 Ga0495583_0164843 3300046506 Bacteria 913
1296 Ga0495608_0033181 3300046511 Bacteria 3491
1297 Ga0495608_0103342 3300046511 Bacteria 1836
1298 Ga0495608_0266708 3300046511 Bacteria 1065
1299 Ga0495608_0501057 3300046511 Bacteria 735
1300 Ga0495618_0000743 3300046514 Bacteria 22768
1301 Ga0495618_0036169 3300046514 Bacteria 3098
1302 Ga0495618_0422616 3300046514 Bacteria 812
1303 Ga0495618_0821398 3300046514 Bacteria 540
1304 Ga0495628_0214703 3300046516 Bacteria 1446
1305 Ga0495628_0229371 3300046516 Bacteria 1392
1306 Ga0495630_0094702 3300046517 Bacteria 2257
1307 Ga0495630_0176568 3300046517 Bacteria 1628
1308 Ga0495630_0462261 3300046517 Bacteria 972
1309 Ga0495630_0559980 3300046517 Bacteria 876
1310 Ga0495630_0814085 3300046517 Bacteria 713
1311 Ga0495630_0953767 3300046517 Bacteria 652
1312 Ga0495643_0072184 3300046522 Bacteria 1811
1313 Ga0495663_0020324 3300046525 Bacteria 1905
1314 Ga0495663_0020379 3300046525 Bacteria 1903
1315 Ga0495666_0012771 3300046526 Bacteria 4187
1316 Ga0495642_0053960 3300046528 Bacteria 1657
1317 Ga0495652_0123654 3300046529 Bacteria 2059
1318 Ga0495652_0156344 3300046529 Bacteria 1775
1319 Ga0495665_0014539 3300046531 Bacteria 4244
1320 Ga0495665_0028776 3300046531 Bacteria 2977
1321 Ga0495665_0250977 3300046531 Bacteria 911
1322 Ga0495640_0156834 3300046533 Bacteria 1461
1323 Ga0495640_0185177 3300046533 Bacteria 1325
1324 Ga0495640_0629692 3300046533 Bacteria 646
1325 Ga0495586_0015359 3300046535 Bacteria 4074
1326 Ga0495586_0126327 3300046535 Bacteria 1430
1327 Ga0495586_0174630 3300046535 Bacteria 1214
1328 Ga0495586_0301689 3300046535 Bacteria 918
1329 Ga0495586_0319161 3300046535 Bacteria 891
1330 Ga0495586_0508105 3300046535 Bacteria 695
1331 Ga0495587_0267041 3300046536 Bacteria 960
1332 Ga0495587_0447806 3300046536 Bacteria 715
1333 Ga0495587_0619377 3300046536 Bacteria 595
1334 Ga0495598_0268802 3300046537 Bacteria 637
1335 Ga0495621_0041710 3300046539 Bacteria 1612
1336 Ga0495621_0053555 3300046539 Bacteria 1449
1337 Ga0495645_0013239 3300046543 Bacteria 5830
1338 Ga0495645_0238829 3300046543 Bacteria 1213
1339 Ga0495645_0680694 3300046543 Bacteria 626
1340 Ga0495622_0380357 3300046557 Bacteria 609
1341 Ga0495667_0016331 3300046559 Bacteria 5016
1342 Ga0495667_0063143 3300046559 Bacteria 2425
1343 Ga0495667_0220730 3300046559 Bacteria 1210
1344 Ga0495656_0085019 3300046615 Bacteria 1436
1345 Ga0495634_0150620 3300046642 Bacteria 1471
1346 Ga0495634_0171853 3300046642 Bacteria 1361
1347 Ga0495634_0192667 3300046642 Bacteria 1270
1348 Ga0495635_0054906 3300046663 Bacteria 2744
1349 Ga0495635_0084340 3300046663 Bacteria 2174
1350 Ga0495659_0249609 3300046664 Bacteria 739
1351 Ga0495661_0341275 3300046665 Bacteria 740
1352 Ga0495588_0088616 3300046674 Bacteria 1620
1353 Ga0495657_0049025 3300046675 Bacteria 2847
1354 Ga0495657_0113082 3300046675 Bacteria 1718
1355 Ga0495599_0010652 3300046678 Bacteria 5627
1356 Ga0495599_0015785 3300046678 Bacteria 4688
1357 Ga0495599_0224563 3300046678 Bacteria 1148
1358 Ga0495623_0017452 3300046679 Bacteria 4637
1359 Ga0495623_0082831 3300046679 Bacteria 1982
1360 Ga0495623_0108146 3300046679 Bacteria 1688
1361 Ga0495646_0016342 3300046680 Bacteria 4709
1362 Ga0495646_0626111 3300046680 Bacteria 545
1363 Ga0495647_0139968 3300046681 Bacteria 1031
1364 Ga0495647_0631783 3300046681 Bacteria 504
1365 Ga0495658_0060006 3300046683 Bacteria 2180
1366 Ga0495658_0110421 3300046683 Bacteria 1653
1367 Ga0495658_0338908 3300046683 Bacteria 955
1368 Ga0495658_0495585 3300046683 Bacteria 781
1369 Ga0495669_0163695 3300046684 Bacteria 1056
1370 Ga0495669_0640093 3300046684 Bacteria 517
1371 Ga0495613_0035641 3300046689 Bacteria 3691
1372 Ga0495613_0182583 3300046689 Bacteria 1485
1373 Ga0495613_0399046 3300046689 Bacteria 938
1374 Ga0495613_0467808 3300046689 Bacteria 852
1375 Ga0495624_0148945 3300046690 Bacteria 1432
1376 Ga0495600_0043998 3300046809 Bacteria 2913
1377 Ga0495581_0162192 3300047315 Bacteria 1307
1378 Ga0495581_0661507 3300047315 Bacteria 603
1379 Ga0495581_0675231 3300047315 Bacteria 596
1380 Ga0495581_0843010 3300047315 Bacteria 525
1381 Ga0495604_0027250 3300047317 Bacteria 4546
1382 Ga0495604_0104964 3300047317 Bacteria 2069
1383 Ga0495636_0036783 3300047318 Bacteria 2020
1384 Ga0495636_0174422 3300047318 Bacteria 973
1385 Ga0495674_0022976 3300047319 Bacteria 5745
1386 Ga0495674_0260821 3300047319 Bacteria 1424
1387 Ga0495674_0899048 3300047319 Bacteria 683
1388 Ga0495676_0582121 3300047321 Bacteria 730
1389 Ga0495680_0013035 3300047322 Bacteria 7271
1390 Ga0495680_0091581 3300047322 Bacteria 2279
1391 Ga0495680_0287504 3300047322 Bacteria 1157
1392 Ga0495680_0442587 3300047322 Bacteria 891
1393 Ga0495680_0722849 3300047322 Bacteria 656
1394 Ga0495680_0893525 3300047322 Bacteria 574
1395 Ga0495675_0079198 3300047444 Bacteria 2069
1396 Ga0495675_0170389 3300047444 Bacteria 1337
1397 Ga0495677_0106504 3300047445 Bacteria 1064
1398 Ga0495685_031250 3300047447 Bacteria 1831
1399 Ga0495684_0071242 3300047471 Bacteria 2641
1400 Ga0495684_0116099 3300047471 Bacteria 2018
1401 Ga0495684_0169445 3300047471 Bacteria 1625
1402 Ga0495684_0271682 3300047471 Bacteria 1226
1403 Ga0495684_0288272 3300047471 Bacteria 1182
1404 Ga0495684_0504246 3300047471 Bacteria 832
1405 Ga0495593_0201702 3300047673 Bacteria 1000
1406 Ga0495602_0013466 3300048088 Bacteria 8359
1407 Ga0495602_0100827 3300048088 Bacteria 2370
1408 Ga0495602_0239437 3300048088 Bacteria 1358
1409 Ga0495602_0401675 3300048088 Bacteria 977
1410 Ga0495602_0923954 3300048088 Bacteria 579
1411 Ga0495615_0252670 3300048090 Bacteria 559
1412 Ga0496100_0078491 3300048903 Bacteria 2222
1413 Ga0496100_0109226 3300048903 Bacteria 1919
1414 Ga0496100_0289027 3300048903 Bacteria 1224
1415 Ga0496100_0800416 3300048903 Bacteria 738
1416 Ga0496101_0056945 3300048904 Bacteria 2826
1417 Ga0496101_0111991 3300048904 Bacteria 2055
1418 Ga0496101_1124416 3300048904 Bacteria 616
1419 Ga0496102_0172439 3300048905 Bacteria 2036
1420 Ga0496102_0970077 3300048905 Bacteria 771
1421 Ga0496104_0065574 3300048907 Bacteria 3446
1422 Ga0496104_0309521 3300048907 Bacteria 1492
1423 Ga0496104_0399240 3300048907 Bacteria 1287
1424 Ga0496105_0059694 3300048908 Bacteria 3147
1425 Ga0496105_0070746 3300048908 Bacteria 2884
1426 Ga0496105_0147782 3300048908 Bacteria 1933
1427 Ga0496106_0027640 3300048909 Bacteria 4226
1428 Ga0496106_0064193 3300048909 Bacteria 2793
1429 Ga0496106_0318902 3300048909 Bacteria 1247
1430 Ga0496106_0342753 3300048909 Bacteria 1200
1431 Ga0496106_0578785 3300048909 Bacteria 900
1432 Ga0496107_0261224 3300048910 Bacteria 1288
1433 Ga0496107_0344283 3300048910 Bacteria 1109
1434 Ga0496107_0711641 3300048910 Bacteria 738
1435 Ga0496108_0035987 3300048911 Bacteria 4117
1436 Ga0496108_0592139 3300048911 Bacteria 966
1437 Ga0496108_1009386 3300048911 Bacteria 710
1438 Ga0496109_0039889 3300048912 Bacteria 4251
1439 Ga0496109_0042753 3300048912 Bacteria 4106
1440 Ga0496109_0043173 3300048912 Bacteria 4086
1441 Ga0496110_0007094 3300048913 Bacteria 8919
1442 Ga0496110_0089104 3300048913 Bacteria 2757
1443 Ga0496110_0151553 3300048913 Bacteria 2099
1444 Ga0496111_0001415 3300048914 Bacteria 13651
1445 Ga0496111_0072867 3300048914 Bacteria 2500
1446 Ga0496111_0553796 3300048914 Bacteria 844
1447 Ga0496112_0002541 3300048915 Bacteria 14732
1448 Ga0496112_0024016 3300048915 Bacteria 5833
1449 Ga0496112_0060181 3300048915 Bacteria 3742
1450 Ga0496112_0079427 3300048915 Bacteria 3245
1451 Ga0496112_0104391 3300048915 Bacteria 2804
1452 Ga0496112_0606487 3300048915 Bacteria 1026
1453 Ga0496112_0976500 3300048915 Bacteria 767
1454 Ga0496112_1175577 3300048915 Bacteria 684
1455 Ga0496113_0047161 3300048916 Bacteria 3201
1456 Ga0496113_0075448 3300048916 Bacteria 2573
1457 Ga0496113_0156046 3300048916 Bacteria 1802
1458 Ga0496113_0813883 3300048916 Bacteria 742
1459 Ga0496113_1115274 3300048916 Bacteria 618
1460 Ga0496114_0000001 3300048917 Bacteria 893286
1461 Ga0496114_0047313 3300048917 Bacteria 3578
1462 Ga0496114_1019079 3300048917 Bacteria 711
1463 Ga0496115_0082370 3300048918 Bacteria 2621
1464 Ga0501306_024127 3300049127 Bacteria 867
1465 Ga0501306_049510 3300049127 Bacteria 671
1466 Ga0501308_074347 3300049128 Bacteria 532
1467 Ga0501310_074323 3300049130 Bacteria 525
1468 Ga0501307_001003 3300049162 Bacteria 2216
1469 Ga0501307_051693 3300049162 Bacteria 619
1470 Ga0501296_050298 3300049519 Bacteria 609
1471 Ga0501298_006514 3300049521 Bacteria 1911
1472 Ga0501298_071487 3300049521 Bacteria 750
1473 Ga0501303_022268 3300049526 Bacteria 684
1474 Ga0501313_033044 3300049529 Bacteria 676
1475 Ga0501313_066371 3300049529 Bacteria 517
1476 Ga0501314_036139 3300049530 Bacteria 564
1477 Ga0501315_027200 3300049531 Bacteria 806
1478 Ga0501317_089645 3300049533 Bacteria 542
1479 Ga0501320_034979 3300049536 Bacteria 639
1480 Ga0501031_0115077 3300049568 Bacteria 1757
1481 Ga0501031_0232197 3300049568 Bacteria 1200
1482 Ga0501031_0959922 3300049568 Bacteria 547
1483 Ga0501032_0082763 3300049569 Bacteria 2135
1484 Ga0501032_0670862 3300049569 Bacteria 658
1485 Ga0501033_0245632 3300049570 Bacteria 1269
1486 Ga0501033_0458016 3300049570 Bacteria 885
1487 Ga0501033_0773273 3300049570 Unclassified 650
1488 Ga0501034_0000132 3300049571 Bacteria 138635
1489 Ga0501034_0044308 3300049571 Bacteria 4500
1490 Ga0501034_0196452 3300049571 Bacteria 1977
1491 Ga0501034_0396995 3300049571 Bacteria 1302
1492 Ga0501034_0762996 3300049571 Bacteria 862
1493 Ga0501034_0806897 3300049571 Bacteria 831
1494 Ga0501036_0170582 3300049572 Bacteria 1833
1495 Ga0501036_0190593 3300049572 Bacteria 1725
1496 Ga0501036_0297376 3300049572 Bacteria 1350
1497 Ga0501036_0311648 3300049572 Bacteria 1315
1498 Ga0501037_0287470 3300049573 Bacteria 1144
1499 Ga0501037_0427947 3300049573 Bacteria 905
1500 Ga0501037_0451245 3300049573 Bacteria 877
1501 Ga0501037_0693149 3300049573 Bacteria 678
1502 Ga0501038_0011902 3300049574 Bacteria 7941
1503 Ga0501038_0353513 3300049574 Bacteria 1144
1504 Ga0501038_0513220 3300049574 Bacteria 915
1505 Ga0501038_1208946 3300049574 Bacteria 548
1506 Ga0501039_0103131 3300049575 Bacteria 2227
1507 Ga0501039_0196869 3300049575 Bacteria 1584
1508 Ga0501039_0663518 3300049575 Bacteria 816
1509 Ga0501040_0021934 3300049576 Bacteria 4270
1510 Ga0501040_0069484 3300049576 Bacteria 2429
1511 Ga0501041_0023985 3300049577 Bacteria 3660
1512 Ga0501041_0117942 3300049577 Bacteria 1648
1513 Ga0501041_0135383 3300049577 Bacteria 1535
1514 Ga0501041_0398134 3300049577 Bacteria 872
1515 Ga0501042_0037878 3300049578 Bacteria 3423
1516 Ga0501042_0215413 3300049578 Bacteria 1385
1517 Ga0501042_0407104 3300049578 Bacteria 986
1518 Ga0501042_0533108 3300049578 Bacteria 853
1519 Ga0501043_0000829 3300049579 Bacteria 27458
1520 Ga0501043_0047600 3300049579 Bacteria 3371
1521 Ga0501046_0000117 3300049580 Bacteria 84016
1522 Ga0501046_0028687 3300049580 Bacteria 4531
1523 Ga0501046_0047535 3300049580 Bacteria 3402
1524 Ga0501046_0102764 3300049580 Bacteria 2191
1525 Ga0501046_0213074 3300049580 Bacteria 1433
1526 Ga0501046_0278630 3300049580 Bacteria 1225
1527 Ga0501046_0447386 3300049580 Bacteria 929
1528 Ga0501047_0029942 3300049581 Bacteria 5247
1529 Ga0501047_0130028 3300049581 Bacteria 2398
1530 Ga0501047_0130576 3300049581 Bacteria 2393
1531 Ga0501048_0031361 3300049582 Bacteria 3844
1532 Ga0501048_0118379 3300049582 Bacteria 1871
1533 Ga0501048_0186441 3300049582 Bacteria 1470
1534 Ga0501048_0229725 3300049582 Bacteria 1316
1535 Ga0501048_0373847 3300049582 Bacteria 1017
1536 Ga0501048_0473535 3300049582 Bacteria 897
1537 Ga0501048_0620527 3300049582 Bacteria 776
1538 Ga0501067_0014484 3300049583 Bacteria 4365
1539 Ga0501067_0039490 3300049583 Bacteria 2620
1540 Ga0501067_0060801 3300049583 Bacteria 2091
1541 Ga0501067_0066718 3300049583 Bacteria 1992
1542 Ga0501067_0232860 3300049583 Bacteria 1025
1543 Ga0501067_0328662 3300049583 Bacteria 851
1544 Ga0501068_0001673 3300049584 Bacteria 11845
1545 Ga0501068_0008160 3300049584 Bacteria 5818
1546 Ga0501068_0075235 3300049584 Bacteria 2065
1547 Ga0501068_0131811 3300049584 Bacteria 1563
1548 Ga0501068_0335310 3300049584 Bacteria 971
1549 Ga0501068_1054470 3300049584 Bacteria 537
1550 Ga0501069_0008330 3300049585 Bacteria 5444
1551 Ga0501069_0017995 3300049585 Bacteria 3810
1552 Ga0501069_0074284 3300049585 Bacteria 1907
1553 Ga0501069_0183155 3300049585 Bacteria 1211
1554 Ga0501069_0212562 3300049585 Bacteria 1123
1555 Ga0501069_0273842 3300049585 Bacteria 987
1556 Ga0501069_0772874 3300049585 Bacteria 581
1557 Ga0501069_0815877 3300049585 Bacteria 566
1558 Ga0501070_0013050 3300049586 Bacteria 7001
1559 Ga0501070_0032011 3300049586 Bacteria 4403
1560 Ga0501070_0063385 3300049586 Bacteria 3062
1561 Ga0501070_0069675 3300049586 Bacteria 2912
1562 Ga0501070_0089832 3300049586 Bacteria 2542
1563 Ga0501070_0097328 3300049586 Bacteria 2434
1564 Ga0501070_0171248 3300049586 Bacteria 1788
1565 Ga0501070_0509274 3300049586 Bacteria 966
1566 Ga0501070_0513201 3300049586 Bacteria 962
1567 Ga0501071_0012801 3300049587 Bacteria 5704
1568 Ga0501071_0238684 3300049587 Bacteria 1370
1569 Ga0501071_0481689 3300049587 Bacteria 951
1570 Ga0501071_0732719 3300049587 Bacteria 761
1571 Ga0501071_0839822 3300049587 Bacteria 708
1572 Ga0501071_0919752 3300049587 Bacteria 675
1573 Ga0501072_0006109 3300049588 Bacteria 9187
1574 Ga0501072_0010585 3300049588 Bacteria 7024
1575 Ga0501072_0032455 3300049588 Bacteria 4090
1576 Ga0501072_0053900 3300049588 Bacteria 3168
1577 Ga0501072_0154703 3300049588 Bacteria 1829
1578 Ga0501072_0209787 3300049588 Bacteria 1552
1579 Ga0501072_0212282 3300049588 Bacteria 1542
1580 Ga0501072_0234614 3300049588 Bacteria 1461
1581 Ga0501072_0265703 3300049588 Bacteria 1365
1582 Ga0501072_0658239 3300049588 Bacteria 824
1583 Ga0501072_1358210 3300049588 Bacteria 550
1584 Ga0501073_0170984 3300049589 Bacteria 1504
1585 Ga0501073_0174870 3300049589 Bacteria 1486
1586 Ga0501073_0772218 3300049589 Bacteria 663
1587 Ga0501074_0069510 3300049590 Bacteria 2532
1588 Ga0501074_0084841 3300049590 Bacteria 2270
1589 Ga0501074_0165238 3300049590 Bacteria 1580
1590 Ga0501074_0246973 3300049590 Bacteria 1269
1591 Ga0501075_0006664 3300049591 Bacteria 7962
1592 Ga0501075_0029122 3300049591 Bacteria 4082
1593 Ga0501075_0036489 3300049591 Bacteria 3669
1594 Ga0501075_0165817 3300049591 Bacteria 1685
1595 Ga0501075_0267549 3300049591 Bacteria 1303
1596 Ga0501075_0319160 3300049591 Bacteria 1184
1597 Ga0501076_0006442 3300049592 Bacteria 8516
1598 Ga0501076_0054868 3300049592 Bacteria 3159
1599 Ga0501076_0069214 3300049592 Bacteria 2820
1600 Ga0501076_0219729 3300049592 Bacteria 1553
1601 Ga0501076_0226375 3300049592 Bacteria 1528
1602 Ga0501076_0244716 3300049592 Bacteria 1467
1603 Ga0501076_0547773 3300049592 Bacteria 954
1604 Ga0501076_0949277 3300049592 Bacteria 709
1605 Ga0501076_1109836 3300049592 Bacteria 651
1606 Ga0501077_0002603 3300049593 Bacteria 10813
1607 Ga0501077_0003447 3300049593 Bacteria 9494
1608 Ga0501077_0048237 3300049593 Bacteria 2705
1609 Ga0501077_0152205 3300049593 Bacteria 1468
1610 Ga0501077_0243273 3300049593 Bacteria 1144
1611 Ga0501077_0383412 3300049593 Bacteria 898
1612 Ga0501077_0619854 3300049593 Bacteria 695
1613 Ga0501198_152313 3300049649 Bacteria 510
1614 Ga0501202_033027 3300049652 Bacteria 1088
1615 Ga0501202_053765 3300049652 Bacteria 897
1616 Ga0501209_004058 3300049656 Bacteria 2494
1617 Ga0501209_143699 3300049656 Bacteria 716
1618 Ga0501216_009705 3300049660 Bacteria 1539
1619 Ga0501216_046341 3300049660 Bacteria 844
1620 Ga0501216_067720 3300049660 Bacteria 732
1621 Ga0501216_174444 3300049660 Bacteria 522
1622 Ga0501217_119395 3300049661 Bacteria 764
1623 Ga0501217_189877 3300049661 Bacteria 635
1624 Ga0501217_243053 3300049661 Bacteria 577
1625 Ga0501223_008477 3300049663 Bacteria 2097
1626 Ga0501224_001238 3300049664 Bacteria 3359
1627 Ga0501227_018036 3300049665 Bacteria 1598
1628 Ga0501230_009571 3300049667 Bacteria 1494
1629 Ga0501233_004905 3300049668 Bacteria 2474
1630 Ga0501233_101052 3300049668 Bacteria 763
1631 Ga0501235_007524 3300049669 Bacteria 2370
1632 Ga0501236_051361 3300049670 Bacteria 709
1633 Ga0501239_013408 3300049672 Bacteria 938
1634 Ga0501239_025043 3300049672 Bacteria 755
1635 Ga0501239_027332 3300049672 Bacteria 732
1636 Ga0501242_033433 3300049674 Bacteria 704
1637 Ga0501242_052523 3300049674 Bacteria 602
1638 Ga0501243_004221 3300049675 Bacteria 2151
1639 Ga0501243_012793 3300049675 Bacteria 1328
1640 Ga0501247_010669 3300049677 Bacteria 1097
1641 Ga0501249_018960 3300049679 Bacteria 1491
1642 Ga0501249_172577 3300049679 Bacteria 555
1643 Ga0501250_041481 3300049680 Bacteria 677
1644 Ga0501251_076902 3300049681 Bacteria 579
1645 Ga0501253_078750 3300049683 Bacteria 740
1646 Ga0501256_042400 3300049685 Bacteria 543
1647 Ga0501257_008968 3300049686 Bacteria 2254
1648 Ga0501257_118845 3300049686 Bacteria 706
1649 Ga0501257_123774 3300049686 Bacteria 695
1650 Ga0501257_166148 3300049686 Bacteria 617
1651 Ga0501257_166883 3300049686 Bacteria 616
1652 Ga0501258_012429 3300049687 Bacteria 923
1653 Ga0501259_084809 3300049688 Bacteria 702
1654 Ga0501259_143473 3300049688 Bacteria 586
1655 Ga0501261_045769 3300049690 Bacteria 703
1656 Ga0501261_050502 3300049690 Bacteria 680
1657 Ga0501221_065122 3300049704 Bacteria 850
1658 Ga0501221_111637 3300049704 Bacteria 689
1659 Ga0501221_237514 3300049704 Bacteria 519
1660 Ga0501225_0004791 3300049705 Bacteria 4004
1661 Ga0501234_001400 3300049707 Bacteria 3791
1662 Ga0501234_097071 3300049707 Bacteria 533
