F495873
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1843 | 555 | 3686 | 205 |
Family's Representative Sequence
| Representative Sequence | 3300053093|Ga0500651_0190048|Ga0500651_0190048_148_918 |
| Length | 256 |
| Sequence | MNGPSKGRFHFHVRGGRDGVRLSLFRGSIVCWPDQRRRACIPAKPILCERTMTKRISAKHKIDRRLGQNIWGRPKSPVNKREYGPGQHGQRRAGKVSDFGIQLRAKQKLKGYYANINERQFKNIYKEATRLRGDTSENLIGLLECRLDAVIYRAKFVPTPFAARQFVSHGHINVNGRRVNIPSYRCRPGDLVEVREKGRGMVLVLEAVQSPERDVPDYVEADHGKMKATFVRIPQLSDVPYPVQMEPNLVVEFYSR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 2 | 2010549000 | Rice roots microbial communities from plants at IRRI, Los Banos, Philippines - endophytes | Metagenome | Endosphere |
| 3 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 4 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 5 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 6 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 7 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 8 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 9 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 10 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 11 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 12 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 13 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 14 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 15 | 3300003577 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 16 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 17 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 18 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 19 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 20 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 21 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 22 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 26 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 28 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 30 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 32 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 34 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 45 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 57 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 62 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 63 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 64 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 65 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 66 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 67 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 69 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 70 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 71 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 72 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 74 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 75 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 79 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 80 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 82 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 83 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 84 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 86 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 87 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 88 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 89 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 90 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 91 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 92 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 93 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 94 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 95 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 96 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 97 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 98 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 99 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 100 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 101 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 102 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 103 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 104 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 105 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 106 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 107 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 108 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 110 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 111 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 112 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 113 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 114 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 115 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 116 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 117 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 118 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 119 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 121 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 122 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 135 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 136 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 137 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 138 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 139 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 150 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 151 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 152 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 153 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 154 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 155 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 156 | 3300015689 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 | Metagenome | Rhizosphere |
| 157 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 158 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 159 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 160 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 161 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 162 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 163 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 164 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 165 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 166 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 167 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 168 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 169 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 170 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 171 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 172 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 173 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 174 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 175 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 176 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 177 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 178 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 179 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 180 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 246 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 247 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 248 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 249 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 251 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 253 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 254 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 255 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 256 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 257 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 258 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 259 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 260 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 261 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 262 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 263 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 264 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 265 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 266 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 267 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 268 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 269 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 270 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 271 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 272 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 273 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 274 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 275 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 276 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 277 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 278 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 279 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 280 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 281 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 282 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 283 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 284 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 285 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 286 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 287 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 288 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 289 | 3300033527 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 290 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 291 | 3300033529 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 292 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 293 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 294 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 295 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 296 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 297 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 298 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 299 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 300 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 301 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 302 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 303 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 304 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 305 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 306 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 307 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 308 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 309 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 310 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 311 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 312 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 313 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 314 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 315 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 316 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 317 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 318 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 319 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 320 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 321 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 322 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 323 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 324 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 325 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 326 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 327 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 328 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 329 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 330 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 331 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 332 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 333 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 334 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 335 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 336 | 3300042136 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 | Metagenome | Rhizosphere |
| 337 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 338 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 339 | 3300042533 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 | Metagenome | Rhizosphere |
| 340 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 341 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 342 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 343 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 344 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 345 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 346 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 347 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 348 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 349 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 350 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 351 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 352 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 353 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 354 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 355 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 356 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 418 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 419 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 420 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 421 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 422 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 423 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 424 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 425 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 426 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 427 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 428 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 429 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 430 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 431 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 432 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 433 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 434 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 435 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 436 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 437 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 438 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 439 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 440 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 441 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 442 | 3300049131 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 443 | 3300049160 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 444 | 3300049162 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 445 | 3300049530 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 446 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 447 | 3300049535 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 448 | 3300049536 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 449 | 3300049541 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 450 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 451 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 452 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 453 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 454 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 455 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 456 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 457 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 458 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 459 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 460 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 461 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 462 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 463 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 464 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 465 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 466 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 467 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 468 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 469 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 470 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 471 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 472 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 473 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 474 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 475 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 476 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 477 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 478 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 479 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 480 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 481 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 482 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 483 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 484 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 485 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 486 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 487 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 488 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 489 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 490 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 491 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 492 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 493 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 494 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 495 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 496 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 497 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 498 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 499 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 500 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 501 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 502 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 503 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 504 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 505 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 506 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 507 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 508 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 509 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 510 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 511 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 512 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 513 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 514 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 515 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 516 | 3300053126 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere | Metagenome | Endosphere |
| 517 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 518 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 519 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 520 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 521 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 522 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 523 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 524 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 525 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 526 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 527 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 528 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 529 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 530 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 531 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 532 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 533 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 534 | 3300053733 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere | Metagenome | Endosphere |
| 535 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 536 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 537 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 538 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 539 | 3300059623 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 540 | 3300059624 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 541 | 3300059625 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 151R_CD_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 542 | 3300059626 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 543 | 3300059631 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 168R_SD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 544 | 3300059639 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 545 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 546 | 3300059642 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 547 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 548 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 549 | 3300059654 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 148R_CW_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 550 | 3300059659 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 157R_AD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 551 | 3300059660 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 161R_SW_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 552 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 553 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 554 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 555 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.67 |
| Metatranscriptomes | 2.33 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 7.65 |
| Nodule | 0.71 |
| Rhizoplane | 6.13 |
| Rhizosphere | 82.96 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0500651_0190048 | 3300053093 | Bacteria | 1216 |
| 2 | RicEn_C4886 | 2010549000 | Bacteria | 1877 |
| 3 | JGI24740J21852_10028970 | 3300001979 | Bacteria | 1823 |
| 4 | JGI24739J22299_10035650 | 3300001989 | Bacteria | 1684 |
| 5 | JGI24737J22298_10009679 | 3300001990 | Bacteria | 3196 |
| 6 | JGI24743J22301_10050974 | 3300001991 | Bacteria | 843 |
| 7 | JGI24735J21928_10019801 | 3300002067 | Bacteria | 2066 |
| 8 | JGI24745J21846_1025938 | 3300002073 | Bacteria | 698 |
| 9 | JGI24738J21930_10039363 | 3300002075 | Bacteria | 961 |
| 10 | JGI25156J39149_1007812 | 3300002705 | Bacteria | 2764 |
| 11 | JGI25157J39369_1001188 | 3300002741 | Bacteria | 11043 |
| 12 | JGI25406J46586_10002529 | 3300003203 | Bacteria | 8658 |
| 13 | JGI25165J46597_1000192 | 3300003214 | Bacteria | 91136 |
| 14 | JGI25165J46597_1003262 | 3300003214 | Bacteria | 4193 |
| 15 | JGI25160J50197_1005746 | 3300003354 | Bacteria | 5118 |
| 16 | Ga0007416J51690_1023620 | 3300003577 | Bacteria | 686 |
| 17 | JGI25404J52841_10047908 | 3300003659 | Bacteria | 900 |
| 18 | Ga0055542_1000612 | 3300003762 | Bacteria | 30367 |
| 19 | Ga0055529_1003526 | 3300003763 | Bacteria | 2576 |
| 20 | Ga0055531_10016283 | 3300003794 | Bacteria | 3217 |