1663 Ga0501079_0012691 3300049741 Bacteria 6435
1664 Ga0501079_0019559 3300049741 Bacteria 5172
1665 Ga0501079_0035622 3300049741 Bacteria 3832
1666 Ga0501079_0055628 3300049741 Bacteria 3053
1667 Ga0501079_0074686 3300049741 Bacteria 2621
1668 Ga0501079_0162200 3300049741 Bacteria 1743
1669 Ga0501079_0202075 3300049741 Bacteria 1552
1670 Ga0501079_0610392 3300049741 Bacteria 858
1671 Ga0501079_0611211 3300049741 Bacteria 858
1672 Ga0501079_0718441 3300049741 Bacteria 786
1673 Ga0501080_0002929 3300049742 Bacteria 14986
1674 Ga0501080_0004569 3300049742 Bacteria 12338
1675 Ga0501080_0092828 3300049742 Bacteria 2803
1676 Ga0501080_0365132 3300049742 Bacteria 1302
1677 Ga0501080_0404222 3300049742 Bacteria 1228
1678 Ga0501080_0607070 3300049742 Bacteria 971
1679 Ga0501080_1618640 3300049742 Bacteria 548
1680 Ga0501081_0019645 3300049743 Bacteria 4501
1681 Ga0501081_0084738 3300049743 Bacteria 2223
1682 Ga0501081_0099127 3300049743 Bacteria 2058
1683 Ga0501081_0125422 3300049743 Bacteria 1831
1684 Ga0501081_1455032 3300049743 Bacteria 520
1685 Ga0501083_0000071 3300049744 Bacteria 67336
1686 Ga0501083_0014932 3300049744 Bacteria 5433
1687 Ga0501083_0043800 3300049744 Bacteria 3031
1688 Ga0501083_0083137 3300049744 Bacteria 2121
1689 Ga0501083_0212131 3300049744 Bacteria 1262
1690 Ga0501083_0348811 3300049744 Bacteria 962
1691 Ga0501083_0923936 3300049744 Bacteria 568
1692 Ga0501232_010440 3300049757 Bacteria 1047
1693 Ga0501262_049657 3300049759 Bacteria 646
1694 Ga0501263_055879 3300049760 Bacteria 609
1695 Ga0501265_030122 3300049762 Bacteria 777
1696 Ga0501266_003064 3300049763 Bacteria 2080
1697 Ga0501267_004229 3300049764 Bacteria 1327
1698 Ga0501267_008912 3300049764 Bacteria 995
1699 Ga0501268_002758 3300049765 Bacteria 2340
1700 Ga0501268_008026 3300049765 Bacteria 1588
1701 Ga0501268_034317 3300049765 Bacteria 932
1702 Ga0501268_039586 3300049765 Bacteria 883
1703 Ga0501268_046406 3300049765 Bacteria 831
1704 Ga0501268_100477 3300049765 Bacteria 619
1705 Ga0501268_107212 3300049765 Bacteria 606
1706 Ga0501270_012851 3300049767 Bacteria 1150
1707 Ga0501270_070908 3300049767 Bacteria 673
1708 Ga0501270_092479 3300049767 Bacteria 619
1709 Ga0501270_108129 3300049767 Bacteria 590
1710 Ga0501271_002195 3300049768 Bacteria 1725
1711 Ga0501272_013617 3300049769 Bacteria 933
1712 Ga0501273_008374 3300049770 Bacteria 1238
1713 Ga0501273_035883 3300049770 Bacteria 720
1714 Ga0501273_080648 3300049770 Bacteria 541
1715 Ga0501274_002181 3300049771 Bacteria 1526
1716 Ga0501275_043350 3300049772 Bacteria 638
1717 Ga0501283_008388 3300049779 Bacteria 1488
1718 Ga0501035_0124162 3300049822 Bacteria 2254
1719 Ga0501035_0186524 3300049822 Bacteria 1785
1720 Ga0501035_0204036 3300049822 Bacteria 1694
1721 Ga0501035_0583180 3300049822 Bacteria 913
1722 Ga0501035_0792784 3300049822 Bacteria 757
1723 Ga0501035_1113324 3300049822 Bacteria 616
1724 Ga0501044_0013639 3300049823 Bacteria 8783
1725 Ga0501044_0064096 3300049823 Bacteria 3753
1726 Ga0501044_0074963 3300049823 Bacteria 3436
1727 Ga0501044_0431474 3300049823 Bacteria 1227
1728 Ga0501044_0502384 3300049823 Bacteria 1114
1729 Ga0501044_0630322 3300049823 Bacteria 963
1730 Ga0501045_0004175 3300049824 Bacteria 9980
1731 Ga0501045_0032763 3300049824 Bacteria 3766
1732 Ga0501045_0086402 3300049824 Bacteria 2315
1733 Ga0501045_0161793 3300049824 Bacteria 1666
1734 Ga0501045_0241244 3300049824 Bacteria 1345
1735 Ga0501045_0330576 3300049824 Bacteria 1134
1736 Ga0501045_0562930 3300049824 Bacteria 845
1737 Ga0501204_013205 3300049850 Bacteria 1001
1738 Ga0501212_001652 3300049851 Bacteria 2552
1739 Ga0501212_083701 3300049851 Bacteria 580
1740 nmdc:mga05p37_151379_c1 3300050507 Bacteria 2837
1741 nmdc:mga05p37_429595_c1 3300050507 Bacteria 1535
1742 nmdc:mga05p37_518028_c1 3300050507 Bacteria 1365
1743 nmdc:mga05p37_663841_c1 3300050507 Bacteria 1165
1744 nmdc:mga09592_311408_c1 3300050508 Bacteria 1364
1745 nmdc:mga09592_413108_c1 3300050508 Bacteria 1166
1746 nmdc:mga09592_759854_c1 3300050508 Bacteria 822
1747 nmdc:mga0qj67_339484_c1 3300050509 Bacteria 1215
1748 nmdc:mga0qj67_77954_c1 3300050509 Bacteria 2652
1749 nmdc:mga0qj67_793471_c1 3300050509 Bacteria 750
1750 nmdc:mga06r32_1497899_c1 3300050510 Bacteria 615
1751 nmdc:mga06r32_342365_c1 3300050510 Bacteria 1480
1752 nmdc:mga06r32_429330_c1 3300050510 Bacteria 1302
1753 nmdc:mga06r32_46152_c1 3300050510 Bacteria 4157
1754 nmdc:mga06r32_6558_c1 3300050510 Bacteria 10457
1755 nmdc:mga08y16_116742_c1 3300050511 Bacteria 2778
1756 nmdc:mga08y16_144197_c1 3300050511 Bacteria 2475
1757 nmdc:mga08y16_22055_c1 3300050511 Bacteria 6725
1758 nmdc:mga08y16_281933_c1 3300050511 Bacteria 1714
1759 nmdc:mga08y16_288511_c1 3300050511 Bacteria 1692
1760 nmdc:mga08y16_311113_c1 3300050511 Bacteria 1622
1761 nmdc:mga08y16_315866_c1 3300050511 Bacteria 1609
1762 nmdc:mga08y16_699500_c1 3300050511 Bacteria 1014
1763 nmdc:mga0n895_1181678_c1 3300050512 Bacteria 739
1764 nmdc:mga0n895_190360_c1 3300050512 Bacteria 2083
1765 nmdc:mga0n895_21843_c1 3300050512 Bacteria 5991
1766 nmdc:mga0n895_253314_c1 3300050512 Bacteria 1787
1767 nmdc:mga0n895_358036_c1 3300050512 Bacteria 1478
1768 nmdc:mga0n895_464171_c1 3300050512 Bacteria 1278
1769 nmdc:mga0n895_512489_c1 3300050512 Bacteria 1208
1770 nmdc:mga0n895_516105_c1 3300050512 Bacteria 1203
1771 nmdc:mga0n895_573569_c1 3300050512 Bacteria 1133
1772 nmdc:mga0rr50_11870_c2 3300050513 Bacteria 5117
1773 nmdc:mga0rr50_1342219_c1 3300050513 Bacteria 606
1774 nmdc:mga0rr50_274532_c1 3300050513 Bacteria 1405
1775 nmdc:mga0rr50_409005_c1 3300050513 Bacteria 1147
1776 nmdc:mga0rr50_508223_c1 3300050513 Bacteria 1025
1777 nmdc:mga0rr50_677514_c1 3300050513 Bacteria 880
1778 nmdc:mga08x19_145676_c1 3300050514 Bacteria 1602
1779 nmdc:mga08x19_1503_c1 3300050514 Bacteria 14447
1780 nmdc:mga08x19_24882_c1 3300050514 Bacteria 3726
1781 nmdc:mga08x19_98185_c1 3300050514 Bacteria 1940
1782 nmdc:mga0a205_26534_c1 3300050515 Bacteria 5526
1783 nmdc:mga0a205_71485_c1 3300050515 Bacteria 3351
1784 Ga0495601_0410362 3300053077 Bacteria 878
1785 Ga0495655_0204864 3300053083 Bacteria 646
1786 Ga0495655_0287792 3300053083 Bacteria 562
1787 Ga0495595_0402086 3300053084 Bacteria 694
1788 Ga0495595_0672761 3300053084 Bacteria 530
1789 Ga0495619_0033082 3300053085 Bacteria 3357
1790 Ga0495619_0216400 3300053085 Bacteria 1327
1791 Ga0495619_0901547 3300053085 Bacteria 595
1792 Ga0501084_0032504 3300054114 Bacteria 4364
1793 Ga0501084_0040463 3300054114 Bacteria 3899
1794 Ga0501084_0042401 3300054114 Bacteria 3807
1795 Ga0501084_0053363 3300054114 Bacteria 3381
1796 Ga0501084_0055496 3300054114 Bacteria 3314
1797 Ga0501084_0060696 3300054114 Bacteria 3165
1798 Ga0501084_0980505 3300054114 Bacteria 710
1799 Ga0501084_1171158 3300054114 Unclassified 645
1800 Ga0590071_003501 3300059421 Bacteria 3853
1801 Ga0590071_006633 3300059421 Bacteria 2751
1802 Ga0590071_007102 3300059421 Bacteria 2652
1803 Ga0590071_009609 3300059421 Bacteria 2271
1804 Ga0590071_018064 3300059421 Bacteria 1658
1805 Ga0590074_010487 3300059423 Bacteria 1549
1806 Ga0590074_063876 3300059423 Bacteria 687
1807 Ga0590075_044972 3300059424 Bacteria 1130
1808 Ga0590077_064462 3300059426 Bacteria 833
1809 Ga0587084_125122 3300059477 Bacteria 544
1810 Ga0587066_016651 3300059490 Bacteria 1161
1811 Ga0587073_0076206 3300059492 Bacteria 822
1812 Ga0587085_153754 3300059506 Bacteria 533
1813 Ga0587085_183001 3300059506 Bacteria 503
1814 Ga0587091_057781 3300059511 Bacteria 815
1815 Ga0587091_084500 3300059511 Bacteria 718
1816 Ga0587113_036215 3300059625 Bacteria 577
1817 Ga0587067_142955 3300059640 Bacteria 594
1818 Ga0587076_201833 3300059645 Bacteria 512
1819 Ga0587079_047120 3300059647 Bacteria 892
1820 Ga0587071_013833 3300060344 Bacteria 1396
1821 Ga0587071_109511 3300060344 Bacteria 648
1822 Ga0501082_0004163 3300060353 Bacteria 12644
1823 Ga0501082_0019498 3300060353 Bacteria 5847
1824 Ga0501082_0033970 3300060353 Bacteria 4399
1825 Ga0501082_0052165 3300060353 Bacteria 3525
1826 Ga0501082_0061602 3300060353 Bacteria 3230
1827 Ga0501082_0063320 3300060353 Bacteria 3184
1828 Ga0501082_0071941 3300060353 Bacteria 2978
1829 Ga0501082_0112785 3300060353 Bacteria 2354
1830 Ga0501082_0226165 3300060353 Bacteria 1628
1831 Ga0501082_0404454 3300060353 Bacteria 1191
1832 Ga0501082_0462845 3300060353 Bacteria 1108
1833 Ga0501082_0472839 3300060353 Bacteria 1095
1834 Ga0501082_0898369 3300060353 Bacteria 775
1835 Ga0501082_1328866 3300060353 Bacteria 628
1836 Ga0530510_0055415 3300061734 Bacteria 2864
1837 Ga0530510_0113500 3300061734 Bacteria 1986
1838 Ga0530510_0155250 3300061734 Bacteria 1691
1839 Ga0530510_0165371 3300061734 Bacteria 1637
1840 Ga0530510_0331267 3300061734 Bacteria 1142
1841 Ga0530510_0469868 3300061734 Bacteria 952
1842 Ga0530510_1158495 3300061734 Bacteria 592
1843 Ga0530510_1211158 3300061734 Bacteria 579

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300007788 Ga0099795_10031621 Ga0099795_100316214 81
2 3300005471 Ga0070698_100001954 Ga0070698_10000195415 87
3 3300006847 Ga0075431_100445223 Ga0075431_1004452232 87
4 3300006880 Ga0075429_100019213 Ga0075429_1000192137 87
5 3300009147 Ga0114129_10794816 Ga0114129_107948161 87
6 3300005518 Ga0070699_100071160 Ga0070699_1000711602 88
7 3300005530 Ga0070679_100443075 Ga0070679_1004430752 88
8 3300005536 Ga0070697_100352424 Ga0070697_1003524242 88
9 3300005547 Ga0070693_100133923 Ga0070693_1001339231 88
10 3300006847 Ga0075431_100132267 Ga0075431_1001322673 88
11 3300009094 Ga0111539_10250172 Ga0111539_102501723 88
12 3300009147 Ga0114129_10768010 Ga0114129_107680103 88
13 3300013297 Ga0157378_11793893 Ga0157378_117938932 88
14 3300014326 Ga0157380_13177473 Ga0157380_131774731 88
15 3300044673 Ga0453683_0012099 Ga0453683_0012099_1637_1927 88
16 3300044673 Ga0453683_0746648 Ga0453683_0746648_337_627 88
17 3300045051 Ga0451576_0032102 Ga0451576_0032102_409_699 88
18 3300048909 Ga0496106_0064193 Ga0496106_0064193_1443_1760 88
19 3300049592 Ga0501076_0949277 Ga0501076_0949277_324_620 88
20 3300050510 nmdc:mga06r32_46152_c1 nmdc:mga06r32_46152_c1_992_1282 88
21 3300050511 nmdc:mga08y16_288511_c1 nmdc:mga08y16_288511_c1_829_1119 88
22 3300061734 Ga0530510_0469868 Ga0530510_0469868_297_593 88
23 3300005366 Ga0070659_100915992 Ga0070659_1009159922 89
24 3300005436 Ga0070713_101642690 Ga0070713_1016426901 89
25 3300005466 Ga0070685_10262680 Ga0070685_102626802 89
26 3300005543 Ga0070672_102016100 Ga0070672_1020161002 89
27 3300005545 Ga0070695_100210430 Ga0070695_1002104303 89
28 3300005545 Ga0070695_101000870 Ga0070695_1010008702 89
29 3300005546 Ga0070696_100014069 Ga0070696_10001406912 89
30 3300005564 Ga0070664_100229505 Ga0070664_1002295052 89
31 3300025915 Ga0207693_10182171 Ga0207693_101821713 89
32 3300025945 Ga0207679_10741175 Ga0207679_107411752 89
33 3300031733 Ga0316577_10076737 Ga0316577_100767372 89
34 3300046472 Ga0495580_0113415 Ga0495580_0113415_1044_1406 89
35 3300049570 Ga0501033_0773273 Ga0501033_0773273_260_607 89
36 3300049573 Ga0501037_0451245 Ga0501037_0451245_218_565 89
37 3300049575 Ga0501039_0196869 Ga0501039_0196869_639_986 89
38 3300049577 Ga0501041_0023985 Ga0501041_0023985_2249_2596 89
39 3300049580 Ga0501046_0028687 Ga0501046_0028687_1089_1436 89
40 3300049582 Ga0501048_0473535 Ga0501048_0473535_318_665 89
41 3300049586 Ga0501070_0097328 Ga0501070_0097328_918_1265 89
42 3300049587 Ga0501071_0238684 Ga0501071_0238684_872_1219 89
43 3300049588 Ga0501072_0010585 Ga0501072_0010585_1089_1436 89
44 3300049592 Ga0501076_0244716 Ga0501076_0244716_171_518 89
45 3300049741 Ga0501079_0035622 Ga0501079_0035622_2436_2783 89
46 3300049742 Ga0501080_0404222 Ga0501080_0404222_247_594 89
47 3300049822 Ga0501035_0204036 Ga0501035_0204036_953_1300 89
48 3300049824 Ga0501045_0032763 Ga0501045_0032763_2934_3281 89
49 3300054114 Ga0501084_1171158 Ga0501084_1171158_203_550 89
50 3300060353 Ga0501082_0226165 Ga0501082_0226165_828_1175 89
51 3300061734 Ga0530510_0055415 Ga0530510_0055415_1645_1992 89
52 3300005337 Ga0070682_100307437 Ga0070682_1003074371 90
53 3300005535 Ga0070684_100172651 Ga0070684_1001726513 90
54 3300014497 Ga0182008_10006718 Ga0182008_100067185 90
55 3300026075 Ga0207708_12019120 Ga0207708_120191201 90
56 3300046459 Ga0495629_0048696 Ga0495629_0048696_452_793 90
57 3300046473 Ga0495582_0010686 Ga0495582_0010686_1128_1469 90
58 3300046531 Ga0495665_0028776 Ga0495665_0028776_257_598 90
59 3300049705 Ga0501225_0004791 Ga0501225_0004791_404_709 90
60 3300005518 Ga0070699_100922820 Ga0070699_1009228202 91
61 3300005545 Ga0070695_100006011 Ga0070695_10000601110 91
62 3300006847 Ga0075431_100446411 Ga0075431_1004464112 91
63 3300013307 Ga0157372_13205857 Ga0157372_132058571 91
64 3300025909 Ga0207705_10461503 Ga0207705_104615031 91
65 3300031903 Ga0307407_10122956 Ga0307407_101229563 91
66 3300031911 Ga0307412_10361947 Ga0307412_103619471 91
67 3300032005 Ga0307411_10209710 Ga0307411_102097103 91
68 3300044712 Ga0453684_0062783 Ga0453684_0062783_3425_3757 91
69 3300044712 Ga0453684_2365960 Ga0453684_2365960_11_298 91
70 3300049128 Ga0501308_074347 Ga0501308_074347_109_393 91
71 3300049130 Ga0501310_074323 Ga0501310_074323_117_401 91
72 3300049593 Ga0501077_0152205 Ga0501077_0152205_886_1212 91
73 3300049686 Ga0501257_166148 Ga0501257_166148_149_433 91
74 3300050508 nmdc:mga09592_311408_c1 nmdc:mga09592_311408_c1_102_488 91
75 3300050510 nmdc:mga06r32_429330_c1 nmdc:mga06r32_429330_c1_376_762 91
76 3300005339 Ga0070660_101050711 Ga0070660_1010507112 92
77 3300005985 Ga0081539_10023333 Ga0081539_100233334 92
78 3300005985 Ga0081539_10215463 Ga0081539_102154632 92
79 3300006871 Ga0075434_100293178 Ga0075434_1002931782 92
80 3300006914 Ga0075436_100145157 Ga0075436_1001451572 92
81 3300007076 Ga0075435_101501941 Ga0075435_1015019412 92
82 3300013297 Ga0157378_11206617 Ga0157378_112066172 92
83 3300013297 Ga0157378_12778686 Ga0157378_127786861 92
84 3300025931 Ga0207644_10860658 Ga0207644_108606582 92
85 3300028653 Ga0265323_10056890 Ga0265323_100568903 92
86 3300031344 Ga0265316_10934161 Ga0265316_109341612 92
87 3300031712 Ga0265342_10633398 Ga0265342_106333981 92
88 3300041456 Ga0451795_1463064 Ga0451795_1463064_79_381 92
89 3300041486 Ga0451807_2773123 Ga0451807_2773123_59_346 92
90 3300045051 Ga0451576_0153457 Ga0451576_0153457_1983_2336 92
91 3300045051 Ga0451576_0237355 Ga0451576_0237355_1127_1474 92
92 3300045976 Ga0466967_1060643 Ga0466967_1060643_185_526 92
93 3300049571 Ga0501034_0806897 Ga0501034_0806897_110_394 92
94 3300049589 Ga0501073_0174870 Ga0501073_0174870_1162_1455 92
95 3300050512 nmdc:mga0n895_21843_c1 nmdc:mga0n895_21843_c1_2919_3266 92
96 3300050513 nmdc:mga0rr50_677514_c1 nmdc:mga0rr50_677514_c1_101_448 92
97 3300059426 Ga0590077_064462 Ga0590077_064462_427_711 92
98 3300005295 Ga0065707_10717645 Ga0065707_107176452 93
99 3300005329 Ga0070683_100071412 Ga0070683_1000714123 93
100 3300005336 Ga0070680_100163795 Ga0070680_1001637952 93
101 3300005338 Ga0068868_100783022 Ga0068868_1007830221 93
102 3300005354 Ga0070675_100303016 Ga0070675_1003030163 93
103 3300005366 Ga0070659_101444930 Ga0070659_1014449301 93
104 3300005434 Ga0070709_10036785 Ga0070709_100367856 93
105 3300005436 Ga0070713_101027119 Ga0070713_1010271192 93
106 3300005439 Ga0070711_100079312 Ga0070711_1000793122 93
107 3300005440 Ga0070705_100090555 Ga0070705_1000905553 93
108 3300005444 Ga0070694_100825210 Ga0070694_1008252102 93
109 3300005445 Ga0070708_100335677 Ga0070708_1003356772 93
110 3300005445 Ga0070708_100366252 Ga0070708_1003662522 93
111 3300005445 Ga0070708_101463714 Ga0070708_1014637142 93
112 3300005459 Ga0068867_101256728 Ga0068867_1012567282 93
113 3300005468 Ga0070707_100439225 Ga0070707_1004392253 93
114 3300005518 Ga0070699_100096501 Ga0070699_1000965012 93
115 3300005518 Ga0070699_100484652 Ga0070699_1004846522 93
116 3300005518 Ga0070699_101192268 Ga0070699_1011922682 93
117 3300005530 Ga0070679_100321944 Ga0070679_1003219443 93
118 3300005535 Ga0070684_100041533 Ga0070684_1000415334 93
119 3300005536 Ga0070697_100159646 Ga0070697_1001596462 93
120 3300005536 Ga0070697_100255073 Ga0070697_1002550732 93
121 3300005545 Ga0070695_100294995 Ga0070695_1002949952 93
122 3300005546 Ga0070696_100064301 Ga0070696_1000643013 93
123 3300005549 Ga0070704_100529683 Ga0070704_1005296833 93
124 3300005564 Ga0070664_102173296 Ga0070664_1021732962 93
125 3300005577 Ga0068857_100205597 Ga0068857_1002055972 93
126 3300005617 Ga0068859_100725038 Ga0068859_1007250381 93
127 3300005841 Ga0068863_100037716 Ga0068863_1000377163 93
128 3300005842 Ga0068858_101117216 Ga0068858_1011172162 93
129 3300006175 Ga0070712_100602962 Ga0070712_1006029622 93
130 3300006237 Ga0097621_100114591 Ga0097621_1001145913 93
131 3300006358 Ga0068871_100188895 Ga0068871_1001888951 93
132 3300006358 Ga0068871_100790188 Ga0068871_1007901881 93
133 3300006852 Ga0075433_10048621 Ga0075433_100486216 93
134 3300006852 Ga0075433_10475033 Ga0075433_104750333 93
135 3300006871 Ga0075434_100056118 Ga0075434_1000561187 93
136 3300006871 Ga0075434_100881444 Ga0075434_1008814442 93
137 3300006880 Ga0075429_100278121 Ga0075429_1002781213 93
138 3300006914 Ga0075436_100034048 Ga0075436_1000340483 93
139 3300006914 Ga0075436_100506269 Ga0075436_1005062692 93
140 3300006931 Ga0097620_100725107 Ga0097620_1007251073 93
141 3300007265 Ga0099794_10235798 Ga0099794_102357982 93
142 3300009093 Ga0105240_10106067 Ga0105240_101060672 93
143 3300009094 Ga0111539_10875500 Ga0111539_108755003 93
144 3300009098 Ga0105245_11604509 Ga0105245_116045092 93
145 3300009147 Ga0114129_10032671 Ga0114129_1003267111 93
146 3300009147 Ga0114129_10442964 Ga0114129_104429642 93
147 3300009147 Ga0114129_10971514 Ga0114129_109715142 93
148 3300009177 Ga0105248_11222903 Ga0105248_112229031 93
149 3300009177 Ga0105248_12276975 Ga0105248_122769752 93
150 3300010375 Ga0105239_10977094 Ga0105239_109770942 93
151 3300012495 Ga0157323_1004571 Ga0157323_10045712 93
152 3300013104 Ga0157370_10885631 Ga0157370_108856311 93
153 3300013105 Ga0157369_10966313 Ga0157369_109663131 93
154 3300013306 Ga0163162_12210203 Ga0163162_122102031 93
155 3300013308 Ga0157375_10470699 Ga0157375_104706992 93
156 3300025906 Ga0207699_10001230 Ga0207699_100012305 93
157 3300025912 Ga0207707_10068861 Ga0207707_100688616 93
158 3300025915 Ga0207693_10130240 Ga0207693_101302404 93
159 3300025916 Ga0207663_10073763 Ga0207663_100737632 93
160 3300025917 Ga0207660_10088243 Ga0207660_100882433 93
161 3300025921 Ga0207652_10261985 Ga0207652_102619853 93
162 3300025926 Ga0207659_10208752 Ga0207659_102087522 93
163 3300025938 Ga0207704_11302836 Ga0207704_113028361 93
164 3300025939 Ga0207665_11293580 Ga0207665_112935802 93
165 3300025941 Ga0207711_11200148 Ga0207711_112001482 93
166 3300025944 Ga0207661_10004866 Ga0207661_1000486612 93
167 3300025944 Ga0207661_11788099 Ga0207661_117880991 93
168 3300025945 Ga0207679_11249370 Ga0207679_112493701 93
169 3300026035 Ga0207703_12206895 Ga0207703_122068952 93
170 3300026078 Ga0207702_10036288 Ga0207702_100362883 93
171 3300026088 Ga0207641_10070450 Ga0207641_100704505 93
172 3300026089 Ga0207648_10654520 Ga0207648_106545202 93
173 3300026116 Ga0207674_10101100 Ga0207674_101011003 93
174 3300027907 Ga0207428_10011903 Ga0207428_100119035 93
175 3300027907 Ga0207428_10401508 Ga0207428_104015083 93
176 3300028800 Ga0265338_10051633 Ga0265338_100516337 93
177 3300031251 Ga0265327_10087014 Ga0265327_100870142 93
178 3300033528 Ga0316588_1148391 Ga0316588_11483912 93
179 3300035086 Ga0373934_0141970 Ga0373934_0141970_466_759 93
180 3300035119 Ga0373956_0345775 Ga0373956_0345775_34_327 93
181 3300035207 Ga0373942_0199256 Ga0373942_0199256_329_622 93
182 3300036401 Ga0373937_0517704 Ga0373937_0517704_624_917 93
183 3300036401 Ga0373937_1128300 Ga0373937_1128300_265_555 93
184 3300037068 Ga0373925_0078483 Ga0373925_0078483_121_414 93
185 3300037068 Ga0373925_0292667 Ga0373925_0292667_500_793 93
186 3300041486 Ga0451807_1934356 Ga0451807_1934356_76_363 93
187 3300041512 Ga0451853_2725406 Ga0451853_2725406_113_403 93
188 3300044712 Ga0453684_1371210 Ga0453684_1371210_22_306 93
189 3300045049 Ga0466959_0772507 Ga0466959_0772507_176_505 93
190 3300045051 Ga0451576_0297024 Ga0451576_0297024_763_1056 93
191 3300046473 Ga0495582_0197880 Ga0495582_0197880_621_914 93
192 3300046511 Ga0495608_0501057 Ga0495608_0501057_208_501 93
193 3300046514 Ga0495618_0000743 Ga0495618_0000743_3028_3321 93
194 3300046517 Ga0495630_0462261 Ga0495630_0462261_551_844 93
195 3300046526 Ga0495666_0012771 Ga0495666_0012771_3125_3418 93
196 3300046531 Ga0495665_0250977 Ga0495665_0250977_274_567 93
197 3300046533 Ga0495640_0156834 Ga0495640_0156834_501_794 93
198 3300046533 Ga0495640_0629692 Ga0495640_0629692_169_462 93
199 3300046663 Ga0495635_0084340 Ga0495635_0084340_1494_1787 93
200 3300046681 Ga0495647_0139968 Ga0495647_0139968_614_907 93
201 3300046681 Ga0495647_0631783 Ga0495647_0631783_16_309 93
202 3300046684 Ga0495669_0640093 Ga0495669_0640093_56_349 93
203 3300046689 Ga0495613_0399046 Ga0495613_0399046_343_636 93
204 3300047322 Ga0495680_0091581 Ga0495680_0091581_394_687 93
205 3300047322 Ga0495680_0722849 Ga0495680_0722849_282_575 93
206 3300047471 Ga0495684_0116099 Ga0495684_0116099_827_1120 93
207 3300048903 Ga0496100_0109226 Ga0496100_0109226_276_623 93
208 3300048904 Ga0496101_0056945 Ga0496101_0056945_1339_1686 93
209 3300048910 Ga0496107_0344283 Ga0496107_0344283_99_446 93
210 3300048915 Ga0496112_0976500 Ga0496112_0976500_223_567 93
211 3300048917 Ga0496114_1019079 Ga0496114_1019079_303_650 93
212 3300048918 Ga0496115_0082370 Ga0496115_0082370_861_1208 93
213 3300049571 Ga0501034_0000132 Ga0501034_0000132_74310_74594 93
214 3300049572 Ga0501036_0190593 Ga0501036_0190593_694_978 93
215 3300049573 Ga0501037_0693149 Ga0501037_0693149_322_606 93
216 3300049578 Ga0501042_0533108 Ga0501042_0533108_323_607 93
217 3300049579 Ga0501043_0000829 Ga0501043_0000829_6107_6391 93
218 3300049580 Ga0501046_0000117 Ga0501046_0000117_28711_28995 93
219 3300049581 Ga0501047_0130028 Ga0501047_0130028_1560_1844 93
220 3300049582 Ga0501048_0031361 Ga0501048_0031361_2952_3236 93
221 3300049592 Ga0501076_0547773 Ga0501076_0547773_97_387 93
222 3300049741 Ga0501079_0718441 Ga0501079_0718441_42_335 93
223 3300049744 Ga0501083_0000071 Ga0501083_0000071_28724_29008 93
224 3300049822 Ga0501035_0124162 Ga0501035_0124162_367_651 93
225 3300049823 Ga0501044_0013639 Ga0501044_0013639_2461_2745 93
226 3300049823 Ga0501044_0074963 Ga0501044_0074963_2960_3244 93
227 3300050507 nmdc:mga05p37_429595_c1 nmdc:mga05p37_429595_c1_1140_1436 93
228 3300050508 nmdc:mga09592_413108_c1 nmdc:mga09592_413108_c1_691_987 93
229 3300050511 nmdc:mga08y16_22055_c1 nmdc:mga08y16_22055_c1_6201_6494 93
230 3300050511 nmdc:mga08y16_699500_c1 nmdc:mga08y16_699500_c1_232_525 93
231 3300050512 nmdc:mga0n895_516105_c1 nmdc:mga0n895_516105_c1_743_1039 93
232 3300054114 Ga0501084_0980505 Ga0501084_0980505_38_331 93
233 3300059506 Ga0587085_153754 Ga0587085_153754_63_353 93
234 3300060353 Ga0501082_0061602 Ga0501082_0061602_2203_2493 93
235 3300060353 Ga0501082_0112785 Ga0501082_0112785_919_1203 93
236 3300005290 Ga0065712_10074846 Ga0065712_100748462 94
237 3300005290 Ga0065712_10439994 Ga0065712_104399941 94
238 3300005293 Ga0065715_10057212 Ga0065715_100572122 94
239 3300005295 Ga0065707_10432448 Ga0065707_104324481 94
240 3300005327 Ga0070658_10171352 Ga0070658_101713523 94
241 3300005327 Ga0070658_10561985 Ga0070658_105619853 94
242 3300005327 Ga0070658_11648416 Ga0070658_116484162 94
243 3300005328 Ga0070676_10010363 Ga0070676_100103635 94
244 3300005328 Ga0070676_10624397 Ga0070676_106243972 94
245 3300005329 Ga0070683_100058071 Ga0070683_1000580712 94
246 3300005329 Ga0070683_100862286 Ga0070683_1008622861 94
247 3300005329 Ga0070683_100935969 Ga0070683_1009359692 94
248 3300005329 Ga0070683_101036957 Ga0070683_1010369572 94
249 3300005329 Ga0070683_101164768 Ga0070683_1011647682 94
250 3300005329 Ga0070683_101170690 Ga0070683_1011706902 94
251 3300005330 Ga0070690_100021133 Ga0070690_1000211335 94
252 3300005330 Ga0070690_100216988 Ga0070690_1002169883 94
253 3300005331 Ga0070670_100240332 Ga0070670_1002403321 94
254 3300005331 Ga0070670_100322579 Ga0070670_1003225792 94
255 3300005331 Ga0070670_100727273 Ga0070670_1007272732 94
256 3300005333 Ga0070677_10078225 Ga0070677_100782253 94
257 3300005333 Ga0070677_10528114 Ga0070677_105281142 94
258 3300005334 Ga0068869_100874259 Ga0068869_1008742592 94
259 3300005334 Ga0068869_100984090 Ga0068869_1009840901 94
260 3300005334 Ga0068869_100984138 Ga0068869_1009841382 94
261 3300005335 Ga0070666_10093653 Ga0070666_100936534 94
262 3300005335 Ga0070666_10327378 Ga0070666_103273781 94
263 3300005335 Ga0070666_10847074 Ga0070666_108470742 94
264 3300005336 Ga0070680_100464968 Ga0070680_1004649682 94
265 3300005336 Ga0070680_101315673 Ga0070680_1013156731 94
266 3300005337 Ga0070682_100309796 Ga0070682_1003097962 94
267 3300005338 Ga0068868_100141727 Ga0068868_1001417272 94
268 3300005338 Ga0068868_100320488 Ga0068868_1003204883 94
269 3300005339 Ga0070660_101042557 Ga0070660_1010425572 94
270 3300005339 Ga0070660_101184695 Ga0070660_1011846952 94
271 3300005340 Ga0070689_100012783 Ga0070689_1000127837 94
272 3300005340 Ga0070689_100031628 Ga0070689_1000316286 94
273 3300005340 Ga0070689_100038522 Ga0070689_1000385223 94
274 3300005340 Ga0070689_100118383 Ga0070689_1001183833 94
275 3300005340 Ga0070689_101465145 Ga0070689_1014651452 94
276 3300005341 Ga0070691_10186317 Ga0070691_101863172 94
277 3300005343 Ga0070687_100018908 Ga0070687_1000189084 94
278 3300005343 Ga0070687_100038862 Ga0070687_1000388622 94
279 3300005343 Ga0070687_100623865 Ga0070687_1006238652 94
280 3300005344 Ga0070661_100323146 Ga0070661_1003231462 94
281 3300005344 Ga0070661_100383300 Ga0070661_1003833002 94
282 3300005344 Ga0070661_100512303 Ga0070661_1005123032 94
283 3300005344 Ga0070661_101593807 Ga0070661_1015938072 94
284 3300005345 Ga0070692_10236677 Ga0070692_102366771 94
285 3300005345 Ga0070692_10595750 Ga0070692_105957502 94
286 3300005347 Ga0070668_100254925 Ga0070668_1002549253 94
287 3300005347 Ga0070668_100802060 Ga0070668_1008020601 94
288 3300005353 Ga0070669_100025980 Ga0070669_1000259804 94
289 3300005353 Ga0070669_100182704 Ga0070669_1001827043 94
290 3300005354 Ga0070675_100374469 Ga0070675_1003744693 94
291 3300005355 Ga0070671_100159410 Ga0070671_1001594102 94
292 3300005355 Ga0070671_100181105 Ga0070671_1001811054 94
293 3300005355 Ga0070671_101392007 Ga0070671_1013920072 94
294 3300005356 Ga0070674_100075414 Ga0070674_1000754143 94
295 3300005356 Ga0070674_101764079 Ga0070674_1017640791 94
296 3300005364 Ga0070673_100003685 Ga0070673_1000036852 94
297 3300005364 Ga0070673_100024226 Ga0070673_1000242264 94
298 3300005364 Ga0070673_100499084 Ga0070673_1004990841 94
299 3300005365 Ga0070688_100024866 Ga0070688_1000248663 94
300 3300005365 Ga0070688_100028355 Ga0070688_1000283552 94
301 3300005365 Ga0070688_100394857 Ga0070688_1003948572 94
302 3300005366 Ga0070659_100108977 Ga0070659_1001089773 94
303 3300005366 Ga0070659_100116694 Ga0070659_1001166942 94
304 3300005366 Ga0070659_100245326 Ga0070659_1002453263 94
305 3300005367 Ga0070667_100043630 Ga0070667_1000436305 94
306 3300005367 Ga0070667_100093065 Ga0070667_1000930654 94
307 3300005367 Ga0070667_100611410 Ga0070667_1006114101 94
308 3300005435 Ga0070714_100710189 Ga0070714_1007101892 94
309 3300005436 Ga0070713_100065550 Ga0070713_1000655504 94
310 3300005436 Ga0070713_100583856 Ga0070713_1005838562 94
311 3300005437 Ga0070710_10128761 Ga0070710_101287612 94
312 3300005438 Ga0070701_10062320 Ga0070701_100623204 94
313 3300005438 Ga0070701_10624172 Ga0070701_106241721 94
314 3300005440 Ga0070705_101704231 Ga0070705_1017042312 94
315 3300005444 Ga0070694_100555824 Ga0070694_1005558243 94
316 3300005445 Ga0070708_100018839 Ga0070708_1000188397 94
317 3300005455 Ga0070663_101530009 Ga0070663_1015300092 94
318 3300005456 Ga0070678_100053888 Ga0070678_1000538882 94
319 3300005456 Ga0070678_100352274 Ga0070678_1003522741 94
320 3300005457 Ga0070662_100251955 Ga0070662_1002519552 94
321 3300005458 Ga0070681_10160574 Ga0070681_101605743 94
322 3300005458 Ga0070681_10415728 Ga0070681_104157282 94
323 3300005459 Ga0068867_100786095 Ga0068867_1007860952 94
324 3300005466 Ga0070685_10028108 Ga0070685_100281082 94
325 3300005466 Ga0070685_10117314 Ga0070685_101173144 94
326 3300005467 Ga0070706_100502739 Ga0070706_1005027392 94
327 3300005468 Ga0070707_100939600 Ga0070707_1009396002 94
328 3300005518 Ga0070699_100244307 Ga0070699_1002443072 94
329 3300005518 Ga0070699_100864240 Ga0070699_1008642402 94
330 3300005535 Ga0070684_100585927 Ga0070684_1005859272 94
331 3300005535 Ga0070684_100611370 Ga0070684_1006113702 94
332 3300005535 Ga0070684_100976783 Ga0070684_1009767832 94
333 3300005535 Ga0070684_101063874 Ga0070684_1010638742 94
334 3300005539 Ga0068853_100203663 Ga0068853_1002036632 94
335 3300005543 Ga0070672_100038933 Ga0070672_1000389332 94
336 3300005543 Ga0070672_100061495 Ga0070672_1000614953 94
337 3300005543 Ga0070672_100308147 Ga0070672_1003081472 94
338 3300005543 Ga0070672_100322927 Ga0070672_1003229272 94
339 3300005544 Ga0070686_100481563 Ga0070686_1004815632 94
340 3300005545 Ga0070695_100081722 Ga0070695_1000817224 94
341 3300005546 Ga0070696_100640509 Ga0070696_1006405091 94
342 3300005547 Ga0070693_100610723 Ga0070693_1006107232 94
343 3300005547 Ga0070693_100877039 Ga0070693_1008770391 94
344 3300005548 Ga0070665_100124547 Ga0070665_1001245474 94
345 3300005548 Ga0070665_101359628 Ga0070665_1013596282 94
346 3300005563 Ga0068855_100389264 Ga0068855_1003892642 94
347 3300005563 Ga0068855_100817487 Ga0068855_1008174872 94
348 3300005564 Ga0070664_100385803 Ga0070664_1003858032 94
349 3300005564 Ga0070664_100616820 Ga0070664_1006168202 94
350 3300005564 Ga0070664_100738379 Ga0070664_1007383792 94
351 3300005577 Ga0068857_100024265 Ga0068857_1000242653 94
352 3300005578 Ga0068854_100999751 Ga0068854_1009997512 94
353 3300005614 Ga0068856_100902275 Ga0068856_1009022752 94
354 3300005615 Ga0070702_100251803 Ga0070702_1002518032 94
355 3300005615 Ga0070702_100499928 Ga0070702_1004999282 94
356 3300005615 Ga0070702_100565489 Ga0070702_1005654892 94
357 3300005615 Ga0070702_101297416 Ga0070702_1012974161 94
358 3300005616 Ga0068852_100241182 Ga0068852_1002411822 94
359 3300005616 Ga0068852_100495111 Ga0068852_1004951113 94
360 3300005616 Ga0068852_101294854 Ga0068852_1012948541 94
361 3300005617 Ga0068859_100039441 Ga0068859_1000394414 94
362 3300005617 Ga0068859_100624071 Ga0068859_1006240712 94
363 3300005618 Ga0068864_100207043 Ga0068864_1002070432 94
364 3300005618 Ga0068864_100277387 Ga0068864_1002773873 94
365 3300005618 Ga0068864_100736050 Ga0068864_1007360502 94
366 3300005718 Ga0068866_10854617 Ga0068866_108546172 94
367 3300005718 Ga0068866_11036562 Ga0068866_110365622 94
368 3300005719 Ga0068861_100234025 Ga0068861_1002340252 94
369 3300005719 Ga0068861_100912461 Ga0068861_1009124612 94
370 3300005834 Ga0068851_10620593 Ga0068851_106205932 94
371 3300005840 Ga0068870_10011998 Ga0068870_100119985 94
372 3300005840 Ga0068870_10446384 Ga0068870_104463842 94
373 3300005841 Ga0068863_100119013 Ga0068863_1001190133 94
374 3300005841 Ga0068863_100223270 Ga0068863_1002232704 94
375 3300005841 Ga0068863_100276028 Ga0068863_1002760283 94
376 3300005841 Ga0068863_101634340 Ga0068863_1016343402 94
377 3300005842 Ga0068858_100393383 Ga0068858_1003933832 94
378 3300005842 Ga0068858_100400542 Ga0068858_1004005423 94
379 3300005842 Ga0068858_101182529 Ga0068858_1011825292 94
380 3300005843 Ga0068860_100530559 Ga0068860_1005305592 94
381 3300005843 Ga0068860_100708526 Ga0068860_1007085262 94
382 3300005844 Ga0068862_101218995 Ga0068862_1012189952 94
383 3300005937 Ga0081455_10245504 Ga0081455_102455042 94
384 3300006058 Ga0075432_10303059 Ga0075432_103030592 94
385 3300006163 Ga0070715_10091235 Ga0070715_100912352 94
386 3300006163 Ga0070715_10781552 Ga0070715_107815522 94
387 3300006175 Ga0070712_101180134 Ga0070712_1011801342 94
388 3300006237 Ga0097621_100072407 Ga0097621_1000724072 94
389 3300006237 Ga0097621_101288906 Ga0097621_1012889062 94
390 3300006358 Ga0068871_100349234 Ga0068871_1003492343 94
391 3300006358 Ga0068871_100524840 Ga0068871_1005248403 94
392 3300006844 Ga0075428_100483856 Ga0075428_1004838562 94
393 3300006852 Ga0075433_10014445 Ga0075433_100144454 94
394 3300006871 Ga0075434_100039856 Ga0075434_1000398564 94
395 3300006871 Ga0075434_100623359 Ga0075434_1006233592 94
396 3300006880 Ga0075429_101064640 Ga0075429_1010646402 94
397 3300006881 Ga0068865_100094461 Ga0068865_1000944615 94
398 3300006881 Ga0068865_100787660 Ga0068865_1007876602 94
399 3300006881 Ga0068865_100999212 Ga0068865_1009992122 94
400 3300006914 Ga0075436_100000105 Ga0075436_10000010549 94
401 3300006931 Ga0097620_100039441 Ga0097620_1000394414 94
402 3300006931 Ga0097620_100624048 Ga0097620_1006240483 94
403 3300007076 Ga0075435_100039577 Ga0075435_1000395776 94
404 3300007076 Ga0075435_100458431 Ga0075435_1004584313 94
405 3300007076 Ga0075435_101173550 Ga0075435_1011735502 94
406 3300009098 Ga0105245_10470338 Ga0105245_104703381 94
407 3300009098 Ga0105245_10564960 Ga0105245_105649602 94
408 3300009098 Ga0105245_11336780 Ga0105245_113367802 94
409 3300009147 Ga0114129_10603869 Ga0114129_106038692 94
410 3300009148 Ga0105243_10345671 Ga0105243_103456712 94
411 3300009174 Ga0105241_10357475 Ga0105241_103574752 94
412 3300009176 Ga0105242_10149144 Ga0105242_101491444 94
413 3300009176 Ga0105242_11282820 Ga0105242_112828202 94
414 3300009177 Ga0105248_10122714 Ga0105248_101227144 94
415 3300009177 Ga0105248_10673931 Ga0105248_106739312 94
416 3300009177 Ga0105248_11563113 Ga0105248_115631132 94
417 3300009177 Ga0105248_12130074 Ga0105248_121300742 94
418 3300009553 Ga0105249_10747690 Ga0105249_107476902 94
419 3300010375 Ga0105239_11728858 Ga0105239_117288581 94
420 3300010375 Ga0105239_13235952 Ga0105239_132359522 94
421 3300011119 Ga0105246_10135906 Ga0105246_101359062 94
422 3300012494 Ga0157341_1042080 Ga0157341_10420802 94
423 3300012505 Ga0157339_1028615 Ga0157339_10286152 94
424 3300012510 Ga0157316_1015673 Ga0157316_10156732 94
425 3300013102 Ga0157371_10502250 Ga0157371_105022502 94
426 3300013104 Ga0157370_11354269 Ga0157370_113542692 94
427 3300013104 Ga0157370_11584828 Ga0157370_115848282 94
428 3300013105 Ga0157369_12520277 Ga0157369_125202772 94
429 3300013296 Ga0157374_10841745 Ga0157374_108417452 94
430 3300013296 Ga0157374_11612879 Ga0157374_116128792 94
431 3300013296 Ga0157374_11672773 Ga0157374_116727732 94
432 3300013297 Ga0157378_10107312 Ga0157378_101073124 94
433 3300013297 Ga0157378_10392433 Ga0157378_103924332 94
434 3300013297 Ga0157378_11111228 Ga0157378_111112281 94
435 3300013306 Ga0163162_12562676 Ga0163162_125626762 94
436 3300013307 Ga0157372_10353040 Ga0157372_103530404 94
437 3300013307 Ga0157372_11176516 Ga0157372_111765162 94
438 3300013307 Ga0157372_11335691 Ga0157372_113356911 94
439 3300013307 Ga0157372_12916985 Ga0157372_129169851 94