| 21 | Ga0065712_10370395 | 3300005290 | Bacteria | 755 |
| 22 | Ga0065715_10105176 | 3300005293 | Bacteria | 2905 |
| 23 | Ga0070658_10021681 | 3300005327 | Bacteria | 5149 |
| 24 | Ga0070658_10021783 | 3300005327 | Bacteria | 5136 |
| 25 | Ga0070658_10031935 | 3300005327 | Bacteria | 4232 |
| 26 | Ga0070658_10051002 | 3300005327 | Bacteria | 3353 |
| 27 | Ga0070658_10386894 | 3300005327 | Bacteria | 1200 |
| 28 | Ga0070676_10014141 | 3300005328 | Bacteria | 4382 |
| 29 | Ga0070683_100224613 | 3300005329 | Bacteria | 1785 |
| 30 | Ga0070683_100468308 | 3300005329 | Bacteria | 1203 |
| 31 | Ga0070683_100542749 | 3300005329 | Bacteria | 1112 |
| 32 | Ga0070690_100010596 | 3300005330 | Bacteria | 5369 |
| 33 | Ga0070670_100014234 | 3300005331 | Bacteria | 6823 |
| 34 | Ga0068869_100173823 | 3300005334 | Bacteria | 1684 |
| 35 | Ga0068869_100225952 | 3300005334 | Bacteria | 1486 |
| 36 | Ga0070666_10019980 | 3300005335 | Bacteria | 4328 |
| 37 | Ga0070666_10240332 | 3300005335 | Bacteria | 1280 |
| 38 | Ga0070680_100026089 | 3300005336 | Bacteria | 4674 |
| 39 | Ga0070680_100530837 | 3300005336 | Bacteria | 1008 |
| 40 | Ga0070680_101022033 | 3300005336 | Bacteria | 714 |
| 41 | Ga0070682_100001226 | 3300005337 | Bacteria | 14606 |
| 42 | Ga0070682_100002466 | 3300005337 | Bacteria | 10225 |
| 43 | Ga0070682_100002995 | 3300005337 | Bacteria | 9375 |
| 44 | Ga0070682_100083887 | 3300005337 | Bacteria | 2069 |
| 45 | Ga0068868_100021232 | 3300005338 | Bacteria | 4889 |
| 46 | Ga0068868_100327996 | 3300005338 | Bacteria | 1306 |
| 47 | Ga0070660_100022647 | 3300005339 | Bacteria | 4649 |
| 48 | Ga0070660_100032440 | 3300005339 | Bacteria | 3930 |
| 49 | Ga0070660_100571500 | 3300005339 | Bacteria | 944 |
| 50 | Ga0070689_100005857 | 3300005340 | Bacteria | 8441 |
| 51 | Ga0070689_100691753 | 3300005340 | Bacteria | 890 |
| 52 | Ga0070689_100703389 | 3300005340 | Bacteria | 882 |
| 53 | Ga0070691_10004158 | 3300005341 | Bacteria | 6571 |
| 54 | Ga0070691_10035914 | 3300005341 | Bacteria | 2335 |
| 55 | Ga0070691_10055160 | 3300005341 | Bacteria | 1903 |
| 56 | Ga0070687_100001867 | 3300005343 | Bacteria | 7638 |
| 57 | Ga0070687_100247855 | 3300005343 | Bacteria | 1105 |
| 58 | Ga0070661_100002323 | 3300005344 | Bacteria | 13057 |
| 59 | Ga0070661_100041250 | 3300005344 | Bacteria | 3368 |
| 60 | Ga0070692_10004328 | 3300005345 | Bacteria | 5910 |
| 61 | Ga0070668_100003026 | 3300005347 | Bacteria | 12438 |
| 62 | Ga0070668_100019887 | 3300005347 | Bacteria | 5059 |
| 63 | Ga0070668_100211414 | 3300005347 | Bacteria | 1596 |
| 64 | Ga0070668_100212046 | 3300005347 | Bacteria | 1593 |
| 65 | Ga0070668_100227611 | 3300005347 | Bacteria | 1540 |
| 66 | Ga0070668_100315465 | 3300005347 | Bacteria | 1315 |
| 67 | Ga0070668_100592997 | 3300005347 | Bacteria | 968 |
| 68 | Ga0070668_100799715 | 3300005347 | Bacteria | 838 |
| 69 | Ga0070669_100001259 | 3300005353 | Bacteria | 18386 |
| 70 | Ga0070669_100056898 | 3300005353 | Bacteria | 2867 |
| 71 | Ga0070675_100015132 | 3300005354 | Bacteria | 6092 |
| 72 | Ga0070675_100182317 | 3300005354 | Bacteria | 1816 |
| 73 | Ga0070675_100432631 | 3300005354 | Bacteria | 1178 |
| 74 | Ga0070671_100001064 | 3300005355 | Bacteria | 20251 |
| 75 | Ga0070674_100000541 | 3300005356 | Bacteria | 18943 |
| 76 | Ga0070674_100066867 | 3300005356 | Bacteria | 2527 |
| 77 | Ga0070674_100088457 | 3300005356 | Bacteria | 2229 |
| 78 | Ga0070674_100163799 | 3300005356 | Bacteria | 1689 |
| 79 | Ga0070674_100362019 | 3300005356 | Bacteria | 1175 |
| 80 | Ga0070674_100364610 | 3300005356 | Bacteria | 1171 |
| 81 | Ga0070673_100000057 | 3300005364 | Bacteria | 45789 |
| 82 | Ga0070688_100001329 | 3300005365 | Bacteria | 12253 |
| 83 | Ga0070659_100000930 | 3300005366 | Bacteria | 21487 |
| 84 | Ga0070659_100008775 | 3300005366 | Bacteria | 7401 |
| 85 | Ga0070659_100016746 | 3300005366 | Bacteria | 5506 |
| 86 | Ga0070659_100550665 | 3300005366 | Bacteria | 987 |
| 87 | Ga0070667_100002740 | 3300005367 | Bacteria | 15237 |
| 88 | Ga0070667_100061608 | 3300005367 | Bacteria | 3177 |
| 89 | Ga0070667_100210428 | 3300005367 | Bacteria | 1728 |
| 90 | Ga0070667_100320517 | 3300005367 | Bacteria | 1398 |
| 91 | Ga0070667_100484448 | 3300005367 | Bacteria | 1133 |
| 92 | Ga0070703_10001755 | 3300005406 | Bacteria | 6422 |
| 93 | Ga0070703_10028563 | 3300005406 | Bacteria | 1668 |
| 94 | Ga0070703_10224050 | 3300005406 | Bacteria | 750 |
| 95 | Ga0070709_10029110 | 3300005434 | Bacteria | 3300 |
| 96 | Ga0070709_10244548 | 3300005434 | Bacteria | 1290 |
| 97 | Ga0070709_10345783 | 3300005434 | Bacteria | 1098 |
| 98 | Ga0070709_10547385 | 3300005434 | Bacteria | 885 |
| 99 | Ga0070714_100037979 | 3300005435 | Bacteria | 4049 |
| 100 | Ga0070714_100667227 | 3300005435 | Bacteria | 1002 |
| 101 | Ga0070713_100000821 | 3300005436 | Bacteria | 19927 |
| 102 | Ga0070713_100064624 | 3300005436 | Bacteria | 3071 |
| 103 | Ga0070710_10070031 | 3300005437 | Bacteria | 2019 |
| 104 | Ga0070710_10513903 | 3300005437 | Bacteria | 822 |
| 105 | Ga0070701_10136185 | 3300005438 | Bacteria | 1400 |
| 106 | Ga0070711_100058787 | 3300005439 | Bacteria | 2667 |
| 107 | Ga0070711_100081834 | 3300005439 | Bacteria | 2302 |
| 108 | Ga0070711_100094047 | 3300005439 | Bacteria | 2166 |
| 109 | Ga0070711_100096299 | 3300005439 | Bacteria | 2144 |
| 110 | Ga0070711_100109994 | 3300005439 | Bacteria | 2021 |
| 111 | Ga0070711_100210304 | 3300005439 | Bacteria | 1506 |
| 112 | Ga0070705_100000482 | 3300005440 | Bacteria | 23023 |
| 113 | Ga0070705_100001911 | 3300005440 | Bacteria | 10701 |
| 114 | Ga0070705_100037527 | 3300005440 | Bacteria | 2734 |
| 115 | Ga0070705_100039606 | 3300005440 | Bacteria | 2675 |
| 116 | Ga0070705_100164198 | 3300005440 | Bacteria | 1488 |
| 117 | Ga0070705_100328749 | 3300005440 | Bacteria | 1107 |
| 118 | Ga0070700_100037506 | 3300005441 | Bacteria | 2948 |
| 119 | Ga0070700_100067062 | 3300005441 | Bacteria | 2279 |
| 120 | Ga0070700_100115743 | 3300005441 | Bacteria | 1789 |
| 121 | Ga0070700_100239407 | 3300005441 | Bacteria | 1296 |
| 122 | Ga0070694_100001027 | 3300005444 | Bacteria | 15886 |
| 123 | Ga0070694_100016532 | 3300005444 | Bacteria | 4645 |
| 124 | Ga0070694_100023169 | 3300005444 | Bacteria | 3990 |
| 125 | Ga0070708_100204145 | 3300005445 | Bacteria | 1851 |
| 126 | Ga0070708_100601211 | 3300005445 | Bacteria | 1037 |
| 127 | Ga0070663_100005184 | 3300005455 | Bacteria | 7719 |
| 128 | Ga0070663_100008291 | 3300005455 | Bacteria | 6384 |
| 129 | Ga0070663_100044716 | 3300005455 | Bacteria | 3124 |
| 130 | Ga0070663_100061385 | 3300005455 | Bacteria | 2707 |
| 131 | Ga0070663_100091503 | 3300005455 | Bacteria | 2254 |
| 132 | Ga0070663_100096361 | 3300005455 | Bacteria | 2200 |
| 133 | Ga0070663_100530272 | 3300005455 | Bacteria | 981 |
| 134 | Ga0070663_100703660 | 3300005455 | Bacteria | 859 |
| 135 | Ga0070678_100023682 | 3300005456 | Bacteria | 4097 |
| 136 | Ga0070678_100136161 | 3300005456 | Bacteria | 1959 |
| 137 | Ga0070678_100407401 | 3300005456 | Bacteria | 1183 |
| 138 | Ga0070662_100005649 | 3300005457 | Bacteria | 8000 |
| 139 | Ga0070662_100401932 | 3300005457 | Bacteria | 1131 |
| 140 | Ga0070681_10009623 | 3300005458 | Bacteria | 9504 |
| 141 | Ga0070681_10054520 | 3300005458 | Bacteria | 3984 |
| 142 | Ga0070681_10056304 | 3300005458 | Bacteria | 3914 |
| 143 | Ga0070681_10107453 | 3300005458 | Bacteria | 2731 |
| 144 | Ga0070681_10119937 | 3300005458 | Bacteria | 2566 |
| 145 | Ga0070681_10286454 | 3300005458 | Bacteria | 1558 |
| 146 | Ga0068867_100054354 | 3300005459 | Bacteria | 2958 |
| 147 | Ga0068867_100388015 | 3300005459 | Bacteria | 1175 |
| 148 | Ga0068867_100840375 | 3300005459 | Bacteria | 822 |
| 149 | Ga0070685_10012730 | 3300005466 | Bacteria | 4426 |
| 150 | Ga0070685_10167378 | 3300005466 | Bacteria | 1406 |
| 151 | Ga0070706_100694230 | 3300005467 | Bacteria | 944 |
| 152 | Ga0070707_100010698 | 3300005468 | Bacteria | 8547 |
| 153 | Ga0070698_100051280 | 3300005471 | Bacteria | 4203 |
| 154 | Ga0070698_100785038 | 3300005471 | Bacteria | 896 |
| 155 | Ga0070699_100000836 | 3300005518 | Bacteria | 28545 |
| 156 | Ga0070699_100069742 | 3300005518 | Bacteria | 3055 |
| 157 | Ga0070699_100094222 | 3300005518 | Bacteria | 2621 |
| 158 | Ga0070699_100416437 | 3300005518 | Bacteria | 1216 |
| 159 | Ga0070679_100015220 | 3300005530 | Bacteria | 7388 |
| 160 | Ga0070679_100089644 | 3300005530 | Bacteria | 3063 |
| 161 | Ga0070679_100097482 | 3300005530 | Bacteria | 2928 |
| 162 | Ga0070684_100438273 | 3300005535 | Bacteria | 1207 |
| 163 | Ga0070684_100970740 | 3300005535 | Bacteria | 797 |
| 164 | Ga0070697_100001866 | 3300005536 | Bacteria | 16103 |
| 165 | Ga0070697_100014888 | 3300005536 | Bacteria | 6105 |
| 166 | Ga0068853_100002253 | 3300005539 | Bacteria | 14417 |
| 167 | Ga0068853_100006655 | 3300005539 | Bacteria | 9203 |
| 168 | Ga0068853_100025202 | 3300005539 | Bacteria | 4990 |
| 169 | Ga0068853_100061886 | 3300005539 | Bacteria | 3238 |
| 170 | Ga0068853_100075662 | 3300005539 | Bacteria | 2938 |
| 171 | Ga0068853_100224330 | 3300005539 | Bacteria | 1717 |
| 172 | Ga0070672_100161402 | 3300005543 | Bacteria | 1860 |
| 173 | Ga0070672_100551467 | 3300005543 | Bacteria | 1001 |
| 174 | Ga0070686_100184664 | 3300005544 | Bacteria | 1484 |
| 175 | Ga0070695_100000195 | 3300005545 | Bacteria | 29584 |
| 176 | Ga0070695_100000581 | 3300005545 | Bacteria | 19279 |
| 177 | Ga0070695_100007007 | 3300005545 | Bacteria | 6679 |
| 178 | Ga0070695_100030874 | 3300005545 | Bacteria | 3338 |
| 179 | Ga0070695_100065339 | 3300005545 | Bacteria | 2369 |
| 180 | Ga0070695_100167265 | 3300005545 | Bacteria | 1548 |
| 181 | Ga0070695_100320465 | 3300005545 | Bacteria | 1152 |
| 182 | Ga0070696_100000690 | 3300005546 | Bacteria | 21595 |
| 183 | Ga0070696_100001754 | 3300005546 | Bacteria | 14229 |
| 184 | Ga0070696_100018247 | 3300005546 | Bacteria | 4740 |
| 185 | Ga0070696_100123840 | 3300005546 | Bacteria | 1874 |
| 186 | Ga0070693_100000914 | 3300005547 | Bacteria | 13126 |
| 187 | Ga0070693_100027143 | 3300005547 | Bacteria | 3099 |
| 188 | Ga0070693_100035966 | 3300005547 | Bacteria | 2750 |
| 189 | Ga0070693_100037340 | 3300005547 | Bacteria | 2708 |
| 190 | Ga0070693_100151406 | 3300005547 | Bacteria | 1470 |
| 191 | Ga0070693_100169615 | 3300005547 | Bacteria | 1397 |
| 192 | Ga0070693_100247245 | 3300005547 | Bacteria | 1181 |
| 193 | Ga0070693_100404663 | 3300005547 | Bacteria | 947 |
| 194 | Ga0070665_100025273 | 3300005548 | Bacteria | 5984 |
| 195 | Ga0070665_100043638 | 3300005548 | Bacteria | 4505 |
| 196 | Ga0070665_100064156 | 3300005548 | Bacteria | 3683 |
| 197 | Ga0070665_100070997 | 3300005548 | Bacteria | 3489 |
| 198 | Ga0070665_100095473 | 3300005548 | Bacteria | 2978 |
| 199 | Ga0070665_100128148 | 3300005548 | Bacteria | 2540 |
| 200 | Ga0070665_100289108 | 3300005548 | Bacteria | 1641 |
| 201 | Ga0070704_100002869 | 3300005549 | Bacteria | 9769 |
| 202 | Ga0070704_100007305 | 3300005549 | Bacteria | 6573 |
| 203 | Ga0070704_100029004 | 3300005549 | Bacteria | 3689 |
| 204 | Ga0070704_100183282 | 3300005549 | Bacteria | 1677 |
| 205 | Ga0070704_100378394 | 3300005549 | Bacteria | 1202 |
| 206 | Ga0070704_100688333 | 3300005549 | Bacteria | 906 |
| 207 | Ga0068855_100072247 | 3300005563 | Bacteria | 4011 |
| 208 | Ga0068855_100076455 | 3300005563 | Bacteria | 3886 |
| 209 | Ga0068855_100255082 | 3300005563 | Bacteria | 1955 |
| 210 | Ga0070664_100003236 | 3300005564 | Bacteria | 13160 |
| 211 | Ga0070664_100701164 | 3300005564 | Bacteria | 943 |
| 212 | Ga0068857_100010632 | 3300005577 | Bacteria | 8003 |
| 213 | Ga0068857_100013736 | 3300005577 | Bacteria | 7055 |
| 214 | Ga0068857_100013738 | 3300005577 | Bacteria | 7055 |
| 215 | Ga0068857_100062947 | 3300005577 | Bacteria | 3298 |
| 216 | Ga0068857_100341791 | 3300005577 | Bacteria | 1385 |
| 217 | Ga0068854_100004526 | 3300005578 | Bacteria | 8767 |
| 218 | Ga0068854_100014363 | 3300005578 | Bacteria | 5220 |
| 219 | Ga0068854_100843221 | 3300005578 | Bacteria | 802 |
| 220 | Ga0068856_100001161 | 3300005614 | Bacteria | 27673 |
| 221 | Ga0068856_100059501 | 3300005614 | Bacteria | 3773 |
| 222 | Ga0068856_100161708 | 3300005614 | Bacteria | 2249 |
| 223 | Ga0068856_100447789 | 3300005614 | Bacteria | 1312 |
| 224 | Ga0068856_100846745 | 3300005614 | Bacteria | 934 |
| 225 | Ga0070702_100012198 | 3300005615 | Bacteria | 4299 |
| 226 | Ga0070702_100032394 | 3300005615 | Bacteria | 2868 |
| 227 | Ga0070702_100082500 | 3300005615 | Bacteria | 1929 |
| 228 | Ga0070702_100181582 | 3300005615 | Bacteria | 1377 |
| 229 | Ga0070702_100182650 | 3300005615 | Bacteria | 1374 |
| 230 | Ga0068852_100008313 | 3300005616 | Bacteria | 7637 |
| 231 | Ga0068852_100018494 | 3300005616 | Bacteria | 5491 |
| 232 | Ga0068852_100158335 | 3300005616 | Bacteria | 2112 |
| 233 | Ga0068859_100000988 | 3300005617 | Bacteria | 29125 |
| 234 | Ga0068859_100569234 | 3300005617 | Bacteria | 1227 |
| 235 | Ga0068864_100026317 | 3300005618 | Bacteria | 4906 |
| 236 | Ga0068864_100045147 | 3300005618 | Bacteria | 3779 |
| 237 | Ga0068864_100620332 | 3300005618 | Bacteria | 1051 |
| 238 | Ga0068866_10013292 | 3300005718 | Bacteria | 3609 |
| 239 | Ga0068866_10209355 | 3300005718 | Bacteria | 1170 |
| 240 | Ga0068866_10386259 | 3300005718 | Bacteria | 899 |
| 241 | Ga0068861_100001822 | 3300005719 | Bacteria | 13732 |
| 242 | Ga0068861_100017951 | 3300005719 | Bacteria | 5031 |
| 243 | Ga0068863_100004888 | 3300005841 | Bacteria | 13206 |
| 244 | Ga0068863_100308348 | 3300005841 | Bacteria | 1536 |
| 245 | Ga0068858_100030872 | 3300005842 | Bacteria | 4977 |
| 246 | Ga0068858_100083031 | 3300005842 | Bacteria | 2979 |
| 247 | Ga0068860_100000926 | 3300005843 | Bacteria | 32568 |
| 248 | Ga0068860_100009033 | 3300005843 | Bacteria | 9921 |
| 249 | Ga0068860_100068511 | 3300005843 | Bacteria | 3371 |
| 250 | Ga0068860_100120631 | 3300005843 | Bacteria | 2511 |
| 251 | Ga0068860_100307635 | 3300005843 | Bacteria | 1554 |
| 252 | Ga0068862_100001945 | 3300005844 | Bacteria | 18720 |
| 253 | Ga0068862_100017794 | 3300005844 | Bacteria | 5916 |
| 254 | Ga0068862_100018580 | 3300005844 | Bacteria | 5790 |
| 255 | Ga0068862_100039031 | 3300005844 | Bacteria | 4031 |
| 256 | Ga0068862_100059776 | 3300005844 | Bacteria | 3273 |
| 257 | Ga0068862_100087797 | 3300005844 | Bacteria | 2705 |
| 258 | Ga0068862_100307291 | 3300005844 | Bacteria | 1461 |
| 259 | Ga0068862_100323811 | 3300005844 | Bacteria | 1423 |
| 260 | Ga0068862_100524184 | 3300005844 | Bacteria | 1128 |
| 261 | Ga0081455_10000206 | 3300005937 | Bacteria | 75450 |
| 262 | Ga0081455_10002195 | 3300005937 | Bacteria | 23269 |
| 263 | Ga0081455_10005107 | 3300005937 | Bacteria | 14473 |
| 264 | Ga0081455_10017029 | 3300005937 | Bacteria | 6986 |
| 265 | Ga0081455_10105529 | 3300005937 | Bacteria | 2251 |
| 266 | Ga0081455_10134987 | 3300005937 | Bacteria | 1924 |
| 267 | Ga0081455_10145278 | 3300005937 | Bacteria | 1836 |
| 268 | Ga0081540_1000056 | 3300005983 | Bacteria | 122552 |
| 269 | Ga0081540_1000084 | 3300005983 | Bacteria | 100067 |
| 270 | Ga0081540_1001770 | 3300005983 | Bacteria | 18155 |
| 271 | Ga0081540_1099107 | 3300005983 | Bacteria | 1260 |
| 272 | Ga0081539_10000054 | 3300005985 | Bacteria | 259053 |
| 273 | Ga0081539_10006565 | 3300005985 | Bacteria | 11078 |
| 274 | Ga0081539_10165130 | 3300005985 | Bacteria | 1052 |
| 275 | Ga0075365_10007267 | 3300006038 | Bacteria | 6192 |
| 276 | Ga0075365_10088030 | 3300006038 | Bacteria | 2112 |
| 277 | Ga0075368_10000337 | 3300006042 | Bacteria | 13784 |
| 278 | Ga0075368_10004593 | 3300006042 | Bacteria | 4692 |
| 279 | Ga0075368_10013623 | 3300006042 | Bacteria | 2989 |
| 280 | Ga0075368_10021504 | 3300006042 | Bacteria | 2451 |
| 281 | Ga0075363_100011887 | 3300006048 | Bacteria | 4182 |
| 282 | Ga0075363_100014188 | 3300006048 | Bacteria | 3886 |
| 283 | Ga0075363_100018851 | 3300006048 | Bacteria | 3443 |
| 284 | Ga0075363_100029503 | 3300006048 | Bacteria | 2833 |
| 285 | Ga0075363_100143314 | 3300006048 | Bacteria | 1346 |
| 286 | Ga0075364_10002122 | 3300006051 | Bacteria | 11093 |
| 287 | Ga0075364_10007755 | 3300006051 | Bacteria | 6392 |
| 288 | Ga0075364_10295816 | 3300006051 | Bacteria | 1102 |
| 289 | Ga0070715_10104527 | 3300006163 | Bacteria | 1326 |
| 290 | Ga0070716_100008734 | 3300006173 | Bacteria | 5033 |
| 291 | Ga0070716_100042581 | 3300006173 | Bacteria | 2536 |
| 292 | Ga0070712_100001926 | 3300006175 | Bacteria | 12699 |
| 293 | Ga0070712_100006320 | 3300006175 | Bacteria | 7346 |
| 294 | Ga0075362_10003670 | 3300006177 | Bacteria | 5417 |
| 295 | Ga0075362_10071447 | 3300006177 | Bacteria | 1586 |
| 296 | Ga0075362_10074486 | 3300006177 | Bacteria | 1556 |
| 297 | Ga0075367_10000532 | 3300006178 | Bacteria | 14389 |
| 298 | Ga0075367_10017857 | 3300006178 | Bacteria | 3902 |
| 299 | Ga0075367_10052250 | 3300006178 | Bacteria | 2418 |
| 300 | Ga0075367_10169171 | 3300006178 | Bacteria | 1361 |
| 301 | Ga0075367_10191110 | 3300006178 | Bacteria | 1277 |
| 302 | Ga0075367_10194115 | 3300006178 | Bacteria | 1267 |
| 303 | Ga0075367_10410518 | 3300006178 | Bacteria | 857 |
| 304 | Ga0075369_10079339 | 3300006186 | Bacteria | 1454 |
| 305 | Ga0075369_10095657 | 3300006186 | Bacteria | 1329 |
| 306 | Ga0075366_10081004 | 3300006195 | Bacteria | 1939 |
| 307 | Ga0075366_10100388 | 3300006195 | Bacteria | 1736 |
| 308 | Ga0097621_100008311 | 3300006237 | Bacteria | 7468 |
| 309 | Ga0097621_100031965 | 3300006237 | Bacteria | 4180 |
| 310 | Ga0097621_100549461 | 3300006237 | Bacteria | 1051 |
| 311 | Ga0097621_100842667 | 3300006237 | Bacteria | 851 |
| 312 | Ga0075370_10076573 | 3300006353 | Bacteria | 1919 |
| 313 | Ga0075370_10142857 | 3300006353 | Bacteria | 1400 |
| 314 | Ga0068871_100014662 | 3300006358 | Bacteria | 5848 |
| 315 | Ga0068871_100083151 | 3300006358 | Bacteria | 2655 |
| 316 | Ga0075428_100050334 | 3300006844 | Bacteria | 4570 |
| 317 | Ga0075428_100100614 | 3300006844 | Bacteria | 3152 |
| 318 | Ga0075430_100031495 | 3300006846 | Bacteria | 4502 |
| 319 | Ga0075430_100080919 | 3300006846 | Bacteria | 2721 |
| 320 | Ga0075430_100265378 | 3300006846 | Bacteria | 1422 |
| 321 | Ga0075430_100628550 | 3300006846 | Bacteria | 886 |
| 322 | Ga0075431_100002538 | 3300006847 | Bacteria | 17614 |
| 323 | Ga0075431_100094545 | 3300006847 | Bacteria | 3085 |
| 324 | Ga0075431_100254902 | 3300006847 | Bacteria | 1782 |
| 325 | Ga0075431_100441702 | 3300006847 | Bacteria | 1298 |
| 326 | Ga0075433_10001745 | 3300006852 | Bacteria | 16240 |
| 327 | Ga0075433_10005400 | 3300006852 | Bacteria | 10043 |
| 328 | Ga0075433_10598806 | 3300006852 | Bacteria | 968 |
| 329 | Ga0075434_100004864 | 3300006871 | Bacteria | 12170 |
| 330 | Ga0075434_100028601 | 3300006871 | Bacteria | 5479 |
| 331 | Ga0075434_100343182 | 3300006871 | Bacteria | 1514 |
| 332 | Ga0075429_100037548 | 3300006880 | Bacteria | 4216 |
| 333 | Ga0075429_100060402 | 3300006880 | Bacteria | 3302 |
| 334 | Ga0075429_100131565 | 3300006880 | Bacteria | 2189 |
| 335 | Ga0068865_100003035 | 3300006881 | Bacteria | 10039 |
| 336 | Ga0068865_100017196 | 3300006881 | Bacteria | 4647 |
| 337 | Ga0068865_100299399 | 3300006881 | Bacteria | 1287 |
| 338 | Ga0075436_100014618 | 3300006914 | Bacteria | 5380 |
| 339 | Ga0075436_100038092 | 3300006914 | Bacteria | 3319 |
| 340 | Ga0075436_100044658 | 3300006914 | Bacteria | 3056 |
| 341 | Ga0075436_100116338 | 3300006914 | Bacteria | 1868 |
| 342 | Ga0097620_100000988 | 3300006931 | Bacteria | 29125 |
| 343 | Ga0097620_100569165 | 3300006931 | Bacteria | 1227 |
| 344 | Ga0075435_100010519 | 3300007076 | Bacteria | 6768 |
| 345 | Ga0075435_100037487 | 3300007076 | Bacteria | 3860 |
| 346 | Ga0075435_100052443 | 3300007076 | Bacteria | 3288 |
| 347 | Ga0075435_100123380 | 3300007076 | Bacteria | 2163 |
| 348 | Ga0075435_100281103 | 3300007076 | Bacteria | 1421 |
| 349 | Ga0099795_10014807 | 3300007788 | Bacteria | 2427 |
| 350 | Ga0105244_10144043 | 3300009036 | Bacteria | 1144 |
| 351 | Ga0105244_10220680 | 3300009036 | Bacteria | 889 |
| 352 | Ga0105250_10077450 | 3300009092 | Bacteria | 1346 |
| 353 | Ga0105240_10073694 | 3300009093 | Bacteria | 4216 |
| 354 | Ga0105240_10183491 | 3300009093 | Bacteria | 2467 |
| 355 | Ga0105240_10205833 | 3300009093 | Bacteria | 2303 |
| 356 | Ga0105240_10310807 | 3300009093 | Bacteria | 1800 |
| 357 | Ga0105240_10482260 | 3300009093 | Bacteria | 1382 |
| 358 | Ga0105240_10547464 | 3300009093 | Bacteria | 1281 |
| 359 | Ga0105240_11176739 | 3300009093 | Bacteria | 813 |
| 360 | Ga0111539_10012221 | 3300009094 | Bacteria | 10767 |
| 361 | Ga0111539_10017956 | 3300009094 | Bacteria | 8762 |
| 362 | Ga0111539_10063889 | 3300009094 | Bacteria | 4356 |
| 363 | Ga0111539_10281772 | 3300009094 | Bacteria | 1934 |
| 364 | Ga0111539_10711556 | 3300009094 | Bacteria | 1169 |
| 365 | Ga0111539_11336403 | 3300009094 | Bacteria | 832 |
| 366 | Ga0105245_10011237 | 3300009098 | Bacteria | 7795 |
| 367 | Ga0105245_10132988 | 3300009098 | Bacteria | 2335 |
| 368 | Ga0105245_10175078 | 3300009098 | Bacteria | 2046 |
| 369 | Ga0105245_10290079 | 3300009098 | Bacteria | 1602 |
| 370 | Ga0105247_10000737 | 3300009101 | Bacteria | 25281 |
| 371 | Ga0105247_10001368 | 3300009101 | Bacteria | 17689 |
| 372 | Ga0105247_10234964 | 3300009101 | Bacteria | 1246 |
| 373 | Ga0105247_10262609 | 3300009101 | Bacteria | 1184 |
| 374 | Ga0105247_10706670 | 3300009101 | Bacteria | 759 |
| 375 | Ga0114129_10051143 | 3300009147 | Bacteria | 5802 |
| 376 | Ga0114129_10122419 | 3300009147 | Bacteria | 3580 |
| 377 | Ga0114129_10197230 | 3300009147 | Bacteria | 2729 |
| 378 | Ga0114129_10242123 | 3300009147 | Bacteria | 2424 |
| 379 | Ga0114129_10394526 | 3300009147 | Bacteria | 1825 |
| 380 | Ga0114129_10404709 | 3300009147 | Bacteria | 1798 |
| 381 | Ga0114129_10407325 | 3300009147 | Bacteria | 1791 |
| 382 | Ga0105243_10029787 | 3300009148 | Bacteria | 4200 |
| 383 | Ga0105243_10085833 | 3300009148 | Bacteria | 2580 |
| 384 | Ga0105243_10088324 | 3300009148 | Bacteria | 2547 |
| 385 | Ga0105243_10100798 | 3300009148 | Bacteria | 2397 |
| 386 | Ga0105243_10682441 | 3300009148 | Bacteria | 999 |
| 387 | Ga0105243_11345118 | 3300009148 | Bacteria | 733 |
| 388 | Ga0105241_10002335 | 3300009174 | Bacteria | 14254 |
| 389 | Ga0105241_10014047 | 3300009174 | Bacteria | 5869 |
| 390 | Ga0105241_10016188 | 3300009174 | Bacteria | 5463 |
| 391 | Ga0105241_10024062 | 3300009174 | Bacteria | 4522 |
| 392 | Ga0105241_10041637 | 3300009174 | Bacteria | 3472 |
| 393 | Ga0105241_10180978 | 3300009174 | Bacteria | 1749 |
| 394 | Ga0105242_10012128 | 3300009176 | Bacteria | 6630 |
| 395 | Ga0105242_10018436 | 3300009176 | Bacteria | 5456 |
| 396 | Ga0105242_10638387 | 3300009176 | Bacteria | 1034 |
| 397 | Ga0105242_10771680 | 3300009176 | Bacteria | 948 |
| 398 | Ga0105242_11097111 | 3300009176 | Bacteria | 810 |
| 399 | Ga0105242_11219632 | 3300009176 | Bacteria | 772 |
| 400 | Ga0105248_10108818 | 3300009177 | Bacteria | 3125 |
| 401 | Ga0105248_10442555 | 3300009177 | Bacteria | 1464 |
| 402 | Ga0105248_10601915 | 3300009177 | Bacteria | 1240 |
| 403 | Ga0105248_11373771 | 3300009177 | Bacteria | 799 |
| 404 | Ga0105237_10003028 | 3300009545 | Bacteria | 20270 |
| 405 | Ga0105237_10006900 | 3300009545 | Bacteria | 12523 |
| 406 | Ga0105237_10071221 | 3300009545 | Bacteria | 3472 |
| 407 | Ga0105237_10092975 | 3300009545 | Bacteria | 3005 |
| 408 | Ga0105237_10380971 | 3300009545 | Bacteria | 1415 |
| 409 | Ga0105237_10558912 | 3300009545 | Bacteria | 1151 |
| 410 | Ga0105237_10629162 | 3300009545 | Bacteria | 1080 |
| 411 | Ga0105238_10017449 | 3300009551 | Bacteria | 7295 |
| 412 | Ga0105238_10026969 | 3300009551 | Bacteria | 5856 |
| 413 | Ga0105238_10050679 | 3300009551 | Bacteria | 4179 |
| 414 | Ga0105238_10053343 | 3300009551 | Bacteria | 4063 |
| 415 | Ga0105238_10428381 | 3300009551 | Bacteria | 1318 |