440 3300013308 Ga0157375_10773256 Ga0157375_107732563 94
441 3300013308 Ga0157375_12065547 Ga0157375_120655472 94
442 3300014325 Ga0163163_10308590 Ga0163163_103085902 94
443 3300014325 Ga0163163_10308637 Ga0163163_103086372 94
444 3300014325 Ga0163163_10395870 Ga0163163_103958703 94
445 3300014325 Ga0163163_11090999 Ga0163163_110909992 94
446 3300014968 Ga0157379_10648203 Ga0157379_106482032 94
447 3300014968 Ga0157379_11425219 Ga0157379_114252192 94
448 3300014969 Ga0157376_10346309 Ga0157376_103463092 94
449 3300014969 Ga0157376_10688632 Ga0157376_106886322 94
450 3300014969 Ga0157376_10976839 Ga0157376_109768392 94
451 3300014969 Ga0157376_12139206 Ga0157376_121392062 94
452 3300015262 Ga0182007_10245076 Ga0182007_102450761 94
453 3300017792 Ga0163161_10184027 Ga0163161_101840273 94
454 3300017792 Ga0163161_10551308 Ga0163161_105513081 94
455 3300017792 Ga0163161_12037071 Ga0163161_120370712 94
456 3300020070 Ga0206356_11621450 Ga0206356_116214502 94
457 3300020075 Ga0206349_1309757 Ga0206349_13097572 94
458 3300021384 Ga0213876_10010709 Ga0213876_100107096 94
459 3300021384 Ga0213876_10244513 Ga0213876_102445132 94
460 3300021384 Ga0213876_10253805 Ga0213876_102538052 94
461 3300025271 Ga0207666_1023196 Ga0207666_10231963 94
462 3300025315 Ga0207697_10011385 Ga0207697_100113854 94
463 3300025321 Ga0207656_10283209 Ga0207656_102832092 94
464 3300025893 Ga0207682_10016764 Ga0207682_100167643 94
465 3300025898 Ga0207692_10077555 Ga0207692_100775551 94
466 3300025899 Ga0207642_10008208 Ga0207642_100082082 94
467 3300025899 Ga0207642_10568459 Ga0207642_105684592 94
468 3300025901 Ga0207688_10027380 Ga0207688_100273804 94
469 3300025903 Ga0207680_10025729 Ga0207680_100257295 94
470 3300025903 Ga0207680_10125424 Ga0207680_101254242 94
471 3300025905 Ga0207685_10030303 Ga0207685_100303034 94
472 3300025907 Ga0207645_10018114 Ga0207645_100181149 94
473 3300025907 Ga0207645_10185904 Ga0207645_101859042 94
474 3300025908 Ga0207643_10003364 Ga0207643_1000336412 94
475 3300025909 Ga0207705_10027229 Ga0207705_100272293 94
476 3300025909 Ga0207705_10029211 Ga0207705_100292115 94
477 3300025909 Ga0207705_10278431 Ga0207705_102784312 94
478 3300025909 Ga0207705_10694084 Ga0207705_106940842 94
479 3300025910 Ga0207684_10460484 Ga0207684_104604842 94
480 3300025912 Ga0207707_10861232 Ga0207707_108612323 94
481 3300025914 Ga0207671_11569578 Ga0207671_115695781 94
482 3300025915 Ga0207693_10488937 Ga0207693_104889372 94
483 3300025917 Ga0207660_10681750 Ga0207660_106817502 94
484 3300025917 Ga0207660_11266911 Ga0207660_112669112 94
485 3300025918 Ga0207662_10007104 Ga0207662_100071047 94
486 3300025918 Ga0207662_10037541 Ga0207662_100375413 94
487 3300025918 Ga0207662_10722687 Ga0207662_107226872 94
488 3300025920 Ga0207649_10178625 Ga0207649_101786251 94
489 3300025920 Ga0207649_10525517 Ga0207649_105255172 94
490 3300025920 Ga0207649_10526993 Ga0207649_105269932 94
491 3300025921 Ga0207652_10917515 Ga0207652_109175152 94
492 3300025921 Ga0207652_10968089 Ga0207652_109680892 94
493 3300025922 Ga0207646_10409012 Ga0207646_104090123 94
494 3300025923 Ga0207681_10068781 Ga0207681_100687812 94
495 3300025923 Ga0207681_10085457 Ga0207681_100854572 94
496 3300025923 Ga0207681_10205225 Ga0207681_102052252 94
497 3300025924 Ga0207694_10843780 Ga0207694_108437802 94
498 3300025925 Ga0207650_10010393 Ga0207650_100103932 94
499 3300025925 Ga0207650_10249865 Ga0207650_102498653 94
500 3300025925 Ga0207650_11374444 Ga0207650_113744442 94
501 3300025926 Ga0207659_10022346 Ga0207659_100223464 94
502 3300025926 Ga0207659_10218655 Ga0207659_102186553 94
503 3300025926 Ga0207659_10497834 Ga0207659_104978342 94
504 3300025927 Ga0207687_10400629 Ga0207687_104006292 94
505 3300025927 Ga0207687_11722786 Ga0207687_117227861 94
506 3300025928 Ga0207700_10087723 Ga0207700_100877232 94
507 3300025928 Ga0207700_10483316 Ga0207700_104833163 94
508 3300025929 Ga0207664_10012437 Ga0207664_100124372 94
509 3300025931 Ga0207644_10490086 Ga0207644_104900862 94
510 3300025931 Ga0207644_11627165 Ga0207644_116271652 94
511 3300025932 Ga0207690_10070701 Ga0207690_100707012 94
512 3300025932 Ga0207690_10207916 Ga0207690_102079162 94
513 3300025933 Ga0207706_10150224 Ga0207706_101502243 94
514 3300025933 Ga0207706_11007915 Ga0207706_110079151 94
515 3300025934 Ga0207686_10060773 Ga0207686_100607734 94
516 3300025934 Ga0207686_11131820 Ga0207686_111318201 94
517 3300025935 Ga0207709_10081832 Ga0207709_100818324 94
518 3300025935 Ga0207709_11327797 Ga0207709_113277972 94
519 3300025936 Ga0207670_10004353 Ga0207670_1000435312 94
520 3300025936 Ga0207670_10018648 Ga0207670_100186482 94
521 3300025936 Ga0207670_10107499 Ga0207670_101074993 94
522 3300025936 Ga0207670_10301182 Ga0207670_103011823 94
523 3300025936 Ga0207670_11928134 Ga0207670_119281341 94
524 3300025937 Ga0207669_11052314 Ga0207669_110523142 94
525 3300025940 Ga0207691_10032808 Ga0207691_100328084 94
526 3300025940 Ga0207691_10046795 Ga0207691_100467953 94
527 3300025941 Ga0207711_11895670 Ga0207711_118956702 94
528 3300025941 Ga0207711_12060576 Ga0207711_120605761 94
529 3300025942 Ga0207689_10019641 Ga0207689_100196416 94
530 3300025942 Ga0207689_10053633 Ga0207689_100536332 94
531 3300025944 Ga0207661_10047859 Ga0207661_100478593 94
532 3300025944 Ga0207661_10179812 Ga0207661_101798122 94
533 3300025945 Ga0207679_10192419 Ga0207679_101924192 94
534 3300025945 Ga0207679_10218788 Ga0207679_102187883 94
535 3300025945 Ga0207679_10316793 Ga0207679_103167932 94
536 3300025945 Ga0207679_10752364 Ga0207679_107523641 94
537 3300025945 Ga0207679_10822952 Ga0207679_108229522 94
538 3300025945 Ga0207679_11269312 Ga0207679_112693122 94
539 3300025945 Ga0207679_12138210 Ga0207679_121382101 94
540 3300025949 Ga0207667_10658021 Ga0207667_106580212 94
541 3300025960 Ga0207651_10021908 Ga0207651_100219086 94
542 3300025960 Ga0207651_10071067 Ga0207651_100710676 94
543 3300025960 Ga0207651_10173474 Ga0207651_101734742 94
544 3300025961 Ga0207712_10675161 Ga0207712_106751612 94
545 3300025972 Ga0207668_10281849 Ga0207668_102818492 94
546 3300025972 Ga0207668_10808508 Ga0207668_108085082 94
547 3300025986 Ga0207658_11026684 Ga0207658_110266842 94
548 3300026023 Ga0207677_10216912 Ga0207677_102169122 94
549 3300026023 Ga0207677_10287200 Ga0207677_102872002 94
550 3300026067 Ga0207678_11960182 Ga0207678_119601822 94
551 3300026075 Ga0207708_10112088 Ga0207708_101120884 94
552 3300026075 Ga0207708_10795262 Ga0207708_107952622 94
553 3300026088 Ga0207641_10464731 Ga0207641_104647312 94
554 3300026088 Ga0207641_10611440 Ga0207641_106114401 94
555 3300026088 Ga0207641_11270260 Ga0207641_112702602 94
556 3300026089 Ga0207648_10048391 Ga0207648_100483914 94
557 3300026089 Ga0207648_10203821 Ga0207648_102038213 94
558 3300026095 Ga0207676_10180609 Ga0207676_101806093 94
559 3300026095 Ga0207676_10297097 Ga0207676_102970972 94
560 3300026095 Ga0207676_11001064 Ga0207676_110010641 94
561 3300026095 Ga0207676_11353882 Ga0207676_113538822 94
562 3300026116 Ga0207674_10048180 Ga0207674_100481803 94
563 3300026116 Ga0207674_10082972 Ga0207674_100829723 94
564 3300026116 Ga0207674_11749475 Ga0207674_117494751 94
565 3300026118 Ga0207675_100316888 Ga0207675_1003168883 94
566 3300026121 Ga0207683_10028596 Ga0207683_100285965 94
567 3300026121 Ga0207683_10035142 Ga0207683_100351426 94
568 3300026121 Ga0207683_10127379 Ga0207683_101273792 94
569 3300026142 Ga0207698_11574528 Ga0207698_115745282 94
570 3300027907 Ga0207428_10276111 Ga0207428_102761112 94
571 3300028379 Ga0268266_10237157 Ga0268266_102371572 94
572 3300028380 Ga0268265_10067252 Ga0268265_100672527 94
573 3300028380 Ga0268265_10415410 Ga0268265_104154102 94
574 3300028380 Ga0268265_10574631 Ga0268265_105746311 94
575 3300028381 Ga0268264_10630454 Ga0268264_106304543 94
576 3300031548 Ga0307408_100406940 Ga0307408_1004069402 94
577 3300031548 Ga0307408_100424859 Ga0307408_1004248592 94
578 3300031548 Ga0307408_100864679 Ga0307408_1008646792 94
579 3300031595 Ga0265313_10145536 Ga0265313_101455361 94
580 3300031665 Ga0316575_10385885 Ga0316575_103858852 94
581 3300031691 Ga0316579_10001157 Ga0316579_100011572 94
582 3300031711 Ga0265314_10001956 Ga0265314_1000195620 94
583 3300031727 Ga0316576_10004863 Ga0316576_100048632 94
584 3300031727 Ga0316576_10044118 Ga0316576_100441183 94
585 3300031728 Ga0316578_10001113 Ga0316578_100011135 94
586 3300031731 Ga0307405_10081500 Ga0307405_100815004 94
587 3300031731 Ga0307405_10100967 Ga0307405_101009674 94
588 3300031731 Ga0307405_10116149 Ga0307405_101161492 94
589 3300031733 Ga0316577_10008737 Ga0316577_1000873714 94
590 3300031824 Ga0307413_10316330 Ga0307413_103163302 94
591 3300031824 Ga0307413_10957308 Ga0307413_109573082 94
592 3300031824 Ga0307413_11250943 Ga0307413_112509431 94
593 3300031824 Ga0307413_11340826 Ga0307413_113408262 94
594 3300031852 Ga0307410_10057005 Ga0307410_100570052 94
595 3300031852 Ga0307410_10869233 Ga0307410_108692332 94
596 3300031901 Ga0307406_10824787 Ga0307406_108247872 94
597 3300031901 Ga0307406_11310203 Ga0307406_113102032 94
598 3300031901 Ga0307406_11468420 Ga0307406_114684201 94
599 3300031903 Ga0307407_11254962 Ga0307407_112549622 94
600 3300031911 Ga0307412_10075320 Ga0307412_100753203 94
601 3300031911 Ga0307412_10791122 Ga0307412_107911222 94
602 3300031911 Ga0307412_10863760 Ga0307412_108637602 94
603 3300031995 Ga0307409_100079067 Ga0307409_1000790673 94
604 3300031995 Ga0307409_101843172 Ga0307409_1018431721 94
605 3300031995 Ga0307409_102131522 Ga0307409_1021315222 94
606 3300032002 Ga0307416_102777375 Ga0307416_1027773752 94
607 3300032004 Ga0307414_10756896 Ga0307414_107568962 94
608 3300032005 Ga0307411_10118769 Ga0307411_101187694 94
609 3300032005 Ga0307411_10336063 Ga0307411_103360632 94
610 3300032126 Ga0307415_100077926 Ga0307415_1000779262 94
611 3300032126 Ga0307415_100116777 Ga0307415_1001167772 94
612 3300032126 Ga0307415_100232082 Ga0307415_1002320823 94
613 3300032137 Ga0316585_10001668 Ga0316585_1000166810 94
614 3300032139 Ga0316580_10001460 Ga0316580_1000146014 94
615 3300034817 Ga0373948_0059906 Ga0373948_0059906_81_380 94
616 3300034957 Ga0373938_0246200 Ga0373938_0246200_173_478 94
617 3300035083 Ga0373926_0269996 Ga0373926_0269996_80_418 94
618 3300035085 Ga0373929_0056692 Ga0373929_0056692_239_538 94
619 3300035086 Ga0373934_0454027 Ga0373934_0454027_77_457 94
620 3300035090 Ga0373949_0250311 Ga0373949_0250311_41_346 94
621 3300035111 Ga0373923_0036974 Ga0373923_0036974_1242_1622 94
622 3300035112 Ga0373932_0170684 Ga0373932_0170684_376_675 94
623 3300035114 Ga0373939_0067213 Ga0373939_0067213_521_820 94
624 3300035117 Ga0373953_0014696 Ga0373953_0014696_1914_2249 94
625 3300035118 Ga0373954_0236932 Ga0373954_0236932_213_512 94
626 3300035119 Ga0373956_0149048 Ga0373956_0149048_290_625 94
627 3300035120 Ga0373957_0106980 Ga0373957_0106980_600_935 94
628 3300035121 Ga0373960_0121692 Ga0373960_0121692_354_653 94
629 3300035171 Ga0373946_0676961 Ga0373946_0676961_111_410 94
630 3300035172 Ga0373955_0088617 Ga0373955_0088617_481_816 94
631 3300035207 Ga0373942_0037456 Ga0373942_0037456_302_601 94
632 3300035241 Ga0373961_0000555 Ga0373961_0000555_10382_10669 94
633 3300035242 Ga0373962_0259282 Ga0373962_0259282_212_511 94
634 3300035398 Ga0316574_0007172 Ga0316574_0007172_2938_3222 94
635 3300035398 Ga0316574_0331037 Ga0316574_0331037_604_888 94
636 3300035398 Ga0316574_0355322 Ga0316574_0355322_620_904 94
637 3300035410 Ga0373924_0040307 Ga0373924_0040307_544_879 94
638 3300035691 Ga0373931_0233081 Ga0373931_0233081_224_523 94
639 3300035691 Ga0373931_0424587 Ga0373931_0424587_235_543 94
640 3300035724 Ga0373933_0002765 Ga0373933_0002765_3732_4067 94
641 3300036401 Ga0373937_0001688 Ga0373937_0001688_17362_17697 94
642 3300036401 Ga0373937_0063603 Ga0373937_0063603_1998_2303 94
643 3300036401 Ga0373937_0245517 Ga0373937_0245517_180_560 94
644 3300036401 Ga0373937_1029058 Ga0373937_1029058_145_483 94
645 3300036401 Ga0373937_1565581 Ga0373937_1565581_116_511 94
646 3300036647 Ga0316582_0015599 Ga0316582_0015599_2347_2631 94
647 3300036647 Ga0316582_0945318 Ga0316582_0945318_235_519 94
648 3300036712 Ga0316584_0007216 Ga0316584_0007216_2440_2724 94
649 3300037068 Ga0373925_0176928 Ga0373925_0176928_823_1188 94
650 3300037312 Ga0395899_0151372 Ga0395899_0151372_1261_1560 94
651 3300037418 Ga0395900_0024491 Ga0395900_0024491_271_570 94
652 3300037466 Ga0395898_1598012 Ga0395898_1598012_224_520 94
653 3300037471 Ga0395905_0025260 Ga0395905_0025260_497_796 94
654 3300037471 Ga0395905_0067530 Ga0395905_0067530_2371_2670 94
655 3300037471 Ga0395905_1736610 Ga0395905_1736610_67_372 94
656 3300037853 Ga0436364_0100568 Ga0436364_0100568_174_491 94
657 3300037853 Ga0436364_1537478 Ga0436364_1537478_18_326 94
658 3300038443 Ga0395901_0001770 Ga0395901_0001770_5615_5914 94
659 3300039437 Ga0436365_0223155 Ga0436365_0223155_458_757 94
660 3300039437 Ga0436365_0408308 Ga0436365_0408308_1708_2007 94
661 3300039437 Ga0436365_1264253 Ga0436365_1264253_294_599 94
662 3300039437 Ga0436365_1424311 Ga0436365_1424311_163_486 94
663 3300039437 Ga0436365_1599614 Ga0436365_1599614_72_398 94
664 3300041406 Ga0439439_0178061 Ga0439439_0178061_192_494 94
665 3300041460 Ga0451802_1318879 Ga0451802_1318879_131_436 94
666 3300041999 Ga0439433_0143812 Ga0439433_0143812_247_534 94
667 3300042876 Ga0451577_0208168 Ga0451577_0208168_524_823 94
668 3300044673 Ga0453683_0714274 Ga0453683_0714274_62_361 94
669 3300044683 Ga0466965_0134875 Ga0466965_0134875_820_1116 94
670 3300044683 Ga0466965_0435969 Ga0466965_0435969_45_341 94
671 3300044693 Ga0466961_0216372 Ga0466961_0216372_37_333 94
672 3300044694 Ga0466963_0055834 Ga0466963_0055834_1155_1484 94
673 3300044712 Ga0453684_0714362 Ga0453684_0714362_408_698 94
674 3300044765 Ga0466970_0649912 Ga0466970_0649912_109_405 94
675 3300044842 Ga0466957_0209596 Ga0466957_0209596_929_1258 94
676 3300044901 Ga0466960_0145973 Ga0466960_0145973_440_736 94
677 3300045049 Ga0466959_1022370 Ga0466959_1022370_72_371 94
678 3300045051 Ga0451576_0308436 Ga0451576_0308436_1331_1630 94
679 3300045051 Ga0451576_0388486 Ga0451576_0388486_850_1197 94
680 3300045836 Ga0466958_0629169 Ga0466958_0629169_313_612 94
681 3300045976 Ga0466967_0277810 Ga0466967_0277810_444_764 94
682 3300046454 Ga0495592_0402576 Ga0495592_0402576_366_665 94
683 3300046454 Ga0495592_0498975 Ga0495592_0498975_213_548 94
684 3300046455 Ga0495603_0021202 Ga0495603_0021202_1303_1602 94
685 3300046455 Ga0495603_0043390 Ga0495603_0043390_1290_1685 94
686 3300046459 Ga0495629_0073936 Ga0495629_0073936_1941_2273 94
687 3300046459 Ga0495629_0077215 Ga0495629_0077215_1279_1674 94
688 3300046459 Ga0495629_0615914 Ga0495629_0615914_167_547 94
689 3300046459 Ga0495629_0678831 Ga0495629_0678831_92_391 94
690 3300046462 Ga0495651_0017188 Ga0495651_0017188_2567_2902 94
691 3300046462 Ga0495651_0084014 Ga0495651_0084014_434_814 94
692 3300046462 Ga0495651_0243225 Ga0495651_0243225_368_763 94
693 3300046463 Ga0495653_0026437 Ga0495653_0026437_3911_4291 94
694 3300046472 Ga0495580_0016230 Ga0495580_0016230_2375_2740 94
695 3300046473 Ga0495582_0014832 Ga0495582_0014832_657_1052 94
696 3300046473 Ga0495582_0109507 Ga0495582_0109507_898_1197 94
697 3300046474 Ga0495605_0283024 Ga0495605_0283024_65_370 94
698 3300046474 Ga0495605_0494223 Ga0495605_0494223_52_360 94
699 3300046475 Ga0495639_0004714 Ga0495639_0004714_2733_3098 94
700 3300046475 Ga0495639_0067391 Ga0495639_0067391_485_793 94
701 3300046476 Ga0495662_0097571 Ga0495662_0097571_860_1159 94
702 3300046476 Ga0495662_0117049 Ga0495662_0117049_789_1184 94
703 3300046477 Ga0495664_0463726 Ga0495664_0463726_175_570 94
704 3300046499 Ga0495594_0005611 Ga0495594_0005611_3162_3527 94
705 3300046499 Ga0495594_0069873 Ga0495594_0069873_1462_1794 94
706 3300046499 Ga0495594_0118996 Ga0495594_0118996_675_1070 94
707 3300046500 Ga0495596_0010087 Ga0495596_0010087_2607_2912 94
708 3300046506 Ga0495583_0164843 Ga0495583_0164843_193_498 94
709 3300046511 Ga0495608_0033181 Ga0495608_0033181_2676_3056 94
710 3300046511 Ga0495608_0103342 Ga0495608_0103342_181_576 94
711 3300046511 Ga0495608_0266708 Ga0495608_0266708_247_582 94
712 3300046514 Ga0495618_0036169 Ga0495618_0036169_2426_2806 94
713 3300046514 Ga0495618_0422616 Ga0495618_0422616_68_463 94
714 3300046514 Ga0495618_0821398 Ga0495618_0821398_47_346 94
715 3300046516 Ga0495628_0214703 Ga0495628_0214703_852_1247 94
716 3300046516 Ga0495628_0229371 Ga0495628_0229371_500_799 94
717 3300046517 Ga0495630_0094702 Ga0495630_0094702_1473_1868 94
718 3300046517 Ga0495630_0176568 Ga0495630_0176568_973_1272 94
719 3300046517 Ga0495630_0559980 Ga0495630_0559980_226_591 94
720 3300046517 Ga0495630_0953767 Ga0495630_0953767_126_506 94
721 3300046525 Ga0495663_0020324 Ga0495663_0020324_277_582 94
722 3300046525 Ga0495663_0020379 Ga0495663_0020379_332_637 94
723 3300046528 Ga0495642_0053960 Ga0495642_0053960_641_946 94
724 3300046529 Ga0495652_0123654 Ga0495652_0123654_781_1116 94
725 3300046529 Ga0495652_0156344 Ga0495652_0156344_425_820 94
726 3300046531 Ga0495665_0014539 Ga0495665_0014539_1462_1827 94
727 3300046533 Ga0495640_0185177 Ga0495640_0185177_192_572 94
728 3300046535 Ga0495586_0015359 Ga0495586_0015359_1125_1463 94
729 3300046535 Ga0495586_0126327 Ga0495586_0126327_29_409 94
730 3300046535 Ga0495586_0174630 Ga0495586_0174630_136_531 94
731 3300046535 Ga0495586_0319161 Ga0495586_0319161_191_556 94
732 3300046535 Ga0495586_0508105 Ga0495586_0508105_237_536 94
733 3300046536 Ga0495587_0267041 Ga0495587_0267041_566_937 94