| 416 | Ga0105238_10900454 | 3300009551 | Bacteria | 903 |
| 417 | Ga0105249_10000531 | 3300009553 | Bacteria | 35092 |
| 418 | Ga0105249_10008319 | 3300009553 | Bacteria | 9032 |
| 419 | Ga0105249_10070606 | 3300009553 | Bacteria | 3224 |
| 420 | Ga0105249_10107309 | 3300009553 | Bacteria | 2635 |
| 421 | Ga0105249_10166990 | 3300009553 | Bacteria | 2131 |
| 422 | Ga0105249_10333549 | 3300009553 | Bacteria | 1531 |
| 423 | Ga0105249_10370752 | 3300009553 | Bacteria | 1455 |
| 424 | Ga0105249_10752003 | 3300009553 | Bacteria | 1037 |
| 425 | Ga0105249_10772019 | 3300009553 | Bacteria | 1024 |
| 426 | Ga0099796_10002097 | 3300010159 | Bacteria | 4273 |
| 427 | Ga0105239_10010524 | 3300010375 | Bacteria | 10339 |
| 428 | Ga0105239_10030053 | 3300010375 | Bacteria | 5975 |
| 429 | Ga0105239_10067664 | 3300010375 | Bacteria | 3924 |
| 430 | Ga0105239_10168067 | 3300010375 | Bacteria | 2452 |
| 431 | Ga0105239_10937793 | 3300010375 | Bacteria | 994 |
| 432 | Ga0105246_10015297 | 3300011119 | Bacteria | 4842 |
| 433 | Ga0105246_10024383 | 3300011119 | Bacteria | 3930 |
| 434 | Ga0105246_10095782 | 3300011119 | Bacteria | 2149 |
| 435 | Ga0105246_10164786 | 3300011119 | Bacteria | 1692 |
| 436 | Ga0105246_10215498 | 3300011119 | Bacteria | 1501 |
| 437 | Ga0105246_10986868 | 3300011119 | Bacteria | 761 |
| 438 | Ga0157373_10064010 | 3300013100 | Bacteria | 2603 |
| 439 | Ga0157373_10102109 | 3300013100 | Bacteria | 2018 |
| 440 | Ga0157371_10024584 | 3300013102 | Bacteria | 4396 |
| 441 | Ga0157370_10019510 | 3300013104 | Bacteria | 6799 |
| 442 | Ga0157370_10019637 | 3300013104 | Bacteria | 6769 |
| 443 | Ga0157370_10110620 | 3300013104 | Bacteria | 2568 |
| 444 | Ga0157370_10132278 | 3300013104 | Bacteria | 2327 |
| 445 | Ga0157370_10395219 | 3300013104 | Bacteria | 1273 |
| 446 | Ga0157370_10893728 | 3300013104 | Bacteria | 806 |
| 447 | Ga0157369_10001030 | 3300013105 | Bacteria | 35205 |
| 448 | Ga0157369_10093483 | 3300013105 | Bacteria | 3210 |
| 449 | Ga0157369_10146006 | 3300013105 | Bacteria | 2501 |
| 450 | Ga0157369_10185997 | 3300013105 | Bacteria | 2184 |
| 451 | Ga0157369_10696279 | 3300013105 | Bacteria | 1046 |
| 452 | Ga0157374_10175222 | 3300013296 | Bacteria | 2093 |
| 453 | Ga0157374_10230288 | 3300013296 | Bacteria | 1820 |
| 454 | Ga0157374_10391418 | 3300013296 | Bacteria | 1385 |
| 455 | Ga0157378_10043214 | 3300013297 | Bacteria | 4001 |
| 456 | Ga0157378_10231402 | 3300013297 | Bacteria | 1761 |
| 457 | Ga0157378_10622154 | 3300013297 | Bacteria | 1093 |
| 458 | Ga0163162_10054728 | 3300013306 | Bacteria | 4015 |
| 459 | Ga0163162_10082841 | 3300013306 | Bacteria | 3280 |
| 460 | Ga0163162_10117746 | 3300013306 | Bacteria | 2758 |
| 461 | Ga0163162_10750552 | 3300013306 | Bacteria | 1095 |
| 462 | Ga0157372_10026742 | 3300013307 | Bacteria | 6279 |
| 463 | Ga0157372_10109363 | 3300013307 | Bacteria | 3165 |
| 464 | Ga0157372_10135005 | 3300013307 | Bacteria | 2841 |
| 465 | Ga0157372_10191024 | 3300013307 | Bacteria | 2372 |
| 466 | Ga0157372_10991994 | 3300013307 | Bacteria | 973 |
| 467 | Ga0157372_11213938 | 3300013307 | Bacteria | 871 |
| 468 | Ga0157375_10001988 | 3300013308 | Bacteria | 17647 |
| 469 | Ga0157375_10008047 | 3300013308 | Bacteria | 9226 |
| 470 | Ga0157375_10143231 | 3300013308 | Bacteria | 2519 |
| 471 | Ga0157375_10189394 | 3300013308 | Bacteria | 2212 |
| 472 | Ga0157375_10976955 | 3300013308 | Bacteria | 987 |
| 473 | Ga0163163_10097157 | 3300014325 | Bacteria | 2966 |
| 474 | Ga0163163_10365068 | 3300014325 | Bacteria | 1500 |
| 475 | Ga0163163_10416832 | 3300014325 | Bacteria | 1402 |
| 476 | Ga0163163_10459326 | 3300014325 | Bacteria | 1334 |
| 477 | Ga0163163_10646252 | 3300014325 | Bacteria | 1121 |
| 478 | Ga0163163_11283878 | 3300014325 | Bacteria | 794 |
| 479 | Ga0157380_10405808 | 3300014326 | Bacteria | 1294 |
| 480 | Ga0157380_10504078 | 3300014326 | Bacteria | 1176 |
| 481 | Ga0157380_10716256 | 3300014326 | Bacteria | 1008 |
| 482 | Ga0182008_10054407 | 3300014497 | Bacteria | 1980 |
| 483 | Ga0157377_10025352 | 3300014745 | Bacteria | 3162 |
| 484 | Ga0157379_10000749 | 3300014968 | Bacteria | 26252 |
| 485 | Ga0157379_10016989 | 3300014968 | Bacteria | 6405 |
| 486 | Ga0157379_10075923 | 3300014968 | Bacteria | 3009 |
| 487 | Ga0157379_10133417 | 3300014968 | Bacteria | 2236 |
| 488 | Ga0157379_10290156 | 3300014968 | Bacteria | 1490 |
| 489 | Ga0157379_10361360 | 3300014968 | Bacteria | 1330 |
| 490 | Ga0157379_10734299 | 3300014968 | Bacteria | 929 |
| 491 | Ga0157376_10003317 | 3300014969 | Bacteria | 11080 |
| 492 | Ga0157376_10399975 | 3300014969 | Bacteria | 1328 |
| 493 | Ga0182007_10035490 | 3300015262 | Bacteria | 1680 |
| 494 | Ga0182007_10052757 | 3300015262 | Bacteria | 1340 |
| 495 | Ga0182005_1092467 | 3300015265 | Bacteria | 842 |
| 496 | Ga0183360_11619 | 3300015689 | Bacteria | 802 |
| 497 | Ga0163161_10003533 | 3300017792 | Bacteria | 10931 |
| 498 | Ga0163161_10025367 | 3300017792 | Bacteria | 4195 |
| 499 | Ga0163161_10084722 | 3300017792 | Bacteria | 2338 |
| 500 | Ga0163161_10264032 | 3300017792 | Bacteria | 1345 |
| 501 | Ga0163161_10741409 | 3300017792 | Bacteria | 821 |
| 502 | Ga0206355_1642619 | 3300020076 | Bacteria | 753 |
| 503 | Ga0214544_1000020 | 3300021320 | Bacteria | 178560 |
| 504 | Ga0214542_1000024 | 3300021321 | Bacteria | 191218 |
| 505 | Ga0214545_1000011 | 3300021324 | Bacteria | 190550 |
| 506 | Ga0214543_1000033 | 3300021327 | Bacteria | 190419 |
| 507 | Ga0213872_10000436 | 3300021361 | Bacteria | 34190 |
| 508 | Ga0213872_10001037 | 3300021361 | Bacteria | 19370 |
| 509 | Ga0213872_10001313 | 3300021361 | Bacteria | 16489 |
| 510 | Ga0213872_10026558 | 3300021361 | Bacteria | 2659 |
| 511 | Ga0213872_10056877 | 3300021361 | Bacteria | 1771 |
| 512 | Ga0213876_10009498 | 3300021384 | Bacteria | 5232 |
| 513 | Ga0213871_10081219 | 3300021441 | Bacteria | 929 |
| 514 | Ga0224712_10238004 | 3300022467 | Bacteria | 838 |
| 515 | Ga0209563_101494 | 3300025230 | Bacteria | 6143 |
| 516 | Ga0209646_1012674 | 3300025246 | Bacteria | 1291 |
| 517 | Ga0209026_1000002 | 3300025250 | Bacteria | 1136158 |
| 518 | Ga0209026_1029710 | 3300025250 | Bacteria | 813 |
| 519 | Ga0209677_102419 | 3300025253 | Bacteria | 7054 |
| 520 | Ga0209148_1000038 | 3300025254 | Bacteria | 493744 |
| 521 | Ga0209759_1000062 | 3300025256 | Bacteria | 197996 |
| 522 | Ga0209233_1000027 | 3300025261 | Bacteria | 652089 |
| 523 | Ga0209233_1000421 | 3300025261 | Bacteria | 31634 |
| 524 | Ga0209455_1000068 | 3300025272 | Bacteria | 310024 |
| 525 | Ga0209676_1000082 | 3300025292 | Bacteria | 280400 |
| 526 | Ga0209758_1000407 | 3300025297 | Bacteria | 73945 |
| 527 | Ga0209758_1000648 | 3300025297 | Bacteria | 52785 |
| 528 | Ga0209758_1000900 | 3300025297 | Bacteria | 40401 |
| 529 | Ga0209758_1000952 | 3300025297 | Bacteria | 39040 |
| 530 | Ga0209758_1005567 | 3300025297 | Bacteria | 9592 |
| 531 | Ga0209758_1029931 | 3300025297 | Bacteria | 2264 |
| 532 | Ga0209256_1011331 | 3300025299 | Bacteria | 3580 |
| 533 | Ga0207426_1000466 | 3300025302 | Bacteria | 62533 |
| 534 | Ga0207426_1049518 | 3300025302 | Bacteria | 1257 |
| 535 | Ga0209257_1000453 | 3300025304 | Bacteria | 76813 |
| 536 | Ga0209257_1000459 | 3300025304 | Bacteria | 75629 |
| 537 | Ga0209257_1001445 | 3300025304 | Bacteria | 28079 |
| 538 | Ga0207697_10063726 | 3300025315 | Bacteria | 1536 |
| 539 | Ga0207697_10200825 | 3300025315 | Bacteria | 877 |
| 540 | Ga0207656_10008565 | 3300025321 | Bacteria | 3769 |
| 541 | Ga0207696_1074805 | 3300025711 | Bacteria | 939 |
| 542 | Ga0207653_10001588 | 3300025885 | Bacteria | 7338 |
| 543 | Ga0207653_10233721 | 3300025885 | Bacteria | 701 |
| 544 | Ga0207692_10055751 | 3300025898 | Bacteria | 2025 |
| 545 | Ga0207692_10318999 | 3300025898 | Bacteria | 950 |
| 546 | Ga0207642_10029261 | 3300025899 | Bacteria | 2279 |
| 547 | Ga0207642_10437371 | 3300025899 | Bacteria | 790 |
| 548 | Ga0207710_10013792 | 3300025900 | Bacteria | 3402 |
| 549 | Ga0207688_10273069 | 3300025901 | Bacteria | 1029 |
| 550 | Ga0207680_10030082 | 3300025903 | Bacteria | 3058 |
| 551 | Ga0207647_10004130 | 3300025904 | Bacteria | 10778 |
| 552 | Ga0207647_10007855 | 3300025904 | Bacteria | 7674 |
| 553 | Ga0207647_10026597 | 3300025904 | Bacteria | 3783 |
| 554 | Ga0207647_10043340 | 3300025904 | Bacteria | 2817 |
| 555 | Ga0207647_10081984 | 3300025904 | Bacteria | 1932 |
| 556 | Ga0207647_10208481 | 3300025904 | Bacteria | 1129 |
| 557 | Ga0207685_10007736 | 3300025905 | Bacteria | 3015 |
| 558 | Ga0207685_10085006 | 3300025905 | Bacteria | 1319 |
| 559 | Ga0207685_10115392 | 3300025905 | Bacteria | 1170 |
| 560 | Ga0207699_10000247 | 3300025906 | Bacteria | 30409 |
| 561 | Ga0207699_10006459 | 3300025906 | Bacteria | 5679 |
| 562 | Ga0207699_10020990 | 3300025906 | Bacteria | 3511 |
| 563 | Ga0207699_10037459 | 3300025906 | Bacteria | 2773 |
| 564 | Ga0207645_10018132 | 3300025907 | Bacteria | 4638 |
| 565 | Ga0207645_10046403 | 3300025907 | Bacteria | 2775 |
| 566 | Ga0207645_10372579 | 3300025907 | Bacteria | 957 |
| 567 | Ga0207705_10085846 | 3300025909 | Bacteria | 2299 |
| 568 | Ga0207705_10108390 | 3300025909 | Bacteria | 2050 |
| 569 | Ga0207705_10220589 | 3300025909 | Bacteria | 1440 |
| 570 | Ga0207705_10235580 | 3300025909 | Bacteria | 1393 |
| 571 | Ga0207654_10028657 | 3300025911 | Bacteria | 3037 |
| 572 | Ga0207654_10032030 | 3300025911 | Bacteria | 2900 |
| 573 | Ga0207707_10056300 | 3300025912 | Bacteria | 3421 |
| 574 | Ga0207707_10111346 | 3300025912 | Bacteria | 2393 |
| 575 | Ga0207707_10154670 | 3300025912 | Bacteria | 2006 |
| 576 | Ga0207707_10171728 | 3300025912 | Bacteria | 1895 |
| 577 | Ga0207707_10232803 | 3300025912 | Bacteria | 1603 |
| 578 | Ga0207707_10546335 | 3300025912 | Bacteria | 984 |
| 579 | Ga0207695_10080996 | 3300025913 | Bacteria | 3287 |
| 580 | Ga0207695_10137937 | 3300025913 | Bacteria | 2391 |
| 581 | Ga0207695_10266602 | 3300025913 | Bacteria | 1609 |
| 582 | Ga0207695_10359508 | 3300025913 | Bacteria | 1342 |
| 583 | Ga0207671_10001115 | 3300025914 | Bacteria | 32386 |
| 584 | Ga0207671_10028628 | 3300025914 | Bacteria | 4162 |
| 585 | Ga0207671_10033498 | 3300025914 | Bacteria | 3821 |
| 586 | Ga0207671_10098471 | 3300025914 | Bacteria | 2212 |
| 587 | Ga0207671_10116914 | 3300025914 | Bacteria | 2035 |
| 588 | Ga0207671_10157615 | 3300025914 | Bacteria | 1757 |
| 589 | Ga0207671_10447878 | 3300025914 | Bacteria | 1028 |
| 590 | Ga0207693_10000452 | 3300025915 | Bacteria | 37613 |
| 591 | Ga0207693_10010567 | 3300025915 | Bacteria | 7489 |
| 592 | Ga0207693_10328403 | 3300025915 | Bacteria | 1197 |
| 593 | Ga0207663_10024121 | 3300025916 | Bacteria | 3500 |
| 594 | Ga0207663_10049118 | 3300025916 | Bacteria | 2615 |
| 595 | Ga0207663_10070876 | 3300025916 | Bacteria | 2247 |
| 596 | Ga0207660_10067495 | 3300025917 | Bacteria | 2590 |
| 597 | Ga0207660_10258532 | 3300025917 | Bacteria | 1376 |
| 598 | Ga0207662_10002336 | 3300025918 | Bacteria | 9507 |
| 599 | Ga0207657_10000216 | 3300025919 | Bacteria | 60001 |
| 600 | Ga0207657_10007456 | 3300025919 | Bacteria | 11217 |
| 601 | Ga0207657_10114352 | 3300025919 | Bacteria | 2225 |
| 602 | Ga0207657_10182122 | 3300025919 | Bacteria | 1698 |
| 603 | Ga0207649_10000746 | 3300025920 | Bacteria | 21330 |
| 604 | Ga0207649_10003062 | 3300025920 | Bacteria | 9185 |
| 605 | Ga0207649_10103220 | 3300025920 | Bacteria | 1891 |
| 606 | Ga0207649_10594945 | 3300025920 | Bacteria | 850 |
| 607 | Ga0207652_10011743 | 3300025921 | Bacteria | 7069 |
| 608 | Ga0207652_10096405 | 3300025921 | Bacteria | 2606 |
| 609 | Ga0207646_10017030 | 3300025922 | Bacteria | 6812 |
| 610 | Ga0207681_10008312 | 3300025923 | Bacteria | 6347 |
| 611 | Ga0207681_10401768 | 3300025923 | Bacteria | 1107 |
| 612 | Ga0207681_10487979 | 3300025923 | Bacteria | 1007 |
| 613 | Ga0207694_10013968 | 3300025924 | Bacteria | 6055 |
| 614 | Ga0207694_10053540 | 3300025924 | Bacteria | 3129 |
| 615 | Ga0207694_10074985 | 3300025924 | Bacteria | 2648 |
| 616 | Ga0207694_10370236 | 3300025924 | Bacteria | 1188 |
| 617 | Ga0207694_10410411 | 3300025924 | Bacteria | 1127 |
| 618 | Ga0207650_10029186 | 3300025925 | Bacteria | 3962 |
| 619 | Ga0207650_10377393 | 3300025925 | Bacteria | 1170 |
| 620 | Ga0207659_10186178 | 3300025926 | Bacteria | 1649 |
| 621 | Ga0207659_10204786 | 3300025926 | Bacteria | 1578 |
| 622 | Ga0207659_10304953 | 3300025926 | Bacteria | 1309 |
| 623 | Ga0207659_10378426 | 3300025926 | Bacteria | 1180 |
| 624 | Ga0207687_10073987 | 3300025927 | Bacteria | 2441 |
| 625 | Ga0207687_10373717 | 3300025927 | Bacteria | 1166 |
| 626 | Ga0207687_10585649 | 3300025927 | Bacteria | 939 |
| 627 | Ga0207700_10000005 | 3300025928 | Bacteria | 394836 |
| 628 | Ga0207700_10858763 | 3300025928 | Bacteria | 812 |
| 629 | Ga0207664_10029550 | 3300025929 | Bacteria | 4176 |
| 630 | Ga0207664_10067335 | 3300025929 | Bacteria | 2873 |
| 631 | Ga0207664_10385348 | 3300025929 | Bacteria | 1245 |
| 632 | Ga0207664_10659262 | 3300025929 | Bacteria | 941 |
| 633 | Ga0207664_11151621 | 3300025929 | Bacteria | 692 |
| 634 | Ga0207644_10048242 | 3300025931 | Bacteria | 3043 |
| 635 | Ga0207644_10654242 | 3300025931 | Bacteria | 875 |
| 636 | Ga0207690_10020548 | 3300025932 | Bacteria | 4082 |
| 637 | Ga0207690_10044955 | 3300025932 | Bacteria | 2914 |
| 638 | Ga0207706_10004343 | 3300025933 | Bacteria | 13311 |
| 639 | Ga0207706_10023201 | 3300025933 | Bacteria | 5573 |
| 640 | Ga0207706_10193087 | 3300025933 | Bacteria | 1787 |
| 641 | Ga0207706_10326748 | 3300025933 | Bacteria | 1334 |
| 642 | Ga0207686_10009840 | 3300025934 | Bacteria | 5197 |
| 643 | Ga0207686_10287222 | 3300025934 | Bacteria | 1217 |
| 644 | Ga0207686_10559218 | 3300025934 | Bacteria | 895 |
| 645 | Ga0207709_10061448 | 3300025935 | Bacteria | 2348 |
| 646 | Ga0207709_10166159 | 3300025935 | Bacteria | 1544 |
| 647 | Ga0207709_10343431 | 3300025935 | Bacteria | 1124 |
| 648 | Ga0207709_10764232 | 3300025935 | Bacteria | 778 |
| 649 | Ga0207670_10013288 | 3300025936 | Bacteria | 4848 |
| 650 | Ga0207670_10085302 | 3300025936 | Bacteria | 2219 |
| 651 | Ga0207670_10984073 | 3300025936 | Bacteria | 709 |
| 652 | Ga0207669_10006682 | 3300025937 | Bacteria | 5288 |
| 653 | Ga0207669_10094332 | 3300025937 | Bacteria | 1958 |
| 654 | Ga0207704_10002567 | 3300025938 | Bacteria | 8192 |
| 655 | Ga0207704_10020922 | 3300025938 | Bacteria | 3473 |
| 656 | Ga0207704_10480338 | 3300025938 | Bacteria | 998 |
| 657 | Ga0207665_10000221 | 3300025939 | Bacteria | 38707 |
| 658 | Ga0207665_10074793 | 3300025939 | Bacteria | 2319 |
| 659 | Ga0207691_10005941 | 3300025940 | Bacteria | 11789 |
| 660 | Ga0207691_10216278 | 3300025940 | Bacteria | 1663 |
| 661 | Ga0207711_10064180 | 3300025941 | Bacteria | 3172 |
| 662 | Ga0207689_10036092 | 3300025942 | Bacteria | 4104 |
| 663 | Ga0207689_10160394 | 3300025942 | Bacteria | 1853 |
| 664 | Ga0207689_10166143 | 3300025942 | Bacteria | 1818 |
| 665 | Ga0207689_10394632 | 3300025942 | Bacteria | 1153 |
| 666 | Ga0207679_10013396 | 3300025945 | Bacteria | 5375 |
| 667 | Ga0207667_10093222 | 3300025949 | Bacteria | 3110 |
| 668 | Ga0207667_10186802 | 3300025949 | Bacteria | 2127 |
| 669 | Ga0207667_10200984 | 3300025949 | Bacteria | 2044 |
| 670 | Ga0207667_10211185 | 3300025949 | Bacteria | 1989 |
| 671 | Ga0207667_10559828 | 3300025949 | Bacteria | 1156 |
| 672 | Ga0207667_10593846 | 3300025949 | Bacteria | 1117 |
| 673 | Ga0207651_10002858 | 3300025960 | Bacteria | 8323 |
| 674 | Ga0207712_10005342 | 3300025961 | Bacteria | 8112 |
| 675 | Ga0207712_10024603 | 3300025961 | Bacteria | 3990 |
| 676 | Ga0207712_10063511 | 3300025961 | Bacteria | 2629 |
| 677 | Ga0207712_10108912 | 3300025961 | Bacteria | 2074 |
| 678 | Ga0207712_10195529 | 3300025961 | Bacteria | 1599 |
| 679 | Ga0207712_10219331 | 3300025961 | Bacteria | 1520 |
| 680 | Ga0207712_10304584 | 3300025961 | Bacteria | 1309 |
| 681 | Ga0207712_10773934 | 3300025961 | Bacteria | 842 |
| 682 | Ga0207668_10013005 | 3300025972 | Bacteria | 5114 |
| 683 | Ga0207668_10057577 | 3300025972 | Bacteria | 2712 |
| 684 | Ga0207668_10082339 | 3300025972 | Bacteria | 2337 |
| 685 | Ga0207668_10173086 | 3300025972 | Bacteria | 1695 |
| 686 | Ga0207668_10230094 | 3300025972 | Bacteria | 1494 |
| 687 | Ga0207668_10760481 | 3300025972 | Bacteria | 855 |
| 688 | Ga0207640_10006200 | 3300025981 | Bacteria | 6547 |
| 689 | Ga0207640_10424385 | 3300025981 | Bacteria | 1089 |
| 690 | Ga0207658_10119156 | 3300025986 | Bacteria | 2101 |
| 691 | Ga0207658_10246838 | 3300025986 | Bacteria | 1515 |
| 692 | Ga0207658_10287354 | 3300025986 | Bacteria | 1412 |
| 693 | Ga0207658_10455791 | 3300025986 | Bacteria | 1133 |
| 694 | Ga0207658_10575822 | 3300025986 | Bacteria | 1009 |
| 695 | Ga0207677_10100552 | 3300026023 | Bacteria | 2126 |
| 696 | Ga0207677_10109511 | 3300026023 | Bacteria | 2054 |
| 697 | Ga0207703_10011279 | 3300026035 | Bacteria | 6950 |
| 698 | Ga0207703_10077424 | 3300026035 | Bacteria | 2761 |
| 699 | Ga0207703_10084220 | 3300026035 | Bacteria | 2658 |
| 700 | Ga0207703_10152980 | 3300026035 | Bacteria | 2013 |
| 701 | Ga0207703_10239751 | 3300026035 | Bacteria | 1630 |
| 702 | Ga0207703_10555384 | 3300026035 | Bacteria | 1083 |
| 703 | Ga0207639_10002485 | 3300026041 | Bacteria | 12354 |
| 704 | Ga0207639_10004167 | 3300026041 | Bacteria | 9731 |
| 705 | Ga0207639_10004947 | 3300026041 | Bacteria | 8977 |
| 706 | Ga0207639_10313166 | 3300026041 | Bacteria | 1391 |
| 707 | Ga0207639_10341915 | 3300026041 | Bacteria | 1334 |
| 708 | Ga0207639_10376317 | 3300026041 | Bacteria | 1274 |
| 709 | Ga0207639_11272816 | 3300026041 | Bacteria | 690 |
| 710 | Ga0207678_10000074 | 3300026067 | Bacteria | 79745 |
| 711 | Ga0207678_10009216 | 3300026067 | Bacteria | 8685 |
| 712 | Ga0207678_10010215 | 3300026067 | Bacteria | 8240 |
| 713 | Ga0207678_10017036 | 3300026067 | Bacteria | 6380 |
| 714 | Ga0207678_10104636 | 3300026067 | Bacteria | 2415 |
| 715 | Ga0207678_10131972 | 3300026067 | Bacteria | 2131 |
| 716 | Ga0207678_10161833 | 3300026067 | Bacteria | 1911 |
| 717 | Ga0207678_10175750 | 3300026067 | Bacteria | 1828 |
| 718 | Ga0207678_10694159 | 3300026067 | Bacteria | 896 |
| 719 | Ga0207678_10695720 | 3300026067 | Bacteria | 894 |
| 720 | Ga0207678_11032402 | 3300026067 | Bacteria | 728 |
| 721 | Ga0207708_10002195 | 3300026075 | Bacteria | 14412 |
| 722 | Ga0207708_10002674 | 3300026075 | Bacteria | 13095 |
| 723 | Ga0207708_10144281 | 3300026075 | Bacteria | 1870 |
| 724 | Ga0207708_10185551 | 3300026075 | Bacteria | 1653 |
| 725 | Ga0207702_10000159 | 3300026078 | Bacteria | 79906 |
| 726 | Ga0207702_10151474 | 3300026078 | Bacteria | 2110 |
| 727 | Ga0207702_10235157 | 3300026078 | Bacteria | 1714 |
| 728 | Ga0207702_10278184 | 3300026078 | Bacteria | 1581 |
| 729 | Ga0207702_10757700 | 3300026078 | Bacteria | 958 |
| 730 | Ga0207641_10033600 | 3300026088 | Bacteria | 4261 |
| 731 | Ga0207641_10268125 | 3300026088 | Bacteria | 1601 |
| 732 | Ga0207648_10083551 | 3300026089 | Bacteria | 2785 |
| 733 | Ga0207648_10100658 | 3300026089 | Bacteria | 2532 |
| 734 | Ga0207648_10115039 | 3300026089 | Bacteria | 2363 |
| 735 | Ga0207648_10124445 | 3300026089 | Bacteria | 2268 |
| 736 | Ga0207648_10361362 | 3300026089 | Bacteria | 1310 |
| 737 | Ga0207676_10039841 | 3300026095 | Bacteria | 3597 |
| 738 | Ga0207676_10149585 | 3300026095 | Bacteria | 2009 |
| 739 | Ga0207674_10000335 | 3300026116 | Bacteria | 60219 |
| 740 | Ga0207674_10015555 | 3300026116 | Bacteria | 8356 |
| 741 | Ga0207674_10023181 | 3300026116 | Bacteria | 6653 |
| 742 | Ga0207674_10120421 | 3300026116 | Bacteria | 2592 |
| 743 | Ga0207674_10613208 | 3300026116 | Bacteria | 1051 |
| 744 | Ga0207675_100000039 | 3300026118 | Bacteria | 91886 |
| 745 | Ga0207675_100053803 | 3300026118 | Bacteria | 3755 |
| 746 | Ga0207675_100274569 | 3300026118 | Bacteria | 1636 |
| 747 | Ga0207683_10000595 | 3300026121 | Bacteria | 33293 |
| 748 | Ga0207683_10073841 | 3300026121 | Bacteria | 3017 |
| 749 | Ga0207683_10080590 | 3300026121 | Bacteria | 2888 |
| 750 | Ga0207683_10169014 | 3300026121 | Bacteria | 1980 |
| 751 | Ga0207698_10034219 | 3300026142 | Bacteria | 3701 |
| 752 | Ga0207698_10470470 | 3300026142 | Bacteria | 1217 |
| 753 | Ga0207698_11452894 | 3300026142 | Bacteria | 701 |
| 754 | Ga0209389_1000011 | 3300027296 | Bacteria | 223265 |
| 755 | Ga0209389_1000025 | 3300027296 | Bacteria | 149588 |
| 756 | Ga0209589_1000018 | 3300027357 | Bacteria | 192614 |
| 757 | Ga0209589_1000066 | 3300027357 | Bacteria | 100795 |
| 758 | Ga0209489_100017 | 3300027361 | Bacteria | 223265 |
| 759 | Ga0209489_100026 | 3300027361 | Bacteria | 192614 |
| 760 | Ga0209489_100030 | 3300027361 | Bacteria | 185999 |
| 761 | Ga0209700_100027 | 3300027363 | Bacteria | 223462 |
| 762 | Ga0209700_100035 | 3300027363 | Bacteria | 192614 |
| 763 | Ga0209179_1005602 | 3300027512 | Bacteria | 1977 |
| 764 | Ga0209813_10000760 | 3300027866 | Bacteria | 7378 |
| 765 | Ga0209813_10005375 | 3300027866 | Bacteria | 3104 |
| 766 | Ga0209813_10044758 | 3300027866 | Bacteria | 1361 |
| 767 | Ga0209813_10059953 | 3300027866 | Bacteria | 1213 |
| 768 | Ga0209974_10087936 | 3300027876 | Bacteria | 1075 |
| 769 | Ga0207428_10008033 | 3300027907 | Bacteria | 9573 |
| 770 | Ga0207428_10043605 | 3300027907 | Bacteria | 3622 |
| 771 | Ga0207428_10078442 | 3300027907 | Bacteria | 2584 |
| 772 | Ga0207428_10172000 | 3300027907 | Bacteria | 1640 |
| 773 | Ga0207428_10195403 | 3300027907 | Bacteria | 1524 |
| 774 | Ga0207428_10666539 | 3300027907 | Bacteria | 746 |
| 775 | Ga0268266_10000873 | 3300028379 | Bacteria | 39154 |
| 776 | Ga0268266_10087621 | 3300028379 | Bacteria | 2724 |
| 777 | Ga0268266_10129837 | 3300028379 | Bacteria | 2253 |
| 778 | Ga0268266_10238915 | 3300028379 | Bacteria | 1676 |
| 779 | Ga0268265_10001274 | 3300028380 | Bacteria | 21743 |
| 780 | Ga0268265_10031136 | 3300028380 | Bacteria | 3851 |
| 781 | Ga0268265_10085096 | 3300028380 | Bacteria | 2508 |
| 782 | Ga0268265_10298580 | 3300028380 | Bacteria | 1449 |
| 783 | Ga0268265_10363619 | 3300028380 | Bacteria | 1325 |
| 784 | Ga0268265_11128615 | 3300028380 | Bacteria | 779 |
| 785 | Ga0268264_10005176 | 3300028381 | Bacteria | 11051 |
| 786 | Ga0268264_10021651 | 3300028381 | Bacteria | 5249 |
| 787 | Ga0268264_10024677 | 3300028381 | Bacteria | 4910 |
| 788 | Ga0268264_10101089 | 3300028381 | Bacteria | 2506 |
| 789 | Ga0268264_10316793 | 3300028381 | Bacteria | 1473 |
| 790 | Ga0268264_10607753 | 3300028381 | Bacteria | 1078 |
| 791 | Ga0265318_10037477 | 3300028577 | Bacteria | 1857 |
| 792 | Ga0265318_10163334 | 3300028577 | Bacteria | 816 |
| 793 | Ga0307517_10175344 | 3300028786 | Bacteria | 1398 |
| 794 | Ga0307515_10298722 | 3300028794 | Bacteria | 1298 |
| 795 | Ga0265324_10003033 | 3300029957 | Bacteria | 8214 |
| 796 | Ga0265328_10006595 | 3300031239 | Bacteria | 4887 |
| 797 | Ga0265328_10022262 | 3300031239 | Bacteria | 2413 |
| 798 | Ga0265320_10002231 | 3300031240 | Bacteria | 13590 |
| 799 | Ga0265325_10049914 | 3300031241 | Bacteria | 2157 |
| 800 | Ga0265340_10001518 | 3300031247 | Bacteria | 13312 |
| 801 | Ga0265340_10075342 | 3300031247 | Bacteria | 1594 |
| 802 | Ga0265340_10091620 | 3300031247 | Bacteria | 1420 |
| 803 | Ga0265340_10119958 | 3300031247 | Bacteria | 1211 |
| 804 | Ga0265339_10096644 | 3300031249 | Bacteria | 1541 |
| 805 | Ga0265331_10000002 | 3300031250 | Bacteria | 511481 |
| 806 | Ga0265331_10000017 | 3300031250 | Bacteria | 269978 |
| 807 | Ga0265331_10000314 | 3300031250 | Bacteria | 52982 |
| 808 | Ga0265331_10000478 | 3300031250 | Bacteria | 38316 |
| 809 | Ga0265331_10009324 | 3300031250 | Bacteria | 5517 |
| 810 | Ga0265331_10016612 | 3300031250 | Bacteria | 3861 |
| 811 | Ga0265331_10162272 | 3300031250 | Bacteria | 1013 |
| 812 | Ga0265331_10191643 | 3300031250 | Bacteria | 922 |
| 813 | Ga0265327_10000033 | 3300031251 | Bacteria | 317182 |
| 814 | Ga0265316_10005893 | 3300031344 | Bacteria | 11812 |
| 815 | Ga0265316_10017819 | 3300031344 | Bacteria | 6124 |
| 816 | Ga0265316_10143150 | 3300031344 | Bacteria | 1795 |
| 817 | Ga0307513_10025773 | 3300031456 | Bacteria | 6801 |
| 818 | Ga0307513_10343306 | 3300031456 | Bacteria | 1243 |
| 819 | Ga0307509_10524222 | 3300031507 | Bacteria | 866 |
| 820 | Ga0307408_100316171 | 3300031548 | Bacteria | 1314 |
| 821 | Ga0265313_10002202 | 3300031595 | Bacteria | 17238 |
| 822 | Ga0265314_10018836 | 3300031711 | Bacteria | 5363 |
| 823 | Ga0265314_10039537 | 3300031711 | Bacteria | 3396 |
| 824 | Ga0265314_10047684 | 3300031711 | Bacteria | 3013 |
| 825 | Ga0265314_10165830 | 3300031711 | Bacteria | 1339 |
| 826 | Ga0265342_10006480 | 3300031712 | Bacteria | 8717 |
| 827 | Ga0307516_10059535 | 3300031730 | Bacteria | 3714 |
| 828 | Ga0307413_10123279 | 3300031824 | Bacteria | 1759 |
| 829 | Ga0307410_10847323 | 3300031852 | Bacteria | 780 |
| 830 | Ga0307406_10000774 | 3300031901 | Bacteria | 17940 |
| 831 | Ga0307406_10481156 | 3300031901 | Bacteria | 1003 |
| 832 | Ga0307406_10665748 | 3300031901 | Bacteria | 866 |
| 833 | Ga0307412_10003682 | 3300031911 | Bacteria | 8515 |
| 834 | Ga0307412_10120408 | 3300031911 | Bacteria | 1889 |
| 835 | Ga0307412_10632544 | 3300031911 | Bacteria | 910 |
| 836 | Ga0307409_100122190 | 3300031995 | Bacteria | 2208 |
| 837 | Ga0307409_100402903 | 3300031995 | Bacteria | 1307 |
| 838 | Ga0307409_100613668 | 3300031995 | Bacteria | 1077 |
| 839 | Ga0307409_100933318 | 3300031995 | Bacteria | 883 |
| 840 | Ga0307416_101678955 | 3300032002 | Bacteria | 740 |
| 841 | Ga0307414_10014861 | 3300032004 | Bacteria | 4684 |
| 842 | Ga0307414_10136883 | 3300032004 | Bacteria | 1911 |
| 843 | Ga0307414_10158594 | 3300032004 | Bacteria | 1794 |
| 844 | Ga0307414_10276399 | 3300032004 | Bacteria | 1409 |
| 845 | Ga0307414_10449737 | 3300032004 | Bacteria | 1129 |
| 846 | Ga0307411_10187376 | 3300032005 | Bacteria | 1576 |
| 847 | Ga0307411_10621267 | 3300032005 | Bacteria | 932 |
| 848 | Ga0307415_101269811 | 3300032126 | Bacteria | 696 |
| 849 | Ga0316583_10025586 | 3300032133 | Bacteria | 2107 |
| 850 | Ga0316585_10018624 | 3300032137 | Bacteria | 2108 |
| 851 | Ga0316593_10027378 | 3300032168 | Bacteria | 1829 |
| 852 | Ga0316593_10197251 | 3300032168 | Bacteria | 743 |
| 853 | Ga0307510_10010422 | 3300033180 | Bacteria | 11039 |
| 854 | Ga0307510_10081949 | 3300033180 | Bacteria | 3124 |
| 855 | Ga0307510_10190048 | 3300033180 | Bacteria | 1603 |
| 856 | Ga0307510_10292534 | 3300033180 | Bacteria | 1094 |
| 857 | Ga0316592_1022506 | 3300033524 | Bacteria | 1348 |
| 858 | Ga0316592_1042795 | 3300033524 | Bacteria | 1004 |
| 859 | Ga0316586_1006026 | 3300033527 | Bacteria | 1729 |
| 860 | Ga0316588_1017308 | 3300033528 | Bacteria | 1605 |
| 861 | Ga0316587_1051103 | 3300033529 | Bacteria | 757 |
| 862 | Ga0316596_1027015 | 3300033541 | Bacteria | 1480 |
| 863 | Ga0373928_0039814 | 3300035084 | Bacteria | 1075 |
| 864 | Ga0373940_0124594 | 3300035088 | Bacteria | 802 |
| 865 | Ga0373949_0003058 | 3300035090 | Bacteria | 4095 |
| 866 | Ga0373949_0036948 | 3300035090 | Bacteria | 1186 |
| 867 | Ga0373939_0005251 | 3300035114 | Bacteria | 3080 |
| 868 | Ga0373939_0007825 | 3300035114 | Bacteria | 2604 |
| 869 | Ga0373939_0084871 | 3300035114 | Bacteria | 1059 |
| 870 | Ga0373941_0010797 | 3300035115 | Bacteria | 2344 |
| 871 | Ga0373941_0220077 | 3300035115 | Bacteria | 729 |
| 872 | Ga0373953_0120779 | 3300035117 | Bacteria | 1113 |
| 873 | Ga0373954_0047670 | 3300035118 | Bacteria | 2006 |
| 874 | Ga0373954_0207274 | 3300035118 | Bacteria | 963 |
| 875 | Ga0373956_0023275 | 3300035119 | Bacteria | 2657 |
| 876 | Ga0373957_0181984 | 3300035120 | Bacteria | 871 |
| 877 | Ga0373960_0007243 | 3300035121 | Bacteria | 2624 |
| 878 | Ga0373960_0013830 | 3300035121 | Bacteria | 2032 |
| 879 | Ga0373960_0069484 | 3300035121 | Bacteria | 1086 |
| 880 | Ga0373960_0073403 | 3300035121 | Bacteria | 1063 |
| 881 | Ga0373943_0108265 | 3300035170 | Bacteria | 1462 |
| 882 | Ga0373955_0038963 | 3300035172 | Bacteria | 2534 |
| 883 | Ga0373942_0009911 | 3300035207 | Bacteria | 2233 |
| 884 | Ga0373942_0021023 | 3300035207 | Bacteria | 1643 |
| 885 | Ga0373961_0010094 | 3300035241 | Bacteria | 2323 |
| 886 | Ga0373961_0066618 | 3300035241 | Bacteria | 1105 |
| 887 | Ga0373961_0071723 | 3300035241 | Bacteria | 1072 |
| 888 | Ga0373962_0001511 | 3300035242 | Bacteria | 5502 |
| 889 | Ga0373931_0001319 | 3300035691 | Bacteria | 10621 |
| 890 | Ga0373931_0004510 | 3300035691 | Bacteria | 6368 |
| 891 | Ga0373931_0020752 | 3300035691 | Bacteria | 3290 |
| 892 | Ga0373931_0167002 | 3300035691 | Bacteria | 1294 |
| 893 | Ga0373931_0214314 | 3300035691 | Bacteria | 1156 |
| 894 | Ga0373935_0001191 | 3300035692 | Bacteria | 14308 |
| 895 | Ga0373935_0012370 | 3300035692 | Bacteria | 5136 |
| 896 | Ga0373935_0349075 | 3300035692 | Bacteria | 1054 |
| 897 | Ga0373927_0011783 | 3300035695 | Bacteria | 5823 |
| 898 | Ga0373927_0197512 | 3300035695 | Bacteria | 1320 |
| 899 | Ga0373927_0251341 | 3300035695 | Bacteria | 1162 |
| 900 | Ga0373947_0067957 | 3300035725 | Bacteria | 2178 |
| 901 | Ga0373947_0472092 | 3300035725 | Bacteria | 851 |
| 902 | Ga0373937_0044626 | 3300036401 | Bacteria | 4050 |
| 903 | Ga0373937_0096130 | 3300036401 | Bacteria | 2747 |
| 904 | Ga0373937_0345739 | 3300036401 | Bacteria | 1408 |
| 905 | Ga0316582_0232890 | 3300036647 | Bacteria | 1261 |
| 906 | Ga0316584_0061029 | 3300036712 | Bacteria | 2824 |
| 907 | Ga0373925_0016064 | 3300037068 | Bacteria | 5420 |
| 908 | Ga0373925_0023175 | 3300037068 | Bacteria | 4530 |
| 909 | Ga0395899_0000059 | 3300037312 | Bacteria | 213004 |
| 910 | Ga0395899_0004247 | 3300037312 | Bacteria | 11219 |
| 911 | Ga0395899_0406994 | 3300037312 | Bacteria | 899 |
| 912 | Ga0395899_0506796 | 3300037312 | Bacteria | 782 |
| 913 | Ga0395900_0000017 | 3300037418 | Bacteria | 369602 |
| 914 | Ga0395900_0017966 | 3300037418 | Bacteria | 7220 |
| 915 | Ga0395900_0043669 | 3300037418 | Bacteria | 4620 |
| 916 | Ga0395900_0052008 | 3300037418 | Bacteria | 4218 |
| 917 | Ga0395900_0249169 | 3300037418 | Bacteria | 1778 |
| 918 | Ga0395900_0319674 | 3300037418 | Bacteria | 1533 |
| 919 | Ga0395898_0000030 | 3300037466 | Bacteria | 369577 |
| 920 | Ga0395898_0182998 | 3300037466 | Bacteria | 2002 |
| 921 | Ga0395898_0252953 | 3300037466 | Bacteria | 1680 |
| 922 | Ga0395898_0266730 | 3300037466 | Bacteria | 1633 |
| 923 | Ga0395905_0000056 | 3300037471 | Bacteria | 209230 |
| 924 | Ga0395905_0000155 | 3300037471 | Bacteria | 112355 |
| 925 | Ga0395905_0003237 | 3300037471 | Bacteria | 17510 |
| 926 | Ga0395905_0015966 | 3300037471 | Bacteria | 7137 |
| 927 | Ga0395905_0259806 | 3300037471 | Bacteria | 1621 |
| 928 | Ga0316581_0019637 | 3300037588 | Bacteria | 1972 |
| 929 | Ga0436364_0560002 | 3300037853 | Bacteria | 93566 |
| 930 | Ga0436364_1552215 | 3300037853 | Bacteria | 8392 |
| 931 | Ga0395901_0000015 | 3300038443 | Bacteria | 373388 |
| 932 | Ga0395901_0006827 | 3300038443 | Bacteria | 11526 |
| 933 | Ga0395901_0046022 | 3300038443 | Bacteria | 4530 |
| 934 | Ga0395901_0109187 | 3300038443 | Bacteria | 2905 |
| 935 | Ga0395901_0250125 | 3300038443 | Bacteria | 1847 |
| 936 | Ga0395901_0330958 | 3300038443 | Bacteria | 1575 |
| 937 | Ga0395901_0437297 | 3300038443 | Bacteria | 1339 |
| 938 | Ga0436365_0093392 | 3300039437 | Bacteria | 124820 |
| 939 | Ga0436365_0226250 | 3300039437 | Bacteria | 1000 |
| 940 | Ga0436365_0650967 | 3300039437 | Bacteria | 3831 |
| 941 | Ga0436365_0761391 | 3300039437 | Bacteria | 1591 |
| 942 | Ga0436365_1477315 | 3300039437 | Bacteria | 937 |
| 943 | Ga0436360_0445476 | 3300039438 | Bacteria | 730 |
| 944 | Ga0436360_0815295 | 3300039438 | Bacteria | 3113 |
| 945 | Ga0436360_0912999 | 3300039438 | Bacteria | 1327 |
| 946 | Ga0436360_0931197 | 3300039438 | Bacteria | 902 |
| 947 | Ga0436360_1214702 | 3300039438 | Bacteria | 1191 |
| 948 | Ga0436361_0112287 | 3300039447 | Bacteria | 22106 |
| 949 | Ga0436361_0301054 | 3300039447 | Bacteria | 795 |
| 950 | Ga0436361_0325755 | 3300039447 | Bacteria | 54753 |
| 951 | Ga0436361_0578839 | 3300039447 | Bacteria | 1501 |
| 952 | Ga0436361_0833838 | 3300039447 | Bacteria | 2497 |
| 953 | Ga0436363_1420920 | 3300039450 | Bacteria | 873 |
| 954 | Ga0436362_0171928 | 3300039453 | Bacteria | 764 |
| 955 | Ga0436362_0528243 | 3300039453 | Bacteria | 1851 |
| 956 | Ga0439438_063402 | 3300041405 | Bacteria | 923 |
| 957 | Ga0439453_0023489 | 3300041408 | Bacteria | 1126 |
| 958 | Ga0451789_0454652 | 3300041443 | Bacteria | 1425 |
| 959 | Ga0451797_0027779 | 3300041453 | Bacteria | 1261 |
| 960 | Ga0451807_2375559 | 3300041486 | Bacteria | 1017 |
| 961 | Ga0451853_3496765 | 3300041512 | Bacteria | 1112 |
| 962 | Ga0439445_0067478 | 3300042004 | Bacteria | 986 |
| 963 | Ga0439448_0011064 | 3300042005 | Bacteria | 2684 |
| 964 | Ga0450900_046263 | 3300042136 | Bacteria | 660 |
| 965 | Ga0439459_0077406 | 3300042438 | Bacteria | 780 |
| 966 | Ga0450893_0012777 | 3300042532 | Bacteria | 1395 |
| 967 | Ga0450901_005797 | 3300042533 | Bacteria | 1269 |
| 968 | Ga0451577_0289675 | 3300042876 | Bacteria | 1484 |
| 969 | Ga0439440_0050739 | 3300042993 | Bacteria | 1036 |
| 970 | Ga0466969_0000296 | 3300044656 | Bacteria | 27238 |
| 971 | Ga0466972_0000261 | 3300044658 | Bacteria | 34759 |
| 972 | Ga0466972_0011899 | 3300044658 | Bacteria | 4371 |
| 973 | Ga0466965_0052182 | 3300044683 | Bacteria | 2030 |
| 974 | Ga0466966_0000163 | 3300044684 | Bacteria | 43388 |
| 975 | Ga0466961_0014752 | 3300044693 | Bacteria | 5020 |
| 976 | Ga0466961_0147439 | 3300044693 | Bacteria | 1471 |
| 977 | Ga0466963_0027220 | 3300044694 | Bacteria | 3659 |
| 978 | Ga0466963_0387747 | 3300044694 | Bacteria | 985 |
| 979 | Ga0453684_0012729 | 3300044712 | Bacteria | 13813 |
| 980 | Ga0453684_0037239 | 3300044712 | Bacteria | 6680 |
| 981 | Ga0453684_0076864 | 3300044712 | Bacteria | 4189 |
| 982 | Ga0453684_0363809 | 3300044712 | Bacteria | 1628 |
| 983 | Ga0466971_0001744 | 3300044719 | Bacteria | 9214 |
| 984 | Ga0466971_0093306 | 3300044719 | Bacteria | 1379 |
| 985 | Ga0466970_0005908 | 3300044765 | Bacteria | 6098 |
| 986 | Ga0466957_0015256 | 3300044842 | Bacteria | 4488 |
| 987 | Ga0466957_0052318 | 3300044842 | Bacteria | 2486 |
| 988 | Ga0466957_0066260 | 3300044842 | Bacteria | 2226 |
| 989 | Ga0466957_0384168 | 3300044842 | Bacteria | 958 |
| 990 | Ga0466960_0039510 | 3300044901 | Bacteria | 2226 |
| 991 | Ga0466959_0000071 | 3300045049 | Bacteria | 68513 |
| 992 | Ga0466959_0025270 | 3300045049 | Bacteria | 4401 |
| 993 | Ga0451576_0000040 | 3300045051 | Bacteria | 349778 |
| 994 | Ga0451576_0008100 | 3300045051 | Bacteria | 12386 |
| 995 | Ga0451576_0253480 | 3300045051 | Bacteria | 1839 |
| 996 | Ga0451576_0804553 | 3300045051 | Bacteria | 987 |
| 997 | Ga0466958_0000501 | 3300045836 | Bacteria | 16450 |
| 998 | Ga0466958_0000962 | 3300045836 | Bacteria | 13039 |
| 999 | Ga0466958_0444992 | 3300045836 | Bacteria | 839 |
| 1000 | Ga0495627_119531 | 3300046453 | Bacteria | 745 |
| 1001 | Ga0495603_0000012 | 3300046455 | Bacteria | 69707 |
| 1002 | Ga0495590_0036195 | 3300046457 | Bacteria | 1722 |
| 1003 | Ga0495590_0189340 | 3300046457 | Bacteria | 754 |
| 1004 | Ga0495629_0000204 | 3300046459 | Bacteria | 52811 |
| 1005 | Ga0495629_0026771 | 3300046459 | Bacteria | 4094 |
| 1006 | Ga0495629_0036745 | 3300046459 | Bacteria | 3456 |
| 1007 | Ga0495638_0009691 | 3300046460 | Bacteria | 6733 |
| 1008 | Ga0495638_0219694 | 3300046460 | Bacteria | 1063 |
| 1009 | Ga0495638_0255997 | 3300046460 | Bacteria | 963 |
| 1010 | Ga0495651_0068227 | 3300046462 | Bacteria | 2711 |
| 1011 | Ga0495650_0048140 | 3300046471 | Bacteria | 1779 |
| 1012 | Ga0495580_0003848 | 3300046472 | Bacteria | 12701 |
| 1013 | Ga0495580_0031069 | 3300046472 | Bacteria | 3863 |
| 1014 | Ga0495582_0000956 | 3300046473 | Bacteria | 16123 |
| 1015 | Ga0495582_0038633 | 3300046473 | Bacteria | 2627 |
| 1016 | Ga0495605_0191326 | 3300046474 | Bacteria | 895 |
| 1017 | Ga0495639_0001489 | 3300046475 | Bacteria | 10436 |
| 1018 | Ga0495664_0028736 | 3300046477 | Bacteria | 3248 |
| 1019 | Ga0495584_0023311 | 3300046491 | Bacteria | 3139 |
| 1020 | Ga0495584_0037100 | 3300046491 | Bacteria | 2462 |
| 1021 | Ga0495584_0091890 | 3300046491 | Bacteria | 1531 |
| 1022 | Ga0495584_0237686 | 3300046491 | Bacteria | 926 |
| 1023 | Ga0495585_0196945 | 3300046492 | Bacteria | 1028 |
| 1024 | Ga0495594_0000041 | 3300046499 | Bacteria | 56922 |
| 1025 | Ga0495594_0309629 | 3300046499 | Bacteria | 900 |
| 1026 | Ga0495607_0117284 | 3300046501 | Bacteria | 1403 |
| 1027 | Ga0495606_0038000 | 3300046507 | Bacteria | 3261 |
| 1028 | Ga0495608_0383695 | 3300046511 | Bacteria | 861 |
| 1029 | Ga0495608_0388541 | 3300046511 | Bacteria | 855 |
| 1030 | Ga0495616_0228102 | 3300046513 | Bacteria | 808 |
| 1031 | Ga0495618_0013081 | 3300046514 | Bacteria | 5045 |
| 1032 | Ga0495618_0333782 | 3300046514 | Bacteria | 937 |
| 1033 | Ga0495618_0364554 | 3300046514 | Bacteria | 889 |
| 1034 | Ga0495630_0039243 | 3300046517 | Bacteria | 3542 |
| 1035 | Ga0495637_0184190 | 3300046520 | Bacteria | 773 |
| 1036 | Ga0495643_0058993 | 3300046522 | Bacteria | 2040 |
| 1037 | Ga0495643_0128777 | 3300046522 | Bacteria | 1272 |
| 1038 | Ga0495643_0189496 | 3300046522 | Bacteria | 994 |
| 1039 | Ga0495663_0068226 | 3300046525 | Bacteria | 1129 |
| 1040 | Ga0495666_0220748 | 3300046526 | Bacteria | 868 |
| 1041 | Ga0495652_0199035 | 3300046529 | Bacteria | 1522 |
| 1042 | Ga0495665_0014774 | 3300046531 | Bacteria | 4208 |
| 1043 | Ga0495640_0373425 | 3300046533 | Bacteria | 878 |
| 1044 | Ga0495587_0211124 | 3300046536 | Bacteria | 1096 |
| 1045 | Ga0495587_0432184 | 3300046536 | Bacteria | 730 |
| 1046 | Ga0495597_0046332 | 3300046542 | Bacteria | 1927 |
| 1047 | Ga0495622_0001150 | 3300046557 | Bacteria | 13782 |
| 1048 | Ga0495622_0016396 | 3300046557 | Bacteria | 3449 |
| 1049 | Ga0495622_0032559 | 3300046557 | Bacteria | 2434 |
| 1050 | Ga0495633_0002153 | 3300046558 | Bacteria | 14119 |
| 1051 | Ga0495633_0071165 | 3300046558 | Bacteria | 1623 |
| 1052 | Ga0495667_0159425 | 3300046559 | Bacteria | 1451 |
| 1053 | Ga0495668_0176722 | 3300046616 | Bacteria | 1170 |
| 1054 | Ga0495634_0109488 | 3300046642 | Bacteria | 1777 |
| 1055 | Ga0495625_0125992 | 3300046660 | Bacteria | 1739 |
| 1056 | Ga0495625_0283446 | 3300046660 | Bacteria | 1065 |
| 1057 | Ga0495635_0010103 | 3300046663 | Bacteria | 6600 |
| 1058 | Ga0495657_0017867 | 3300046675 | Bacteria | 5144 |
| 1059 | Ga0495657_0268283 | 3300046675 | Bacteria | 1024 |
| 1060 | Ga0495646_0066665 | 3300046680 | Bacteria | 2129 |
| 1061 | Ga0495646_0387902 | 3300046680 | Bacteria | 727 |
| 1062 | Ga0495658_0003944 | 3300046683 | Bacteria | 7323 |
| 1063 | Ga0495658_0271406 | 3300046683 | Bacteria | 1069 |
| 1064 | Ga0495658_0328719 | 3300046683 | Bacteria | 970 |
| 1065 | Ga0495658_0534842 | 3300046683 | Bacteria | 750 |
| 1066 | Ga0495669_0106417 | 3300046684 | Bacteria | 1307 |
| 1067 | Ga0495613_0000075 | 3300046689 | Bacteria | 97894 |
| 1068 | Ga0495613_0055177 | 3300046689 | Bacteria | 2920 |
| 1069 | Ga0495624_0076666 | 3300046690 | Bacteria | 2074 |
| 1070 | Ga0495671_0239979 | 3300046692 | Bacteria | 876 |
| 1071 | Ga0495649_0064277 | 3300046694 | Bacteria | 1971 |
| 1072 | Ga0495600_0022581 | 3300046809 | Bacteria | 4041 |
| 1073 | Ga0495581_0000422 | 3300047315 | Bacteria | 21439 |
| 1074 | Ga0495604_0004947 | 3300047317 | Bacteria | 10564 |
| 1075 | Ga0495604_0303634 | 3300047317 | Bacteria | 1071 |
| 1076 | Ga0495674_0245362 | 3300047319 | Bacteria | 1475 |
| 1077 | Ga0495676_0082205 | 3300047321 | Bacteria | 2438 |
| 1078 | Ga0495680_0036041 | 3300047322 | Bacteria | 3977 |
| 1079 | Ga0495683_0189370 | 3300047323 | Bacteria | 934 |
| 1080 | Ga0495683_0204248 | 3300047323 | Bacteria | 889 |
| 1081 | Ga0495687_139709 | 3300047443 | Bacteria | 844 |
| 1082 | Ga0495677_0107704 | 3300047445 | Bacteria | 1058 |
| 1083 | Ga0495673_0004418 | 3300047469 | Bacteria | 8798 |
| 1084 | Ga0495681_0233668 | 3300047470 | Bacteria | 732 |
| 1085 | Ga0495686_0086340 | 3300047472 | Bacteria | 1910 |
| 1086 | Ga0495686_0121506 | 3300047472 | Bacteria | 1556 |
| 1087 | Ga0495686_0164418 | 3300047472 | Bacteria | 1294 |
| 1088 | Ga0495593_0002009 | 3300047673 | Bacteria | 12133 |
| 1089 | Ga0495593_0120514 | 3300047673 | Bacteria | 1335 |
| 1090 | Ga0495602_0036625 | 3300048088 | Bacteria | 4564 |
| 1091 | Ga0495602_0255334 | 3300048088 | Bacteria | 1304 |
| 1092 | Ga0495614_0021119 | 3300048089 | Bacteria | 2814 |
| 1093 | Ga0495626_0099393 | 3300048091 | Bacteria | 1270 |
| 1094 | Ga0495626_0250349 | 3300048091 | Bacteria | 711 |
| 1095 | Ga0496100_0003333 | 3300048903 | Bacteria | 8364 |
| 1096 | Ga0496100_0020476 | 3300048903 | Bacteria | 3966 |
| 1097 | Ga0496100_0036049 | 3300048903 | Bacteria | 3117 |
| 1098 | Ga0496100_0382342 | 3300048903 | Bacteria | 1069 |
| 1099 | Ga0496101_0001105 | 3300048904 | Bacteria | 16040 |
| 1100 | Ga0496101_0011382 | 3300048904 | Bacteria | 5902 |
| 1101 | Ga0496101_0073681 | 3300048904 | Bacteria | 2508 |
| 1102 | Ga0496101_0149709 | 3300048904 | Bacteria | 1784 |
| 1103 | Ga0496101_0329000 | 3300048904 | Bacteria | 1199 |
| 1104 | Ga0496102_0022644 | 3300048905 | Bacteria | 5568 |
| 1105 | Ga0496102_0032247 | 3300048905 | Bacteria | 4707 |
| 1106 | Ga0496102_0117953 | 3300048905 | Bacteria | 2477 |
| 1107 | Ga0496102_0128264 | 3300048905 | Bacteria | 2372 |
| 1108 | Ga0496102_0134898 | 3300048905 | Bacteria | 2312 |
| 1109 | Ga0496102_0178287 | 3300048905 | Bacteria | 2001 |
| 1110 | Ga0496102_0325718 | 3300048905 | Bacteria | 1447 |
| 1111 | Ga0496102_0335632 | 3300048905 | Bacteria | 1423 |
| 1112 | Ga0496102_0348090 | 3300048905 | Bacteria | 1395 |
| 1113 | Ga0496102_0381317 | 3300048905 | Bacteria | 1327 |
| 1114 | Ga0496102_0595519 | 3300048905 | Bacteria | 1028 |
| 1115 | Ga0496103_0011964 | 3300048906 | Bacteria | 5153 |
| 1116 | Ga0496103_0018424 | 3300048906 | Bacteria | 4188 |
| 1117 | Ga0496103_0021663 | 3300048906 | Bacteria | 3868 |
| 1118 | Ga0496103_0032188 | 3300048906 | Bacteria | 3199 |
| 1119 | Ga0496103_0120418 | 3300048906 | Bacteria | 1671 |
| 1120 | Ga0496103_0298409 | 3300048906 | Bacteria | 1036 |
| 1121 | Ga0496104_0009311 | 3300048907 | Bacteria | 8734 |
| 1122 | Ga0496104_0034308 | 3300048907 | Bacteria | 4730 |
| 1123 | Ga0496104_0139330 | 3300048907 | Bacteria | 2331 |
| 1124 | Ga0496104_0188509 | 3300048907 | Bacteria | 1973 |
| 1125 | Ga0496104_0274479 | 3300048907 | Bacteria | 1598 |
| 1126 | Ga0496104_0290614 | 3300048907 | Bacteria | 1547 |
| 1127 | Ga0496104_0466730 | 3300048907 | Bacteria | 1174 |
| 1128 | Ga0496105_0003160 | 3300048908 | Bacteria | 12132 |
| 1129 | Ga0496105_0006016 | 3300048908 | Bacteria | 9272 |
| 1130 | Ga0496105_0044255 | 3300048908 | Bacteria | 3671 |
| 1131 | Ga0496105_0158207 | 3300048908 | Bacteria | 1860 |
| 1132 | Ga0496105_0252930 | 3300048908 | Bacteria | 1427 |
| 1133 | Ga0496105_0517783 | 3300048908 | Bacteria | 934 |
| 1134 | Ga0496106_0000370 | 3300048909 | Bacteria | 31887 |
| 1135 | Ga0496106_0000929 | 3300048909 | Bacteria | 21332 |
| 1136 | Ga0496106_0010898 | 3300048909 | Bacteria | 6717 |
| 1137 | Ga0496106_0038703 | 3300048909 | Bacteria | 3570 |
| 1138 | Ga0496106_0097598 | 3300048909 | Bacteria | 2275 |
| 1139 | Ga0496106_0103365 | 3300048909 | Bacteria | 2211 |
| 1140 | Ga0496106_0166740 | 3300048909 | Bacteria | 1744 |
| 1141 | Ga0496106_0197982 | 3300048909 | Bacteria | 1598 |
| 1142 | Ga0496106_0743167 | 3300048909 | Bacteria | 780 |
| 1143 | Ga0496106_0774605 | 3300048909 | Bacteria | 762 |
| 1144 | Ga0496107_0000197 | 3300048910 | Bacteria | 31646 |
| 1145 | Ga0496107_0002908 | 3300048910 | Bacteria | 11321 |
| 1146 | Ga0496107_0003884 | 3300048910 | Bacteria | 10045 |
| 1147 | Ga0496107_0030161 | 3300048910 | Bacteria | 3864 |
| 1148 | Ga0496107_0038428 | 3300048910 | Bacteria | 3433 |
| 1149 | Ga0496107_0071684 | 3300048910 | Bacteria | 2518 |
| 1150 | Ga0496107_0082406 | 3300048910 | Bacteria | 2346 |
| 1151 | Ga0496107_0265826 | 3300048910 | Bacteria | 1276 |
| 1152 | Ga0496108_0022688 | 3300048911 | Bacteria | 5162 |
| 1153 | Ga0496108_0133772 | 3300048911 | Bacteria | 2132 |
| 1154 | Ga0496108_0195406 | 3300048911 | Bacteria | 1754 |
| 1155 | Ga0496108_0304484 | 3300048911 | Bacteria | 1388 |
| 1156 | Ga0496108_0307809 | 3300048911 | Bacteria | 1380 |
| 1157 | Ga0496108_0315096 | 3300048911 | Bacteria | 1363 |
| 1158 | Ga0496108_0334206 | 3300048911 | Bacteria | 1321 |
| 1159 | Ga0496108_0441937 | 3300048911 | Bacteria | 1136 |
| 1160 | Ga0496108_0522625 | 3300048911 | Bacteria | 1036 |
| 1161 | Ga0496108_0731956 | 3300048911 | Bacteria | 856 |
| 1162 | Ga0496109_0069376 | 3300048912 | Bacteria | 3232 |
| 1163 | Ga0496109_0071965 | 3300048912 | Bacteria | 3175 |
| 1164 | Ga0496109_0075773 | 3300048912 | Bacteria | 3093 |
| 1165 | Ga0496109_0107861 | 3300048912 | Bacteria | 2587 |
| 1166 | Ga0496109_0116895 | 3300048912 | Bacteria | 2482 |
| 1167 | Ga0496109_0309120 | 3300048912 | Bacteria | 1491 |
| 1168 | Ga0496109_0312969 | 3300048912 | Bacteria | 1481 |
| 1169 | Ga0496109_1093015 | 3300048912 | Bacteria | 734 |
| 1170 | Ga0496110_0003625 | 3300048913 | Bacteria | 11877 |
| 1171 | Ga0496110_0022817 | 3300048913 | Bacteria | 5317 |
| 1172 | Ga0496110_0629877 | 3300048913 | Bacteria | 972 |
| 1173 | Ga0496111_0025325 | 3300048914 | Bacteria | 4186 |
| 1174 | Ga0496111_0048951 | 3300048914 | Bacteria | 3047 |
| 1175 | Ga0496111_0094870 | 3300048914 | Bacteria | 2188 |
| 1176 | Ga0496111_0271931 | 3300048914 | Bacteria | 1257 |
| 1177 | Ga0496111_0386045 | 3300048914 | Bacteria | 1035 |
| 1178 | Ga0496111_0625842 | 3300048914 | Bacteria | 787 |
| 1179 | Ga0496112_0008520 | 3300048915 | Bacteria | 9187 |
| 1180 | Ga0496112_0012075 | 3300048915 | Bacteria | 7925 |
| 1181 | Ga0496112_0092098 | 3300048915 | Bacteria | 3000 |
| 1182 | Ga0496112_0108040 | 3300048915 | Bacteria | 2752 |
| 1183 | Ga0496112_0135180 | 3300048915 | Bacteria | 2436 |
| 1184 | Ga0496112_0831742 | 3300048915 | Bacteria | 847 |
| 1185 | Ga0496113_0021889 | 3300048916 | Bacteria | 4514 |
| 1186 | Ga0496113_0033853 | 3300048916 | Bacteria | 3723 |
| 1187 | Ga0496113_0043296 | 3300048916 | Bacteria | 3331 |
| 1188 | Ga0496113_0060307 | 3300048916 | Bacteria | 2859 |
| 1189 | Ga0496113_0062903 | 3300048916 | Bacteria | 2804 |
| 1190 | Ga0496113_0197816 | 3300048916 | Bacteria | 1597 |
| 1191 | Ga0496113_1036651 | 3300048916 | Bacteria | 645 |
| 1192 | Ga0496114_0026036 | 3300048917 | Bacteria | 4785 |
| 1193 | Ga0496114_0051930 | 3300048917 | Bacteria | 3414 |
| 1194 | Ga0496114_0138405 | 3300048917 | Bacteria | 2106 |
| 1195 | Ga0496114_0399886 | 3300048917 | Bacteria | 1216 |
| 1196 | Ga0496114_0461753 | 3300048917 | Bacteria | 1124 |
| 1197 | Ga0496114_0475210 | 3300048917 | Bacteria | 1106 |
| 1198 | Ga0496114_0880698 | 3300048917 | Bacteria | 776 |
| 1199 | Ga0496115_0056491 | 3300048918 | Bacteria | 3155 |
| 1200 | Ga0496115_0060837 | 3300048918 | Bacteria | 3043 |
| 1201 | Ga0496115_0092745 | 3300048918 | Bacteria | 2469 |
| 1202 | Ga0496115_0120861 | 3300048918 | Bacteria | 2155 |
| 1203 | Ga0496115_0144169 | 3300048918 | Bacteria | 1965 |
| 1204 | Ga0496115_0278134 | 3300048918 | Bacteria | 1374 |
| 1205 | Ga0496116_0322532 | 3300048919 | Bacteria | 722 |
| 1206 | Ga0496119_0026505 | 3300048922 | Bacteria | 4017 |
| 1207 | Ga0496120_0006976 | 3300048923 | Bacteria | 8507 |
| 1208 | Ga0496120_0012874 | 3300048923 | Bacteria | 5664 |
| 1209 | Ga0496120_0060944 | 3300048923 | Bacteria | 2108 |
| 1210 | Ga0496121_0004399 | 3300048924 | Bacteria | 18999 |
| 1211 | Ga0496121_0117248 | 3300048924 | Bacteria | 2017 |
| 1212 | Ga0496121_0195010 | 3300048924 | Bacteria | 1448 |
| 1213 | Ga0496121_0283377 | 3300048924 | Bacteria | 1132 |