734 3300046536 Ga0495587_0447806 Ga0495587_0447806_316_621 94
735 3300046536 Ga0495587_0619377 Ga0495587_0619377_51_425 94
736 3300046537 Ga0495598_0268802 Ga0495598_0268802_296_622 94
737 3300046539 Ga0495621_0041710 Ga0495621_0041710_852_1157 94
738 3300046539 Ga0495621_0053555 Ga0495621_0053555_712_1020 94
739 3300046543 Ga0495645_0013239 Ga0495645_0013239_48_383 94
740 3300046543 Ga0495645_0238829 Ga0495645_0238829_596_991 94
741 3300046543 Ga0495645_0680694 Ga0495645_0680694_138_437 94
742 3300046557 Ga0495622_0380357 Ga0495622_0380357_93_458 94
743 3300046559 Ga0495667_0016331 Ga0495667_0016331_1592_1972 94
744 3300046559 Ga0495667_0063143 Ga0495667_0063143_1856_2251 94
745 3300046559 Ga0495667_0220730 Ga0495667_0220730_636_941 94
746 3300046615 Ga0495656_0085019 Ga0495656_0085019_950_1255 94
747 3300046642 Ga0495634_0150620 Ga0495634_0150620_668_967 94
748 3300046642 Ga0495634_0171853 Ga0495634_0171853_83_463 94
749 3300046642 Ga0495634_0192667 Ga0495634_0192667_596_991 94
750 3300046663 Ga0495635_0054906 Ga0495635_0054906_2015_2395 94
751 3300046665 Ga0495661_0341275 Ga0495661_0341275_170_475 94
752 3300046675 Ga0495657_0049025 Ga0495657_0049025_2342_2647 94
753 3300046675 Ga0495657_0113082 Ga0495657_0113082_684_992 94
754 3300046678 Ga0495599_0010652 Ga0495599_0010652_1806_2201 94
755 3300046678 Ga0495599_0015785 Ga0495599_0015785_3133_3468 94
756 3300046678 Ga0495599_0224563 Ga0495599_0224563_599_970 94
757 3300046679 Ga0495623_0017452 Ga0495623_0017452_115_450 94
758 3300046679 Ga0495623_0082831 Ga0495623_0082831_43_423 94
759 3300046679 Ga0495623_0108146 Ga0495623_0108146_1251_1556 94
760 3300046680 Ga0495646_0016342 Ga0495646_0016342_937_1332 94
761 3300046680 Ga0495646_0626111 Ga0495646_0626111_48_383 94
762 3300046683 Ga0495658_0060006 Ga0495658_0060006_143_442 94
763 3300046683 Ga0495658_0110421 Ga0495658_0110421_770_1165 94
764 3300046684 Ga0495669_0163695 Ga0495669_0163695_70_375 94
765 3300046689 Ga0495613_0035641 Ga0495613_0035641_3208_3588 94
766 3300046689 Ga0495613_0182583 Ga0495613_0182583_842_1141 94
767 3300046689 Ga0495613_0467808 Ga0495613_0467808_213_608 94
768 3300046690 Ga0495624_0148945 Ga0495624_0148945_307_702 94
769 3300046809 Ga0495600_0043998 Ga0495600_0043998_2544_2879 94
770 3300047315 Ga0495581_0162192 Ga0495581_0162192_430_762 94
771 3300047315 Ga0495581_0661507 Ga0495581_0661507_77_376 94
772 3300047315 Ga0495581_0675231 Ga0495581_0675231_134_529 94
773 3300047315 Ga0495581_0843010 Ga0495581_0843010_35_340 94
774 3300047317 Ga0495604_0027250 Ga0495604_0027250_3984_4364 94
775 3300047317 Ga0495604_0104964 Ga0495604_0104964_400_795 94
776 3300047318 Ga0495636_0036783 Ga0495636_0036783_253_603 94
777 3300047318 Ga0495636_0174422 Ga0495636_0174422_72_377 94
778 3300047319 Ga0495674_0022976 Ga0495674_0022976_3191_3571 94
779 3300047319 Ga0495674_0260821 Ga0495674_0260821_166_501 94
780 3300047319 Ga0495674_0899048 Ga0495674_0899048_182_577 94
781 3300047321 Ga0495676_0582121 Ga0495676_0582121_145_444 94
782 3300047322 Ga0495680_0013035 Ga0495680_0013035_1802_2182 94
783 3300047322 Ga0495680_0287504 Ga0495680_0287504_596_991 94
784 3300047322 Ga0495680_0442587 Ga0495680_0442587_503_838 94
785 3300047322 Ga0495680_0893525 Ga0495680_0893525_31_330 94
786 3300047444 Ga0495675_0079198 Ga0495675_0079198_756_1091 94
787 3300047444 Ga0495675_0170389 Ga0495675_0170389_968_1273 94
788 3300047445 Ga0495677_0106504 Ga0495677_0106504_554_859 94
789 3300047447 Ga0495685_031250 Ga0495685_031250_351_656 94
790 3300047471 Ga0495684_0071242 Ga0495684_0071242_1176_1541 94
791 3300047471 Ga0495684_0169445 Ga0495684_0169445_1253_1552 94
792 3300047471 Ga0495684_0271682 Ga0495684_0271682_519_854 94
793 3300047471 Ga0495684_0288272 Ga0495684_0288272_206_586 94
794 3300047471 Ga0495684_0504246 Ga0495684_0504246_285_680 94
795 3300047673 Ga0495593_0201702 Ga0495593_0201702_169_474 94
796 3300048088 Ga0495602_0013466 Ga0495602_0013466_4159_4539 94
797 3300048088 Ga0495602_0100827 Ga0495602_0100827_1970_2305 94
798 3300048088 Ga0495602_0239437 Ga0495602_0239437_316_711 94
799 3300048088 Ga0495602_0401675 Ga0495602_0401675_639_944 94
800 3300048088 Ga0495602_0923954 Ga0495602_0923954_131_436 94
801 3300048090 Ga0495615_0252670 Ga0495615_0252670_157_462 94
802 3300048903 Ga0496100_0289027 Ga0496100_0289027_623_928 94
803 3300048904 Ga0496101_1124416 Ga0496101_1124416_125_430 94
804 3300048907 Ga0496104_0399240 Ga0496104_0399240_532_837 94
805 3300048908 Ga0496105_0059694 Ga0496105_0059694_1380_1685 94
806 3300048909 Ga0496106_0578785 Ga0496106_0578785_545_850 94
807 3300048910 Ga0496107_0711641 Ga0496107_0711641_338_643 94
808 3300048911 Ga0496108_1009386 Ga0496108_1009386_277_582 94
809 3300048913 Ga0496110_0151553 Ga0496110_0151553_323_628 94
810 3300048914 Ga0496111_0553796 Ga0496111_0553796_443_748 94
811 3300048915 Ga0496112_0104391 Ga0496112_0104391_922_1227 94
812 3300048916 Ga0496113_0156046 Ga0496113_0156046_579_884 94
813 3300048916 Ga0496113_1115274 Ga0496113_1115274_256_564 94
814 3300048917 Ga0496114_0000001 Ga0496114_0000001_519143_519430 94
815 3300049127 Ga0501306_024127 Ga0501306_024127_380_727 94
816 3300049127 Ga0501306_049510 Ga0501306_049510_341_637 94
817 3300049162 Ga0501307_001003 Ga0501307_001003_1809_2156 94
818 3300049529 Ga0501313_033044 Ga0501313_033044_225_521 94
819 3300049529 Ga0501313_066371 Ga0501313_066371_25_369 94
820 3300049530 Ga0501314_036139 Ga0501314_036139_145_492 94
821 3300049531 Ga0501315_027200 Ga0501315_027200_329_625 94
822 3300049533 Ga0501317_089645 Ga0501317_089645_217_513 94
823 3300049569 Ga0501032_0082763 Ga0501032_0082763_1696_2001 94
824 3300049571 Ga0501034_0196452 Ga0501034_0196452_869_1174 94
825 3300049574 Ga0501038_0011902 Ga0501038_0011902_6549_6854 94
826 3300049579 Ga0501043_0047600 Ga0501043_0047600_143_448 94
827 3300049580 Ga0501046_0447386 Ga0501046_0447386_380_685 94
828 3300049581 Ga0501047_0029942 Ga0501047_0029942_3986_4291 94
829 3300049582 Ga0501048_0620527 Ga0501048_0620527_339_626 94
830 3300049583 Ga0501067_0039490 Ga0501067_0039490_2213_2500 94
831 3300049584 Ga0501068_0001673 Ga0501068_0001673_6630_6917 94
832 3300049586 Ga0501070_0171248 Ga0501070_0171248_501_806 94
833 3300049591 Ga0501075_0006664 Ga0501075_0006664_4615_4902 94
834 3300049593 Ga0501077_0003447 Ga0501077_0003447_2899_3186 94
835 3300049668 Ga0501233_101052 Ga0501233_101052_219_524 94
836 3300049672 Ga0501239_025043 Ga0501239_025043_128_427 94
837 3300049742 Ga0501080_0002929 Ga0501080_0002929_11801_12088 94
838 3300049765 Ga0501268_039586 Ga0501268_039586_379_684 94
839 3300049765 Ga0501268_046406 Ga0501268_046406_163_459 94
840 3300049765 Ga0501268_107212 Ga0501268_107212_134_430 94
841 3300049770 Ga0501273_080648 Ga0501273_080648_27_326 94
842 3300049823 Ga0501044_0064096 Ga0501044_0064096_1959_2264 94
843 3300049823 Ga0501044_0630322 Ga0501044_0630322_443_766 94
844 3300050507 nmdc:mga05p37_663841_c1 nmdc:mga05p37_663841_c1_234_551 94
845 3300050511 nmdc:mga08y16_281933_c1 nmdc:mga08y16_281933_c1_167_472 94
846 3300050511 nmdc:mga08y16_315866_c1 nmdc:mga08y16_315866_c1_1174_1473 94
847 3300050512 nmdc:mga0n895_190360_c1 nmdc:mga0n895_190360_c1_1008_1304 94
848 3300050512 nmdc:mga0n895_253314_c1 nmdc:mga0n895_253314_c1_517_840 94
849 3300050512 nmdc:mga0n895_464171_c1 nmdc:mga0n895_464171_c1_221_520 94
850 3300050512 nmdc:mga0n895_573569_c1 nmdc:mga0n895_573569_c1_129_446 94
851 3300050513 nmdc:mga0rr50_1342219_c1 nmdc:mga0rr50_1342219_c1_218_505 94
852 3300050513 nmdc:mga0rr50_409005_c1 nmdc:mga0rr50_409005_c1_295_618 94
853 3300050514 nmdc:mga08x19_1503_c1 nmdc:mga08x19_1503_c1_10259_10546 94
854 3300050514 nmdc:mga08x19_24882_c1 nmdc:mga08x19_24882_c1_762_1085 94
855 3300053077 Ga0495601_0410362 Ga0495601_0410362_46_441 94
856 3300053083 Ga0495655_0204864 Ga0495655_0204864_70_357 94
857 3300053083 Ga0495655_0287792 Ga0495655_0287792_87_392 94
858 3300053084 Ga0495595_0402086 Ga0495595_0402086_292_627 94
859 3300053084 Ga0495595_0672761 Ga0495595_0672761_18_398 94
860 3300053085 Ga0495619_0033082 Ga0495619_0033082_2423_2758 94
861 3300053085 Ga0495619_0216400 Ga0495619_0216400_156_536 94
862 3300053085 Ga0495619_0901547 Ga0495619_0901547_130_429 94
863 3300059421 Ga0590071_006633 Ga0590071_006633_709_1017 94
864 3300059506 Ga0587085_183001 Ga0587085_183001_160_459 94
865 3300059511 Ga0587091_084500 Ga0587091_084500_362_649 94
866 3300061734 Ga0530510_1211158 Ga0530510_1211158_199_486 94
867 3300004799 Ga0058863_10086968 Ga0058863_100869684 95
868 3300004800 Ga0058861_11789312 Ga0058861_117893122 95
869 3300004803 Ga0058862_12643353 Ga0058862_126433532 95
870 3300005290 Ga0065712_10815210 Ga0065712_108152102 95
871 3300005293 Ga0065715_10299813 Ga0065715_102998132 95
872 3300005293 Ga0065715_10811487 Ga0065715_108114872 95
873 3300005327 Ga0070658_11812599 Ga0070658_118125991 95
874 3300005329 Ga0070683_100366719 Ga0070683_1003667193 95
875 3300005330 Ga0070690_100086374 Ga0070690_1000863743 95
876 3300005331 Ga0070670_100806131 Ga0070670_1008061312 95
877 3300005334 Ga0068869_100892987 Ga0068869_1008929871 95
878 3300005334 Ga0068869_100907740 Ga0068869_1009077401 95
879 3300005335 Ga0070666_10215569 Ga0070666_102155693 95
880 3300005336 Ga0070680_100003421 Ga0070680_10000342118 95
881 3300005336 Ga0070680_100011604 Ga0070680_1000116042 95
882 3300005336 Ga0070680_100048050 Ga0070680_1000480504 95
883 3300005336 Ga0070680_100156870 Ga0070680_1001568703 95
884 3300005336 Ga0070680_100321809 Ga0070680_1003218093 95
885 3300005336 Ga0070680_100369443 Ga0070680_1003694432 95
886 3300005336 Ga0070680_100466058 Ga0070680_1004660582 95
887 3300005337 Ga0070682_101120793 Ga0070682_1011207932 95
888 3300005338 Ga0068868_101742480 Ga0068868_1017424801 95
889 3300005339 Ga0070660_100100995 Ga0070660_1001009952 95
890 3300005339 Ga0070660_100250698 Ga0070660_1002506982 95
891 3300005339 Ga0070660_100293209 Ga0070660_1002932093 95
892 3300005341 Ga0070691_10028966 Ga0070691_100289663 95
893 3300005344 Ga0070661_100028453 Ga0070661_1000284534 95
894 3300005344 Ga0070661_100034455 Ga0070661_1000344559 95
895 3300005344 Ga0070661_100459024 Ga0070661_1004590242 95
896 3300005344 Ga0070661_101477934 Ga0070661_1014779341 95
897 3300005344 Ga0070661_101786665 Ga0070661_1017866651 95
898 3300005345 Ga0070692_11148700 Ga0070692_111487002 95
899 3300005347 Ga0070668_101483884 Ga0070668_1014838842 95
900 3300005353 Ga0070669_100218637 Ga0070669_1002186371 95
901 3300005354 Ga0070675_101472671 Ga0070675_1014726711 95
902 3300005354 Ga0070675_101702594 Ga0070675_1017025941 95
903 3300005355 Ga0070671_100079081 Ga0070671_1000790812 95
904 3300005355 Ga0070671_101835633 Ga0070671_1018356331 95
905 3300005356 Ga0070674_101938091 Ga0070674_1019380912 95
906 3300005364 Ga0070673_100153788 Ga0070673_1001537882 95
907 3300005366 Ga0070659_100058242 Ga0070659_1000582427 95
908 3300005366 Ga0070659_100601719 Ga0070659_1006017191 95
909 3300005366 Ga0070659_101134747 Ga0070659_1011347471 95
910 3300005434 Ga0070709_10171398 Ga0070709_101713982 95
911 3300005435 Ga0070714_100000411 Ga0070714_10000041135 95
912 3300005435 Ga0070714_100139880 Ga0070714_1001398801 95
913 3300005435 Ga0070714_100462329 Ga0070714_1004623291 95
914 3300005439 Ga0070711_100034546 Ga0070711_1000345469 95
915 3300005440 Ga0070705_100020535 Ga0070705_1000205359 95
916 3300005441 Ga0070700_101012060 Ga0070700_1010120601 95
917 3300005444 Ga0070694_100977120 Ga0070694_1009771202 95
918 3300005445 Ga0070708_100003800 Ga0070708_1000038002 95
919 3300005445 Ga0070708_100055604 Ga0070708_1000556045 95
920 3300005445 Ga0070708_101042104 Ga0070708_1010421041 95
921 3300005455 Ga0070663_100005346 Ga0070663_10000534611 95
922 3300005455 Ga0070663_100094822 Ga0070663_1000948225 95
923 3300005455 Ga0070663_100798646 Ga0070663_1007986462 95
924 3300005457 Ga0070662_100054587 Ga0070662_1000545875 95
925 3300005457 Ga0070662_100704165 Ga0070662_1007041652 95
926 3300005458 Ga0070681_10035181 Ga0070681_100351815 95
927 3300005458 Ga0070681_10116033 Ga0070681_101160334 95
928 3300005458 Ga0070681_10171280 Ga0070681_101712803 95
929 3300005458 Ga0070681_10225090 Ga0070681_102250903 95
930 3300005458 Ga0070681_10227553 Ga0070681_102275533 95
931 3300005458 Ga0070681_10477193 Ga0070681_104771932 95
932 3300005458 Ga0070681_10498751 Ga0070681_104987512 95
933 3300005458 Ga0070681_10758644 Ga0070681_107586442 95
934 3300005458 Ga0070681_11251139 Ga0070681_112511391 95
935 3300005459 Ga0068867_101331788 Ga0068867_1013317881 95
936 3300005467 Ga0070706_100006592 Ga0070706_1000065928 95
937 3300005467 Ga0070706_100171538 Ga0070706_1001715384 95
938 3300005467 Ga0070706_100354241 Ga0070706_1003542412 95
939 3300005468 Ga0070707_100016356 Ga0070707_1000163564 95
940 3300005468 Ga0070707_100019047 Ga0070707_1000190474 95
941 3300005468 Ga0070707_100948615 Ga0070707_1009486151 95
942 3300005468 Ga0070707_100995176 Ga0070707_1009951762 95
943 3300005471 Ga0070698_100024253 Ga0070698_1000242538 95
944 3300005471 Ga0070698_100052230 Ga0070698_1000522305 95
945 3300005471 Ga0070698_100466389 Ga0070698_1004663892 95
946 3300005471 Ga0070698_102150056 Ga0070698_1021500562 95
947 3300005518 Ga0070699_100003912 Ga0070699_10000391222 95
948 3300005518 Ga0070699_101175842 Ga0070699_1011758422 95
949 3300005518 Ga0070699_101184395 Ga0070699_1011843952 95
950 3300005518 Ga0070699_101674234 Ga0070699_1016742342 95
951 3300005530 Ga0070679_100014655 Ga0070679_1000146556 95
952 3300005530 Ga0070679_100019482 Ga0070679_10001948214 95
953 3300005530 Ga0070679_100045568 Ga0070679_1000455689 95
954 3300005530 Ga0070679_100165137 Ga0070679_1001651373 95
955 3300005530 Ga0070679_100243051 Ga0070679_1002430512 95
956 3300005530 Ga0070679_100249770 Ga0070679_1002497703 95
957 3300005530 Ga0070679_100609953 Ga0070679_1006099533 95
958 3300005535 Ga0070684_100298128 Ga0070684_1002981283 95
959 3300005536 Ga0070697_100173667 Ga0070697_1001736673 95
960 3300005539 Ga0068853_100040762 Ga0068853_1000407627 95
961 3300005539 Ga0068853_100176850 Ga0068853_1001768502 95
962 3300005539 Ga0068853_100355905 Ga0068853_1003559052 95
963 3300005539 Ga0068853_101652526 Ga0068853_1016525261 95
964 3300005543 Ga0070672_100079274 Ga0070672_1000792743 95
965 3300005544 Ga0070686_100365031 Ga0070686_1003650313 95
966 3300005546 Ga0070696_100199231 Ga0070696_1001992312 95
967 3300005546 Ga0070696_100287300 Ga0070696_1002873002 95
968 3300005546 Ga0070696_100698752 Ga0070696_1006987522 95
969 3300005547 Ga0070693_100700302 Ga0070693_1007003022 95
970 3300005548 Ga0070665_102322188 Ga0070665_1023221881 95
971 3300005549 Ga0070704_100337516 Ga0070704_1003375162 95
972 3300005549 Ga0070704_100347075 Ga0070704_1003470752 95
973 3300005563 Ga0068855_100033387 Ga0068855_1000333872 95
974 3300005563 Ga0068855_100533266 Ga0068855_1005332662 95
975 3300005563 Ga0068855_101726342 Ga0068855_1017263422 95
976 3300005564 Ga0070664_100276901 Ga0070664_1002769012 95
977 3300005564 Ga0070664_100312256 Ga0070664_1003122562 95
978 3300005564 Ga0070664_100678751 Ga0070664_1006787512 95
979 3300005577 Ga0068857_100306504 Ga0068857_1003065043 95
980 3300005578 Ga0068854_100008727 Ga0068854_1000087277 95
981 3300005578 Ga0068854_100013720 Ga0068854_1000137205 95
982 3300005578 Ga0068854_100069785 Ga0068854_1000697852 95
983 3300005614 Ga0068856_100073182 Ga0068856_1000731822 95
984 3300005614 Ga0068856_100776822 Ga0068856_1007768223 95
985 3300005615 Ga0070702_101245784 Ga0070702_1012457842 95
986 3300005616 Ga0068852_100026550 Ga0068852_1000265502 95
987 3300005616 Ga0068852_100029132 Ga0068852_1000291322 95
988 3300005616 Ga0068852_100622674 Ga0068852_1006226742 95
989 3300005616 Ga0068852_102534548 Ga0068852_1025345482 95
990 3300005617 Ga0068859_100216391 Ga0068859_1002163912 95
991 3300005617 Ga0068859_100351569 Ga0068859_1003515693 95
992 3300005840 Ga0068870_10270076 Ga0068870_102700763 95
993 3300005841 Ga0068863_100284520 Ga0068863_1002845203 95
994 3300005841 Ga0068863_100525038 Ga0068863_1005250382 95
995 3300005841 Ga0068863_102623373 Ga0068863_1026233731 95
996 3300005844 Ga0068862_100513910 Ga0068862_1005139102 95
997 3300005937 Ga0081455_10243169 Ga0081455_102431692 95
998 3300005981 Ga0081538_10078237 Ga0081538_100782372 95
999 3300006163 Ga0070715_10614808 Ga0070715_106148082 95
1000 3300006173 Ga0070716_100120125 Ga0070716_1001201251 95
1001 3300006175 Ga0070712_100150856 Ga0070712_1001508562 95
1002 3300006844 Ga0075428_101106268 Ga0075428_1011062682 95
1003 3300006844 Ga0075428_102713510 Ga0075428_1027135102 95
1004 3300006846 Ga0075430_100388623 Ga0075430_1003886233 95
1005 3300006846 Ga0075430_101203605 Ga0075430_1012036052 95
1006 3300006847 Ga0075431_100066106 Ga0075431_1000661062 95
1007 3300006847 Ga0075431_100679135 Ga0075431_1006791352 95
1008 3300006852 Ga0075433_10082656 Ga0075433_100826562 95
1009 3300006852 Ga0075433_10453291 Ga0075433_104532913 95
1010 3300006880 Ga0075429_100181478 Ga0075429_1001814783 95
1011 3300006881 Ga0068865_100136783 Ga0068865_1001367832 95
1012 3300006881 Ga0068865_100273628 Ga0068865_1002736282 95
1013 3300006931 Ga0097620_100216397 Ga0097620_1002163972 95
1014 3300006931 Ga0097620_100351562 Ga0097620_1003515623 95
1015 3300007265 Ga0099794_10805773 Ga0099794_108057732 95
1016 3300009093 Ga0105240_10101231 Ga0105240_101012314 95
1017 3300009093 Ga0105240_10377512 Ga0105240_103775122 95
1018 3300009093 Ga0105240_11405854 Ga0105240_114058542 95
1019 3300009093 Ga0105240_12715848 Ga0105240_127158481 95
1020 3300009094 Ga0111539_10296278 Ga0111539_102962782 95
1021 3300009094 Ga0111539_12150536 Ga0111539_121505361 95
1022 3300009098 Ga0105245_10429375 Ga0105245_104293753 95
1023 3300009101 Ga0105247_10723337 Ga0105247_107233372 95
1024 3300009148 Ga0105243_10657686 Ga0105243_106576862 95
1025 3300009148 Ga0105243_10911407 Ga0105243_109114071 95
1026 3300009148 Ga0105243_12099905 Ga0105243_120999051 95
1027 3300009148 Ga0105243_12447293 Ga0105243_124472931 95
1028 3300009174 Ga0105241_10146778 Ga0105241_101467783 95
1029 3300009177 Ga0105248_10322129 Ga0105248_103221292 95
1030 3300009545 Ga0105237_10688214 Ga0105237_106882143 95
1031 3300009545 Ga0105237_11180422 Ga0105237_111804222 95
1032 3300009551 Ga0105238_10074647 Ga0105238_100746473 95
1033 3300009551 Ga0105238_10911998 Ga0105238_109119982 95
1034 3300009551 Ga0105238_11817297 Ga0105238_118172972 95
1035 3300009553 Ga0105249_10974948 Ga0105249_109749481 95
1036 3300012482 Ga0157318_1028166 Ga0157318_10281661 95
1037 3300013100 Ga0157373_10075094 Ga0157373_100750942 95
1038 3300013100 Ga0157373_10107506 Ga0157373_101075063 95
1039 3300013100 Ga0157373_10261289 Ga0157373_102612893 95
1040 3300013104 Ga0157370_10006391 Ga0157370_1000639123 95
1041 3300013104 Ga0157370_10051328 Ga0157370_100513282 95
1042 3300013104 Ga0157370_10284510 Ga0157370_102845102 95
1043 3300013105 Ga0157369_10129033 Ga0157369_101290333 95
1044 3300013105 Ga0157369_10360263 Ga0157369_103602632 95
1045 3300013105 Ga0157369_11050120 Ga0157369_110501202 95
1046 3300013296 Ga0157374_10938383 Ga0157374_109383832 95
1047 3300013297 Ga0157378_10168578 Ga0157378_101685783 95
1048 3300013297 Ga0157378_10924224 Ga0157378_109242242 95
1049 3300013297 Ga0157378_11286448 Ga0157378_112864482 95
1050 3300013297 Ga0157378_12350404 Ga0157378_123504041 95
1051 3300013306 Ga0163162_10771069 Ga0163162_107710692 95
1052 3300013306 Ga0163162_11353130 Ga0163162_113531302 95
1053 3300013307 Ga0157372_10360783 Ga0157372_103607832 95
1054 3300013307 Ga0157372_10437193 Ga0157372_104371932 95
1055 3300013307 Ga0157372_10438515 Ga0157372_104385152 95
1056 3300013307 Ga0157372_10707076 Ga0157372_107070762 95
1057 3300013307 Ga0157372_11876377 Ga0157372_118763772 95
1058 3300014325 Ga0163163_10833141 Ga0163163_108331412 95
1059 3300014326 Ga0157380_11276920 Ga0157380_112769202 95
1060 3300014745 Ga0157377_10220127 Ga0157377_102201272 95
1061 3300014968 Ga0157379_11019995 Ga0157379_110199952 95
1062 3300014968 Ga0157379_11275611 Ga0157379_112756112 95
1063 3300014968 Ga0157379_12463332 Ga0157379_124633322 95
1064 3300014969 Ga0157376_13037862 Ga0157376_130378621 95
1065 3300025901 Ga0207688_10684318 Ga0207688_106843182 95
1066 3300025903 Ga0207680_10351990 Ga0207680_103519902 95
1067 3300025906 Ga0207699_10127954 Ga0207699_101279542 95
1068 3300025908 Ga0207643_10281215 Ga0207643_102812152 95
1069 3300025909 Ga0207705_10031424 Ga0207705_100314242 95
1070 3300025910 Ga0207684_10022976 Ga0207684_1002297612 95
1071 3300025910 Ga0207684_10321730 Ga0207684_103217302 95
1072 3300025910 Ga0207684_10466072 Ga0207684_104660722 95
1073 3300025911 Ga0207654_10028743 Ga0207654_100287434 95
1074 3300025912 Ga0207707_10004257 Ga0207707_1000425718 95
1075 3300025912 Ga0207707_10020853 Ga0207707_100208537 95
1076 3300025912 Ga0207707_10627301 Ga0207707_106273013 95
1077 3300025912 Ga0207707_10784898 Ga0207707_107848982 95
1078 3300025912 Ga0207707_11104162 Ga0207707_111041622 95
1079 3300025913 Ga0207695_10004617 Ga0207695_100046177 95
1080 3300025913 Ga0207695_10013424 Ga0207695_100134247 95
1081 3300025913 Ga0207695_10070341 Ga0207695_100703416 95
1082 3300025913 Ga0207695_10226195 Ga0207695_102261953 95
1083 3300025914 Ga0207671_10127670 Ga0207671_101276702 95
1084 3300025915 Ga0207693_10177031 Ga0207693_101770312 95
1085 3300025915 Ga0207693_10361372 Ga0207693_103613723 95
1086 3300025915 Ga0207693_10440034 Ga0207693_104400342 95
1087 3300025916 Ga0207663_10008487 Ga0207663_100084877 95
1088 3300025916 Ga0207663_10511946 Ga0207663_105119462 95
1089 3300025916 Ga0207663_10892089 Ga0207663_108920892 95
1090 3300025917 Ga0207660_10004139 Ga0207660_1000413917 95
1091 3300025917 Ga0207660_10032435 Ga0207660_100324354 95
1092 3300025917 Ga0207660_10044376 Ga0207660_100443766 95
1093 3300025917 Ga0207660_10097907 Ga0207660_100979074 95
1094 3300025917 Ga0207660_10168557 Ga0207660_101685573 95
1095 3300025918 Ga0207662_10247582 Ga0207662_102475823 95
1096 3300025918 Ga0207662_10304538 Ga0207662_103045382 95
1097 3300025919 Ga0207657_10001138 Ga0207657_1000113832 95
1098 3300025919 Ga0207657_10047239 Ga0207657_100472399 95
1099 3300025919 Ga0207657_10133641 Ga0207657_101336412 95
1100 3300025919 Ga0207657_10281579 Ga0207657_102815793 95
1101 3300025919 Ga0207657_10553571 Ga0207657_105535712 95
1102 3300025920 Ga0207649_10025188 Ga0207649_100251889 95
1103 3300025920 Ga0207649_10058649 Ga0207649_100586492 95
1104 3300025920 Ga0207649_10118913 Ga0207649_101189132 95
1105 3300025920 Ga0207649_10167119 Ga0207649_101671192 95
1106 3300025920 Ga0207649_11091551 Ga0207649_110915512 95
1107 3300025921 Ga0207652_10011077 Ga0207652_100110774 95
1108 3300025921 Ga0207652_10012004 Ga0207652_100120044 95
1109 3300025921 Ga0207652_10065009 Ga0207652_100650096 95
1110 3300025921 Ga0207652_10180913 Ga0207652_101809131 95
1111 3300025921 Ga0207652_10261717 Ga0207652_102617173 95
1112 3300025921 Ga0207652_10324641 Ga0207652_103246413 95
1113 3300025921 Ga0207652_10444285 Ga0207652_104442852 95
1114 3300025921 Ga0207652_10539114 Ga0207652_105391143 95
1115 3300025922 Ga0207646_10103586 Ga0207646_101035863 95
1116 3300025922 Ga0207646_10473825 Ga0207646_104738253 95
1117 3300025922 Ga0207646_10536794 Ga0207646_105367943 95
1118 3300025922 Ga0207646_11799240 Ga0207646_117992402 95
1119 3300025923 Ga0207681_10544386 Ga0207681_105443863 95
1120 3300025924 Ga0207694_10026946 Ga0207694_100269463 95
1121 3300025924 Ga0207694_10248765 Ga0207694_102487652 95
1122 3300025924 Ga0207694_10275749 Ga0207694_102757492 95
1123 3300025926 Ga0207659_11694803 Ga0207659_116948032 95
1124 3300025927 Ga0207687_11183420 Ga0207687_111834202 95
1125 3300025929 Ga0207664_10000099 Ga0207664_100000995 95
1126 3300025929 Ga0207664_10420601 Ga0207664_104206012 95
1127 3300025929 Ga0207664_11970421 Ga0207664_119704211 95
1128 3300025931 Ga0207644_10227703 Ga0207644_102277033 95
1129 3300025932 Ga0207690_10076401 Ga0207690_100764012 95
1130 3300025933 Ga0207706_10535245 Ga0207706_105352452 95
1131 3300025933 Ga0207706_10556469 Ga0207706_105564692 95
1132 3300025933 Ga0207706_11353459 Ga0207706_113534592 95
1133 3300025934 Ga0207686_11331536 Ga0207686_113315361 95
1134 3300025936 Ga0207670_11139326 Ga0207670_111393262 95
1135 3300025937 Ga0207669_10346609 Ga0207669_103466093 95
1136 3300025938 Ga0207704_11365406 Ga0207704_113654062 95
1137 3300025939 Ga0207665_10021871 Ga0207665_100218717 95
1138 3300025939 Ga0207665_10197621 Ga0207665_101976213 95
1139 3300025940 Ga0207691_10153386 Ga0207691_101533863 95
1140 3300025940 Ga0207691_10322355 Ga0207691_103223553 95
1141 3300025941 Ga0207711_10183645 Ga0207711_101836454 95
1142 3300025942 Ga0207689_10123876 Ga0207689_101238761 95
1143 3300025945 Ga0207679_10314992 Ga0207679_103149922 95
1144 3300025945 Ga0207679_10872568 Ga0207679_108725682 95
1145 3300025945 Ga0207679_12086469 Ga0207679_120864691 95
1146 3300025949 Ga0207667_10034763 Ga0207667_100347637 95
1147 3300025949 Ga0207667_12081101 Ga0207667_120811011 95
1148 3300025960 Ga0207651_10128156 Ga0207651_101281562 95
1149 3300025981 Ga0207640_10001854 Ga0207640_100018547 95
1150 3300025981 Ga0207640_10238690 Ga0207640_102386902 95
1151 3300025981 Ga0207640_10280376 Ga0207640_102803762 95
1152 3300025981 Ga0207640_10719024 Ga0207640_107190241 95
1153 3300025986 Ga0207658_12005943 Ga0207658_120059431 95
1154 3300026023 Ga0207677_10058774 Ga0207677_100587743 95
1155 3300026023 Ga0207677_10416302 Ga0207677_104163022 95
1156 3300026035 Ga0207703_11017431 Ga0207703_110174312 95
1157 3300026041 Ga0207639_10002689 Ga0207639_1000268922 95
1158 3300026041 Ga0207639_10204557 Ga0207639_102045573 95
1159 3300026041 Ga0207639_10217878 Ga0207639_102178782 95
1160 3300026041 Ga0207639_10798015 Ga0207639_107980152 95
1161 3300026041 Ga0207639_11176347 Ga0207639_111763472 95
1162 3300026067 Ga0207678_10012023 Ga0207678_1001202310 95
1163 3300026067 Ga0207678_10076305 Ga0207678_100763055 95
1164 3300026075 Ga0207708_10156616 Ga0207708_101566162 95
1165 3300026075 Ga0207708_10614938 Ga0207708_106149381 95
1166 3300026078 Ga0207702_10086091 Ga0207702_100860915 95
1167 3300026078 Ga0207702_10868485 Ga0207702_108684852 95
1168 3300026078 Ga0207702_11628407 Ga0207702_116284072 95
1169 3300026088 Ga0207641_10281147 Ga0207641_102811472 95
1170 3300026089 Ga0207648_10097740 Ga0207648_100977402 95
1171 3300026095 Ga0207676_11162364 Ga0207676_111623642 95
1172 3300026116 Ga0207674_10100870 Ga0207674_101008703 95
1173 3300026116 Ga0207674_10268372 Ga0207674_102683722 95
1174 3300026121 Ga0207683_10618670 Ga0207683_106186702 95
1175 3300026142 Ga0207698_10038152 Ga0207698_100381527 95
1176 3300026142 Ga0207698_10046102 Ga0207698_100461028 95
1177 3300026142 Ga0207698_10601353 Ga0207698_106013532 95
1178 3300026142 Ga0207698_11688725 Ga0207698_116887252 95
1179 3300026142 Ga0207698_12636717 Ga0207698_126367172 95
1180 3300027252 Ga0209973_1021955 Ga0209973_10219552 95
1181 3300027424 Ga0209984_1054251 Ga0209984_10542512 95
1182 3300027471 Ga0209995_1009325 Ga0209995_10093252 95
1183 3300027526 Ga0209968_1003096 Ga0209968_10030963 95
1184 3300027543 Ga0209999_1002599 Ga0209999_10025991 95
1185 3300027543 Ga0209999_1091843 Ga0209999_10918432 95
1186 3300027552 Ga0209982_1017982 Ga0209982_10179823 95
1187 3300027614 Ga0209970_1024737 Ga0209970_10247372 95
1188 3300027617 Ga0210002_1043222 Ga0210002_10432222 95
1189 3300027665 Ga0209983_1018496 Ga0209983_10184962 95
1190 3300027665 Ga0209983_1019830 Ga0209983_10198302 95
1191 3300027682 Ga0209971_1020116 Ga0209971_10201162 95
1192 3300027695 Ga0209966_1000982 Ga0209966_10009826 95
1193 3300027695 Ga0209966_1108664 Ga0209966_11086642 95
1194 3300027717 Ga0209998_10003458 Ga0209998_100034586 95
1195 3300027876 Ga0209974_10007380 Ga0209974_100073803 95
1196 3300027907 Ga0207428_10193964 Ga0207428_101939642 95
1197 3300028379 Ga0268266_10142482 Ga0268266_101424824 95
1198 3300028380 Ga0268265_10859804 Ga0268265_108598042 95
1199 3300028381 Ga0268264_10221374 Ga0268264_102213743 95
1200 3300030745 Ga0316182_1255157 Ga0316182_12551572 95
1201 3300031240 Ga0265320_10064432 Ga0265320_100644322 95
1202 3300031548 Ga0307408_100016817 Ga0307408_1000168175 95
1203 3300031548 Ga0307408_100019763 Ga0307408_1000197635 95
1204 3300031548 Ga0307408_100046769 Ga0307408_1000467692 95
1205 3300031548 Ga0307408_100052712 Ga0307408_1000527124 95
1206 3300031548 Ga0307408_100062503 Ga0307408_1000625033 95
1207 3300031548 Ga0307408_100099262 Ga0307408_1000992625 95
1208 3300031548 Ga0307408_100153960 Ga0307408_1001539602 95
1209 3300031548 Ga0307408_100223526 Ga0307408_1002235261 95
1210 3300031548 Ga0307408_100713907 Ga0307408_1007139072 95
1211 3300031548 Ga0307408_101332649 Ga0307408_1013326492 95
1212 3300031665 Ga0316575_10039695 Ga0316575_100396954 95
1213 3300031731 Ga0307405_10003326 Ga0307405_1000332614 95
1214 3300031731 Ga0307405_10004504 Ga0307405_100045048 95
1215 3300031731 Ga0307405_10083760 Ga0307405_100837601 95
1216 3300031731 Ga0307405_10107686 Ga0307405_101076862 95
1217 3300031731 Ga0307405_10152371 Ga0307405_101523714 95
1218 3300031731 Ga0307405_10250335 Ga0307405_102503352 95
1219 3300031731 Ga0307405_11012285 Ga0307405_110122852 95
1220 3300031731 Ga0307405_11208907 Ga0307405_112089072 95
1221 3300031731 Ga0307405_11333273 Ga0307405_113332732 95
1222 3300031824 Ga0307413_10001842 Ga0307413_100018424 95
1223 3300031824 Ga0307413_10002091 Ga0307413_100020916 95
1224 3300031824 Ga0307413_10006358 Ga0307413_100063584 95
1225 3300031824 Ga0307413_10031527 Ga0307413_100315275 95
1226 3300031824 Ga0307413_10055726 Ga0307413_100557263 95
1227 3300031824 Ga0307413_10067122 Ga0307413_100671224 95
1228 3300031824 Ga0307413_10074613 Ga0307413_100746134 95
1229 3300031824 Ga0307413_10079652 Ga0307413_100796523 95
1230 3300031824 Ga0307413_10203183 Ga0307413_102031832 95
1231 3300031824 Ga0307413_10701827 Ga0307413_107018271 95
1232 3300031824 Ga0307413_10760750 Ga0307413_107607502 95
1233 3300031824 Ga0307413_11758549 Ga0307413_117585492 95
1234 3300031852 Ga0307410_10000285 Ga0307410_1000028516 95
1235 3300031852 Ga0307410_10000967 Ga0307410_1000096718 95
1236 3300031852 Ga0307410_10022252 Ga0307410_100222524 95
1237 3300031852 Ga0307410_10022355 Ga0307410_100223552 95
1238 3300031852 Ga0307410_10054575 Ga0307410_100545752 95
1239 3300031852 Ga0307410_10067694 Ga0307410_100676943 95
1240 3300031852 Ga0307410_10109480 Ga0307410_101094802 95
1241 3300031852 Ga0307410_10126427 Ga0307410_101264271 95
1242 3300031852 Ga0307410_10654568 Ga0307410_106545682 95
1243 3300031852 Ga0307410_10712613 Ga0307410_107126132 95
1244 3300031852 Ga0307410_10958461 Ga0307410_109584612 95
1245 3300031852 Ga0307410_11030798 Ga0307410_110307982 95
1246 3300031901 Ga0307406_10009039 Ga0307406_1000903911 95
1247 3300031901 Ga0307406_10030981 Ga0307406_100309813 95
1248 3300031901 Ga0307406_10074742 Ga0307406_100747423 95
1249 3300031901 Ga0307406_10102636 Ga0307406_101026364 95
1250 3300031901 Ga0307406_10139031 Ga0307406_101390311 95
1251 3300031901 Ga0307406_10208490 Ga0307406_102084903 95
1252 3300031901 Ga0307406_10257460 Ga0307406_102574602 95
1253 3300031901 Ga0307406_10392032 Ga0307406_103920323 95
1254 3300031903 Ga0307407_10005111 Ga0307407_100051115 95
1255 3300031903 Ga0307407_10005124 Ga0307407_1000512411 95
1256 3300031903 Ga0307407_10044520 Ga0307407_100445204 95
1257 3300031903 Ga0307407_10241220 Ga0307407_102412202 95
1258 3300031903 Ga0307407_10500819 Ga0307407_105008192 95
1259 3300031903 Ga0307407_10543982 Ga0307407_105439823 95
1260 3300031903 Ga0307407_10568148 Ga0307407_105681482 95
1261 3300031903 Ga0307407_10942719 Ga0307407_109427192 95
1262 3300031903 Ga0307407_10954127 Ga0307407_109541272 95
1263 3300031911 Ga0307412_10005885 Ga0307412_100058858 95
1264 3300031911 Ga0307412_10007821 Ga0307412_100078218 95
1265 3300031911 Ga0307412_10016367 Ga0307412_100163672 95
1266 3300031911 Ga0307412_10060199 Ga0307412_100601994 95
1267 3300031911 Ga0307412_10094473 Ga0307412_100944731 95
1268 3300031911 Ga0307412_10139932 Ga0307412_101399322 95
1269 3300031911 Ga0307412_10202806 Ga0307412_102028062 95
1270 3300031911 Ga0307412_11152646 Ga0307412_111526462 95
1271 3300031911 Ga0307412_11837595 Ga0307412_118375952 95
1272 3300031995 Ga0307409_100005454 Ga0307409_1000054544 95
1273 3300031995 Ga0307409_100008795 Ga0307409_10000879514 95
1274 3300031995 Ga0307409_100032235 Ga0307409_1000322356 95
1275 3300031995 Ga0307409_100047584 Ga0307409_1000475845 95
1276 3300031995 Ga0307409_100055663 Ga0307409_1000556637 95
1277 3300031995 Ga0307409_100079063 Ga0307409_1000790635 95
1278 3300031995 Ga0307409_100172626 Ga0307409_1001726263 95
1279 3300031995 Ga0307409_100487723 Ga0307409_1004877232 95
1280 3300031995 Ga0307409_100541231 Ga0307409_1005412312 95
1281 3300031995 Ga0307409_100655432 Ga0307409_1006554322 95
1282 3300031995 Ga0307409_100810599 Ga0307409_1008105992 95
1283 3300031995 Ga0307409_101036773 Ga0307409_1010367731 95
1284 3300031995 Ga0307409_101214543 Ga0307409_1012145431 95
1285 3300032002 Ga0307416_100003682 Ga0307416_10000368214 95
1286 3300032002 Ga0307416_100009003 Ga0307416_1000090037 95
1287 3300032002 Ga0307416_100016074 Ga0307416_1000160743 95
1288 3300032002 Ga0307416_100092060 Ga0307416_1000920604 95
1289 3300032002 Ga0307416_100113896 Ga0307416_1001138962 95
1290 3300032002 Ga0307416_100116989 Ga0307416_1001169893 95
1291 3300032002 Ga0307416_100417503 Ga0307416_1004175033 95
1292 3300032002 Ga0307416_100491460 Ga0307416_1004914602 95
1293 3300032002 Ga0307416_100535955 Ga0307416_1005359552 95
1294 3300032002 Ga0307416_100538135 Ga0307416_1005381352 95
1295 3300032002 Ga0307416_100612039 Ga0307416_1006120392 95
1296 3300032002 Ga0307416_100650942 Ga0307416_1006509422 95
1297 3300032002 Ga0307416_100833658 Ga0307416_1008336581 95
1298 3300032002 Ga0307416_101065588 Ga0307416_1010655883 95
1299 3300032002 Ga0307416_101526866 Ga0307416_1015268662 95
1300 3300032004 Ga0307414_10036134 Ga0307414_100361345 95
1301 3300032004 Ga0307414_10074656 Ga0307414_100746562 95
1302 3300032004 Ga0307414_10180246 Ga0307414_101802464 95
1303 3300032004 Ga0307414_10726338 Ga0307414_107263382 95
1304 3300032004 Ga0307414_10956519 Ga0307414_109565192 95
1305 3300032004 Ga0307414_10986856 Ga0307414_109868562 95
1306 3300032005 Ga0307411_10000568 Ga0307411_1000056823 95
1307 3300032005 Ga0307411_10005072 Ga0307411_100050725 95
1308 3300032005 Ga0307411_10012793 Ga0307411_1001279310 95
1309 3300032005 Ga0307411_10020764 Ga0307411_100207642 95
1310 3300032005 Ga0307411_10114848 Ga0307411_101148483 95
1311 3300032005 Ga0307411_10347332 Ga0307411_103473322 95
1312 3300032005 Ga0307411_10825064 Ga0307411_108250642 95
1313 3300032005 Ga0307411_10889294 Ga0307411_108892941 95
1314 3300032126 Ga0307415_100004310 Ga0307415_1000043107 95
1315 3300032126 Ga0307415_100004471 Ga0307415_1000044715 95
1316 3300032126 Ga0307415_100006886 Ga0307415_1000068867 95
1317 3300032126 Ga0307415_100017495 Ga0307415_1000174957 95
1318 3300032126 Ga0307415_100073037 Ga0307415_1000730374 95
1319 3300032126 Ga0307415_100238109 Ga0307415_1002381093 95
1320 3300032126 Ga0307415_100315483 Ga0307415_1003154831 95