| 1214 | Ga0496122_0003989 | 3300048925 | Bacteria | 18819 |
| 1215 | Ga0496123_0000732 | 3300048926 | Bacteria | 53376 |
| 1216 | Ga0496123_0004691 | 3300048926 | Bacteria | 14159 |
| 1217 | Ga0496124_0126144 | 3300048927 | Bacteria | 2039 |
| 1218 | Ga0496124_0278373 | 3300048927 | Bacteria | 1221 |
| 1219 | Ga0496124_0672741 | 3300048927 | Bacteria | 661 |
| 1220 | Ga0496125_0001673 | 3300048928 | Bacteria | 31116 |
| 1221 | Ga0496125_0134295 | 3300048928 | Bacteria | 1734 |
| 1222 | Ga0496125_0320766 | 3300048928 | Bacteria | 939 |
| 1223 | Ga0496125_0404021 | 3300048928 | Bacteria | 797 |
| 1224 | Ga0496126_0063768 | 3300048929 | Bacteria | 3302 |
| 1225 | Ga0496126_0283832 | 3300048929 | Bacteria | 1371 |
| 1226 | Ga0501341_03081 | 3300049131 | Bacteria | 929 |
| 1227 | Ga0501341_06796 | 3300049131 | Bacteria | 708 |
| 1228 | Ga0501304_013565 | 3300049160 | Bacteria | 746 |
| 1229 | Ga0501307_029406 | 3300049162 | Bacteria | 755 |
| 1230 | Ga0501314_014114 | 3300049530 | Bacteria | 780 |
| 1231 | Ga0501317_029807 | 3300049533 | Bacteria | 786 |
| 1232 | Ga0501319_005604 | 3300049535 | Bacteria | 905 |
| 1233 | Ga0501320_022059 | 3300049536 | Bacteria | 744 |
| 1234 | Ga0501325_016174 | 3300049541 | Bacteria | 743 |
| 1235 | Ga0501031_0000018 | 3300049568 | Bacteria | 106734 |
| 1236 | Ga0501031_0004819 | 3300049568 | Bacteria | 8764 |
| 1237 | Ga0501031_0011795 | 3300049568 | Bacteria | 5699 |
| 1238 | Ga0501031_0017396 | 3300049568 | Bacteria | 4671 |
| 1239 | Ga0501031_0019004 | 3300049568 | Bacteria | 4474 |
| 1240 | Ga0501031_0027610 | 3300049568 | Bacteria | 3700 |
| 1241 | Ga0501031_0090635 | 3300049568 | Bacteria | 1994 |
| 1242 | Ga0501031_0093230 | 3300049568 | Bacteria | 1965 |
| 1243 | Ga0501031_0180474 | 3300049568 | Bacteria | 1379 |
| 1244 | Ga0501031_0309154 | 3300049568 | Bacteria | 1024 |
| 1245 | Ga0501031_0323768 | 3300049568 | Bacteria | 998 |
| 1246 | Ga0501031_0334047 | 3300049568 | Bacteria | 981 |
| 1247 | Ga0501031_0338096 | 3300049568 | Bacteria | 975 |
| 1248 | Ga0501031_0358294 | 3300049568 | Bacteria | 944 |
| 1249 | Ga0501031_0444789 | 3300049568 | Bacteria | 837 |
| 1250 | Ga0501032_0000201 | 3300049569 | Bacteria | 49742 |
| 1251 | Ga0501032_0000564 | 3300049569 | Bacteria | 30069 |
| 1252 | Ga0501032_0008483 | 3300049569 | Bacteria | 7492 |
| 1253 | Ga0501032_0015071 | 3300049569 | Bacteria | 5460 |
| 1254 | Ga0501032_0024542 | 3300049569 | Bacteria | 4161 |
| 1255 | Ga0501032_0045244 | 3300049569 | Bacteria | 2978 |
| 1256 | Ga0501032_0068470 | 3300049569 | Bacteria | 2369 |
| 1257 | Ga0501032_0089499 | 3300049569 | Bacteria | 2043 |
| 1258 | Ga0501032_0129953 | 3300049569 | Bacteria | 1662 |
| 1259 | Ga0501032_0134005 | 3300049569 | Bacteria | 1633 |
| 1260 | Ga0501032_0176821 | 3300049569 | Bacteria | 1398 |
| 1261 | Ga0501032_0228372 | 3300049569 | Bacteria | 1210 |
| 1262 | Ga0501033_0000328 | 3300049570 | Bacteria | 45346 |
| 1263 | Ga0501033_0000443 | 3300049570 | Bacteria | 39616 |
| 1264 | Ga0501033_0002655 | 3300049570 | Bacteria | 15024 |
| 1265 | Ga0501033_0003152 | 3300049570 | Bacteria | 13705 |
| 1266 | Ga0501033_0015074 | 3300049570 | Bacteria | 5864 |
| 1267 | Ga0501033_0016649 | 3300049570 | Bacteria | 5561 |
| 1268 | Ga0501033_0024371 | 3300049570 | Bacteria | 4565 |
| 1269 | Ga0501033_0026107 | 3300049570 | Bacteria | 4397 |
| 1270 | Ga0501033_0038123 | 3300049570 | Bacteria | 3596 |
| 1271 | Ga0501033_0058501 | 3300049570 | Bacteria | 2847 |
| 1272 | Ga0501033_0073909 | 3300049570 | Bacteria | 2503 |
| 1273 | Ga0501033_0102582 | 3300049570 | Bacteria | 2087 |
| 1274 | Ga0501033_0107767 | 3300049570 | Bacteria | 2029 |
| 1275 | Ga0501033_0115195 | 3300049570 | Bacteria | 1953 |
| 1276 | Ga0501033_0149703 | 3300049570 | Bacteria | 1684 |
| 1277 | Ga0501033_0161613 | 3300049570 | Bacteria | 1612 |
| 1278 | Ga0501033_0211126 | 3300049570 | Bacteria | 1384 |
| 1279 | Ga0501033_0318198 | 3300049570 | Bacteria | 1093 |
| 1280 | Ga0501033_0629760 | 3300049570 | Bacteria | 734 |
| 1281 | Ga0501034_0000005 | 3300049571 | Bacteria | 367512 |
| 1282 | Ga0501034_0000033 | 3300049571 | Bacteria | 243508 |
| 1283 | Ga0501034_0000061 | 3300049571 | Bacteria | 195178 |
| 1284 | Ga0501034_0000314 | 3300049571 | Bacteria | 86025 |
| 1285 | Ga0501034_0000681 | 3300049571 | Bacteria | 51656 |
| 1286 | Ga0501034_0011987 | 3300049571 | Bacteria | 8957 |
| 1287 | Ga0501034_0021545 | 3300049571 | Bacteria | 6567 |
| 1288 | Ga0501034_0024021 | 3300049571 | Bacteria | 6202 |
| 1289 | Ga0501034_0032646 | 3300049571 | Bacteria | 5286 |
| 1290 | Ga0501034_0040361 | 3300049571 | Bacteria | 4724 |
| 1291 | Ga0501034_0047357 | 3300049571 | Bacteria | 4341 |
| 1292 | Ga0501034_0060789 | 3300049571 | Bacteria | 3795 |
| 1293 | Ga0501034_0061513 | 3300049571 | Bacteria | 3770 |
| 1294 | Ga0501034_0096024 | 3300049571 | Bacteria | 2960 |
| 1295 | Ga0501034_0109071 | 3300049571 | Bacteria | 2759 |
| 1296 | Ga0501034_0152423 | 3300049571 | Bacteria | 2287 |
| 1297 | Ga0501034_0162570 | 3300049571 | Bacteria | 2203 |
| 1298 | Ga0501034_0221338 | 3300049571 | Bacteria | 1845 |
| 1299 | Ga0501034_0227391 | 3300049571 | Bacteria | 1816 |
| 1300 | Ga0501034_0250558 | 3300049571 | Bacteria | 1715 |
| 1301 | Ga0501034_0272853 | 3300049571 | Bacteria | 1632 |
| 1302 | Ga0501034_0305621 | 3300049571 | Bacteria | 1526 |
| 1303 | Ga0501034_0358193 | 3300049571 | Bacteria | 1386 |
| 1304 | Ga0501034_0559565 | 3300049571 | Bacteria | 1052 |
| 1305 | Ga0501034_1183646 | 3300049571 | Bacteria | 643 |
| 1306 | Ga0501036_0000005 | 3300049572 | Bacteria | 246420 |
| 1307 | Ga0501036_0000027 | 3300049572 | Bacteria | 99799 |
| 1308 | Ga0501036_0005854 | 3300049572 | Bacteria | 9956 |
| 1309 | Ga0501036_0008162 | 3300049572 | Bacteria | 8582 |
| 1310 | Ga0501036_0017322 | 3300049572 | Bacteria | 6021 |
| 1311 | Ga0501036_0037202 | 3300049572 | Bacteria | 4117 |
| 1312 | Ga0501036_0048667 | 3300049572 | Bacteria | 3589 |
| 1313 | Ga0501036_0112205 | 3300049572 | Bacteria | 2304 |
| 1314 | Ga0501036_0177705 | 3300049572 | Bacteria | 1792 |
| 1315 | Ga0501036_0186371 | 3300049572 | Bacteria | 1746 |
| 1316 | Ga0501036_0254302 | 3300049572 | Bacteria | 1472 |
| 1317 | Ga0501036_0313616 | 3300049572 | Bacteria | 1311 |
| 1318 | Ga0501036_0375418 | 3300049572 | Bacteria | 1187 |
| 1319 | Ga0501037_0000045 | 3300049573 | Bacteria | 117148 |
| 1320 | Ga0501037_0000104 | 3300049573 | Bacteria | 80204 |
| 1321 | Ga0501037_0000271 | 3300049573 | Bacteria | 44641 |
| 1322 | Ga0501037_0001652 | 3300049573 | Bacteria | 16226 |
| 1323 | Ga0501037_0002530 | 3300049573 | Bacteria | 13205 |
| 1324 | Ga0501037_0009928 | 3300049573 | Bacteria | 6981 |
| 1325 | Ga0501037_0031330 | 3300049573 | Bacteria | 3925 |
| 1326 | Ga0501037_0049206 | 3300049573 | Bacteria | 3087 |
| 1327 | Ga0501037_0049408 | 3300049573 | Bacteria | 3080 |
| 1328 | Ga0501037_0138110 | 3300049573 | Bacteria | 1745 |
| 1329 | Ga0501037_0198785 | 3300049573 | Bacteria | 1417 |
| 1330 | Ga0501037_0292653 | 3300049573 | Bacteria | 1132 |
| 1331 | Ga0501037_0349463 | 3300049573 | Bacteria | 1020 |
| 1332 | Ga0501037_0404808 | 3300049573 | Bacteria | 935 |
| 1333 | Ga0501037_0432744 | 3300049573 | Bacteria | 899 |
| 1334 | Ga0501037_0484587 | 3300049573 | Bacteria | 840 |
| 1335 | Ga0501037_0700991 | 3300049573 | Bacteria | 674 |
| 1336 | Ga0501038_0000001 | 3300049574 | Bacteria | 375481 |
| 1337 | Ga0501038_0000340 | 3300049574 | Bacteria | 40348 |
| 1338 | Ga0501038_0005022 | 3300049574 | Bacteria | 12285 |
| 1339 | Ga0501038_0022940 | 3300049574 | Bacteria | 5587 |
| 1340 | Ga0501038_0024635 | 3300049574 | Bacteria | 5365 |
| 1341 | Ga0501038_0035324 | 3300049574 | Bacteria | 4388 |
| 1342 | Ga0501038_0042473 | 3300049574 | Bacteria | 3959 |
| 1343 | Ga0501038_0054962 | 3300049574 | Bacteria | 3422 |
| 1344 | Ga0501038_0070214 | 3300049574 | Bacteria | 2974 |
| 1345 | Ga0501038_0122866 | 3300049574 | Bacteria | 2139 |
| 1346 | Ga0501038_0161583 | 3300049574 | Bacteria | 1820 |
| 1347 | Ga0501038_0239184 | 3300049574 | Bacteria | 1442 |
| 1348 | Ga0501038_0286172 | 3300049574 | Bacteria | 1296 |
| 1349 | Ga0501038_0310247 | 3300049574 | Bacteria | 1236 |
| 1350 | Ga0501038_0346954 | 3300049574 | Bacteria | 1157 |
| 1351 | Ga0501038_0395620 | 3300049574 | Bacteria | 1070 |
| 1352 | Ga0501038_0522909 | 3300049574 | Bacteria | 905 |
| 1353 | Ga0501039_0000003 | 3300049575 | Bacteria | 357424 |
| 1354 | Ga0501039_0000007 | 3300049575 | Bacteria | 277831 |
| 1355 | Ga0501039_0000802 | 3300049575 | Bacteria | 22639 |
| 1356 | Ga0501039_0002360 | 3300049575 | Bacteria | 14059 |
| 1357 | Ga0501039_0010241 | 3300049575 | Bacteria | 7144 |
| 1358 | Ga0501039_0013631 | 3300049575 | Bacteria | 6217 |
| 1359 | Ga0501039_0020878 | 3300049575 | Bacteria | 5020 |
| 1360 | Ga0501039_0046660 | 3300049575 | Bacteria | 3347 |
| 1361 | Ga0501039_0148950 | 3300049575 | Bacteria | 1839 |
| 1362 | Ga0501039_0290120 | 3300049575 | Bacteria | 1286 |
| 1363 | Ga0501039_0292636 | 3300049575 | Bacteria | 1280 |
| 1364 | Ga0501039_0309843 | 3300049575 | Bacteria | 1241 |
| 1365 | Ga0501039_0330799 | 3300049575 | Bacteria | 1197 |
| 1366 | Ga0501039_0395949 | 3300049575 | Bacteria | 1085 |
| 1367 | Ga0501039_0657967 | 3300049575 | Bacteria | 820 |
| 1368 | Ga0501039_0905061 | 3300049575 | Bacteria | 687 |
| 1369 | Ga0501040_0003550 | 3300049576 | Bacteria | 10081 |
| 1370 | Ga0501040_0034815 | 3300049576 | Bacteria | 3412 |
| 1371 | Ga0501040_0036827 | 3300049576 | Bacteria | 3322 |
| 1372 | Ga0501040_0116070 | 3300049576 | Bacteria | 1875 |
| 1373 | Ga0501040_0127805 | 3300049576 | Bacteria | 1786 |
| 1374 | Ga0501040_0391639 | 3300049576 | Bacteria | 997 |
| 1375 | Ga0501041_0010586 | 3300049577 | Bacteria | 5436 |
| 1376 | Ga0501041_0024250 | 3300049577 | Bacteria | 3641 |
| 1377 | Ga0501041_0066945 | 3300049577 | Bacteria | 2201 |
| 1378 | Ga0501041_0270716 | 3300049577 | Bacteria | 1068 |
| 1379 | Ga0501041_0410981 | 3300049577 | Bacteria | 858 |
| 1380 | Ga0501042_0014332 | 3300049578 | Bacteria | 5410 |
| 1381 | Ga0501042_0036971 | 3300049578 | Bacteria | 3464 |
| 1382 | Ga0501042_0050539 | 3300049578 | Bacteria | 2965 |
| 1383 | Ga0501042_0099243 | 3300049578 | Bacteria | 2093 |
| 1384 | Ga0501042_0108557 | 3300049578 | Bacteria | 1998 |
| 1385 | Ga0501042_0154488 | 3300049578 | Bacteria | 1655 |
| 1386 | Ga0501043_0000096 | 3300049579 | Bacteria | 79864 |
| 1387 | Ga0501043_0000248 | 3300049579 | Bacteria | 48962 |
| 1388 | Ga0501043_0001636 | 3300049579 | Bacteria | 19475 |
| 1389 | Ga0501043_0006416 | 3300049579 | Bacteria | 9449 |
| 1390 | Ga0501043_0030108 | 3300049579 | Bacteria | 4263 |
| 1391 | Ga0501043_0031597 | 3300049579 | Bacteria | 4162 |
| 1392 | Ga0501043_0039968 | 3300049579 | Bacteria | 3687 |
| 1393 | Ga0501043_0152562 | 3300049579 | Bacteria | 1808 |
| 1394 | Ga0501043_0170588 | 3300049579 | Bacteria | 1697 |
| 1395 | Ga0501043_0204152 | 3300049579 | Bacteria | 1533 |
| 1396 | Ga0501043_0273882 | 3300049579 | Bacteria | 1295 |
| 1397 | Ga0501043_0703974 | 3300049579 | Bacteria | 738 |
| 1398 | Ga0501043_0864112 | 3300049579 | Bacteria | 651 |
| 1399 | Ga0501046_0000023 | 3300049580 | Bacteria | 213965 |
| 1400 | Ga0501046_0001575 | 3300049580 | Bacteria | 21813 |
| 1401 | Ga0501046_0003564 | 3300049580 | Bacteria | 14270 |
| 1402 | Ga0501046_0006295 | 3300049580 | Bacteria | 10524 |
| 1403 | Ga0501046_0011230 | 3300049580 | Bacteria | 7668 |
| 1404 | Ga0501046_0012911 | 3300049580 | Bacteria | 7101 |
| 1405 | Ga0501046_0029227 | 3300049580 | Bacteria | 4483 |
| 1406 | Ga0501046_0030845 | 3300049580 | Bacteria | 4350 |
| 1407 | Ga0501046_0058101 | 3300049580 | Bacteria | 3033 |
| 1408 | Ga0501046_0060031 | 3300049580 | Bacteria | 2977 |
| 1409 | Ga0501046_0099874 | 3300049580 | Bacteria | 2227 |
| 1410 | Ga0501046_0185188 | 3300049580 | Bacteria | 1555 |
| 1411 | Ga0501046_0427760 | 3300049580 | Bacteria | 954 |
| 1412 | Ga0501046_0527134 | 3300049580 | Bacteria | 844 |
| 1413 | Ga0501047_0000122 | 3300049581 | Bacteria | 95307 |
| 1414 | Ga0501047_0001023 | 3300049581 | Bacteria | 28199 |
| 1415 | Ga0501047_0004600 | 3300049581 | Bacteria | 12977 |
| 1416 | Ga0501047_0004914 | 3300049581 | Bacteria | 12557 |
| 1417 | Ga0501047_0008466 | 3300049581 | Bacteria | 9706 |
| 1418 | Ga0501047_0021450 | 3300049581 | Bacteria | 6202 |
| 1419 | Ga0501047_0022728 | 3300049581 | Bacteria | 6021 |
| 1420 | Ga0501047_0026581 | 3300049581 | Bacteria | 5569 |
| 1421 | Ga0501047_0064620 | 3300049581 | Bacteria | 3529 |
| 1422 | Ga0501047_0068795 | 3300049581 | Bacteria | 3410 |
| 1423 | Ga0501047_0073145 | 3300049581 | Bacteria | 3300 |
| 1424 | Ga0501047_0090627 | 3300049581 | Bacteria | 2935 |
| 1425 | Ga0501047_0107883 | 3300049581 | Bacteria | 2666 |
| 1426 | Ga0501047_0170509 | 3300049581 | Bacteria | 2045 |
| 1427 | Ga0501047_0180906 | 3300049581 | Bacteria | 1975 |
| 1428 | Ga0501047_0338964 | 3300049581 | Bacteria | 1341 |
| 1429 | Ga0501047_0348117 | 3300049581 | Bacteria | 1319 |
| 1430 | Ga0501047_0850694 | 3300049581 | Bacteria | 726 |
| 1431 | Ga0501048_0000060 | 3300049582 | Bacteria | 54898 |
| 1432 | Ga0501048_0000299 | 3300049582 | Bacteria | 33603 |
| 1433 | Ga0501048_0010572 | 3300049582 | Bacteria | 6886 |
| 1434 | Ga0501048_0158920 | 3300049582 | Bacteria | 1599 |
| 1435 | Ga0501048_0208661 | 3300049582 | Bacteria | 1385 |
| 1436 | Ga0501048_0239518 | 3300049582 | Bacteria | 1287 |
| 1437 | Ga0501048_0341510 | 3300049582 | Bacteria | 1067 |
| 1438 | Ga0501048_0439009 | 3300049582 | Bacteria | 934 |
| 1439 | Ga0501048_0781530 | 3300049582 | Bacteria | 686 |
| 1440 | Ga0501067_0000224 | 3300049583 | Bacteria | 31442 |
| 1441 | Ga0501067_0002012 | 3300049583 | Bacteria | 11204 |
| 1442 | Ga0501067_0008225 | 3300049583 | Bacteria | 5793 |
| 1443 | Ga0501067_0048413 | 3300049583 | Bacteria | 2357 |
| 1444 | Ga0501067_0052948 | 3300049583 | Bacteria | 2249 |
| 1445 | Ga0501067_0054371 | 3300049583 | Bacteria | 2218 |
| 1446 | Ga0501067_0102845 | 3300049583 | Bacteria | 1587 |
| 1447 | Ga0501067_0357210 | 3300049583 | Bacteria | 815 |
| 1448 | Ga0501067_0369388 | 3300049583 | Bacteria | 800 |
| 1449 | Ga0501068_0001760 | 3300049584 | Bacteria | 11514 |
| 1450 | Ga0501068_0005327 | 3300049584 | Bacteria | 7028 |
| 1451 | Ga0501068_0020442 | 3300049584 | Bacteria | 3857 |
| 1452 | Ga0501068_0063002 | 3300049584 | Bacteria | 2255 |
| 1453 | Ga0501068_0079118 | 3300049584 | Bacteria | 2016 |
| 1454 | Ga0501068_0125825 | 3300049584 | Bacteria | 1600 |
| 1455 | Ga0501069_0000012 | 3300049585 | Bacteria | 148453 |
| 1456 | Ga0501069_0010871 | 3300049585 | Bacteria | 4821 |
| 1457 | Ga0501069_0014599 | 3300049585 | Bacteria | 4200 |
| 1458 | Ga0501069_0024963 | 3300049585 | Bacteria | 3264 |
| 1459 | Ga0501069_0063468 | 3300049585 | Bacteria | 2063 |
| 1460 | Ga0501069_0077586 | 3300049585 | Bacteria | 1868 |
| 1461 | Ga0501069_0122508 | 3300049585 | Bacteria | 1486 |
| 1462 | Ga0501069_0344870 | 3300049585 | Bacteria | 877 |
| 1463 | Ga0501070_0000655 | 3300049586 | Bacteria | 31899 |
| 1464 | Ga0501070_0006725 | 3300049586 | Bacteria | 9790 |
| 1465 | Ga0501070_0016571 | 3300049586 | Bacteria | 6189 |
| 1466 | Ga0501070_0018812 | 3300049586 | Bacteria | 5794 |
| 1467 | Ga0501070_0095134 | 3300049586 | Bacteria | 2465 |
| 1468 | Ga0501070_0100999 | 3300049586 | Bacteria | 2386 |
| 1469 | Ga0501070_0144310 | 3300049586 | Bacteria | 1965 |
| 1470 | Ga0501070_0158774 | 3300049586 | Bacteria | 1864 |
| 1471 | Ga0501070_0166828 | 3300049586 | Bacteria | 1814 |
| 1472 | Ga0501070_0201311 | 3300049586 | Bacteria | 1635 |
| 1473 | Ga0501070_0256433 | 3300049586 | Bacteria | 1430 |
| 1474 | Ga0501070_0262462 | 3300049586 | Bacteria | 1411 |
| 1475 | Ga0501070_0264672 | 3300049586 | Bacteria | 1405 |
| 1476 | Ga0501070_0317161 | 3300049586 | Bacteria | 1268 |
| 1477 | Ga0501070_0345630 | 3300049586 | Bacteria | 1208 |
| 1478 | Ga0501070_0354419 | 3300049586 | Bacteria | 1191 |
| 1479 | Ga0501070_0393622 | 3300049586 | Bacteria | 1121 |
| 1480 | Ga0501070_0436748 | 3300049586 | Bacteria | 1056 |
| 1481 | Ga0501070_0470211 | 3300049586 | Bacteria | 1012 |
| 1482 | Ga0501070_0648276 | 3300049586 | Bacteria | 839 |
| 1483 | Ga0501070_0852893 | 3300049586 | Bacteria | 713 |
| 1484 | Ga0501071_0012761 | 3300049587 | Bacteria | 5712 |
| 1485 | Ga0501071_0028792 | 3300049587 | Bacteria | 3916 |
| 1486 | Ga0501071_0048177 | 3300049587 | Bacteria | 3063 |
| 1487 | Ga0501071_0053351 | 3300049587 | Bacteria | 2916 |
| 1488 | Ga0501071_0064234 | 3300049587 | Bacteria | 2663 |
| 1489 | Ga0501071_0113545 | 3300049587 | Bacteria | 2003 |
| 1490 | Ga0501071_0166399 | 3300049587 | Bacteria | 1650 |
| 1491 | Ga0501071_0179667 | 3300049587 | Bacteria | 1585 |
| 1492 | Ga0501071_0376487 | 3300049587 | Bacteria | 1082 |
| 1493 | Ga0501071_0391157 | 3300049587 | Bacteria | 1061 |
| 1494 | Ga0501072_0004865 | 3300049588 | Bacteria | 10218 |
| 1495 | Ga0501072_0017931 | 3300049588 | Bacteria | 5443 |
| 1496 | Ga0501072_0034155 | 3300049588 | Bacteria | 3986 |
| 1497 | Ga0501072_0062830 | 3300049588 | Bacteria | 2929 |
| 1498 | Ga0501072_0183311 | 3300049588 | Bacteria | 1670 |
| 1499 | Ga0501072_0234011 | 3300049588 | Bacteria | 1463 |
| 1500 | Ga0501072_0825671 | 3300049588 | Bacteria | 725 |
| 1501 | Ga0501073_0000014 | 3300049589 | Bacteria | 159719 |
| 1502 | Ga0501073_0002833 | 3300049589 | Bacteria | 12998 |
| 1503 | Ga0501073_0018220 | 3300049589 | Bacteria | 5074 |
| 1504 | Ga0501073_0024859 | 3300049589 | Bacteria | 4299 |
| 1505 | Ga0501073_0034517 | 3300049589 | Bacteria | 3600 |
| 1506 | Ga0501073_0038666 | 3300049589 | Bacteria | 3383 |
| 1507 | Ga0501073_0041910 | 3300049589 | Bacteria | 3233 |
| 1508 | Ga0501073_0047652 | 3300049589 | Bacteria | 3011 |
| 1509 | Ga0501073_0056617 | 3300049589 | Bacteria | 2742 |
| 1510 | Ga0501073_0065487 | 3300049589 | Bacteria | 2534 |
| 1511 | Ga0501073_0083577 | 3300049589 | Bacteria | 2221 |
| 1512 | Ga0501073_0137204 | 3300049589 | Bacteria | 1695 |
| 1513 | Ga0501073_0170505 | 3300049589 | Bacteria | 1506 |
| 1514 | Ga0501073_0190027 | 3300049589 | Bacteria | 1421 |
| 1515 | Ga0501073_0383579 | 3300049589 | Bacteria | 971 |
| 1516 | Ga0501073_0451539 | 3300049589 | Bacteria | 888 |
| 1517 | Ga0501073_0645765 | 3300049589 | Bacteria | 730 |
| 1518 | Ga0501074_0000018 | 3300049590 | Bacteria | 76326 |
| 1519 | Ga0501074_0002711 | 3300049590 | Bacteria | 12399 |
| 1520 | Ga0501074_0012897 | 3300049590 | Bacteria | 6077 |
| 1521 | Ga0501074_0015276 | 3300049590 | Bacteria | 5580 |
| 1522 | Ga0501074_0021326 | 3300049590 | Bacteria | 4704 |
| 1523 | Ga0501074_0103606 | 3300049590 | Bacteria | 2037 |
| 1524 | Ga0501074_0133838 | 3300049590 | Bacteria | 1773 |
| 1525 | Ga0501074_0318524 | 3300049590 | Bacteria | 1104 |
| 1526 | Ga0501074_0570773 | 3300049590 | Bacteria | 801 |
| 1527 | Ga0501075_0018336 | 3300049591 | Bacteria | 5065 |
| 1528 | Ga0501075_0027652 | 3300049591 | Bacteria | 4181 |
| 1529 | Ga0501075_0043514 | 3300049591 | Bacteria | 3368 |
| 1530 | Ga0501075_0059389 | 3300049591 | Bacteria | 2880 |
| 1531 | Ga0501075_0106152 | 3300049591 | Bacteria | 2135 |
| 1532 | Ga0501075_0893142 | 3300049591 | Bacteria | 676 |
| 1533 | Ga0501076_0006456 | 3300049592 | Bacteria | 8510 |
| 1534 | Ga0501076_0018774 | 3300049592 | Bacteria | 5276 |
| 1535 | Ga0501076_0027098 | 3300049592 | Bacteria | 4445 |
| 1536 | Ga0501076_0066828 | 3300049592 | Bacteria | 2870 |
| 1537 | Ga0501076_0177685 | 3300049592 | Bacteria | 1735 |
| 1538 | Ga0501076_0311057 | 3300049592 | Bacteria | 1292 |
| 1539 | Ga0501077_0001847 | 3300049593 | Bacteria | 12803 |
| 1540 | Ga0501077_0004733 | 3300049593 | Bacteria | 8270 |
| 1541 | Ga0501077_0011089 | 3300049593 | Bacteria | 5622 |
| 1542 | Ga0501077_0023018 | 3300049593 | Bacteria | 3951 |
| 1543 | Ga0501077_0037231 | 3300049593 | Bacteria | 3100 |
| 1544 | Ga0501077_0265565 | 3300049593 | Bacteria | 1092 |
| 1545 | Ga0501077_0272029 | 3300049593 | Bacteria | 1078 |
| 1546 | Ga0501077_0303739 | 3300049593 | Bacteria | 1017 |
| 1547 | Ga0501079_0004830 | 3300049741 | Bacteria | 9983 |
| 1548 | Ga0501079_0005303 | 3300049741 | Bacteria | 9591 |
| 1549 | Ga0501079_0014814 | 3300049741 | Bacteria | 5944 |
| 1550 | Ga0501079_0058404 | 3300049741 | Bacteria | 2976 |
| 1551 | Ga0501079_0084466 | 3300049741 | Bacteria | 2456 |
| 1552 | Ga0501079_0109216 | 3300049741 | Bacteria | 2148 |
| 1553 | Ga0501079_0118284 | 3300049741 | Bacteria | 2060 |
| 1554 | Ga0501079_0233810 | 3300049741 | Bacteria | 1436 |
| 1555 | Ga0501079_0406820 | 3300049741 | Bacteria | 1067 |
| 1556 | Ga0501079_0426889 | 3300049741 | Bacteria | 1041 |
| 1557 | Ga0501079_0781664 | 3300049741 | Bacteria | 752 |
| 1558 | Ga0501080_0000002 | 3300049742 | Bacteria | 218492 |
| 1559 | Ga0501080_0002237 | 3300049742 | Bacteria | 16816 |
| 1560 | Ga0501080_0004022 | 3300049742 | Bacteria | 13021 |
| 1561 | Ga0501080_0010582 | 3300049742 | Bacteria | 8443 |
| 1562 | Ga0501080_0013615 | 3300049742 | Bacteria | 7489 |
| 1563 | Ga0501080_0013921 | 3300049742 | Bacteria | 7404 |
| 1564 | Ga0501080_0035684 | 3300049742 | Bacteria | 4641 |
| 1565 | Ga0501080_0052841 | 3300049742 | Bacteria | 3782 |
| 1566 | Ga0501080_0078300 | 3300049742 | Bacteria | 3075 |
| 1567 | Ga0501080_0094547 | 3300049742 | Bacteria | 2776 |
| 1568 | Ga0501080_0142348 | 3300049742 | Bacteria | 2217 |
| 1569 | Ga0501080_0385462 | 3300049742 | Bacteria | 1262 |
| 1570 | Ga0501080_0518077 | 3300049742 | Bacteria | 1064 |
| 1571 | Ga0501080_0529225 | 3300049742 | Bacteria | 1051 |
| 1572 | Ga0501080_0683087 | 3300049742 | Bacteria | 906 |
| 1573 | Ga0501080_1169928 | 3300049742 | Bacteria | 662 |
| 1574 | Ga0501081_0010055 | 3300049743 | Bacteria | 6170 |
| 1575 | Ga0501081_0035267 | 3300049743 | Bacteria | 3405 |
| 1576 | Ga0501081_0085755 | 3300049743 | Bacteria | 2210 |
| 1577 | Ga0501081_0126776 | 3300049743 | Bacteria | 1821 |
| 1578 | Ga0501081_0144990 | 3300049743 | Bacteria | 1703 |
| 1579 | Ga0501081_0659993 | 3300049743 | Bacteria | 784 |
| 1580 | Ga0501081_0828834 | 3300049743 | Bacteria | 697 |
| 1581 | Ga0501083_0003370 | 3300049744 | Bacteria | 11185 |
| 1582 | Ga0501083_0024248 | 3300049744 | Bacteria | 4204 |
| 1583 | Ga0501083_0063805 | 3300049744 | Bacteria | 2456 |
| 1584 | Ga0501083_0087008 | 3300049744 | Bacteria | 2066 |
| 1585 | Ga0501083_0163497 | 3300049744 | Bacteria | 1455 |
| 1586 | Ga0501083_0240614 | 3300049744 | Bacteria | 1178 |
| 1587 | Ga0501083_0267403 | 3300049744 | Bacteria | 1112 |
| 1588 | Ga0501083_0306741 | 3300049744 | Bacteria | 1032 |
| 1589 | Ga0501035_0000008 | 3300049822 | Bacteria | 313425 |
| 1590 | Ga0501035_0000032 | 3300049822 | Bacteria | 175435 |
| 1591 | Ga0501035_0000039 | 3300049822 | Bacteria | 156824 |
| 1592 | Ga0501035_0000117 | 3300049822 | Bacteria | 96642 |
| 1593 | Ga0501035_0002261 | 3300049822 | Bacteria | 19041 |
| 1594 | Ga0501035_0004448 | 3300049822 | Bacteria | 13299 |
| 1595 | Ga0501035_0005021 | 3300049822 | Bacteria | 12533 |
| 1596 | Ga0501035_0008137 | 3300049822 | Bacteria | 9772 |
| 1597 | Ga0501035_0017042 | 3300049822 | Bacteria | 6694 |
| 1598 | Ga0501035_0026899 | 3300049822 | Bacteria | 5259 |
| 1599 | Ga0501035_0029253 | 3300049822 | Bacteria | 5024 |
| 1600 | Ga0501035_0045729 | 3300049822 | Bacteria | 3937 |
| 1601 | Ga0501035_0071486 | 3300049822 | Bacteria | 3072 |
| 1602 | Ga0501035_0094737 | 3300049822 | Bacteria | 2625 |
| 1603 | Ga0501035_0099467 | 3300049822 | Bacteria | 2553 |
| 1604 | Ga0501035_0106844 | 3300049822 | Bacteria | 2453 |
| 1605 | Ga0501035_0172930 | 3300049822 | Bacteria | 1865 |
| 1606 | Ga0501035_0173103 | 3300049822 | Bacteria | 1864 |
| 1607 | Ga0501035_0181247 | 3300049822 | Bacteria | 1815 |
| 1608 | Ga0501035_0198596 | 3300049822 | Bacteria | 1721 |
| 1609 | Ga0501035_0256988 | 3300049822 | Bacteria | 1482 |
| 1610 | Ga0501035_0325138 | 3300049822 | Bacteria | 1291 |