1321 3300032126 Ga0307415_100443838 Ga0307415_1004438382 95
1322 3300032126 Ga0307415_101090887 Ga0307415_1010908872 95
1323 3300032133 Ga0316583_10001183 Ga0316583_100011837 95
1324 3300032133 Ga0316583_10017879 Ga0316583_100178794 95
1325 3300032133 Ga0316583_10084259 Ga0316583_100842592 95
1326 3300033524 Ga0316592_1120642 Ga0316592_11206422 95
1327 3300033541 Ga0316596_1039349 Ga0316596_10393492 95
1328 3300034818 Ga0373950_0080083 Ga0373950_0080083_319_609 95
1329 3300034819 Ga0373958_0022561 Ga0373958_0022561_397_687 95
1330 3300034820 Ga0373959_0078539 Ga0373959_0078539_66_356 95
1331 3300035084 Ga0373928_0033370 Ga0373928_0033370_24_314 95
1332 3300035085 Ga0373929_0029820 Ga0373929_0029820_597_887 95
1333 3300035088 Ga0373940_0074398 Ga0373940_0074398_436_726 95
1334 3300035089 Ga0373944_0057368 Ga0373944_0057368_575_952 95
1335 3300035092 Ga0373952_0021650 Ga0373952_0021650_565_855 95
1336 3300035092 Ga0373952_0022759 Ga0373952_0022759_413_703 95
1337 3300035114 Ga0373939_0254051 Ga0373939_0254051_241_531 95
1338 3300035115 Ga0373941_0232439 Ga0373941_0232439_255_545 95
1339 3300035116 Ga0373945_0397345 Ga0373945_0397345_277_576 95
1340 3300035121 Ga0373960_0200705 Ga0373960_0200705_370_660 95
1341 3300035170 Ga0373943_0015892 Ga0373943_0015892_2077_2376 95
1342 3300035170 Ga0373943_0407194 Ga0373943_0407194_195_572 95
1343 3300035171 Ga0373946_0276367 Ga0373946_0276367_19_318 95
1344 3300035241 Ga0373961_0314891 Ga0373961_0314891_88_378 95
1345 3300035691 Ga0373931_0065790 Ga0373931_0065790_290_580 95
1346 3300035691 Ga0373931_0856974 Ga0373931_0856974_292_582 95
1347 3300035692 Ga0373935_0058549 Ga0373935_0058549_91_468 95
1348 3300037068 Ga0373925_0487257 Ga0373925_0487257_425_715 95
1349 3300037471 Ga0395905_1312912 Ga0395905_1312912_173_463 95
1350 3300037853 Ga0436364_0390676 Ga0436364_0390676_110_427 95
1351 3300038698 Ga0242419_003585 Ga0242419_003585_658_948 95
1352 3300038996 Ga0242420_050187 Ga0242420_050187_302_592 95
1353 3300039437 Ga0436365_0234011 Ga0436365_0234011_280_645 95
1354 3300041406 Ga0439439_0048325 Ga0439439_0048325_357_647 95
1355 3300041408 Ga0439453_0097394 Ga0439453_0097394_231_521 95
1356 3300041452 Ga0451793_0749803 Ga0451793_0749803_1061_1351 95
1357 3300041486 Ga0451807_0674211 Ga0451807_0674211_2113_2403 95
1358 3300041501 Ga0451845_0267143 Ga0451845_0267143_187_477 95
1359 3300041512 Ga0451853_2480235 Ga0451853_2480235_229_519 95
1360 3300042006 Ga0439432_163717 Ga0439432_163717_14_325 95
1361 3300042007 Ga0439449_0103716 Ga0439449_0103716_341_646 95
1362 3300042012 Ga0439455_0022797 Ga0439455_0022797_318_608 95
1363 3300042013 Ga0439456_080993 Ga0439456_080993_403_693 95
1364 3300042156 Ga0439446_0049325 Ga0439446_0049325_235_525 95
1365 3300042156 Ga0439446_0053270 Ga0439446_0053270_178_495 95
1366 3300042156 Ga0439446_0174111 Ga0439446_0174111_169_474 95
1367 3300042156 Ga0439446_0346855 Ga0439446_0346855_156_446 95
1368 3300042435 Ga0439434_0081628 Ga0439434_0081628_594_884 95
1369 3300042435 Ga0439434_0157571 Ga0439434_0157571_253_543 95
1370 3300042438 Ga0439459_0037912 Ga0439459_0037912_515_805 95
1371 3300042876 Ga0451577_0049852 Ga0451577_0049852_2424_2714 95
1372 3300042876 Ga0451577_0391595 Ga0451577_0391595_447_737 95
1373 3300044673 Ga0453683_0182841 Ga0453683_0182841_970_1260 95
1374 3300044706 Ga0466964_0133383 Ga0466964_0133383_553_843 95
1375 3300044712 Ga0453684_0532052 Ga0453684_0532052_97_387 95
1376 3300044712 Ga0453684_1964546 Ga0453684_1964546_19_312 95
1377 3300044901 Ga0466960_0176826 Ga0466960_0176826_376_666 95
1378 3300045051 Ga0451576_0252033 Ga0451576_0252033_67_357 95
1379 3300045836 Ga0466958_0198001 Ga0466958_0198001_80_391 95
1380 3300045976 Ga0466967_1139939 Ga0466967_1139939_21_311 95
1381 3300046457 Ga0495590_0238336 Ga0495590_0238336_64_354 95
1382 3300046472 Ga0495580_0076246 Ga0495580_0076246_255_545 95
1383 3300046472 Ga0495580_0087356 Ga0495580_0087356_1069_1446 95
1384 3300046491 Ga0495584_0592649 Ga0495584_0592649_166_456 95
1385 3300046517 Ga0495630_0814085 Ga0495630_0814085_148_438 95
1386 3300046535 Ga0495586_0301689 Ga0495586_0301689_322_612 95
1387 3300046664 Ga0495659_0249609 Ga0495659_0249609_275_670 95
1388 3300046674 Ga0495588_0088616 Ga0495588_0088616_923_1213 95
1389 3300046683 Ga0495658_0338908 Ga0495658_0338908_327_617 95
1390 3300048903 Ga0496100_0078491 Ga0496100_0078491_212_502 95
1391 3300048903 Ga0496100_0800416 Ga0496100_0800416_158_448 95
1392 3300048904 Ga0496101_0111991 Ga0496101_0111991_709_999 95
1393 3300048905 Ga0496102_0172439 Ga0496102_0172439_790_1080 95
1394 3300048905 Ga0496102_0970077 Ga0496102_0970077_129_419 95
1395 3300048907 Ga0496104_0065574 Ga0496104_0065574_2172_2462 95
1396 3300048907 Ga0496104_0309521 Ga0496104_0309521_1057_1347 95
1397 3300048908 Ga0496105_0070746 Ga0496105_0070746_238_528 95
1398 3300048908 Ga0496105_0147782 Ga0496105_0147782_426_716 95
1399 3300048909 Ga0496106_0027640 Ga0496106_0027640_3862_4152 95
1400 3300048909 Ga0496106_0318902 Ga0496106_0318902_690_980 95
1401 3300048909 Ga0496106_0342753 Ga0496106_0342753_168_458 95
1402 3300048910 Ga0496107_0261224 Ga0496107_0261224_524_814 95
1403 3300048911 Ga0496108_0035987 Ga0496108_0035987_3092_3382 95
1404 3300048911 Ga0496108_0592139 Ga0496108_0592139_460_750 95
1405 3300048912 Ga0496109_0039889 Ga0496109_0039889_3181_3471 95
1406 3300048912 Ga0496109_0042753 Ga0496109_0042753_2746_3075 95
1407 3300048912 Ga0496109_0043173 Ga0496109_0043173_2670_2960 95
1408 3300048913 Ga0496110_0007094 Ga0496110_0007094_5487_5777 95
1409 3300048913 Ga0496110_0089104 Ga0496110_0089104_1675_1965 95
1410 3300048914 Ga0496111_0001415 Ga0496111_0001415_10234_10524 95
1411 3300048914 Ga0496111_0072867 Ga0496111_0072867_143_433 95
1412 3300048915 Ga0496112_0024016 Ga0496112_0024016_2244_2534 95
1413 3300048915 Ga0496112_0079427 Ga0496112_0079427_251_550 95
1414 3300048915 Ga0496112_0606487 Ga0496112_0606487_308_607 95
1415 3300048915 Ga0496112_1175577 Ga0496112_1175577_349_639 95
1416 3300048916 Ga0496113_0047161 Ga0496113_0047161_958_1248 95
1417 3300048916 Ga0496113_0075448 Ga0496113_0075448_1784_2074 95
1418 3300048917 Ga0496114_0047313 Ga0496114_0047313_2884_3174 95
1419 3300049162 Ga0501307_051693 Ga0501307_051693_18_308 95
1420 3300049519 Ga0501296_050298 Ga0501296_050298_153_467 95
1421 3300049521 Ga0501298_006514 Ga0501298_006514_67_357 95
1422 3300049521 Ga0501298_071487 Ga0501298_071487_371_661 95
1423 3300049526 Ga0501303_022268 Ga0501303_022268_31_351 95
1424 3300049536 Ga0501320_034979 Ga0501320_034979_321_629 95
1425 3300049568 Ga0501031_0115077 Ga0501031_0115077_901_1191 95
1426 3300049568 Ga0501031_0232197 Ga0501031_0232197_43_333 95
1427 3300049568 Ga0501031_0959922 Ga0501031_0959922_49_342 95
1428 3300049569 Ga0501032_0670862 Ga0501032_0670862_189_479 95
1429 3300049570 Ga0501033_0245632 Ga0501033_0245632_270_560 95
1430 3300049570 Ga0501033_0458016 Ga0501033_0458016_542_832 95
1431 3300049571 Ga0501034_0044308 Ga0501034_0044308_1836_2126 95
1432 3300049571 Ga0501034_0396995 Ga0501034_0396995_90_380 95
1433 3300049571 Ga0501034_0762996 Ga0501034_0762996_313_603 95
1434 3300049572 Ga0501036_0170582 Ga0501036_0170582_449_739 95
1435 3300049572 Ga0501036_0297376 Ga0501036_0297376_922_1212 95
1436 3300049572 Ga0501036_0311648 Ga0501036_0311648_943_1236 95
1437 3300049573 Ga0501037_0287470 Ga0501037_0287470_154_444 95
1438 3300049573 Ga0501037_0427947 Ga0501037_0427947_551_841 95
1439 3300049574 Ga0501038_0353513 Ga0501038_0353513_498_788 95
1440 3300049574 Ga0501038_0513220 Ga0501038_0513220_151_441 95
1441 3300049574 Ga0501038_1208946 Ga0501038_1208946_194_484 95
1442 3300049575 Ga0501039_0103131 Ga0501039_0103131_1142_1483 95
1443 3300049575 Ga0501039_0663518 Ga0501039_0663518_48_341 95
1444 3300049576 Ga0501040_0021934 Ga0501040_0021934_3353_3646 95
1445 3300049576 Ga0501040_0069484 Ga0501040_0069484_1535_1825 95
1446 3300049577 Ga0501041_0117942 Ga0501041_0117942_754_1044 95
1447 3300049577 Ga0501041_0135383 Ga0501041_0135383_848_1138 95
1448 3300049577 Ga0501041_0398134 Ga0501041_0398134_412_702 95
1449 3300049578 Ga0501042_0037878 Ga0501042_0037878_2903_3193 95
1450 3300049578 Ga0501042_0215413 Ga0501042_0215413_17_310 95
1451 3300049580 Ga0501046_0047535 Ga0501046_0047535_1460_1750 95
1452 3300049580 Ga0501046_0102764 Ga0501046_0102764_1061_1351 95
1453 3300049580 Ga0501046_0213074 Ga0501046_0213074_484_780 95
1454 3300049580 Ga0501046_0278630 Ga0501046_0278630_354_647 95
1455 3300049581 Ga0501047_0130576 Ga0501047_0130576_1263_1574 95
1456 3300049582 Ga0501048_0118379 Ga0501048_0118379_1529_1819 95
1457 3300049582 Ga0501048_0186441 Ga0501048_0186441_1011_1301 95
1458 3300049582 Ga0501048_0229725 Ga0501048_0229725_764_1054 95
1459 3300049582 Ga0501048_0373847 Ga0501048_0373847_10_300 95
1460 3300049583 Ga0501067_0014484 Ga0501067_0014484_2137_2427 95
1461 3300049583 Ga0501067_0060801 Ga0501067_0060801_827_1117 95
1462 3300049583 Ga0501067_0066718 Ga0501067_0066718_1532_1822 95
1463 3300049583 Ga0501067_0232860 Ga0501067_0232860_101_391 95
1464 3300049583 Ga0501067_0328662 Ga0501067_0328662_110_400 95
1465 3300049584 Ga0501068_0008160 Ga0501068_0008160_3154_3444 95
1466 3300049584 Ga0501068_0075235 Ga0501068_0075235_1395_1685 95
1467 3300049584 Ga0501068_0131811 Ga0501068_0131811_1048_1341 95
1468 3300049584 Ga0501068_0335310 Ga0501068_0335310_605_895 95
1469 3300049584 Ga0501068_1054470 Ga0501068_1054470_70_360 95
1470 3300049585 Ga0501069_0008330 Ga0501069_0008330_4622_4912 95
1471 3300049585 Ga0501069_0017995 Ga0501069_0017995_340_630 95
1472 3300049585 Ga0501069_0074284 Ga0501069_0074284_593_883 95
1473 3300049585 Ga0501069_0183155 Ga0501069_0183155_162_452 95
1474 3300049585 Ga0501069_0212562 Ga0501069_0212562_702_1013 95
1475 3300049585 Ga0501069_0273842 Ga0501069_0273842_281_574 95
1476 3300049585 Ga0501069_0772874 Ga0501069_0772874_187_477 95
1477 3300049586 Ga0501070_0013050 Ga0501070_0013050_4589_4879 95
1478 3300049586 Ga0501070_0032011 Ga0501070_0032011_284_574 95
1479 3300049586 Ga0501070_0063385 Ga0501070_0063385_2495_2785 95
1480 3300049586 Ga0501070_0069675 Ga0501070_0069675_1696_2007 95
1481 3300049586 Ga0501070_0089832 Ga0501070_0089832_715_1005 95
1482 3300049586 Ga0501070_0509274 Ga0501070_0509274_447_737 95
1483 3300049587 Ga0501071_0012801 Ga0501071_0012801_3040_3330 95
1484 3300049587 Ga0501071_0481689 Ga0501071_0481689_217_507 95
1485 3300049587 Ga0501071_0732719 Ga0501071_0732719_307_597 95
1486 3300049587 Ga0501071_0839822 Ga0501071_0839822_108_404 95
1487 3300049588 Ga0501072_0006109 Ga0501072_0006109_5731_6021 95
1488 3300049588 Ga0501072_0032455 Ga0501072_0032455_1789_2079 95
1489 3300049588 Ga0501072_0053900 Ga0501072_0053900_1172_1465 95
1490 3300049588 Ga0501072_0209787 Ga0501072_0209787_279_572 95
1491 3300049588 Ga0501072_0212282 Ga0501072_0212282_582_872 95
1492 3300049588 Ga0501072_0234614 Ga0501072_0234614_808_1098 95
1493 3300049588 Ga0501072_0265703 Ga0501072_0265703_153_443 95
1494 3300049588 Ga0501072_0658239 Ga0501072_0658239_511_801 95
1495 3300049588 Ga0501072_1358210 Ga0501072_1358210_181_477 95
1496 3300049589 Ga0501073_0170984 Ga0501073_0170984_419_709 95
1497 3300049589 Ga0501073_0772218 Ga0501073_0772218_11_301 95
1498 3300049590 Ga0501074_0069510 Ga0501074_0069510_2085_2378 95
1499 3300049590 Ga0501074_0084841 Ga0501074_0084841_952_1242 95
1500 3300049590 Ga0501074_0165238 Ga0501074_0165238_991_1281 95
1501 3300049590 Ga0501074_0246973 Ga0501074_0246973_910_1251 95
1502 3300049591 Ga0501075_0029122 Ga0501075_0029122_3689_3979 95
1503 3300049591 Ga0501075_0036489 Ga0501075_0036489_1581_1874 95
1504 3300049591 Ga0501075_0165817 Ga0501075_0165817_204_494 95
1505 3300049591 Ga0501075_0319160 Ga0501075_0319160_206_499 95
1506 3300049592 Ga0501076_0006442 Ga0501076_0006442_7809_8099 95
1507 3300049592 Ga0501076_0054868 Ga0501076_0054868_2538_2828 95
1508 3300049592 Ga0501076_0069214 Ga0501076_0069214_2008_2349 95
1509 3300049592 Ga0501076_0219729 Ga0501076_0219729_118_411 95
1510 3300049592 Ga0501076_0226375 Ga0501076_0226375_1051_1341 95
1511 3300049592 Ga0501076_1109836 Ga0501076_1109836_204_500 95
1512 3300049593 Ga0501077_0002603 Ga0501077_0002603_2696_2986 95
1513 3300049593 Ga0501077_0048237 Ga0501077_0048237_119_409 95
1514 3300049593 Ga0501077_0243273 Ga0501077_0243273_614_907 95
1515 3300049593 Ga0501077_0383412 Ga0501077_0383412_115_456 95
1516 3300049593 Ga0501077_0619854 Ga0501077_0619854_228_521 95
1517 3300049649 Ga0501198_152313 Ga0501198_152313_128_448 95
1518 3300049652 Ga0501202_033027 Ga0501202_033027_516_836 95
1519 3300049652 Ga0501202_053765 Ga0501202_053765_411_725 95
1520 3300049656 Ga0501209_004058 Ga0501209_004058_225_515 95
1521 3300049656 Ga0501209_143699 Ga0501209_143699_233_523 95
1522 3300049660 Ga0501216_009705 Ga0501216_009705_584_874 95
1523 3300049660 Ga0501216_046341 Ga0501216_046341_213_533 95
1524 3300049660 Ga0501216_067720 Ga0501216_067720_104_409 95
1525 3300049660 Ga0501216_174444 Ga0501216_174444_101_406 95
1526 3300049661 Ga0501217_119395 Ga0501217_119395_347_667 95
1527 3300049661 Ga0501217_189877 Ga0501217_189877_185_475 95
1528 3300049661 Ga0501217_243053 Ga0501217_243053_141_446 95
1529 3300049663 Ga0501223_008477 Ga0501223_008477_1580_1900 95
1530 3300049664 Ga0501224_001238 Ga0501224_001238_161_481 95
1531 3300049665 Ga0501227_018036 Ga0501227_018036_62_382 95
1532 3300049667 Ga0501230_009571 Ga0501230_009571_1154_1474 95
1533 3300049668 Ga0501233_004905 Ga0501233_004905_1493_1813 95
1534 3300049669 Ga0501235_007524 Ga0501235_007524_454_774 95
1535 3300049670 Ga0501236_051361 Ga0501236_051361_349_639 95
1536 3300049672 Ga0501239_013408 Ga0501239_013408_206_526 95
1537 3300049672 Ga0501239_027332 Ga0501239_027332_327_617 95
1538 3300049674 Ga0501242_033433 Ga0501242_033433_46_366 95
1539 3300049674 Ga0501242_052523 Ga0501242_052523_259_549 95
1540 3300049675 Ga0501243_004221 Ga0501243_004221_1049_1369 95
1541 3300049675 Ga0501243_012793 Ga0501243_012793_759_1049 95
1542 3300049677 Ga0501247_010669 Ga0501247_010669_732_1022 95
1543 3300049679 Ga0501249_018960 Ga0501249_018960_476_781 95
1544 3300049679 Ga0501249_172577 Ga0501249_172577_177_467 95
1545 3300049680 Ga0501250_041481 Ga0501250_041481_95_385 95
1546 3300049681 Ga0501251_076902 Ga0501251_076902_73_363 95
1547 3300049683 Ga0501253_078750 Ga0501253_078750_208_528 95
1548 3300049685 Ga0501256_042400 Ga0501256_042400_182_502 95
1549 3300049686 Ga0501257_008968 Ga0501257_008968_1816_2106 95
1550 3300049686 Ga0501257_118845 Ga0501257_118845_268_588 95
1551 3300049686 Ga0501257_123774 Ga0501257_123774_300_605 95
1552 3300049686 Ga0501257_166883 Ga0501257_166883_255_560 95
1553 3300049687 Ga0501258_012429 Ga0501258_012429_554_844 95
1554 3300049688 Ga0501259_084809 Ga0501259_084809_213_533 95
1555 3300049688 Ga0501259_143473 Ga0501259_143473_83_373 95
1556 3300049690 Ga0501261_045769 Ga0501261_045769_312_602 95
1557 3300049690 Ga0501261_050502 Ga0501261_050502_334_648 95
1558 3300049704 Ga0501221_065122 Ga0501221_065122_71_391 95
1559 3300049704 Ga0501221_111637 Ga0501221_111637_213_503 95
1560 3300049704 Ga0501221_237514 Ga0501221_237514_151_441 95
1561 3300049707 Ga0501234_001400 Ga0501234_001400_3207_3527 95
1562 3300049707 Ga0501234_097071 Ga0501234_097071_176_481 95
1563 3300049741 Ga0501079_0012691 Ga0501079_0012691_4400_4693 95
1564 3300049741 Ga0501079_0019559 Ga0501079_0019559_2214_2555 95
1565 3300049741 Ga0501079_0055628 Ga0501079_0055628_830_1120 95
1566 3300049741 Ga0501079_0074686 Ga0501079_0074686_1555_1851 95
1567 3300049741 Ga0501079_0162200 Ga0501079_0162200_318_611 95
1568 3300049741 Ga0501079_0202075 Ga0501079_0202075_209_499 95
1569 3300049741 Ga0501079_0610392 Ga0501079_0610392_60_350 95
1570 3300049741 Ga0501079_0611211 Ga0501079_0611211_421_738 95
1571 3300049742 Ga0501080_0004569 Ga0501080_0004569_2988_3278 95
1572 3300049742 Ga0501080_0092828 Ga0501080_0092828_526_816 95
1573 3300049742 Ga0501080_0365132 Ga0501080_0365132_237_527 95
1574 3300049742 Ga0501080_0607070 Ga0501080_0607070_359_655 95
1575 3300049743 Ga0501081_0019645 Ga0501081_0019645_1925_2218 95
1576 3300049743 Ga0501081_0084738 Ga0501081_0084738_507_797 95
1577 3300049743 Ga0501081_0099127 Ga0501081_0099127_970_1260 95
1578 3300049743 Ga0501081_0125422 Ga0501081_0125422_452_748 95
1579 3300049744 Ga0501083_0014932 Ga0501083_0014932_2009_2299 95
1580 3300049744 Ga0501083_0043800 Ga0501083_0043800_841_1131 95
1581 3300049744 Ga0501083_0083137 Ga0501083_0083137_951_1244 95
1582 3300049744 Ga0501083_0212131 Ga0501083_0212131_559_855 95
1583 3300049744 Ga0501083_0348811 Ga0501083_0348811_591_884 95
1584 3300049744 Ga0501083_0923936 Ga0501083_0923936_53_343 95
1585 3300049757 Ga0501232_010440 Ga0501232_010440_67_357 95
1586 3300049759 Ga0501262_049657 Ga0501262_049657_23_328 95
1587 3300049760 Ga0501263_055879 Ga0501263_055879_177_467 95
1588 3300049762 Ga0501265_030122 Ga0501265_030122_134_448 95
1589 3300049763 Ga0501266_003064 Ga0501266_003064_818_1138 95
1590 3300049764 Ga0501267_004229 Ga0501267_004229_208_528 95
1591 3300049764 Ga0501267_008912 Ga0501267_008912_166_471 95
1592 3300049765 Ga0501268_002758 Ga0501268_002758_1071_1361 95
1593 3300049765 Ga0501268_008026 Ga0501268_008026_882_1187 95
1594 3300049765 Ga0501268_034317 Ga0501268_034317_248_568 95
1595 3300049765 Ga0501268_100477 Ga0501268_100477_275_565 95
1596 3300049767 Ga0501270_012851 Ga0501270_012851_243_557 95
1597 3300049767 Ga0501270_070908 Ga0501270_070908_176_466 95
1598 3300049767 Ga0501270_092479 Ga0501270_092479_213_533 95
1599 3300049767 Ga0501270_108129 Ga0501270_108129_10_300 95
1600 3300049768 Ga0501271_002195 Ga0501271_002195_1085_1375 95
1601 3300049769 Ga0501272_013617 Ga0501272_013617_164_454 95
1602 3300049770 Ga0501273_008374 Ga0501273_008374_382_672 95
1603 3300049770 Ga0501273_035883 Ga0501273_035883_202_522 95
1604 3300049771 Ga0501274_002181 Ga0501274_002181_52_372 95
1605 3300049772 Ga0501275_043350 Ga0501275_043350_221_526 95
1606 3300049779 Ga0501283_008388 Ga0501283_008388_10_330 95
1607 3300049822 Ga0501035_0186524 Ga0501035_0186524_935_1225 95
1608 3300049822 Ga0501035_0583180 Ga0501035_0583180_291_584 95
1609 3300049822 Ga0501035_0792784 Ga0501035_0792784_288_578 95
1610 3300049822 Ga0501035_1113324 Ga0501035_1113324_118_411 95
1611 3300049823 Ga0501044_0431474 Ga0501044_0431474_496_786 95
1612 3300049823 Ga0501044_0502384 Ga0501044_0502384_284_574 95
1613 3300049824 Ga0501045_0004175 Ga0501045_0004175_1265_1558 95
1614 3300049824 Ga0501045_0086402 Ga0501045_0086402_1125_1466 95
1615 3300049824 Ga0501045_0161793 Ga0501045_0161793_454_744 95
1616 3300049824 Ga0501045_0241244 Ga0501045_0241244_1017_1313 95
1617 3300049824 Ga0501045_0330576 Ga0501045_0330576_436_726 95
1618 3300049824 Ga0501045_0562930 Ga0501045_0562930_231_521 95
1619 3300049850 Ga0501204_013205 Ga0501204_013205_548_838 95
1620 3300049851 Ga0501212_001652 Ga0501212_001652_1095_1415 95
1621 3300049851 Ga0501212_083701 Ga0501212_083701_240_530 95
1622 3300050507 nmdc:mga05p37_518028_c1 nmdc:mga05p37_518028_c1_426_716 95
1623 3300050508 nmdc:mga09592_759854_c1 nmdc:mga09592_759854_c1_34_372 95
1624 3300050509 nmdc:mga0qj67_339484_c1 nmdc:mga0qj67_339484_c1_490_780 95
1625 3300050509 nmdc:mga0qj67_77954_c1 nmdc:mga0qj67_77954_c1_690_1034 95
1626 3300050509 nmdc:mga0qj67_793471_c1 nmdc:mga0qj67_793471_c1_446_736 95
1627 3300050510 nmdc:mga06r32_1497899_c1 nmdc:mga06r32_1497899_c1_29_355 95
1628 3300050510 nmdc:mga06r32_342365_c1 nmdc:mga06r32_342365_c1_968_1306 95
1629 3300050510 nmdc:mga06r32_6558_c1 nmdc:mga06r32_6558_c1_6974_7318 95
1630 3300050511 nmdc:mga08y16_116742_c1 nmdc:mga08y16_116742_c1_553_843 95
1631 3300050511 nmdc:mga08y16_144197_c1 nmdc:mga08y16_144197_c1_1385_1675 95
1632 3300050511 nmdc:mga08y16_311113_c1 nmdc:mga08y16_311113_c1_177_467 95
1633 3300050512 nmdc:mga0n895_1181678_c1 nmdc:mga0n895_1181678_c1_183_545 95
1634 3300050512 nmdc:mga0n895_358036_c1 nmdc:mga0n895_358036_c1_611_910 95
1635 3300050513 nmdc:mga0rr50_11870_c2 nmdc:mga0rr50_11870_c2_2869_3168 95
1636 3300050513 nmdc:mga0rr50_274532_c1 nmdc:mga0rr50_274532_c1_191_556 95
1637 3300050514 nmdc:mga08x19_145676_c1 nmdc:mga08x19_145676_c1_336_701 95
1638 3300050515 nmdc:mga0a205_71485_c1 nmdc:mga0a205_71485_c1_66_356 95
1639 3300054114 Ga0501084_0032504 Ga0501084_0032504_2065_2355 95
1640 3300054114 Ga0501084_0040463 Ga0501084_0040463_616_909 95
1641 3300054114 Ga0501084_0042401 Ga0501084_0042401_2486_2782 95
1642 3300054114 Ga0501084_0053363 Ga0501084_0053363_2400_2690 95
1643 3300054114 Ga0501084_0055496 Ga0501084_0055496_1940_2230 95
1644 3300054114 Ga0501084_0060696 Ga0501084_0060696_183_473 95
1645 3300059421 Ga0590071_003501 Ga0590071_003501_3053_3343 95
1646 3300059421 Ga0590071_007102 Ga0590071_007102_513_803 95
1647 3300059421 Ga0590071_009609 Ga0590071_009609_650_940 95
1648 3300059421 Ga0590071_018064 Ga0590071_018064_764_1054 95
1649 3300059423 Ga0590074_010487 Ga0590074_010487_214_504 95
1650 3300059423 Ga0590074_063876 Ga0590074_063876_145_435 95
1651 3300059424 Ga0590075_044972 Ga0590075_044972_357_647 95
1652 3300059477 Ga0587084_125122 Ga0587084_125122_140_430 95
1653 3300059490 Ga0587066_016651 Ga0587066_016651_87_377 95
1654 3300059492 Ga0587073_0076206 Ga0587073_0076206_168_458 95
1655 3300059511 Ga0587091_057781 Ga0587091_057781_211_501 95
1656 3300059625 Ga0587113_036215 Ga0587113_036215_168_458 95
1657 3300059640 Ga0587067_142955 Ga0587067_142955_196_486 95
1658 3300059645 Ga0587076_201833 Ga0587076_201833_13_303 95
1659 3300059647 Ga0587079_047120 Ga0587079_047120_40_330 95
1660 3300060344 Ga0587071_013833 Ga0587071_013833_932_1222 95
1661 3300060353 Ga0501082_0004163 Ga0501082_0004163_8484_8777 95
1662 3300060353 Ga0501082_0019498 Ga0501082_0019498_2199_2489 95
1663 3300060353 Ga0501082_0033970 Ga0501082_0033970_3469_3759 95
1664 3300060353 Ga0501082_0052165 Ga0501082_0052165_2251_2541 95
1665 3300060353 Ga0501082_0063320 Ga0501082_0063320_87_377 95
1666 3300060353 Ga0501082_0071941 Ga0501082_0071941_2577_2918 95
1667 3300060353 Ga0501082_0404454 Ga0501082_0404454_666_962 95
1668 3300060353 Ga0501082_0462845 Ga0501082_0462845_499_789 95
1669 3300060353 Ga0501082_0472839 Ga0501082_0472839_360_650 95
1670 3300060353 Ga0501082_1328866 Ga0501082_1328866_249_542 95
1671 3300061734 Ga0530510_0113500 Ga0530510_0113500_800_1096 95
1672 3300061734 Ga0530510_0155250 Ga0530510_0155250_1366_1656 95
1673 3300061734 Ga0530510_0165371 Ga0530510_0165371_587_928 95
1674 3300061734 Ga0530510_0331267 Ga0530510_0331267_49_339 95
1675 3300061734 Ga0530510_1158495 Ga0530510_1158495_93_386 95
1676 3300003371 JGI26145J50221_1006158 JGI26145J50221_10061581 96
1677 3300005293 Ga0065715_10116004 Ga0065715_101160044 96
1678 3300005328 Ga0070676_10089561 Ga0070676_100895613 96
1679 3300005329 Ga0070683_100003340 Ga0070683_1000033407 96
1680 3300005336 Ga0070680_100103171 Ga0070680_1001031714 96
1681 3300005336 Ga0070680_100119665 Ga0070680_1001196652 96
1682 3300005337 Ga0070682_100029919 Ga0070682_1000299194 96
1683 3300005337 Ga0070682_100060558 Ga0070682_1000605583 96
1684 3300005337 Ga0070682_100203345 Ga0070682_1002033452 96
1685 3300005338 Ga0068868_100013085 Ga0068868_1000130852 96
1686 3300005341 Ga0070691_10272178 Ga0070691_102721782 96
1687 3300005344 Ga0070661_100029610 Ga0070661_1000296104 96
1688 3300005345 Ga0070692_10085682 Ga0070692_100856823 96
1689 3300005345 Ga0070692_10152386 Ga0070692_101523862 96
1690 3300005353 Ga0070669_100571542 Ga0070669_1005715422 96
1691 3300005354 Ga0070675_101610651 Ga0070675_1016106511 96
1692 3300005364 Ga0070673_102163037 Ga0070673_1021630371 96
1693 3300005406 Ga0070703_10122590 Ga0070703_101225901 96
1694 3300005434 Ga0070709_10006385 Ga0070709_100063859 96
1695 3300005440 Ga0070705_100169323 Ga0070705_1001693232 96
1696 3300005441 Ga0070700_100195386 Ga0070700_1001953863 96
1697 3300005444 Ga0070694_101097517 Ga0070694_1010975171 96
1698 3300005445 Ga0070708_100001661 Ga0070708_1000016617 96
1699 3300005445 Ga0070708_100020893 Ga0070708_1000208936 96
1700 3300005445 Ga0070708_100338186 Ga0070708_1003381862 96
1701 3300005457 Ga0070662_100198764 Ga0070662_1001987643 96
1702 3300005457 Ga0070662_100452728 Ga0070662_1004527281 96
1703 3300005458 Ga0070681_10044619 Ga0070681_100446197 96
1704 3300005458 Ga0070681_10053922 Ga0070681_100539223 96
1705 3300005458 Ga0070681_10078280 Ga0070681_100782804 96
1706 3300005458 Ga0070681_11130055 Ga0070681_111300552 96
1707 3300005459 Ga0068867_100093589 Ga0068867_1000935892 96
1708 3300005459 Ga0068867_100262442 Ga0068867_1002624423 96
1709 3300005467 Ga0070706_100115208 Ga0070706_1001152084 96
1710 3300005467 Ga0070706_100188726 Ga0070706_1001887261 96
1711 3300005468 Ga0070707_100198999 Ga0070707_1001989994 96
1712 3300005471 Ga0070698_100030896 Ga0070698_1000308962 96
1713 3300005518 Ga0070699_100243299 Ga0070699_1002432993 96
1714 3300005518 Ga0070699_100314429 Ga0070699_1003144292 96
1715 3300005530 Ga0070679_100052627 Ga0070679_1000526275 96
1716 3300005530 Ga0070679_100091847 Ga0070679_1000918474 96
1717 3300005535 Ga0070684_100005718 Ga0070684_1000057187 96
1718 3300005535 Ga0070684_100152966 Ga0070684_1001529664 96
1719 3300005535 Ga0070684_100349691 Ga0070684_1003496913 96
1720 3300005536 Ga0070697_100034669 Ga0070697_1000346698 96
1721 3300005536 Ga0070697_100308839 Ga0070697_1003088391 96
1722 3300005536 Ga0070697_101146138 Ga0070697_1011461381 96
1723 3300005539 Ga0068853_100246394 Ga0068853_1002463943 96
1724 3300005544 Ga0070686_100247099 Ga0070686_1002470992 96
1725 3300005545 Ga0070695_100006164 Ga0070695_1000061645 96
1726 3300005546 Ga0070696_100345231 Ga0070696_1003452313 96
1727 3300005546 Ga0070696_101931493 Ga0070696_1019314931 96
1728 3300005547 Ga0070693_100000799 Ga0070693_1000007991 96
1729 3300005549 Ga0070704_100129452 Ga0070704_1001294523 96
1730 3300005549 Ga0070704_100324442 Ga0070704_1003244422 96
1731 3300005563 Ga0068855_101906615 Ga0068855_1019066152 96
1732 3300005564 Ga0070664_100008033 Ga0070664_1000080334 96
1733 3300005577 Ga0068857_100009735 Ga0068857_10000973512 96
1734 3300005578 Ga0068854_100168844 Ga0068854_1001688442 96
1735 3300005578 Ga0068854_101564314 Ga0068854_1015643141 96
1736 3300005718 Ga0068866_10025649 Ga0068866_100256496 96
1737 3300005718 Ga0068866_10131416 Ga0068866_101314162 96
1738 3300005844 Ga0068862_100624739 Ga0068862_1006247392 96
1739 3300006173 Ga0070716_100014957 Ga0070716_1000149572 96
1740 3300006173 Ga0070716_100185223 Ga0070716_1001852233 96
1741 3300006852 Ga0075433_10017586 Ga0075433_100175868 96
1742 3300006871 Ga0075434_100411482 Ga0075434_1004114822 96
1743 3300006914 Ga0075436_100011027 Ga0075436_1000110277 96
1744 3300006914 Ga0075436_100293565 Ga0075436_1002935652 96
1745 3300007076 Ga0075435_100093480 Ga0075435_1000934802 96
1746 3300007076 Ga0075435_101207494 Ga0075435_1012074942 96
1747 3300007265 Ga0099794_10232222 Ga0099794_102322222 96
1748 3300009098 Ga0105245_10094704 Ga0105245_100947045 96
1749 3300009098 Ga0105245_10155732 Ga0105245_101557322 96
1750 3300009098 Ga0105245_10219981 Ga0105245_102199812 96
1751 3300009147 Ga0114129_10074165 Ga0114129_100741655 96
1752 3300012507 Ga0157342_1020734 Ga0157342_10207342 96
1753 3300013100 Ga0157373_10134672 Ga0157373_101346724 96
1754 3300013102 Ga0157371_11376732 Ga0157371_113767321 96
1755 3300013306 Ga0163162_10942245 Ga0163162_109422451 96
1756 3300013307 Ga0157372_10398247 Ga0157372_103982472 96
1757 3300025899 Ga0207642_10469862 Ga0207642_104698622 96
1758 3300025899 Ga0207642_10642395 Ga0207642_106423952 96
1759 3300025906 Ga0207699_10044660 Ga0207699_100446605 96
1760 3300025906 Ga0207699_10560054 Ga0207699_105600542 96
1761 3300025907 Ga0207645_10193216 Ga0207645_101932163 96
1762 3300025910 Ga0207684_10199408 Ga0207684_101994082 96
1763 3300025910 Ga0207684_11038716 Ga0207684_110387162 96
1764 3300025912 Ga0207707_10041250 Ga0207707_100412504 96
1765 3300025912 Ga0207707_10075446 Ga0207707_100754465 96
1766 3300025912 Ga0207707_10097923 Ga0207707_100979233 96
1767 3300025917 Ga0207660_10046045 Ga0207660_100460455 96
1768 3300025917 Ga0207660_10478573 Ga0207660_104785732 96
1769 3300025918 Ga0207662_10185746 Ga0207662_101857462 96
1770 3300025920 Ga0207649_10032190 Ga0207649_100321904 96
1771 3300025921 Ga0207652_10042922 Ga0207652_100429225 96
1772 3300025921 Ga0207652_10093206 Ga0207652_100932063 96
1773 3300025922 Ga0207646_10019243 Ga0207646_100192439 96
1774 3300025922 Ga0207646_10035672 Ga0207646_100356727 96
1775 3300025923 Ga0207681_10545758 Ga0207681_105457582 96
1776 3300025926 Ga0207659_11195230 Ga0207659_111952302 96
1777 3300025927 Ga0207687_10075869 Ga0207687_100758692 96
1778 3300025927 Ga0207687_10136950 Ga0207687_101369502 96
1779 3300025933 Ga0207706_10075992 Ga0207706_100759921 96
1780 3300025937 Ga0207669_10350187 Ga0207669_103501872 96
1781 3300025938 Ga0207704_10040337 Ga0207704_100403372 96
1782 3300025939 Ga0207665_10024947 Ga0207665_100249472 96
1783 3300025939 Ga0207665_10097926 Ga0207665_100979262 96
1784 3300025944 Ga0207661_10001907 Ga0207661_100019077 96
1785 3300025945 Ga0207679_10002650 Ga0207679_100026502 96
1786 3300025949 Ga0207667_11478457 Ga0207667_114784572 96
1787 3300025960 Ga0207651_10036217 Ga0207651_100362176 96
1788 3300025981 Ga0207640_10129033 Ga0207640_101290333 96
1789 3300025981 Ga0207640_10583783 Ga0207640_105837832 96
1790 3300026023 Ga0207677_10012623 Ga0207677_100126232 96
1791 3300026023 Ga0207677_10092972 Ga0207677_100929722 96
1792 3300026041 Ga0207639_10051893 Ga0207639_100518935 96
1793 3300026041 Ga0207639_11760032 Ga0207639_117600322 96
1794 3300026075 Ga0207708_11220680 Ga0207708_112206802 96
1795 3300026078 Ga0207702_10249947 Ga0207702_102499473 96
1796 3300026089 Ga0207648_10306254 Ga0207648_103062542 96
1797 3300026116 Ga0207674_10168287 Ga0207674_101682872 96
1798 3300027252 Ga0209973_1018244 Ga0209973_10182442 96
1799 3300027364 Ga0209967_1084390 Ga0209967_10843902 96
1800 3300027424 Ga0209984_1013486 Ga0209984_10134862 96
1801 3300027471 Ga0209995_1003150 Ga0209995_10031505 96
1802 3300027543 Ga0209999_1124806 Ga0209999_11248061 96
1803 3300027614 Ga0209970_1052785 Ga0209970_10527852 96
1804 3300027617 Ga0210002_1082987 Ga0210002_10829872 96
1805 3300027665 Ga0209983_1000810 Ga0209983_100081016 96
1806 3300027717 Ga0209998_10080529 Ga0209998_100805292 96
1807 3300027876 Ga0209974_10007508 Ga0209974_100075084 96
1808 3300028380 Ga0268265_11001979 Ga0268265_110019792 96
1809 3300032002 Ga0307416_100118263 Ga0307416_1001182633 96
1810 3300034816 Ga0373930_0074044 Ga0373930_0074044_261_632 96
1811 3300034819 Ga0373958_0094801 Ga0373958_0094801_132_503 96
1812 3300034820 Ga0373959_0006266 Ga0373959_0006266_1577_1948 96
1813 3300034820 Ga0373959_0013525 Ga0373959_0013525_737_1105 96
1814 3300034957 Ga0373938_0034724 Ga0373938_0034724_287_655 96
1815 3300035084 Ga0373928_0062653 Ga0373928_0062653_402_773 96
1816 3300035084 Ga0373928_0154152 Ga0373928_0154152_154_522 96
1817 3300035085 Ga0373929_0026783 Ga0373929_0026783_716_1087 96
1818 3300035092 Ga0373952_0044807 Ga0373952_0044807_191_562 96
1819 3300035115 Ga0373941_0017581 Ga0373941_0017581_690_1061 96
1820 3300035121 Ga0373960_0040013 Ga0373960_0040013_264_632 96
1821 3300035241 Ga0373961_0036950 Ga0373961_0036950_449_817 96
1822 3300035691 Ga0373931_0113587 Ga0373931_0113587_786_1157 96
1823 3300041496 Ga0451839_1015318 Ga0451839_1015318_92_451 96
1824 3300046522 Ga0495643_0072184 Ga0495643_0072184_830_1204 96
1825 3300046683 Ga0495658_0495585 Ga0495658_0495585_131_478 96
1826 3300048915 Ga0496112_0002541 Ga0496112_0002541_3206_3577 96
1827 3300048915 Ga0496112_0060181 Ga0496112_0060181_325_681 96
1828 3300048916 Ga0496113_0813883 Ga0496113_0813883_154_510 96
1829 3300049578 Ga0501042_0407104 Ga0501042_0407104_227_517 96
1830 3300049585 Ga0501069_0815877 Ga0501069_0815877_136_426 96
1831 3300049586 Ga0501070_0513201 Ga0501070_0513201_519_809 96
1832 3300049587 Ga0501071_0919752 Ga0501071_0919752_53_343 96
1833 3300049588 Ga0501072_0154703 Ga0501072_0154703_985_1275 96
1834 3300049591 Ga0501075_0267549 Ga0501075_0267549_616_906 96
1835 3300049742 Ga0501080_1618640 Ga0501080_1618640_215_505 96
1836 3300049743 Ga0501081_1455032 Ga0501081_1455032_15_308 96
1837 3300050507 nmdc:mga05p37_151379_c1 nmdc:mga05p37_151379_c1_1564_1941 96
1838 3300050512 nmdc:mga0n895_512489_c1 nmdc:mga0n895_512489_c1_364_735 96
1839 3300050513 nmdc:mga0rr50_508223_c1 nmdc:mga0rr50_508223_c1_304_681 96
1840 3300050514 nmdc:mga08x19_98185_c1 nmdc:mga08x19_98185_c1_980_1348 96
1841 3300050515 nmdc:mga0a205_26534_c1 nmdc:mga0a205_26534_c1_3645_4016 96
1842 3300060344 Ga0587071_109511 Ga0587071_109511_192_563 96
1843 3300060353 Ga0501082_0898369 Ga0501082_0898369_364_654 96

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00203

Ribosomal_S19

Ribosomal protein S19

3

83

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
4v48-assembly1.cif.gz_BS real space refined coordinates of the 30s and 50s subunits fitted into the low resolution cryo-em map of the initiation-like state of e. coli 70s ribosome 0.9657 15 76
5mmm-assembly1.cif.gz_s structure of the 70s chloroplast ribosome 0.9441 8 83
7qv3-assembly1.cif.gz_s bacillus subtilis muts2-collided disome complex (muts2 conf.2; leading 70s) 0.9377 4 80
7qv3-assembly1.cif.gz_s bacillus subtilis muts2-collided disome complex (muts2 conf.2; leading 70s) 0.9262 4 80
8buu-assembly1.cif.gz_s are-abcf vmlr2 bound to a 70s ribosome 0.9236 2 84
ID Description Score Start End Superfamily
af_P06588_1_92_3.30.860.10 Alpha Beta;2-Layer Sandwich;30s Ribosomal Protein S19; Chain A;Ribosomal protein S19/S15 0.9482 8 83 3.30.860.10
5zeus00 Alpha Beta;2-Layer Sandwich;30s Ribosomal Protein S19; Chain A;Ribosomal protein S19/S15 0.9025 7 83 3.30.860.10
2y0uS00 Alpha Beta;2-Layer Sandwich;30s Ribosomal Protein S19; Chain A;Ribosomal protein S19/S15 0.8973 4 81 3.30.860.10
4kj2S00 Alpha Beta;2-Layer Sandwich;30s Ribosomal Protein S19; Chain A;Ribosomal protein S19/S15 0.8925 3 81 3.30.860.10
2y0uS00 Alpha Beta;2-Layer Sandwich;30s Ribosomal Protein S19; Chain A;Ribosomal protein S19/S15 0.8865 4 81 3.30.860.10
ID Description Score Start End GO Terms
AF-A0A7C7UQP5-F1-model_v4 Small ribosomal subunit protein uS19 (30S ribosomal protein S19) 0.9738 1 78 GO:0000028
GO:0003735
GO:0005737
GO:0006412
GO:0015935
GO:0019843
AF-A0A7C7UQP5-F1-model_v4 Small ribosomal subunit protein uS19 (30S ribosomal protein S19) 0.9617 1 78 GO:0000028
GO:0003735
GO:0005737
GO:0006412
GO:0015935
GO:0019843
AF-A0A1F4QGH0-F1-model_v4 Small ribosomal subunit protein uS19 (30S ribosomal protein S19) 0.9374 1 82 GO:0000028
GO:0003735
GO:0005737
GO:0006412
GO:0015935
GO:0019843
AF-A0A661WLB4-F1-model_v4 Small ribosomal subunit protein uS19 0.9309 1 83 GO:0000028
GO:0003735
GO:0005737
GO:0006412
GO:0015935
GO:0019843
AF-H6T3U6-F1-model_v4 Small ribosomal subunit protein uS19c (30S ribosomal protein S19, chloroplastic) 0.93 7 85 GO:0000028
GO:0003735
GO:0005763
GO:0006412
GO:0009536
GO:0019843

Feature Viewer

pLDDT pTM Quality
87.25 0.71 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map