| 1611 | Ga0501035_0433007 | 3300049822 | Bacteria | 1090 |
| 1612 | Ga0501035_0484671 | 3300049822 | Bacteria | 1019 |
| 1613 | Ga0501035_0750170 | 3300049822 | Bacteria | 783 |
| 1614 | Ga0501044_0000001 | 3300049823 | Bacteria | 418087 |
| 1615 | Ga0501044_0000019 | 3300049823 | Bacteria | 223724 |
| 1616 | Ga0501044_0000047 | 3300049823 | Bacteria | 146449 |
| 1617 | Ga0501044_0000703 | 3300049823 | Bacteria | 40390 |
| 1618 | Ga0501044_0004317 | 3300049823 | Bacteria | 15935 |
| 1619 | Ga0501044_0010978 | 3300049823 | Bacteria | 9833 |
| 1620 | Ga0501044_0013911 | 3300049823 | Bacteria | 8695 |
| 1621 | Ga0501044_0028245 | 3300049823 | Bacteria | 5922 |
| 1622 | Ga0501044_0034875 | 3300049823 | Bacteria | 5273 |
| 1623 | Ga0501044_0035914 | 3300049823 | Bacteria | 5187 |
| 1624 | Ga0501044_0046510 | 3300049823 | Bacteria | 4491 |
| 1625 | Ga0501044_0048777 | 3300049823 | Bacteria | 4373 |
| 1626 | Ga0501044_0058195 | 3300049823 | Bacteria | 3964 |
| 1627 | Ga0501044_0058823 | 3300049823 | Bacteria | 3940 |
| 1628 | Ga0501044_0103289 | 3300049823 | Bacteria | 2865 |
| 1629 | Ga0501044_0121136 | 3300049823 | Bacteria | 2617 |
| 1630 | Ga0501044_0143513 | 3300049823 | Bacteria | 2375 |
| 1631 | Ga0501044_0148141 | 3300049823 | Bacteria | 2331 |
| 1632 | Ga0501044_0154920 | 3300049823 | Bacteria | 2271 |
| 1633 | Ga0501044_0177509 | 3300049823 | Bacteria | 2098 |
| 1634 | Ga0501044_0191453 | 3300049823 | Bacteria | 2008 |
| 1635 | Ga0501044_0209608 | 3300049823 | Bacteria | 1903 |
| 1636 | Ga0501044_0231424 | 3300049823 | Bacteria | 1795 |
| 1637 | Ga0501044_0337127 | 3300049823 | Bacteria | 1429 |
| 1638 | Ga0501044_0365035 | 3300049823 | Bacteria | 1361 |
| 1639 | Ga0501044_0462847 | 3300049823 | Bacteria | 1173 |
| 1640 | Ga0501044_0669613 | 3300049823 | Bacteria | 925 |
| 1641 | Ga0501045_0001654 | 3300049824 | Bacteria | 14980 |
| 1642 | Ga0501045_0008550 | 3300049824 | Bacteria | 7136 |
| 1643 | Ga0501045_0009260 | 3300049824 | Bacteria | 6888 |
| 1644 | Ga0501045_0010803 | 3300049824 | Bacteria | 6398 |
| 1645 | Ga0501045_0041021 | 3300049824 | Bacteria | 3367 |
| 1646 | Ga0501045_0050604 | 3300049824 | Bacteria | 3032 |
| 1647 | Ga0501045_0230832 | 3300049824 | Bacteria | 1378 |
| 1648 | Ga0501045_0663410 | 3300049824 | Bacteria | 770 |
| 1649 | nmdc:mga03683_4036_c1 | 3300050489 | Bacteria | 4817 |
| 1650 | nmdc:mga03683_58041_c1 | 3300050489 | Bacteria | 1630 |
| 1651 | nmdc:mga03n38_117253_c1 | 3300050490 | Bacteria | 1304 |
| 1652 | nmdc:mga03n38_132244_c1 | 3300050490 | Bacteria | 1238 |
| 1653 | nmdc:mga03n38_1389_c1 | 3300050490 | Bacteria | 6885 |
| 1654 | nmdc:mga03n38_143265_c1 | 3300050490 | Bacteria | 1196 |
| 1655 | nmdc:mga03n38_245834_c1 | 3300050490 | Bacteria | 943 |
| 1656 | nmdc:mga03n38_436972_c1 | 3300050490 | Bacteria | 726 |
| 1657 | nmdc:mga00v17_130479_c1 | 3300050491 | Bacteria | 1606 |
| 1658 | nmdc:mga00v17_264705_c1 | 3300050491 | Bacteria | 1115 |
| 1659 | nmdc:mga00v17_26959_c1 | 3300050491 | Bacteria | 3352 |
| 1660 | nmdc:mga00v17_400348_c1 | 3300050491 | Bacteria | 892 |
| 1661 | nmdc:mga0yw44_129012_c1 | 3300050492 | Bacteria | 1635 |
| 1662 | nmdc:mga0yw44_35872_c1 | 3300050492 | Bacteria | 2918 |
| 1663 | nmdc:mga0yw44_4300_c1 | 3300050492 | Bacteria | 6501 |
| 1664 | nmdc:mga0yw44_78709_c1 | 3300050492 | Bacteria | 2062 |
| 1665 | nmdc:mga0k408_124121_c1 | 3300050493 | Bacteria | 1531 |
| 1666 | nmdc:mga0k408_20853_c2 | 3300050493 | Bacteria | 1912 |
| 1667 | nmdc:mga0k408_82957_c1 | 3300050493 | Bacteria | 1879 |
| 1668 | nmdc:mga06z11_12231_c1 | 3300050494 | Bacteria | 3728 |
| 1669 | nmdc:mga06z11_33762_c1 | 3300050494 | Bacteria | 2506 |
| 1670 | nmdc:mga06z11_705_c1 | 3300050494 | Bacteria | 12155 |
| 1671 | nmdc:mga06z11_72969_c1 | 3300050494 | Bacteria | 1821 |
| 1672 | nmdc:mga04h51_23833_c1 | 3300050495 | Bacteria | 1868 |
| 1673 | nmdc:mga04h51_4615_c1 | 3300050495 | Bacteria | 3443 |
| 1674 | nmdc:mga04h51_694_c1 | 3300050495 | Bacteria | 7837 |
| 1675 | nmdc:mga07m45_211273_c1 | 3300050496 | Bacteria | 1129 |
| 1676 | nmdc:mga07m45_239053_c1 | 3300050496 | Bacteria | 1057 |
| 1677 | nmdc:mga07m45_434322_c1 | 3300050496 | Bacteria | 762 |
| 1678 | nmdc:mga07m45_53418_c1 | 3300050496 | Bacteria | 2283 |
| 1679 | nmdc:mga05p37_182118_c1 | 3300050507 | Bacteria | 2555 |
| 1680 | nmdc:mga05p37_427650_c1 | 3300050507 | Bacteria | 1539 |
| 1681 | nmdc:mga05p37_51437_c1 | 3300050507 | Bacteria | 5066 |
| 1682 | nmdc:mga05p37_65210_c1 | 3300050507 | Bacteria | 4482 |
| 1683 | nmdc:mga05p37_98045_c1 | 3300050507 | Bacteria | 3610 |
| 1684 | nmdc:mga09592_114198_c1 | 3300050508 | Bacteria | 2318 |
| 1685 | nmdc:mga09592_200339_c1 | 3300050508 | Bacteria | 1729 |
| 1686 | nmdc:mga09592_241494_c1 | 3300050508 | Bacteria | 1565 |
| 1687 | nmdc:mga09592_524289_c1 | 3300050508 | Bacteria | 1019 |
| 1688 | nmdc:mga0qj67_156075_c1 | 3300050509 | Bacteria | 1852 |
| 1689 | nmdc:mga0qj67_314501_c1 | 3300050509 | Bacteria | 1268 |
| 1690 | nmdc:mga0qj67_54444_c1 | 3300050509 | Bacteria | 3168 |
| 1691 | nmdc:mga06r32_190094_c1 | 3300050510 | Bacteria | 2041 |
| 1692 | nmdc:mga06r32_23400_c1 | 3300050510 | Bacteria | 5714 |
| 1693 | nmdc:mga06r32_264088_c1 | 3300050510 | Bacteria | 1709 |
| 1694 | nmdc:mga06r32_350083_c1 | 3300050510 | Bacteria | 1462 |
| 1695 | nmdc:mga08y16_139567_c1 | 3300050511 | Bacteria | 2520 |
| 1696 | nmdc:mga08y16_171037_c1 | 3300050511 | Bacteria | 2257 |
| 1697 | nmdc:mga08y16_21413_c1 | 3300050511 | Bacteria | 6828 |
| 1698 | nmdc:mga08y16_296484_c1 | 3300050511 | Bacteria | 1667 |
| 1699 | nmdc:mga08y16_316692_c1 | 3300050511 | Bacteria | 1606 |
| 1700 | nmdc:mga08y16_5359_c1 | 3300050511 | Bacteria | 13416 |
| 1701 | nmdc:mga08y16_63289_c1 | 3300050511 | Bacteria | 3863 |
| 1702 | nmdc:mga0n895_15896_c1 | 3300050512 | Bacteria | 6884 |
| 1703 | nmdc:mga0n895_170676_c1 | 3300050512 | Bacteria | 2207 |
| 1704 | nmdc:mga0n895_2207_c1 | 3300050512 | Bacteria | 15060 |
| 1705 | nmdc:mga0n895_30612_c1 | 3300050512 | Bacteria | 5146 |
| 1706 | nmdc:mga0n895_83313_c1 | 3300050512 | Bacteria | 3189 |
| 1707 | nmdc:mga0rr50_121476_c1 | 3300050513 | Bacteria | 2080 |
| 1708 | nmdc:mga0rr50_19863_c1 | 3300050513 | Bacteria | 4546 |
| 1709 | nmdc:mga0rr50_224297_c1 | 3300050513 | Bacteria | 1553 |
| 1710 | nmdc:mga0rr50_519292_c1 | 3300050513 | Bacteria | 1013 |
| 1711 | nmdc:mga0rr50_60126_c1 | 3300050513 | Bacteria | 2857 |
| 1712 | nmdc:mga0rr50_653383_c1 | 3300050513 | Bacteria | 897 |
| 1713 | nmdc:mga08x19_156817_c1 | 3300050514 | Bacteria | 1544 |
| 1714 | nmdc:mga08x19_208239_c1 | 3300050514 | Bacteria | 1342 |
| 1715 | nmdc:mga08x19_21206_c1 | 3300050514 | Bacteria | 4007 |
| 1716 | nmdc:mga08x19_69_c1 | 3300050514 | Bacteria | 100711 |
| 1717 | nmdc:mga08x19_9966_c1 | 3300050514 | Bacteria | 5696 |
| 1718 | nmdc:mga0a205_21733_c1 | 3300050515 | Bacteria | 6067 |
| 1719 | nmdc:mga0a205_431202_c1 | 3300050515 | Bacteria | 1180 |
| 1720 | nmdc:mga0a205_468445_c1 | 3300050515 | Bacteria | 1119 |
| 1721 | nmdc:mga0sz30_1901_c1 | 3300050516 | Bacteria | 7452 |
| 1722 | nmdc:mga0sz30_32122_c1 | 3300050516 | Bacteria | 2176 |
| 1723 | nmdc:mga0sz30_9747_c2 | 3300050516 | Bacteria | 2319 |
| 1724 | Ga0495601_0066610 | 3300053077 | Bacteria | 2293 |
| 1725 | Ga0495601_0076451 | 3300053077 | Bacteria | 2144 |
| 1726 | Ga0495612_0157560 | 3300053078 | Bacteria | 990 |
| 1727 | Ga0495655_0000251 | 3300053083 | Bacteria | 10014 |
| 1728 | Ga0495595_0028754 | 3300053084 | Bacteria | 2484 |
| 1729 | Ga0495595_0032219 | 3300053084 | Bacteria | 2360 |
| 1730 | Ga0495619_0004327 | 3300053085 | Bacteria | 9056 |
| 1731 | Ga0495619_0196442 | 3300053085 | Bacteria | 1397 |
| 1732 | Ga0495619_0454718 | 3300053085 | Bacteria | 882 |
| 1733 | Ga0500643_000019 | 3300053087 | Bacteria | 294301 |
| 1734 | Ga0500643_014322 | 3300053087 | Bacteria | 2763 |
| 1735 | Ga0500644_0003737 | 3300053088 | Bacteria | 3781 |
| 1736 | Ga0500646_0002953 | 3300053090 | Bacteria | 4366 |
| 1737 | Ga0500651_0003961 | 3300053093 | Bacteria | 8216 |
| 1738 | Ga0500566_0000487 | 3300053094 | Bacteria | 22108 |
| 1739 | Ga0500641_0042791 | 3300053096 | Bacteria | 1836 |
| 1740 | Ga0500641_0131552 | 3300053096 | Bacteria | 1080 |
| 1741 | Ga0500555_011538 | 3300053103 | Bacteria | 2539 |
| 1742 | Ga0500556_0000036 | 3300053104 | Bacteria | 144864 |
| 1743 | Ga0500556_0001299 | 3300053104 | Bacteria | 11249 |
| 1744 | Ga0500572_004255 | 3300053111 | Bacteria | 3250 |
| 1745 | Ga0500595_024485 | 3300053119 | Bacteria | 2106 |
| 1746 | Ga0500595_048346 | 3300053119 | Bacteria | 1329 |
| 1747 | Ga0500595_065616 | 3300053119 | Bacteria | 1086 |
| 1748 | Ga0500607_060523 | 3300053121 | Bacteria | 1985 |
| 1749 | Ga0500621_044069 | 3300053126 | Bacteria | 1804 |
| 1750 | Ga0500642_0272533 | 3300053130 | Bacteria | 771 |
| 1751 | Ga0500652_048904 | 3300053131 | Bacteria | 1722 |
| 1752 | Ga0500658_0098157 | 3300053134 | Bacteria | 1275 |
| 1753 | Ga0500559_0039340 | 3300053136 | Bacteria | 2056 |
| 1754 | Ga0500559_0047072 | 3300053136 | Bacteria | 1893 |
| 1755 | Ga0500568_0000309 | 3300053139 | Bacteria | 38852 |
| 1756 | Ga0500568_0031708 | 3300053139 | Bacteria | 2178 |
| 1757 | Ga0500588_0003081 | 3300053146 | Bacteria | 3478 |
| 1758 | Ga0500588_0028064 | 3300053146 | Bacteria | 1592 |
| 1759 | Ga0500604_0001638 | 3300053151 | Bacteria | 6294 |
| 1760 | Ga0500604_0006127 | 3300053151 | Bacteria | 3175 |
| 1761 | Ga0500604_0022165 | 3300053151 | Bacteria | 1801 |
| 1762 | Ga0500604_0030493 | 3300053151 | Bacteria | 1577 |
| 1763 | Ga0500616_0002280 | 3300053153 | Bacteria | 16258 |
| 1764 | Ga0500616_0009256 | 3300053153 | Bacteria | 6005 |
| 1765 | Ga0500616_0019054 | 3300053153 | Bacteria | 3874 |
| 1766 | Ga0500616_0024006 | 3300053153 | Bacteria | 3393 |
| 1767 | Ga0500616_0032619 | 3300053153 | Bacteria | 2847 |
| 1768 | Ga0500616_0056137 | 3300053153 | Bacteria | 2056 |
| 1769 | Ga0500619_054403 | 3300053154 | Bacteria | 1303 |
| 1770 | Ga0500620_000626 | 3300053155 | Bacteria | 6046 |
| 1771 | Ga0500620_018206 | 3300053155 | Bacteria | 2041 |
| 1772 | Ga0500627_0185884 | 3300053158 | Bacteria | 934 |
| 1773 | Ga0500634_0000025 | 3300053161 | Bacteria | 81954 |
| 1774 | Ga0500638_003723 | 3300053162 | Bacteria | 5722 |
| 1775 | Ga0500636_0000194 | 3300053177 | Bacteria | 32748 |
| 1776 | Ga0500637_0178773 | 3300053178 | Bacteria | 1217 |
| 1777 | Ga0500645_056068 | 3300053730 | Bacteria | 1144 |
| 1778 | Ga0500609_003263 | 3300053731 | Bacteria | 2288 |
| 1779 | Ga0500552_011425 | 3300053733 | Bacteria | 1115 |
| 1780 | Ga0501084_0006046 | 3300054114 | Bacteria | 9953 |
| 1781 | Ga0501084_0009681 | 3300054114 | Bacteria | 7970 |
| 1782 | Ga0501084_0023106 | 3300054114 | Bacteria | 5190 |
| 1783 | Ga0501084_0049863 | 3300054114 | Bacteria | 3504 |
| 1784 | Ga0501084_0068743 | 3300054114 | Bacteria | 2965 |
| 1785 | Ga0501084_0124882 | 3300054114 | Bacteria | 2165 |
| 1786 | Ga0501084_0149033 | 3300054114 | Bacteria | 1971 |
| 1787 | Ga0501084_0250923 | 3300054114 | Bacteria | 1494 |
| 1788 | Ga0501084_0553673 | 3300054114 | Bacteria | 972 |
| 1789 | Ga0587077_051409 | 3300059493 | Bacteria | 864 |
| 1790 | Ga0587077_080517 | 3300059493 | Bacteria | 746 |
| 1791 | Ga0587082_059591 | 3300059504 | Bacteria | 749 |
| 1792 | Ga0587082_059824 | 3300059504 | Bacteria | 748 |
| 1793 | Ga0587091_050805 | 3300059511 | Bacteria | 850 |
| 1794 | Ga0587101_027942 | 3300059623 | Bacteria | 861 |
| 1795 | Ga0587101_033312 | 3300059623 | Bacteria | 815 |
| 1796 | Ga0587109_069466 | 3300059624 | Bacteria | 759 |
| 1797 | Ga0587113_015543 | 3300059625 | Bacteria | 756 |
| 1798 | Ga0587115_051677 | 3300059626 | Bacteria | 669 |
| 1799 | Ga0587130_013116 | 3300059631 | Bacteria | 835 |
| 1800 | Ga0587062_006809 | 3300059639 | Bacteria | 1311 |
| 1801 | Ga0587062_050607 | 3300059639 | Bacteria | 702 |
| 1802 | Ga0587068_057336 | 3300059641 | Bacteria | 742 |
| 1803 | Ga0587069_046331 | 3300059642 | Bacteria | 759 |
| 1804 | Ga0587076_063858 | 3300059645 | Bacteria | 749 |
| 1805 | Ga0587079_059224 | 3300059647 | Bacteria | 826 |
| 1806 | Ga0587110_013617 | 3300059654 | Bacteria | 853 |
| 1807 | Ga0587120_008602 | 3300059659 | Bacteria | 838 |
| 1808 | Ga0587124_010216 | 3300059660 | Bacteria | 834 |
| 1809 | Ga0587111_0066355 | 3300060346 | Bacteria | 832 |
| 1810 | Ga0587111_0068265 | 3300060346 | Bacteria | 824 |
| 1811 | Ga0587111_0096492 | 3300060346 | Bacteria | 730 |
| 1812 | Ga0501082_0002218 | 3300060353 | Bacteria | 16990 |
| 1813 | Ga0501082_0008244 | 3300060353 | Bacteria | 8984 |
| 1814 | Ga0501082_0015022 | 3300060353 | Bacteria | 6673 |
| 1815 | Ga0501082_0021725 | 3300060353 | Bacteria | 5532 |
| 1816 | Ga0501082_0033112 | 3300060353 | Bacteria | 4457 |
| 1817 | Ga0501082_0038987 | 3300060353 | Bacteria | 4098 |
| 1818 | Ga0501082_0050351 | 3300060353 | Bacteria | 3592 |
| 1819 | Ga0501082_0058924 | 3300060353 | Bacteria | 3309 |
| 1820 | Ga0501082_0072665 | 3300060353 | Bacteria | 2963 |
| 1821 | Ga0501082_0109419 | 3300060353 | Bacteria | 2392 |
| 1822 | Ga0501082_0165672 | 3300060353 | Bacteria | 1920 |
| 1823 | Ga0501082_0190851 | 3300060353 | Bacteria | 1782 |
| 1824 | Ga0501082_0331408 | 3300060353 | Bacteria | 1326 |
| 1825 | Ga0501082_0348487 | 3300060353 | Bacteria | 1291 |
| 1826 | Ga0501082_0374891 | 3300060353 | Bacteria | 1241 |
| 1827 | Ga0501082_0402469 | 3300060353 | Bacteria | 1195 |
| 1828 | Ga0501082_0431388 | 3300060353 | Bacteria | 1151 |
| 1829 | Ga0501082_0508428 | 3300060353 | Bacteria | 1053 |
| 1830 | Ga0501082_0716932 | 3300060353 | Bacteria | 875 |
| 1831 | Ga0501082_0752630 | 3300060353 | Bacteria | 853 |
| 1832 | Ga0501082_0920630 | 3300060353 | Bacteria | 765 |
| 1833 | Ga0501082_1191385 | 3300060353 | Bacteria | 666 |
| 1834 | Ga0466962_0000476 | 3300061719 | Bacteria | 17393 |
| 1835 | Ga0466962_0168384 | 3300061719 | Bacteria | 1066 |
| 1836 | Ga0530510_0005850 | 3300061734 | Bacteria | 8520 |
| 1837 | Ga0530510_0007021 | 3300061734 | Bacteria | 7843 |
| 1838 | Ga0530510_0026303 | 3300061734 | Bacteria | 4164 |
| 1839 | Ga0530510_0165872 | 3300061734 | Bacteria | 1635 |
| 1840 | Ga0530510_0203259 | 3300061734 | Bacteria | 1472 |
| 1841 | Ga0530510_0298869 | 3300061734 | Bacteria | 1204 |
| 1842 | Ga0530510_0395637 | 3300061734 | Bacteria | 1041 |
| 1843 | Ga0530510_0710982 | 3300061734 | Bacteria | 766 |
| 1844 | Ga0500651_0190048 | |||
| 1845 | RicEn_C4886 | |||
| 1846 | JGI24740J21852_10028970 | |||
| 1847 | JGI24739J22299_10035650 | |||
| 1848 | JGI24737J22298_10009679 | |||
| 1849 | JGI24743J22301_10050974 | |||
| 1850 | JGI24735J21928_10019801 | |||
| 1851 | JGI24745J21846_1025938 | |||
| 1852 | JGI24738J21930_10039363 | |||
| 1853 | JGI25156J39149_1007812 | |||
| 1854 | JGI25157J39369_1001188 | |||
| 1855 | JGI25406J46586_10002529 | |||
| 1856 | JGI25165J46597_1000192 | |||
| 1857 | JGI25165J46597_1003262 | |||
| 1858 | JGI25160J50197_1005746 | |||
| 1859 | Ga0007416J51690_1023620 | |||
| 1860 | JGI25404J52841_10047908 | |||
| 1861 | Ga0055542_1000612 | |||
| 1862 | Ga0055529_1003526 | |||
| 1863 | Ga0055531_10016283 | |||
| 1864 | Ga0065712_10370395 | |||
| 1865 | Ga0065715_10105176 | |||
| 1866 | Ga0070658_10021681 | |||
| 1867 | Ga0070658_10021783 | |||
| 1868 | Ga0070658_10031935 | |||
| 1869 | Ga0070658_10051002 | |||
| 1870 | Ga0070658_10386894 | |||
| 1871 | Ga0070676_10014141 | |||
| 1872 | Ga0070683_100224613 | |||
| 1873 | Ga0070683_100468308 | |||
| 1874 | Ga0070683_100542749 | |||
| 1875 | Ga0070690_100010596 | |||
| 1876 | Ga0070670_100014234 | |||
| 1877 | Ga0068869_100173823 | |||
| 1878 | Ga0068869_100225952 | |||
| 1879 | Ga0070666_10019980 | |||
| 1880 | Ga0070666_10240332 | |||
| 1881 | Ga0070680_100026089 | |||
| 1882 | Ga0070680_100530837 | |||
| 1883 | Ga0070680_101022033 | |||
| 1884 | Ga0070682_100001226 | |||
| 1885 | Ga0070682_100002466 | |||
| 1886 | Ga0070682_100002995 | |||
| 1887 | Ga0070682_100083887 | |||
| 1888 | Ga0068868_100021232 | |||
| 1889 | Ga0068868_100327996 | |||
| 1890 | Ga0070660_100022647 | |||
| 1891 | Ga0070660_100032440 | |||
| 1892 | Ga0070660_100571500 | |||
| 1893 | Ga0070689_100005857 | |||
| 1894 | Ga0070689_100691753 | |||
| 1895 | Ga0070689_100703389 | |||
| 1896 | Ga0070691_10004158 | |||
| 1897 | Ga0070691_10035914 | |||
| 1898 | Ga0070691_10055160 | |||
| 1899 | Ga0070687_100001867 | |||
| 1900 | Ga0070687_100247855 | |||
| 1901 | Ga0070661_100002323 | |||
| 1902 | Ga0070661_100041250 | |||
| 1903 | Ga0070692_10004328 | |||
| 1904 | Ga0070668_100003026 | |||
| 1905 | Ga0070668_100019887 | |||
| 1906 | Ga0070668_100211414 | |||
| 1907 | Ga0070668_100212046 | |||
| 1908 | Ga0070668_100227611 | |||
| 1909 | Ga0070668_100315465 | |||
| 1910 | Ga0070668_100592997 | |||
| 1911 | Ga0070668_100799715 | |||
| 1912 | Ga0070669_100001259 | |||
| 1913 | Ga0070669_100056898 | |||
| 1914 | Ga0070675_100015132 | |||
| 1915 | Ga0070675_100182317 | |||
| 1916 | Ga0070675_100432631 | |||
| 1917 | Ga0070671_100001064 | |||
| 1918 | Ga0070674_100000541 | |||
| 1919 | Ga0070674_100066867 | |||
| 1920 | Ga0070674_100088457 | |||
| 1921 | Ga0070674_100163799 | |||
| 1922 | Ga0070674_100362019 | |||
| 1923 | Ga0070674_100364610 | |||
| 1924 | Ga0070673_100000057 | |||
| 1925 | Ga0070688_100001329 | |||
| 1926 | Ga0070659_100000930 | |||
| 1927 | Ga0070659_100008775 | |||
| 1928 | Ga0070659_100016746 | |||
| 1929 | Ga0070659_100550665 | |||
| 1930 | Ga0070667_100002740 | |||
| 1931 | Ga0070667_100061608 | |||
| 1932 | Ga0070667_100210428 | |||
| 1933 | Ga0070667_100320517 | |||
| 1934 | Ga0070667_100484448 | |||
| 1935 | Ga0070703_10001755 | |||
| 1936 | Ga0070703_10028563 | |||
| 1937 | Ga0070703_10224050 | |||
| 1938 | Ga0070709_10029110 | |||
| 1939 | Ga0070709_10244548 | |||
| 1940 | Ga0070709_10345783 | |||
| 1941 | Ga0070709_10547385 | |||
| 1942 | Ga0070714_100037979 | |||
| 1943 | Ga0070714_100667227 | |||
| 1944 | Ga0070713_100000821 | |||
| 1945 | Ga0070713_100064624 | |||
| 1946 | Ga0070710_10070031 | |||
| 1947 | Ga0070710_10513903 | |||
| 1948 | Ga0070701_10136185 | |||
| 1949 | Ga0070711_100058787 | |||
| 1950 | Ga0070711_100081834 | |||
| 1951 | Ga0070711_100094047 | |||
| 1952 | Ga0070711_100096299 | |||
| 1953 | Ga0070711_100109994 | |||
| 1954 | Ga0070711_100210304 | |||
| 1955 | Ga0070705_100000482 | |||
| 1956 | Ga0070705_100001911 | |||
| 1957 | Ga0070705_100037527 | |||
| 1958 | Ga0070705_100039606 | |||
| 1959 | Ga0070705_100164198 | |||
| 1960 | Ga0070705_100328749 | |||
| 1961 | Ga0070700_100037506 | |||
| 1962 | Ga0070700_100067062 | |||
| 1963 | Ga0070700_100115743 | |||
| 1964 | Ga0070700_100239407 | |||
| 1965 | Ga0070694_100001027 | |||
| 1966 | Ga0070694_100016532 | |||
| 1967 | Ga0070694_100023169 | |||
| 1968 | Ga0070708_100204145 | |||
| 1969 | Ga0070708_100601211 | |||
| 1970 | Ga0070663_100005184 | |||
| 1971 | Ga0070663_100008291 | |||
| 1972 | Ga0070663_100044716 | |||
| 1973 | Ga0070663_100061385 | |||
| 1974 | Ga0070663_100091503 | |||
| 1975 | Ga0070663_100096361 | |||
| 1976 | Ga0070663_100530272 | |||
| 1977 | Ga0070663_100703660 | |||
| 1978 | Ga0070678_100023682 | |||
| 1979 | Ga0070678_100136161 | |||
| 1980 | Ga0070678_100407401 | |||
| 1981 | Ga0070662_100005649 | |||
| 1982 | Ga0070662_100401932 | |||
| 1983 | Ga0070681_10009623 | |||
| 1984 | Ga0070681_10054520 | |||
| 1985 | Ga0070681_10056304 | |||
| 1986 | Ga0070681_10107453 | |||
| 1987 | Ga0070681_10119937 | |||
| 1988 | Ga0070681_10286454 | |||
| 1989 | Ga0068867_100054354 | |||
| 1990 | Ga0068867_100388015 | |||
| 1991 | Ga0068867_100840375 | |||
| 1992 | Ga0070685_10012730 | |||
| 1993 | Ga0070685_10167378 | |||
| 1994 | Ga0070706_100694230 | |||
| 1995 | Ga0070707_100010698 | |||
| 1996 | Ga0070698_100051280 | |||
| 1997 | Ga0070698_100785038 | |||
| 1998 | Ga0070699_100000836 | |||
| 1999 | Ga0070699_100069742 | |||
| 2000 | Ga0070699_100094222 | |||
| 2001 | Ga0070699_100416437 | |||
| 2002 | Ga0070679_100015220 | |||
| 2003 | Ga0070679_100089644 | |||
| 2004 | Ga0070679_100097482 | |||
| 2005 | Ga0070684_100438273 | |||
| 2006 | Ga0070684_100970740 | |||
| 2007 | Ga0070697_100001866 | |||
| 2008 | Ga0070697_100014888 | |||
| 2009 | Ga0068853_100002253 | |||
| 2010 | Ga0068853_100006655 | |||
| 2011 | Ga0068853_100025202 | |||
| 2012 | Ga0068853_100061886 | |||
| 2013 | Ga0068853_100075662 | |||
| 2014 | Ga0068853_100224330 | |||
| 2015 | Ga0070672_100161402 | |||
| 2016 | Ga0070672_100551467 | |||
| 2017 | Ga0070686_100184664 | |||
| 2018 | Ga0070695_100000195 | |||
| 2019 | Ga0070695_100000581 | |||
| 2020 | Ga0070695_100007007 | |||
| 2021 | Ga0070695_100030874 | |||
| 2022 | Ga0070695_100065339 | |||
| 2023 | Ga0070695_100167265 | |||
| 2024 | Ga0070695_100320465 | |||
| 2025 | Ga0070696_100000690 | |||
| 2026 | Ga0070696_100001754 | |||
| 2027 | Ga0070696_100018247 | |||
| 2028 | Ga0070696_100123840 | |||
| 2029 | Ga0070693_100000914 | |||
| 2030 | Ga0070693_100027143 | |||
| 2031 | Ga0070693_100035966 | |||
| 2032 | Ga0070693_100037340 | |||
| 2033 | Ga0070693_100151406 | |||
| 2034 | Ga0070693_100169615 | |||
| 2035 | Ga0070693_100247245 | |||
| 2036 | Ga0070693_100404663 | |||
| 2037 | Ga0070665_100025273 | |||
| 2038 | Ga0070665_100043638 | |||
| 2039 | Ga0070665_100064156 | |||
| 2040 | Ga0070665_100070997 | |||
| 2041 | Ga0070665_100095473 | |||
| 2042 | Ga0070665_100128148 | |||
| 2043 | Ga0070665_100289108 | |||
| 2044 | Ga0070704_100002869 | |||
| 2045 | Ga0070704_100007305 | |||
| 2046 | Ga0070704_100029004 | |||
| 2047 | Ga0070704_100183282 | |||
| 2048 | Ga0070704_100378394 | |||
| 2049 | Ga0070704_100688333 | |||
| 2050 | Ga0068855_100072247 | |||
| 2051 | Ga0068855_100076455 | |||
| 2052 | Ga0068855_100255082 | |||
| 2053 | Ga0070664_100003236 | |||
| 2054 | Ga0070664_100701164 | |||
| 2055 | Ga0068857_100010632 | |||
| 2056 | Ga0068857_100013736 | |||
| 2057 | Ga0068857_100013738 | |||
| 2058 | Ga0068857_100062947 | |||
| 2059 | Ga0068857_100341791 | |||
| 2060 | Ga0068854_100004526 | |||
| 2061 | Ga0068854_100014363 | |||
| 2062 | Ga0068854_100843221 | |||
| 2063 | Ga0068856_100001161 | |||
| 2064 | Ga0068856_100059501 | |||
| 2065 | Ga0068856_100161708 | |||
| 2066 | Ga0068856_100447789 | |||
| 2067 | Ga0068856_100846745 | |||
| 2068 | Ga0070702_100012198 | |||
| 2069 | Ga0070702_100032394 | |||
| 2070 | Ga0070702_100082500 | |||
| 2071 | Ga0070702_100181582 | |||
| 2072 | Ga0070702_100182650 | |||
| 2073 | Ga0068852_100008313 | |||
| 2074 | Ga0068852_100018494 | |||
| 2075 | Ga0068852_100158335 | |||
| 2076 | Ga0068859_100000988 | |||
| 2077 | Ga0068859_100569234 | |||
| 2078 | Ga0068864_100026317 | |||
| 2079 | Ga0068864_100045147 | |||
| 2080 | Ga0068864_100620332 | |||
| 2081 | Ga0068866_10013292 | |||
| 2082 | Ga0068866_10209355 | |||
| 2083 | Ga0068866_10386259 | |||
| 2084 | Ga0068861_100001822 | |||
| 2085 | Ga0068861_100017951 | |||
| 2086 | Ga0068863_100004888 | |||
| 2087 | Ga0068863_100308348 | |||
| 2088 | Ga0068858_100030872 | |||
| 2089 | Ga0068858_100083031 | |||
| 2090 | Ga0068860_100000926 | |||
| 2091 | Ga0068860_100009033 | |||
| 2092 | Ga0068860_100068511 | |||
| 2093 | Ga0068860_100120631 | |||
| 2094 | Ga0068860_100307635 | |||
| 2095 | Ga0068862_100001945 | |||
| 2096 | Ga0068862_100017794 | |||
| 2097 | Ga0068862_100018580 | |||
| 2098 | Ga0068862_100039031 | |||
| 2099 | Ga0068862_100059776 | |||
| 2100 | Ga0068862_100087797 | |||
| 2101 | Ga0068862_100307291 | |||
| 2102 | Ga0068862_100323811 | |||
| 2103 | Ga0068862_100524184 | |||
| 2104 | Ga0081455_10000206 | |||
| 2105 | Ga0081455_10002195 | |||
| 2106 | Ga0081455_10005107 | |||
| 2107 | Ga0081455_10017029 | |||
| 2108 | Ga0081455_10105529 | |||
| 2109 | Ga0081455_10134987 | |||
| 2110 | Ga0081455_10145278 | |||
| 2111 | Ga0081540_1000056 | |||
| 2112 | Ga0081540_1000084 | |||
| 2113 | Ga0081540_1001770 | |||
| 2114 | Ga0081540_1099107 | |||
| 2115 | Ga0081539_10000054 | |||
| 2116 | Ga0081539_10006565 | |||
| 2117 | Ga0081539_10165130 | |||
| 2118 | Ga0075365_10007267 | |||
| 2119 | Ga0075365_10088030 | |||
| 2120 | Ga0075368_10000337 | |||
| 2121 | Ga0075368_10004593 | |||
| 2122 | Ga0075368_10013623 | |||
| 2123 | Ga0075368_10021504 | |||
| 2124 | Ga0075363_100011887 | |||
| 2125 | Ga0075363_100014188 | |||
| 2126 | Ga0075363_100018851 | |||
| 2127 | Ga0075363_100029503 | |||
| 2128 | Ga0075363_100143314 | |||
| 2129 | Ga0075364_10002122 | |||
| 2130 | Ga0075364_10007755 | |||
| 2131 | Ga0075364_10295816 | |||
| 2132 | Ga0070715_10104527 | |||
| 2133 | Ga0070716_100008734 | |||
| 2134 | Ga0070716_100042581 | |||
| 2135 | Ga0070712_100001926 | |||
| 2136 | Ga0070712_100006320 | |||
| 2137 | Ga0075362_10003670 | |||
| 2138 | Ga0075362_10071447 | |||
| 2139 | Ga0075362_10074486 | |||
| 2140 | Ga0075367_10000532 | |||
| 2141 | Ga0075367_10017857 | |||
| 2142 | Ga0075367_10052250 | |||
| 2143 | Ga0075367_10169171 | |||
| 2144 | Ga0075367_10191110 | |||
| 2145 | Ga0075367_10194115 | |||
| 2146 | Ga0075367_10410518 | |||
| 2147 | Ga0075369_10079339 | |||
| 2148 | Ga0075369_10095657 | |||
| 2149 | Ga0075366_10081004 | |||
| 2150 | Ga0075366_10100388 | |||
| 2151 | Ga0097621_100008311 | |||
| 2152 | Ga0097621_100031965 | |||
| 2153 | Ga0097621_100549461 | |||
| 2154 | Ga0097621_100842667 | |||
| 2155 | Ga0075370_10076573 | |||
| 2156 | Ga0075370_10142857 | |||
| 2157 | Ga0068871_100014662 | |||
| 2158 | Ga0068871_100083151 | |||
| 2159 | Ga0075428_100050334 | |||
| 2160 | Ga0075428_100100614 | |||
| 2161 | Ga0075430_100031495 | |||
| 2162 | Ga0075430_100080919 | |||
| 2163 | Ga0075430_100265378 | |||
| 2164 | Ga0075430_100628550 | |||
| 2165 | Ga0075431_100002538 | |||
| 2166 | Ga0075431_100094545 | |||
| 2167 | Ga0075431_100254902 | |||
| 2168 | Ga0075431_100441702 | |||
| 2169 | Ga0075433_10001745 | |||
| 2170 | Ga0075433_10005400 | |||
| 2171 | Ga0075433_10598806 | |||
| 2172 | Ga0075434_100004864 | |||
| 2173 | Ga0075434_100028601 | |||
| 2174 | Ga0075434_100343182 | |||
| 2175 | Ga0075429_100037548 | |||
| 2176 | Ga0075429_100060402 | |||
| 2177 | Ga0075429_100131565 | |||
| 2178 | Ga0068865_100003035 | |||
| 2179 | Ga0068865_100017196 | |||
| 2180 | Ga0068865_100299399 | |||
| 2181 | Ga0075436_100014618 | |||
| 2182 | Ga0075436_100038092 | |||
| 2183 | Ga0075436_100044658 | |||
| 2184 | Ga0075436_100116338 | |||
| 2185 | Ga0097620_100000988 | |||
| 2186 | Ga0097620_100569165 | |||
| 2187 | Ga0075435_100010519 | |||
| 2188 | Ga0075435_100037487 | |||
| 2189 | Ga0075435_100052443 | |||
| 2190 | Ga0075435_100123380 | |||
| 2191 | Ga0075435_100281103 | |||
| 2192 | Ga0099795_10014807 | |||
| 2193 | Ga0105244_10144043 | |||
| 2194 | Ga0105244_10220680 | |||
| 2195 | Ga0105250_10077450 | |||
| 2196 | Ga0105240_10073694 | |||
| 2197 | Ga0105240_10183491 | |||
| 2198 | Ga0105240_10205833 | |||
| 2199 | Ga0105240_10310807 | |||
| 2200 | Ga0105240_10482260 | |||
| 2201 | Ga0105240_10547464 | |||
| 2202 | Ga0105240_11176739 | |||
| 2203 | Ga0111539_10012221 | |||
| 2204 | Ga0111539_10017956 | |||
| 2205 | Ga0111539_10063889 | |||
| 2206 | Ga0111539_10281772 | |||
| 2207 | Ga0111539_10711556 | |||
| 2208 | Ga0111539_11336403 | |||
| 2209 | Ga0105245_10011237 | |||
| 2210 | Ga0105245_10132988 | |||
| 2211 | Ga0105245_10175078 | |||
| 2212 | Ga0105245_10290079 | |||
| 2213 | Ga0105247_10000737 | |||
| 2214 | Ga0105247_10001368 | |||
| 2215 | Ga0105247_10234964 | |||
| 2216 | Ga0105247_10262609 | |||
| 2217 | Ga0105247_10706670 | |||
| 2218 | Ga0114129_10051143 | |||
| 2219 | Ga0114129_10122419 | |||
| 2220 | Ga0114129_10197230 | |||
| 2221 | Ga0114129_10242123 | |||
| 2222 | Ga0114129_10394526 | |||
| 2223 | Ga0114129_10404709 | |||
| 2224 | Ga0114129_10407325 | |||
| 2225 | Ga0105243_10029787 | |||
| 2226 | Ga0105243_10085833 | |||
| 2227 | Ga0105243_10088324 | |||
| 2228 | Ga0105243_10100798 | |||
| 2229 | Ga0105243_10682441 | |||
| 2230 | Ga0105243_11345118 | |||
| 2231 | Ga0105241_10002335 | |||
| 2232 | Ga0105241_10014047 | |||
| 2233 | Ga0105241_10016188 | |||
| 2234 | Ga0105241_10024062 | |||
| 2235 | Ga0105241_10041637 | |||
| 2236 | Ga0105241_10180978 | |||
| 2237 | Ga0105242_10012128 | |||
| 2238 | Ga0105242_10018436 | |||
| 2239 | Ga0105242_10638387 | |||
| 2240 | Ga0105242_10771680 | |||
| 2241 | Ga0105242_11097111 | |||
| 2242 | Ga0105242_11219632 | |||
| 2243 | Ga0105248_10108818 | |||
| 2244 | Ga0105248_10442555 | |||
| 2245 | Ga0105248_10601915 | |||
| 2246 | Ga0105248_11373771 | |||
| 2247 | Ga0105237_10003028 | |||
| 2248 | Ga0105237_10006900 | |||
| 2249 | Ga0105237_10071221 | |||
| 2250 | Ga0105237_10092975 | |||
| 2251 | Ga0105237_10380971 | |||
| 2252 | Ga0105237_10558912 | |||
| 2253 | Ga0105237_10629162 | |||
| 2254 | Ga0105238_10017449 | |||
| 2255 | Ga0105238_10026969 | |||
| 2256 | Ga0105238_10050679 | |||
| 2257 | Ga0105238_10053343 | |||
| 2258 | Ga0105238_10428381 | |||
| 2259 | Ga0105238_10900454 | |||
| 2260 | Ga0105249_10000531 | |||
| 2261 | Ga0105249_10008319 | |||
| 2262 | Ga0105249_10070606 | |||
| 2263 | Ga0105249_10107309 | |||
| 2264 | Ga0105249_10166990 | |||
| 2265 | Ga0105249_10333549 | |||
| 2266 | Ga0105249_10370752 | |||
| 2267 | Ga0105249_10752003 | |||
| 2268 | Ga0105249_10772019 | |||
| 2269 | Ga0099796_10002097 | |||
| 2270 | Ga0105239_10010524 | |||
| 2271 | Ga0105239_10030053 | |||
| 2272 | Ga0105239_10067664 | |||
| 2273 | Ga0105239_10168067 | |||
| 2274 | Ga0105239_10937793 | |||
| 2275 | Ga0105246_10015297 | |||
| 2276 | Ga0105246_10024383 | |||
| 2277 | Ga0105246_10095782 | |||
| 2278 | Ga0105246_10164786 | |||
| 2279 | Ga0105246_10215498 | |||
| 2280 | Ga0105246_10986868 | |||
| 2281 | Ga0157373_10064010 | |||
| 2282 | Ga0157373_10102109 | |||
| 2283 | Ga0157371_10024584 | |||
| 2284 | Ga0157370_10019510 | |||
| 2285 | Ga0157370_10019637 | |||
| 2286 | Ga0157370_10110620 | |||
| 2287 | Ga0157370_10132278 | |||
| 2288 | Ga0157370_10395219 | |||
| 2289 | Ga0157370_10893728 | |||
| 2290 | Ga0157369_10001030 | |||
| 2291 | Ga0157369_10093483 | |||
| 2292 | Ga0157369_10146006 | |||
| 2293 | Ga0157369_10185997 | |||
| 2294 | Ga0157369_10696279 | |||
| 2295 | Ga0157374_10175222 | |||
| 2296 | Ga0157374_10230288 | |||
| 2297 | Ga0157374_10391418 | |||
| 2298 | Ga0157378_10043214 | |||
| 2299 | Ga0157378_10231402 | |||
| 2300 | Ga0157378_10622154 | |||
| 2301 | Ga0163162_10054728 | |||
| 2302 | Ga0163162_10082841 | |||
| 2303 | Ga0163162_10117746 | |||
| 2304 | Ga0163162_10750552 | |||
| 2305 | Ga0157372_10026742 | |||
| 2306 | Ga0157372_10109363 | |||
| 2307 | Ga0157372_10135005 | |||
| 2308 | Ga0157372_10191024 | |||
| 2309 | Ga0157372_10991994 | |||
| 2310 | Ga0157372_11213938 | |||
| 2311 | Ga0157375_10001988 | |||
| 2312 | Ga0157375_10008047 | |||
| 2313 | Ga0157375_10143231 | |||
| 2314 | Ga0157375_10189394 | |||
| 2315 | Ga0157375_10976955 | |||
| 2316 | Ga0163163_10097157 | |||
| 2317 | Ga0163163_10365068 | |||
| 2318 | Ga0163163_10416832 | |||
| 2319 | Ga0163163_10459326 | |||
| 2320 | Ga0163163_10646252 | |||
| 2321 | Ga0163163_11283878 | |||
| 2322 | Ga0157380_10405808 | |||
| 2323 | Ga0157380_10504078 | |||
| 2324 | Ga0157380_10716256 | |||
| 2325 | Ga0182008_10054407 | |||
| 2326 | Ga0157377_10025352 | |||
| 2327 | Ga0157379_10000749 | |||
| 2328 | Ga0157379_10016989 | |||
| 2329 | Ga0157379_10075923 | |||
| 2330 | Ga0157379_10133417 | |||
| 2331 | Ga0157379_10290156 | |||
| 2332 | Ga0157379_10361360 | |||
| 2333 | Ga0157379_10734299 | |||
| 2334 | Ga0157376_10003317 | |||
| 2335 | Ga0157376_10399975 | |||
| 2336 | Ga0182007_10035490 | |||
| 2337 | Ga0182007_10052757 | |||
| 2338 | Ga0182005_1092467 | |||
| 2339 | Ga0183360_11619 | |||
| 2340 | Ga0163161_10003533 | |||
| 2341 | Ga0163161_10025367 | |||
| 2342 | Ga0163161_10084722 | |||
| 2343 | Ga0163161_10264032 | |||
| 2344 | Ga0163161_10741409 | |||
| 2345 | Ga0206355_1642619 | |||
| 2346 | Ga0214544_1000020 | |||
| 2347 | Ga0214542_1000024 | |||
| 2348 | Ga0214545_1000011 | |||
| 2349 | Ga0214543_1000033 | |||
| 2350 | Ga0213872_10000436 | |||
| 2351 | Ga0213872_10001037 | |||
| 2352 | Ga0213872_10001313 | |||
| 2353 | Ga0213872_10026558 | |||
| 2354 | Ga0213872_10056877 | |||
| 2355 | Ga0213876_10009498 | |||
| 2356 | Ga0213871_10081219 | |||
| 2357 | Ga0224712_10238004 | |||
| 2358 | Ga0209563_101494 | |||
| 2359 | Ga0209646_1012674 | |||
| 2360 | Ga0209026_1000002 | |||
| 2361 | Ga0209026_1029710 | |||
| 2362 | Ga0209677_102419 | |||
| 2363 | Ga0209148_1000038 | |||
| 2364 | Ga0209759_1000062 | |||
| 2365 | Ga0209233_1000027 | |||
| 2366 | Ga0209233_1000421 | |||
| 2367 | Ga0209455_1000068 | |||
| 2368 | Ga0209676_1000082 | |||
| 2369 | Ga0209758_1000407 | |||
| 2370 | Ga0209758_1000648 | |||
| 2371 | Ga0209758_1000900 | |||
| 2372 | Ga0209758_1000952 | |||
| 2373 | Ga0209758_1005567 | |||
| 2374 | Ga0209758_1029931 | |||
| 2375 | Ga0209256_1011331 | |||
| 2376 | Ga0207426_1000466 | |||
| 2377 | Ga0207426_1049518 | |||
| 2378 | Ga0209257_1000453 | |||
| 2379 | Ga0209257_1000459 | |||
| 2380 | Ga0209257_1001445 | |||
| 2381 | Ga0207697_10063726 | |||
| 2382 | Ga0207697_10200825 | |||
| 2383 | Ga0207656_10008565 | |||
| 2384 | Ga0207696_1074805 | |||
| 2385 | Ga0207653_10001588 | |||
| 2386 | Ga0207653_10233721 | |||
| 2387 | Ga0207692_10055751 | |||
| 2388 | Ga0207692_10318999 | |||
| 2389 | Ga0207642_10029261 | |||
| 2390 | Ga0207642_10437371 | |||
| 2391 | Ga0207710_10013792 | |||
| 2392 | Ga0207688_10273069 | |||
| 2393 | Ga0207680_10030082 | |||
| 2394 | Ga0207647_10004130 | |||
| 2395 | Ga0207647_10007855 | |||
| 2396 | Ga0207647_10026597 | |||
| 2397 | Ga0207647_10043340 | |||
| 2398 | Ga0207647_10081984 | |||
| 2399 | Ga0207647_10208481 | |||
| 2400 | Ga0207685_10007736 | |||
| 2401 | Ga0207685_10085006 | |||
| 2402 | Ga0207685_10115392 | |||
| 2403 | Ga0207699_10000247 | |||
| 2404 | Ga0207699_10006459 | |||
| 2405 | Ga0207699_10020990 | |||
| 2406 | Ga0207699_10037459 | |||
| 2407 | Ga0207645_10018132 | |||
| 2408 | Ga0207645_10046403 | |||
| 2409 | Ga0207645_10372579 | |||
| 2410 | Ga0207705_10085846 | |||
| 2411 | Ga0207705_10108390 | |||
| 2412 | Ga0207705_10220589 | |||
| 2413 | Ga0207705_10235580 | |||
| 2414 | Ga0207654_10028657 | |||
| 2415 | Ga0207654_10032030 | |||
| 2416 | Ga0207707_10056300 | |||
| 2417 | Ga0207707_10111346 | |||
| 2418 | Ga0207707_10154670 | |||
| 2419 | Ga0207707_10171728 | |||
| 2420 | Ga0207707_10232803 | |||
| 2421 | Ga0207707_10546335 | |||
| 2422 | Ga0207695_10080996 | |||
| 2423 | Ga0207695_10137937 | |||
| 2424 | Ga0207695_10266602 | |||
| 2425 | Ga0207695_10359508 | |||
| 2426 | Ga0207671_10001115 | |||
| 2427 | Ga0207671_10028628 | |||
| 2428 | Ga0207671_10033498 | |||
| 2429 | Ga0207671_10098471 | |||
| 2430 | Ga0207671_10116914 | |||
| 2431 | Ga0207671_10157615 | |||
| 2432 | Ga0207671_10447878 | |||
| 2433 | Ga0207693_10000452 | |||
| 2434 | Ga0207693_10010567 | |||
| 2435 | Ga0207693_10328403 | |||
| 2436 | Ga0207663_10024121 | |||
| 2437 | Ga0207663_10049118 | |||
| 2438 | Ga0207663_10070876 | |||
| 2439 | Ga0207660_10067495 | |||
| 2440 | Ga0207660_10258532 | |||
| 2441 | Ga0207662_10002336 | |||
| 2442 | Ga0207657_10000216 | |||
| 2443 | Ga0207657_10007456 | |||
| 2444 | Ga0207657_10114352 | |||
| 2445 | Ga0207657_10182122 | |||
| 2446 | Ga0207649_10000746 | |||
| 2447 | Ga0207649_10003062 | |||
| 2448 | Ga0207649_10103220 | |||
| 2449 | Ga0207649_10594945 | |||
| 2450 | Ga0207652_10011743 | |||
| 2451 | Ga0207652_10096405 | |||
| 2452 | Ga0207646_10017030 | |||
| 2453 | Ga0207681_10008312 | |||
| 2454 | Ga0207681_10401768 | |||
| 2455 | Ga0207681_10487979 | |||
| 2456 | Ga0207694_10013968 | |||
| 2457 | Ga0207694_10053540 | |||
| 2458 | Ga0207694_10074985 | |||
| 2459 | Ga0207694_10370236 | |||
| 2460 | Ga0207694_10410411 | |||
| 2461 | Ga0207650_10029186 | |||
| 2462 | Ga0207650_10377393 | |||
| 2463 | Ga0207659_10186178 | |||
| 2464 | Ga0207659_10204786 | |||
| 2465 | Ga0207659_10304953 | |||
| 2466 | Ga0207659_10378426 | |||
| 2467 | Ga0207687_10073987 | |||
| 2468 | Ga0207687_10373717 | |||
| 2469 | Ga0207687_10585649 | |||
| 2470 | Ga0207700_10000005 | |||
| 2471 | Ga0207700_10858763 | |||
| 2472 | Ga0207664_10029550 | |||
| 2473 | Ga0207664_10067335 | |||
| 2474 | Ga0207664_10385348 | |||
| 2475 | Ga0207664_10659262 | |||
| 2476 | Ga0207664_11151621 | |||
| 2477 | Ga0207644_10048242 | |||
| 2478 | Ga0207644_10654242 | |||
| 2479 | Ga0207690_10020548 | |||
| 2480 | Ga0207690_10044955 | |||
| 2481 | Ga0207706_10004343 | |||
| 2482 | Ga0207706_10023201 | |||
| 2483 | Ga0207706_10193087 | |||
| 2484 | Ga0207706_10326748 | |||
| 2485 | Ga0207686_10009840 | |||
| 2486 | Ga0207686_10287222 | |||
| 2487 | Ga0207686_10559218 | |||
| 2488 | Ga0207709_10061448 | |||
| 2489 | Ga0207709_10166159 | |||
| 2490 | Ga0207709_10343431 | |||
| 2491 | Ga0207709_10764232 | |||
| 2492 | Ga0207670_10013288 | |||
| 2493 | Ga0207670_10085302 | |||
| 2494 | Ga0207670_10984073 | |||
| 2495 | Ga0207669_10006682 | |||
| 2496 | Ga0207669_10094332 | |||
| 2497 | Ga0207704_10002567 | |||
| 2498 | Ga0207704_10020922 | |||
| 2499 | Ga0207704_10480338 | |||
| 2500 | Ga0207665_10000221 | |||
| 2501 | Ga0207665_10074793 | |||
| 2502 | Ga0207691_10005941 | |||
| 2503 | Ga0207691_10216278 | |||
| 2504 | Ga0207711_10064180 | |||
| 2505 | Ga0207689_10036092 | |||
| 2506 | Ga0207689_10160394 | |||
| 2507 | Ga0207689_10166143 | |||
| 2508 | Ga0207689_10394632 | |||
| 2509 | Ga0207679_10013396 | |||
| 2510 | Ga0207667_10093222 | |||
| 2511 | Ga0207667_10186802 | |||
| 2512 | Ga0207667_10200984 | |||
| 2513 | Ga0207667_10211185 | |||
| 2514 | Ga0207667_10559828 | |||
| 2515 | Ga0207667_10593846 | |||
| 2516 | Ga0207651_10002858 | |||
| 2517 | Ga0207712_10005342 | |||
| 2518 | Ga0207712_10024603 | |||
| 2519 | Ga0207712_10063511 | |||
| 2520 | Ga0207712_10108912 | |||
| 2521 | Ga0207712_10195529 | |||
| 2522 | Ga0207712_10219331 | |||
| 2523 | Ga0207712_10304584 | |||
| 2524 | Ga0207712_10773934 | |||
| 2525 | Ga0207668_10013005 | |||
| 2526 | Ga0207668_10057577 | |||
| 2527 | Ga0207668_10082339 | |||
| 2528 | Ga0207668_10173086 | |||
| 2529 | Ga0207668_10230094 | |||
| 2530 | Ga0207668_10760481 | |||
| 2531 | Ga0207640_10006200 | |||
| 2532 | Ga0207640_10424385 | |||
| 2533 | Ga0207658_10119156 | |||
| 2534 | Ga0207658_10246838 | |||
| 2535 | Ga0207658_10287354 | |||
| 2536 | Ga0207658_10455791 | |||
| 2537 | Ga0207658_10575822 | |||
| 2538 | Ga0207677_10100552 | |||
| 2539 | Ga0207677_10109511 | |||
| 2540 | Ga0207703_10011279 | |||
| 2541 | Ga0207703_10077424 | |||
| 2542 | Ga0207703_10084220 | |||
| 2543 | Ga0207703_10152980 | |||
| 2544 | Ga0207703_10239751 | |||
| 2545 | Ga0207703_10555384 | |||
| 2546 | Ga0207639_10002485 | |||
| 2547 | Ga0207639_10004167 | |||
| 2548 | Ga0207639_10004947 | |||
| 2549 | Ga0207639_10313166 | |||
| 2550 | Ga0207639_10341915 | |||
| 2551 | Ga0207639_10376317 | |||
| 2552 | Ga0207639_11272816 | |||
| 2553 | Ga0207678_10000074 | |||
| 2554 | Ga0207678_10009216 | |||
| 2555 | Ga0207678_10010215 | |||
| 2556 | Ga0207678_10017036 | |||
| 2557 | Ga0207678_10104636 | |||
| 2558 | Ga0207678_10131972 | |||
| 2559 | Ga0207678_10161833 | |||
| 2560 | Ga0207678_10175750 | |||
| 2561 | Ga0207678_10694159 | |||
| 2562 | Ga0207678_10695720 | |||
| 2563 | Ga0207678_11032402 | |||
| 2564 | Ga0207708_10002195 | |||
| 2565 | Ga0207708_10002674 | |||
| 2566 | Ga0207708_10144281 | |||
| 2567 | Ga0207708_10185551 | |||
| 2568 | Ga0207702_10000159 | |||
| 2569 | Ga0207702_10151474 | |||
| 2570 | Ga0207702_10235157 | |||
| 2571 | Ga0207702_10278184 | |||
| 2572 | Ga0207702_10757700 | |||
| 2573 | Ga0207641_10033600 | |||
| 2574 | Ga0207641_10268125 | |||
| 2575 | Ga0207648_10083551 | |||
| 2576 | Ga0207648_10100658 | |||
| 2577 | Ga0207648_10115039 | |||
| 2578 | Ga0207648_10124445 | |||
| 2579 | Ga0207648_10361362 | |||
| 2580 | Ga0207676_10039841 | |||
| 2581 | Ga0207676_10149585 | |||
| 2582 | Ga0207674_10000335 | |||
| 2583 | Ga0207674_10015555 | |||
| 2584 | Ga0207674_10023181 | |||
| 2585 | Ga0207674_10120421 | |||
| 2586 | Ga0207674_10613208 | |||
| 2587 | Ga0207675_100000039 | |||
| 2588 | Ga0207675_100053803 | |||
| 2589 | Ga0207675_100274569 | |||
| 2590 | Ga0207683_10000595 | |||
| 2591 | Ga0207683_10073841 | |||
| 2592 | Ga0207683_10080590 | |||
| 2593 | Ga0207683_10169014 | |||
| 2594 | Ga0207698_10034219 | |||
| 2595 | Ga0207698_10470470 | |||
| 2596 | Ga0207698_11452894 | |||
| 2597 | Ga0209389_1000011 | |||
| 2598 | Ga0209389_1000025 | |||
| 2599 | Ga0209589_1000018 | |||
| 2600 | Ga0209589_1000066 | |||
| 2601 | Ga0209489_100017 | |||
| 2602 | Ga0209489_100026 | |||
| 2603 | Ga0209489_100030 | |||
| 2604 | Ga0209700_100027 | |||
| 2605 | Ga0209700_100035 | |||
| 2606 | Ga0209179_1005602 | |||
| 2607 | Ga0209813_10000760 | |||
| 2608 | Ga0209813_10005375 | |||
| 2609 | Ga0209813_10044758 | |||
| 2610 | Ga0209813_10059953 | |||
| 2611 | Ga0209974_10087936 | |||
| 2612 | Ga0207428_10008033 | |||
| 2613 | Ga0207428_10043605 | |||
| 2614 | Ga0207428_10078442 | |||
| 2615 | Ga0207428_10172000 | |||
| 2616 | Ga0207428_10195403 | |||
| 2617 | Ga0207428_10666539 | |||
| 2618 | Ga0268266_10000873 | |||
| 2619 | Ga0268266_10087621 | |||
| 2620 | Ga0268266_10129837 | |||
| 2621 | Ga0268266_10238915 | |||
| 2622 | Ga0268265_10001274 | |||
| 2623 | Ga0268265_10031136 | |||
| 2624 | Ga0268265_10085096 | |||
| 2625 | Ga0268265_10298580 | |||
| 2626 | Ga0268265_10363619 | |||
| 2627 | Ga0268265_11128615 | |||
| 2628 | Ga0268264_10005176 | |||
| 2629 | Ga0268264_10021651 | |||
| 2630 | Ga0268264_10024677 | |||
| 2631 | Ga0268264_10101089 | |||
| 2632 | Ga0268264_10316793 | |||
| 2633 | Ga0268264_10607753 | |||
| 2634 | Ga0265318_10037477 | |||
| 2635 | Ga0265318_10163334 | |||
| 2636 | Ga0307517_10175344 | |||
| 2637 | Ga0307515_10298722 | |||
| 2638 | Ga0265324_10003033 | |||
| 2639 | Ga0265328_10006595 | |||
| 2640 | Ga0265328_10022262 | |||
| 2641 | Ga0265320_10002231 | |||
| 2642 | Ga0265325_10049914 | |||
| 2643 | Ga0265340_10001518 | |||
| 2644 | Ga0265340_10075342 | |||
| 2645 | Ga0265340_10091620 | |||
| 2646 | Ga0265340_10119958 | |||
| 2647 | Ga0265339_10096644 | |||
| 2648 | Ga0265331_10000002 | |||
| 2649 | Ga0265331_10000017 | |||
| 2650 | Ga0265331_10000314 | |||
| 2651 | Ga0265331_10000478 | |||
| 2652 | Ga0265331_10009324 | |||
| 2653 | Ga0265331_10016612 | |||
| 2654 | Ga0265331_10162272 | |||
| 2655 | Ga0265331_10191643 | |||
| 2656 | Ga0265327_10000033 | |||
| 2657 | Ga0265316_10005893 | |||
| 2658 | Ga0265316_10017819 | |||
| 2659 | Ga0265316_10143150 | |||
| 2660 | Ga0307513_10025773 | |||
| 2661 | Ga0307513_10343306 | |||
| 2662 | Ga0307509_10524222 | |||
| 2663 | Ga0307408_100316171 | |||
| 2664 | Ga0265313_10002202 | |||
| 2665 | Ga0265314_10018836 | |||
| 2666 | Ga0265314_10039537 | |||
| 2667 | Ga0265314_10047684 | |||
| 2668 | Ga0265314_10165830 | |||
| 2669 | Ga0265342_10006480 | |||
| 2670 | Ga0307516_10059535 | |||
| 2671 | Ga0307413_10123279 | |||
| 2672 | Ga0307410_10847323 | |||
| 2673 | Ga0307406_10000774 | |||
| 2674 | Ga0307406_10481156 | |||
| 2675 | Ga0307406_10665748 | |||
| 2676 | Ga0307412_10003682 | |||
| 2677 | Ga0307412_10120408 | |||
| 2678 | Ga0307412_10632544 | |||
| 2679 | Ga0307409_100122190 | |||
| 2680 | Ga0307409_100402903 | |||
| 2681 | Ga0307409_100613668 | |||
| 2682 | Ga0307409_100933318 | |||
| 2683 | Ga0307416_101678955 | |||
| 2684 | Ga0307414_10014861 | |||
| 2685 | Ga0307414_10136883 | |||
| 2686 | Ga0307414_10158594 | |||
| 2687 | Ga0307414_10276399 | |||
| 2688 | Ga0307414_10449737 | |||
| 2689 | Ga0307411_10187376 | |||
| 2690 | Ga0307411_10621267 | |||
| 2691 | Ga0307415_101269811 | |||
| 2692 | Ga0316583_10025586 | |||
| 2693 | Ga0316585_10018624 | |||
| 2694 | Ga0316593_10027378 | |||
| 2695 | Ga0316593_10197251 | |||
| 2696 | Ga0307510_10010422 | |||
| 2697 | Ga0307510_10081949 | |||
| 2698 | Ga0307510_10190048 | |||
| 2699 | Ga0307510_10292534 | |||
| 2700 | Ga0316592_1022506 | |||
| 2701 | Ga0316592_1042795 | |||
| 2702 | Ga0316586_1006026 | |||
| 2703 | Ga0316588_1017308 | |||
| 2704 | Ga0316587_1051103 | |||
| 2705 | Ga0316596_1027015 | |||
| 2706 | Ga0373928_0039814 | |||
| 2707 | Ga0373940_0124594 | |||
| 2708 | Ga0373949_0003058 | |||
| 2709 | Ga0373949_0036948 | |||
| 2710 | Ga0373939_0005251 | |||
| 2711 | Ga0373939_0007825 | |||
| 2712 | Ga0373939_0084871 | |||
| 2713 | Ga0373941_0010797 | |||
| 2714 | Ga0373941_0220077 | |||
| 2715 | Ga0373953_0120779 | |||
| 2716 | Ga0373954_0047670 | |||
| 2717 | Ga0373954_0207274 | |||
| 2718 | Ga0373956_0023275 | |||
| 2719 | Ga0373957_0181984 | |||
| 2720 | Ga0373960_0007243 | |||
| 2721 | Ga0373960_0013830 | |||
| 2722 | Ga0373960_0069484 | |||
| 2723 | Ga0373960_0073403 | |||
| 2724 | Ga0373943_0108265 | |||
| 2725 | Ga0373955_0038963 | |||
| 2726 | Ga0373942_0009911 | |||
| 2727 | Ga0373942_0021023 | |||
| 2728 | Ga0373961_0010094 | |||
| 2729 | Ga0373961_0066618 | |||
| 2730 | Ga0373961_0071723 | |||
| 2731 | Ga0373962_0001511 | |||
| 2732 | Ga0373931_0001319 | |||
| 2733 | Ga0373931_0004510 | |||
| 2734 | Ga0373931_0020752 | |||
| 2735 | Ga0373931_0167002 | |||
| 2736 | Ga0373931_0214314 | |||
| 2737 | Ga0373935_0001191 | |||
| 2738 | Ga0373935_0012370 | |||
| 2739 | Ga0373935_0349075 | |||
| 2740 | Ga0373927_0011783 | |||
| 2741 | Ga0373927_0197512 | |||
| 2742 | Ga0373927_0251341 | |||
| 2743 | Ga0373947_0067957 | |||
| 2744 | Ga0373947_0472092 | |||
| 2745 | Ga0373937_0044626 | |||
| 2746 | Ga0373937_0096130 | |||
| 2747 | Ga0373937_0345739 | |||
| 2748 | Ga0316582_0232890 | |||
| 2749 | Ga0316584_0061029 | |||
| 2750 | Ga0373925_0016064 | |||
| 2751 | Ga0373925_0023175 | |||
| 2752 | Ga0395899_0000059 | |||
| 2753 | Ga0395899_0004247 | |||
| 2754 | Ga0395899_0406994 | |||
| 2755 | Ga0395899_0506796 | |||
| 2756 | Ga0395900_0000017 | |||
| 2757 | Ga0395900_0017966 | |||
| 2758 | Ga0395900_0043669 | |||
| 2759 | Ga0395900_0052008 | |||
| 2760 | Ga0395900_0249169 | |||
| 2761 | Ga0395900_0319674 | |||
| 2762 | Ga0395898_0000030 | |||
| 2763 | Ga0395898_0182998 | |||
| 2764 | Ga0395898_0252953 | |||
| 2765 | Ga0395898_0266730 | |||
| 2766 | Ga0395905_0000056 | |||
| 2767 | Ga0395905_0000155 | |||
| 2768 | Ga0395905_0003237 | |||
| 2769 | Ga0395905_0015966 | |||
| 2770 | Ga0395905_0259806 | |||
| 2771 | Ga0316581_0019637 | |||
| 2772 | Ga0436364_0560002 | |||
| 2773 | Ga0436364_1552215 | |||
| 2774 | Ga0395901_0000015 | |||
| 2775 | Ga0395901_0006827 | |||
| 2776 | Ga0395901_0046022 | |||
| 2777 | Ga0395901_0109187 | |||
| 2778 | Ga0395901_0250125 | |||
| 2779 | Ga0395901_0330958 | |||
| 2780 | Ga0395901_0437297 | |||
| 2781 | Ga0436365_0093392 | |||
| 2782 | Ga0436365_0226250 | |||
| 2783 | Ga0436365_0650967 | |||
| 2784 | Ga0436365_0761391 | |||
| 2785 | Ga0436365_1477315 | |||
| 2786 | Ga0436360_0445476 | |||
| 2787 | Ga0436360_0815295 | |||
| 2788 | Ga0436360_0912999 | |||
| 2789 | Ga0436360_0931197 | |||
| 2790 | Ga0436360_1214702 | |||
| 2791 | Ga0436361_0112287 | |||
| 2792 | Ga0436361_0301054 | |||
| 2793 | Ga0436361_0325755 | |||
| 2794 | Ga0436361_0578839 | |||
| 2795 | Ga0436361_0833838 | |||
| 2796 | Ga0436363_1420920 | |||
| 2797 | Ga0436362_0171928 | |||
| 2798 | Ga0436362_0528243 | |||
| 2799 | Ga0439438_063402 | |||
| 2800 | Ga0439453_0023489 | |||
| 2801 | Ga0451789_0454652 | |||
| 2802 | Ga0451797_0027779 | |||
| 2803 | Ga0451807_2375559 | |||
| 2804 | Ga0451853_3496765 | |||
| 2805 | Ga0439445_0067478 | |||
| 2806 | Ga0439448_0011064 | |||
| 2807 | Ga0450900_046263 | |||
| 2808 | Ga0439459_0077406 | |||
| 2809 | Ga0450893_0012777 | |||
| 2810 | Ga0450901_005797 | |||
| 2811 | Ga0451577_0289675 | |||
| 2812 | Ga0439440_0050739 | |||
| 2813 | Ga0466969_0000296 | |||
| 2814 | Ga0466972_0000261 | |||
| 2815 | Ga0466972_0011899 | |||
| 2816 | Ga0466965_0052182 | |||
| 2817 | Ga0466966_0000163 | |||
| 2818 | Ga0466961_0014752 | |||
| 2819 | Ga0466961_0147439 | |||
| 2820 | Ga0466963_0027220 | |||
| 2821 | Ga0466963_0387747 | |||
| 2822 | Ga0453684_0012729 | |||
| 2823 | Ga0453684_0037239 | |||
| 2824 | Ga0453684_0076864 | |||
| 2825 | Ga0453684_0363809 | |||
| 2826 | Ga0466971_0001744 | |||
| 2827 | Ga0466971_0093306 | |||
| 2828 | Ga0466970_0005908 | |||
| 2829 | Ga0466957_0015256 | |||
| 2830 | Ga0466957_0052318 | |||
| 2831 | Ga0466957_0066260 | |||
| 2832 | Ga0466957_0384168 | |||
| 2833 | Ga0466960_0039510 | |||
| 2834 | Ga0466959_0000071 | |||
| 2835 | Ga0466959_0025270 | |||
| 2836 | Ga0451576_0000040 | |||
| 2837 | Ga0451576_0008100 | |||
| 2838 | Ga0451576_0253480 | |||
| 2839 | Ga0451576_0804553 | |||
| 2840 | Ga0466958_0000501 | |||
| 2841 | Ga0466958_0000962 | |||
| 2842 | Ga0466958_0444992 | |||
| 2843 | Ga0495627_119531 | |||
| 2844 | Ga0495603_0000012 | |||
| 2845 | Ga0495590_0036195 | |||
| 2846 | Ga0495590_0189340 | |||
| 2847 | Ga0495629_0000204 | |||
| 2848 | Ga0495629_0026771 | |||
| 2849 | Ga0495629_0036745 | |||
| 2850 | Ga0495638_0009691 | |||
| 2851 | Ga0495638_0219694 | |||
| 2852 | Ga0495638_0255997 | |||
| 2853 | Ga0495651_0068227 | |||
| 2854 | Ga0495650_0048140 | |||
| 2855 | Ga0495580_0003848 | |||
| 2856 | Ga0495580_0031069 | |||
| 2857 | Ga0495582_0000956 | |||
| 2858 | Ga0495582_0038633 | |||
| 2859 | Ga0495605_0191326 | |||
| 2860 | Ga0495639_0001489 | |||
| 2861 | Ga0495664_0028736 | |||
| 2862 | Ga0495584_0023311 | |||
| 2863 | Ga0495584_0037100 | |||
| 2864 | Ga0495584_0091890 | |||
| 2865 | Ga0495584_0237686 | |||
| 2866 | Ga0495585_0196945 | |||
| 2867 | Ga0495594_0000041 | |||
| 2868 | Ga0495594_0309629 | |||
| 2869 | Ga0495607_0117284 | |||
| 2870 | Ga0495606_0038000 | |||
| 2871 | Ga0495608_0383695 | |||
| 2872 | Ga0495608_0388541 | |||
| 2873 | Ga0495616_0228102 | |||
| 2874 | Ga0495618_0013081 | |||
| 2875 | Ga0495618_0333782 | |||
| 2876 | Ga0495618_0364554 | |||
| 2877 | Ga0495630_0039243 | |||
| 2878 | Ga0495637_0184190 | |||
| 2879 | Ga0495643_0058993 | |||
| 2880 | Ga0495643_0128777 | |||
| 2881 | Ga0495643_0189496 | |||
| 2882 | Ga0495663_0068226 | |||
| 2883 | Ga0495666_0220748 | |||
| 2884 | Ga0495652_0199035 | |||
| 2885 | Ga0495665_0014774 | |||
| 2886 | Ga0495640_0373425 | |||
| 2887 | Ga0495587_0211124 | |||
| 2888 | Ga0495587_0432184 | |||
| 2889 | Ga0495597_0046332 | |||
| 2890 | Ga0495622_0001150 | |||
| 2891 | Ga0495622_0016396 | |||
| 2892 | Ga0495622_0032559 | |||
| 2893 | Ga0495633_0002153 | |||
| 2894 | Ga0495633_0071165 | |||
| 2895 | Ga0495667_0159425 | |||
| 2896 | Ga0495668_0176722 | |||
| 2897 | Ga0495634_0109488 | |||
| 2898 | Ga0495625_0125992 | |||
| 2899 | Ga0495625_0283446 | |||
| 2900 | Ga0495635_0010103 | |||
| 2901 | Ga0495657_0017867 | |||
| 2902 | Ga0495657_0268283 | |||
| 2903 | Ga0495646_0066665 | |||
| 2904 | Ga0495646_0387902 | |||
| 2905 | Ga0495658_0003944 | |||
| 2906 | Ga0495658_0271406 | |||
| 2907 | Ga0495658_0328719 | |||
| 2908 | Ga0495658_0534842 | |||
| 2909 | Ga0495669_0106417 | |||
| 2910 | Ga0495613_0000075 | |||
| 2911 | Ga0495613_0055177 | |||
| 2912 | Ga0495624_0076666 | |||
| 2913 | Ga0495671_0239979 | |||
| 2914 | Ga0495649_0064277 | |||
| 2915 | Ga0495600_0022581 | |||
| 2916 | Ga0495581_0000422 | |||
| 2917 | Ga0495604_0004947 | |||
| 2918 | Ga0495604_0303634 | |||
| 2919 | Ga0495674_0245362 | |||
| 2920 | Ga0495676_0082205 | |||
| 2921 | Ga0495680_0036041 | |||
| 2922 | Ga0495683_0189370 | |||
| 2923 | Ga0495683_0204248 | |||
| 2924 | Ga0495687_139709 | |||
| 2925 | Ga0495677_0107704 | |||
| 2926 | Ga0495673_0004418 | |||
| 2927 | Ga0495681_0233668 | |||
| 2928 | Ga0495686_0086340 | |||
| 2929 | Ga0495686_0121506 | |||
| 2930 | Ga0495686_0164418 | |||
| 2931 | Ga0495593_0002009 | |||
| 2932 | Ga0495593_0120514 | |||
| 2933 | Ga0495602_0036625 | |||
| 2934 | Ga0495602_0255334 | |||
| 2935 | Ga0495614_0021119 | |||
| 2936 | Ga0495626_0099393 | |||
| 2937 | Ga0495626_0250349 | |||
| 2938 | Ga0496100_0003333 | |||
| 2939 | Ga0496100_0020476 | |||
| 2940 | Ga0496100_0036049 | |||
| 2941 | Ga0496100_0382342 | |||
| 2942 | Ga0496101_0001105 | |||
| 2943 | Ga0496101_0011382 | |||
| 2944 | Ga0496101_0073681 | |||
| 2945 | Ga0496101_0149709 | |||
| 2946 | Ga0496101_0329000 | |||
| 2947 | Ga0496102_0022644 | |||
| 2948 | Ga0496102_0032247 | |||
| 2949 | Ga0496102_0117953 | |||
| 2950 | Ga0496102_0128264 | |||
| 2951 | Ga0496102_0134898 | |||
| 2952 | Ga0496102_0178287 | |||
| 2953 | Ga0496102_0325718 | |||
| 2954 | Ga0496102_0335632 | |||
| 2955 | Ga0496102_0348090 | |||
| 2956 | Ga0496102_0381317 | |||
| 2957 | Ga0496102_0595519 | |||
| 2958 | Ga0496103_0011964 | |||
| 2959 | Ga0496103_0018424 | |||
| 2960 | Ga0496103_0021663 | |||
| 2961 | Ga0496103_0032188 | |||
| 2962 | Ga0496103_0120418 | |||
| 2963 | Ga0496103_0298409 | |||
| 2964 | Ga0496104_0009311 | |||
| 2965 | Ga0496104_0034308 | |||
| 2966 | Ga0496104_0139330 | |||
| 2967 | Ga0496104_0188509 | |||
| 2968 | Ga0496104_0274479 | |||
| 2969 | Ga0496104_0290614 | |||
| 2970 | Ga0496104_0466730 | |||
| 2971 | Ga0496105_0003160 | |||
| 2972 | Ga0496105_0006016 | |||
| 2973 | Ga0496105_0044255 | |||
| 2974 | Ga0496105_0158207 | |||
| 2975 | Ga0496105_0252930 | |||
| 2976 | Ga0496105_0517783 | |||
| 2977 | Ga0496106_0000370 | |||
| 2978 | Ga0496106_0000929 | |||
| 2979 | Ga0496106_0010898 | |||
| 2980 | Ga0496106_0038703 | |||
| 2981 | Ga0496106_0097598 | |||
| 2982 | Ga0496106_0103365 | |||
| 2983 | Ga0496106_0166740 | |||
| 2984 | Ga0496106_0197982 | |||
| 2985 | Ga0496106_0743167 | |||
| 2986 | Ga0496106_0774605 | |||
| 2987 | Ga0496107_0000197 | |||
| 2988 | Ga0496107_0002908 | |||
| 2989 | Ga0496107_0003884 | |||
| 2990 | Ga0496107_0030161 | |||
| 2991 | Ga0496107_0038428 | |||
| 2992 | Ga0496107_0071684 | |||
| 2993 | Ga0496107_0082406 | |||
| 2994 | Ga0496107_0265826 | |||
| 2995 | Ga0496108_0022688 | |||
| 2996 | Ga0496108_0133772 | |||
| 2997 | Ga0496108_0195406 | |||
| 2998 | Ga0496108_0304484 | |||
| 2999 | Ga0496108_0307809 | |||
| 3000 | Ga0496108_0315096 | |||
| 3001 | Ga0496108_0334206 | |||
| 3002 | Ga0496108_0441937 | |||
| 3003 | Ga0496108_0522625 | |||
| 3004 | Ga0496108_0731956 | |||
| 3005 | Ga0496109_0069376 | |||
| 3006 | Ga0496109_0071965 | |||
| 3007 | Ga0496109_0075773 | |||
| 3008 | Ga0496109_0107861 | |||
| 3009 | Ga0496109_0116895 | |||
| 3010 | Ga0496109_0309120 | |||
| 3011 | Ga0496109_0312969 | |||
| 3012 | Ga0496109_1093015 | |||
| 3013 | Ga0496110_0003625 | |||
| 3014 | Ga0496110_0022817 | |||
| 3015 | Ga0496110_0629877 | |||
| 3016 | Ga0496111_0025325 | |||
| 3017 | Ga0496111_0048951 | |||
| 3018 | Ga0496111_0094870 | |||
| 3019 | Ga0496111_0271931 | |||
| 3020 | Ga0496111_0386045 | |||
| 3021 | Ga0496111_0625842 | |||
| 3022 | Ga0496112_0008520 | |||
| 3023 | Ga0496112_0012075 | |||
| 3024 | Ga0496112_0092098 | |||
| 3025 | Ga0496112_0108040 | |||
| 3026 | Ga0496112_0135180 | |||
| 3027 | Ga0496112_0831742 | |||
| 3028 | Ga0496113_0021889 | |||
| 3029 | Ga0496113_0033853 | |||
| 3030 | Ga0496113_0043296 | |||
| 3031 | Ga0496113_0060307 | |||
| 3032 | Ga0496113_0062903 | |||
| 3033 | Ga0496113_0197816 | |||
| 3034 | Ga0496113_1036651 | |||
| 3035 | Ga0496114_0026036 | |||
| 3036 | Ga0496114_0051930 | |||
| 3037 | Ga0496114_0138405 | |||
| 3038 | Ga0496114_0399886 | |||
| 3039 | Ga0496114_0461753 | |||
| 3040 | Ga0496114_0475210 | |||
| 3041 | Ga0496114_0880698 | |||
| 3042 | Ga0496115_0056491 | |||
| 3043 | Ga0496115_0060837 | |||
| 3044 | Ga0496115_0092745 | |||
| 3045 | Ga0496115_0120861 | |||
| 3046 | Ga0496115_0144169 | |||
| 3047 | Ga0496115_0278134 | |||
| 3048 | Ga0496116_0322532 | |||
| 3049 | Ga0496119_0026505 | |||
| 3050 | Ga0496120_0006976 | |||
| 3051 | Ga0496120_0012874 | |||
| 3052 | Ga0496120_0060944 | |||
| 3053 | Ga0496121_0004399 | |||
| 3054 | Ga0496121_0117248 | |||
| 3055 | Ga0496121_0195010 | |||
| 3056 | Ga0496121_0283377 | |||
| 3057 | Ga0496122_0003989 | |||
| 3058 | Ga0496123_0000732 | |||
| 3059 | Ga0496123_0004691 | |||
| 3060 | Ga0496124_0126144 | |||
| 3061 | Ga0496124_0278373 | |||
| 3062 | Ga0496124_0672741 | |||
| 3063 | Ga0496125_0001673 | |||
| 3064 | Ga0496125_0134295 | |||
| 3065 | Ga0496125_0320766 | |||
| 3066 | Ga0496125_0404021 | |||
| 3067 | Ga0496126_0063768 | |||
| 3068 | Ga0496126_0283832 | |||
| 3069 | Ga0501341_03081 | |||
| 3070 | Ga0501341_06796 | |||
| 3071 | Ga0501304_013565 | |||
| 3072 | Ga0501307_029406 | |||
| 3073 | Ga0501314_014114 | |||
| 3074 | Ga0501317_029807 | |||
| 3075 | Ga0501319_005604 | |||
| 3076 | Ga0501320_022059 | |||
| 3077 | Ga0501325_016174 | |||
| 3078 | Ga0501031_0000018 | |||
| 3079 | Ga0501031_0004819 | |||
| 3080 | Ga0501031_0011795 | |||
| 3081 | Ga0501031_0017396 | |||
| 3082 | Ga0501031_0019004 | |||
| 3083 | Ga0501031_0027610 | |||
| 3084 | Ga0501031_0090635 | |||
| 3085 | Ga0501031_0093230 | |||
| 3086 | Ga0501031_0180474 | |||
| 3087 | Ga0501031_0309154 | |||
| 3088 | Ga0501031_0323768 | |||
| 3089 | Ga0501031_0334047 | |||
| 3090 | Ga0501031_0338096 | |||
| 3091 | Ga0501031_0358294 | |||
| 3092 | Ga0501031_0444789 | |||
| 3093 | Ga0501032_0000201 | |||
| 3094 | Ga0501032_0000564 | |||
| 3095 | Ga0501032_0008483 | |||
| 3096 | Ga0501032_0015071 | |||
| 3097 | Ga0501032_0024542 | |||
| 3098 | Ga0501032_0045244 | |||
| 3099 | Ga0501032_0068470 | |||
| 3100 | Ga0501032_0089499 | |||
| 3101 | Ga0501032_0129953 | |||
| 3102 | Ga0501032_0134005 | |||
| 3103 | Ga0501032_0176821 | |||
| 3104 | Ga0501032_0228372 | |||
| 3105 | Ga0501033_0000328 | |||
| 3106 | Ga0501033_0000443 | |||
| 3107 | Ga0501033_0002655 | |||
| 3108 | Ga0501033_0003152 | |||
| 3109 | Ga0501033_0015074 | |||
| 3110 | Ga0501033_0016649 | |||
| 3111 | Ga0501033_0024371 | |||
| 3112 | Ga0501033_0026107 | |||
| 3113 | Ga0501033_0038123 | |||
| 3114 | Ga0501033_0058501 | |||
| 3115 | Ga0501033_0073909 | |||
| 3116 | Ga0501033_0102582 | |||
| 3117 | Ga0501033_0107767 | |||
| 3118 | Ga0501033_0115195 | |||
| 3119 | Ga0501033_0149703 | |||
| 3120 | Ga0501033_0161613 | |||
| 3121 | Ga0501033_0211126 | |||
| 3122 | Ga0501033_0318198 | |||
| 3123 | Ga0501033_0629760 | |||
| 3124 | Ga0501034_0000005 | |||
| 3125 | Ga0501034_0000033 | |||
| 3126 | Ga0501034_0000061 | |||
| 3127 | Ga0501034_0000314 | |||
| 3128 | Ga0501034_0000681 | |||
| 3129 | Ga0501034_0011987 | |||
| 3130 | Ga0501034_0021545 | |||
| 3131 | Ga0501034_0024021 | |||
| 3132 | Ga0501034_0032646 | |||
| 3133 | Ga0501034_0040361 | |||
| 3134 | Ga0501034_0047357 | |||
| 3135 | Ga0501034_0060789 | |||
| 3136 | Ga0501034_0061513 | |||
| 3137 | Ga0501034_0096024 | |||
| 3138 | Ga0501034_0109071 | |||
| 3139 | Ga0501034_0152423 | |||
| 3140 | Ga0501034_0162570 | |||
| 3141 | Ga0501034_0221338 | |||
| 3142 | Ga0501034_0227391 | |||
| 3143 | Ga0501034_0250558 | |||
| 3144 | Ga0501034_0272853 | |||
| 3145 | Ga0501034_0305621 | |||
| 3146 | Ga0501034_0358193 | |||
| 3147 | Ga0501034_0559565 | |||
| 3148 | Ga0501034_1183646 | |||
| 3149 | Ga0501036_0000005 | |||
| 3150 | Ga0501036_0000027 | |||
| 3151 | Ga0501036_0005854 | |||
| 3152 | Ga0501036_0008162 | |||
| 3153 | Ga0501036_0017322 | |||
| 3154 | Ga0501036_0037202 | |||
| 3155 | Ga0501036_0048667 | |||
| 3156 | Ga0501036_0112205 | |||
| 3157 | Ga0501036_0177705 | |||
| 3158 | Ga0501036_0186371 | |||
| 3159 | Ga0501036_0254302 | |||
| 3160 | Ga0501036_0313616 | |||
| 3161 | Ga0501036_0375418 | |||
| 3162 | Ga0501037_0000045 | |||
| 3163 | Ga0501037_0000104 | |||
| 3164 | Ga0501037_0000271 | |||
| 3165 | Ga0501037_0001652 | |||
| 3166 | Ga0501037_0002530 | |||
| 3167 | Ga0501037_0009928 | |||
| 3168 | Ga0501037_0031330 | |||
| 3169 | Ga0501037_0049206 | |||
| 3170 | Ga0501037_0049408 | |||
| 3171 | Ga0501037_0138110 | |||
| 3172 | Ga0501037_0198785 | |||
| 3173 | Ga0501037_0292653 | |||
| 3174 | Ga0501037_0349463 | |||
| 3175 | Ga0501037_0404808 | |||
| 3176 | Ga0501037_0432744 | |||
| 3177 | Ga0501037_0484587 | |||
| 3178 | Ga0501037_0700991 | |||
| 3179 | Ga0501038_0000001 | |||
| 3180 | Ga0501038_0000340 | |||
| 3181 | Ga0501038_0005022 | |||
| 3182 | Ga0501038_0022940 | |||
| 3183 | Ga0501038_0024635 | |||
| 3184 | Ga0501038_0035324 | |||
| 3185 | Ga0501038_0042473 | |||
| 3186 | Ga0501038_0054962 | |||
| 3187 | Ga0501038_0070214 | |||
| 3188 | Ga0501038_0122866 | |||
| 3189 | Ga0501038_0161583 | |||
| 3190 | Ga0501038_0239184 | |||
| 3191 | Ga0501038_0286172 | |||
| 3192 | Ga0501038_0310247 | |||
| 3193 | Ga0501038_0346954 | |||
| 3194 | Ga0501038_0395620 | |||
| 3195 | Ga0501038_0522909 | |||
| 3196 | Ga0501039_0000003 | |||
| 3197 | Ga0501039_0000007 | |||
| 3198 | Ga0501039_0000802 | |||
| 3199 | Ga0501039_0002360 | |||
| 3200 | Ga0501039_0010241 | |||
| 3201 | Ga0501039_0013631 | |||
| 3202 | Ga0501039_0020878 | |||
| 3203 | Ga0501039_0046660 | |||
| 3204 | Ga0501039_0148950 | |||
| 3205 | Ga0501039_0290120 | |||
| 3206 | Ga0501039_0292636 | |||
| 3207 | Ga0501039_0309843 | |||
| 3208 | Ga0501039_0330799 | |||
| 3209 | Ga0501039_0395949 | |||
| 3210 | Ga0501039_0657967 | |||
| 3211 | Ga0501039_0905061 | |||
| 3212 | Ga0501040_0003550 | |||
| 3213 | Ga0501040_0034815 | |||
| 3214 | Ga0501040_0036827 | |||
| 3215 | Ga0501040_0116070 | |||
| 3216 | Ga0501040_0127805 | |||
| 3217 | Ga0501040_0391639 | |||
| 3218 | Ga0501041_0010586 | |||
| 3219 | Ga0501041_0024250 | |||
| 3220 | Ga0501041_0066945 | |||
| 3221 | Ga0501041_0270716 | |||
| 3222 | Ga0501041_0410981 | |||
| 3223 | Ga0501042_0014332 | |||
| 3224 | Ga0501042_0036971 | |||
| 3225 | Ga0501042_0050539 | |||
| 3226 | Ga0501042_0099243 | |||
| 3227 | Ga0501042_0108557 | |||
| 3228 | Ga0501042_0154488 | |||
| 3229 | Ga0501043_0000096 | |||
| 3230 | Ga0501043_0000248 | |||
| 3231 | Ga0501043_0001636 | |||
| 3232 | Ga0501043_0006416 | |||
| 3233 | Ga0501043_0030108 | |||
| 3234 | Ga0501043_0031597 | |||
| 3235 | Ga0501043_0039968 | |||
| 3236 | Ga0501043_0152562 | |||
| 3237 | Ga0501043_0170588 | |||
| 3238 | Ga0501043_0204152 | |||
| 3239 | Ga0501043_0273882 | |||
| 3240 | Ga0501043_0703974 | |||
| 3241 | Ga0501043_0864112 | |||
| 3242 | Ga0501046_0000023 | |||
| 3243 | Ga0501046_0001575 | |||
| 3244 | Ga0501046_0003564 | |||
| 3245 | Ga0501046_0006295 | |||
| 3246 | Ga0501046_0011230 | |||
| 3247 | Ga0501046_0012911 | |||
| 3248 | Ga0501046_0029227 | |||
| 3249 | Ga0501046_0030845 | |||
| 3250 | Ga0501046_0058101 | |||
| 3251 | Ga0501046_0060031 | |||
| 3252 | Ga0501046_0099874 | |||
| 3253 | Ga0501046_0185188 | |||
| 3254 | Ga0501046_0427760 | |||
| 3255 | Ga0501046_0527134 | |||
| 3256 | Ga0501047_0000122 | |||
| 3257 | Ga0501047_0001023 | |||
| 3258 | Ga0501047_0004600 | |||
| 3259 | Ga0501047_0004914 | |||
| 3260 | Ga0501047_0008466 | |||
| 3261 | Ga0501047_0021450 | |||
| 3262 | Ga0501047_0022728 | |||
| 3263 | Ga0501047_0026581 | |||
| 3264 | Ga0501047_0064620 | |||
| 3265 | Ga0501047_0068795 | |||
| 3266 | Ga0501047_0073145 | |||
| 3267 | Ga0501047_0090627 | |||
| 3268 | Ga0501047_0107883 | |||
| 3269 | Ga0501047_0170509 | |||
| 3270 | Ga0501047_0180906 | |||
| 3271 | Ga0501047_0338964 | |||
| 3272 | Ga0501047_0348117 | |||
| 3273 | Ga0501047_0850694 | |||
| 3274 | Ga0501048_0000060 | |||
| 3275 | Ga0501048_0000299 | |||
| 3276 | Ga0501048_0010572 | |||
| 3277 | Ga0501048_0158920 | |||
| 3278 | Ga0501048_0208661 | |||
| 3279 | Ga0501048_0239518 | |||
| 3280 | Ga0501048_0341510 | |||
| 3281 | Ga0501048_0439009 | |||
| 3282 | Ga0501048_0781530 | |||
| 3283 | Ga0501067_0000224 | |||
| 3284 | Ga0501067_0002012 | |||
| 3285 | Ga0501067_0008225 | |||
| 3286 | Ga0501067_0048413 | |||
| 3287 | Ga0501067_0052948 | |||
| 3288 | Ga0501067_0054371 | |||
| 3289 | Ga0501067_0102845 | |||
| 3290 | Ga0501067_0357210 | |||
| 3291 | Ga0501067_0369388 | |||
| 3292 | Ga0501068_0001760 | |||
| 3293 | Ga0501068_0005327 | |||
| 3294 | Ga0501068_0020442 | |||
| 3295 | Ga0501068_0063002 | |||
| 3296 | Ga0501068_0079118 | |||
| 3297 | Ga0501068_0125825 | |||
| 3298 | Ga0501069_0000012 | |||
| 3299 | Ga0501069_0010871 | |||
| 3300 | Ga0501069_0014599 | |||
| 3301 | Ga0501069_0024963 | |||
| 3302 | Ga0501069_0063468 | |||
| 3303 | Ga0501069_0077586 | |||
| 3304 | Ga0501069_0122508 | |||
| 3305 | Ga0501069_0344870 | |||
| 3306 | Ga0501070_0000655 | |||
| 3307 | Ga0501070_0006725 | |||
| 3308 | Ga0501070_0016571 | |||
| 3309 | Ga0501070_0018812 | |||
| 3310 | Ga0501070_0095134 | |||
| 3311 | Ga0501070_0100999 | |||
| 3312 | Ga0501070_0144310 | |||
| 3313 | Ga0501070_0158774 | |||
| 3314 | Ga0501070_0166828 | |||
| 3315 | Ga0501070_0201311 | |||
| 3316 | Ga0501070_0256433 | |||
| 3317 | Ga0501070_0262462 | |||
| 3318 | Ga0501070_0264672 | |||
| 3319 | Ga0501070_0317161 | |||
| 3320 | Ga0501070_0345630 | |||
| 3321 | Ga0501070_0354419 | |||
| 3322 | Ga0501070_0393622 | |||
| 3323 | Ga0501070_0436748 | |||
| 3324 | Ga0501070_0470211 | |||
| 3325 | Ga0501070_0648276 | |||
| 3326 | Ga0501070_0852893 | |||
| 3327 | Ga0501071_0012761 | |||
| 3328 | Ga0501071_0028792 | |||
| 3329 | Ga0501071_0048177 | |||
| 3330 | Ga0501071_0053351 | |||
| 3331 | Ga0501071_0064234 | |||
| 3332 | Ga0501071_0113545 | |||
| 3333 | Ga0501071_0166399 | |||
| 3334 | Ga0501071_0179667 | |||
| 3335 | Ga0501071_0376487 | |||
| 3336 | Ga0501071_0391157 | |||
| 3337 | Ga0501072_0004865 | |||
| 3338 | Ga0501072_0017931 | |||
| 3339 | Ga0501072_0034155 | |||
| 3340 | Ga0501072_0062830 | |||
| 3341 | Ga0501072_0183311 | |||
| 3342 | Ga0501072_0234011 | |||
| 3343 | Ga0501072_0825671 | |||
| 3344 | Ga0501073_0000014 | |||
| 3345 | Ga0501073_0002833 | |||
| 3346 | Ga0501073_0018220 | |||
| 3347 | Ga0501073_0024859 | |||
| 3348 | Ga0501073_0034517 | |||
| 3349 | Ga0501073_0038666 | |||
| 3350 | Ga0501073_0041910 | |||
| 3351 | Ga0501073_0047652 | |||
| 3352 | Ga0501073_0056617 | |||
| 3353 | Ga0501073_0065487 | |||
| 3354 | Ga0501073_0083577 | |||
| 3355 | Ga0501073_0137204 | |||
| 3356 | Ga0501073_0170505 | |||
| 3357 | Ga0501073_0190027 | |||
| 3358 | Ga0501073_0383579 | |||
| 3359 | Ga0501073_0451539 | |||
| 3360 | Ga0501073_0645765 | |||
| 3361 | Ga0501074_0000018 | |||
| 3362 | Ga0501074_0002711 | |||
| 3363 | Ga0501074_0012897 | |||
| 3364 | Ga0501074_0015276 | |||
| 3365 | Ga0501074_0021326 | |||
| 3366 | Ga0501074_0103606 | |||
| 3367 | Ga0501074_0133838 | |||
| 3368 | Ga0501074_0318524 | |||
| 3369 | Ga0501074_0570773 | |||
| 3370 | Ga0501075_0018336 | |||
| 3371 | Ga0501075_0027652 | |||
| 3372 | Ga0501075_0043514 | |||
| 3373 | Ga0501075_0059389 | |||
| 3374 | Ga0501075_0106152 | |||
| 3375 | Ga0501075_0893142 | |||
| 3376 | Ga0501076_0006456 | |||
| 3377 | Ga0501076_0018774 | |||
| 3378 | Ga0501076_0027098 | |||
| 3379 | Ga0501076_0066828 | |||
| 3380 | Ga0501076_0177685 | |||
| 3381 | Ga0501076_0311057 | |||
| 3382 | Ga0501077_0001847 | |||
| 3383 | Ga0501077_0004733 | |||
| 3384 | Ga0501077_0011089 | |||
| 3385 | Ga0501077_0023018 | |||
| 3386 | Ga0501077_0037231 | |||
| 3387 | Ga0501077_0265565 | |||
| 3388 | Ga0501077_0272029 | |||
| 3389 | Ga0501077_0303739 | |||
| 3390 | Ga0501079_0004830 | |||
| 3391 | Ga0501079_0005303 | |||
| 3392 | Ga0501079_0014814 | |||
| 3393 | Ga0501079_0058404 | |||
| 3394 | Ga0501079_0084466 | |||
| 3395 | Ga0501079_0109216 | |||
| 3396 | Ga0501079_0118284 | |||
| 3397 | Ga0501079_0233810 | |||
| 3398 | Ga0501079_0406820 | |||
| 3399 | Ga0501079_0426889 | |||
| 3400 | Ga0501079_0781664 | |||
| 3401 | Ga0501080_0000002 | |||
| 3402 | Ga0501080_0002237 | |||
| 3403 | Ga0501080_0004022 | |||
| 3404 | Ga0501080_0010582 | |||
| 3405 | Ga0501080_0013615 | |||
| 3406 | Ga0501080_0013921 | |||
| 3407 | Ga0501080_0035684 | |||
| 3408 | Ga0501080_0052841 | |||
| 3409 | Ga0501080_0078300 | |||
| 3410 | Ga0501080_0094547 | |||
| 3411 | Ga0501080_0142348 | |||
| 3412 | Ga0501080_0385462 | |||
| 3413 | Ga0501080_0518077 | |||
| 3414 | Ga0501080_0529225 | |||
| 3415 | Ga0501080_0683087 | |||
| 3416 | Ga0501080_1169928 | |||
| 3417 | Ga0501081_0010055 | |||
| 3418 | Ga0501081_0035267 | |||
| 3419 | Ga0501081_0085755 | |||
| 3420 | Ga0501081_0126776 | |||
| 3421 | Ga0501081_0144990 | |||
| 3422 | Ga0501081_0659993 | |||
| 3423 | Ga0501081_0828834 | |||
| 3424 | Ga0501083_0003370 | |||
| 3425 | Ga0501083_0024248 | |||
| 3426 | Ga0501083_0063805 | |||
| 3427 | Ga0501083_0087008 | |||
| 3428 | Ga0501083_0163497 | |||
| 3429 | Ga0501083_0240614 | |||
| 3430 | Ga0501083_0267403 | |||
| 3431 | Ga0501083_0306741 | |||
| 3432 | Ga0501035_0000008 | |||
| 3433 | Ga0501035_0000032 | |||
| 3434 | Ga0501035_0000039 | |||
| 3435 | Ga0501035_0000117 | |||
| 3436 | Ga0501035_0002261 | |||
| 3437 | Ga0501035_0004448 | |||
| 3438 | Ga0501035_0005021 | |||
| 3439 | Ga0501035_0008137 | |||
| 3440 | Ga0501035_0017042 | |||
| 3441 | Ga0501035_0026899 | |||
| 3442 | Ga0501035_0029253 | |||
| 3443 | Ga0501035_0045729 | |||
| 3444 | Ga0501035_0071486 | |||
| 3445 | Ga0501035_0094737 | |||
| 3446 | Ga0501035_0099467 | |||
| 3447 | Ga0501035_0106844 | |||
| 3448 | Ga0501035_0172930 | |||
| 3449 | Ga0501035_0173103 | |||
| 3450 | Ga0501035_0181247 | |||
| 3451 | Ga0501035_0198596 | |||
| 3452 | Ga0501035_0256988 | |||
| 3453 | Ga0501035_0325138 | |||
| 3454 | Ga0501035_0433007 | |||
| 3455 | Ga0501035_0484671 | |||
| 3456 | Ga0501035_0750170 | |||
| 3457 | Ga0501044_0000001 | |||
| 3458 | Ga0501044_0000019 | |||
| 3459 | Ga0501044_0000047 | |||
| 3460 | Ga0501044_0000703 | |||
| 3461 | Ga0501044_0004317 | |||
| 3462 | Ga0501044_0010978 | |||
| 3463 | Ga0501044_0013911 | |||
| 3464 | Ga0501044_0028245 | |||
| 3465 | Ga0501044_0034875 | |||
| 3466 | Ga0501044_0035914 | |||
| 3467 | Ga0501044_0046510 | |||
| 3468 | Ga0501044_0048777 | |||
| 3469 | Ga0501044_0058195 | |||
| 3470 | Ga0501044_0058823 | |||
| 3471 | Ga0501044_0103289 | |||
| 3472 | Ga0501044_0121136 | |||
| 3473 | Ga0501044_0143513 | |||
| 3474 | Ga0501044_0148141 | |||
| 3475 | Ga0501044_0154920 | |||
| 3476 | Ga0501044_0177509 | |||
| 3477 | Ga0501044_0191453 | |||
| 3478 | Ga0501044_0209608 | |||
| 3479 | Ga0501044_0231424 | |||
| 3480 | Ga0501044_0337127 | |||
| 3481 | Ga0501044_0365035 | |||
| 3482 | Ga0501044_0462847 | |||
| 3483 | Ga0501044_0669613 | |||
| 3484 | Ga0501045_0001654 | |||
| 3485 | Ga0501045_0008550 | |||
| 3486 | Ga0501045_0009260 | |||
| 3487 | Ga0501045_0010803 | |||
| 3488 | Ga0501045_0041021 | |||
| 3489 | Ga0501045_0050604 | |||
| 3490 | Ga0501045_0230832 | |||
| 3491 | Ga0501045_0663410 | |||
| 3492 | nmdc:mga03683_4036_c1 | |||
| 3493 | nmdc:mga03683_58041_c1 | |||
| 3494 | nmdc:mga03n38_117253_c1 | |||
| 3495 | nmdc:mga03n38_132244_c1 | |||
| 3496 | nmdc:mga03n38_1389_c1 | |||
| 3497 | nmdc:mga03n38_143265_c1 | |||
| 3498 | nmdc:mga03n38_245834_c1 | |||
| 3499 | nmdc:mga03n38_436972_c1 | |||
| 3500 | nmdc:mga00v17_130479_c1 | |||
| 3501 | nmdc:mga00v17_264705_c1 | |||
| 3502 | nmdc:mga00v17_26959_c1 | |||
| 3503 | nmdc:mga00v17_400348_c1 | |||
| 3504 | nmdc:mga0yw44_129012_c1 | |||
| 3505 | nmdc:mga0yw44_35872_c1 | |||
| 3506 | nmdc:mga0yw44_4300_c1 | |||
| 3507 | nmdc:mga0yw44_78709_c1 | |||
| 3508 | nmdc:mga0k408_124121_c1 | |||
| 3509 | nmdc:mga0k408_20853_c2 | |||
| 3510 | nmdc:mga0k408_82957_c1 | |||
| 3511 | nmdc:mga06z11_12231_c1 | |||
| 3512 | nmdc:mga06z11_33762_c1 | |||
| 3513 | nmdc:mga06z11_705_c1 | |||
| 3514 | nmdc:mga06z11_72969_c1 | |||
| 3515 | nmdc:mga04h51_23833_c1 | |||
| 3516 | nmdc:mga04h51_4615_c1 | |||
| 3517 | nmdc:mga04h51_694_c1 | |||
| 3518 | nmdc:mga07m45_211273_c1 | |||
| 3519 | nmdc:mga07m45_239053_c1 | |||
| 3520 | nmdc:mga07m45_434322_c1 | |||
| 3521 | nmdc:mga07m45_53418_c1 | |||
| 3522 | nmdc:mga05p37_182118_c1 | |||
| 3523 | nmdc:mga05p37_427650_c1 | |||
| 3524 | nmdc:mga05p37_51437_c1 | |||
| 3525 | nmdc:mga05p37_65210_c1 | |||
| 3526 | nmdc:mga05p37_98045_c1 | |||
| 3527 | nmdc:mga09592_114198_c1 | |||
| 3528 | nmdc:mga09592_200339_c1 | |||
| 3529 | nmdc:mga09592_241494_c1 | |||
| 3530 | nmdc:mga09592_524289_c1 | |||
| 3531 | nmdc:mga0qj67_156075_c1 | |||
| 3532 | nmdc:mga0qj67_314501_c1 | |||
| 3533 | nmdc:mga0qj67_54444_c1 | |||
| 3534 | nmdc:mga06r32_190094_c1 | |||
| 3535 | nmdc:mga06r32_23400_c1 | |||
| 3536 | nmdc:mga06r32_264088_c1 | |||
| 3537 | nmdc:mga06r32_350083_c1 | |||
| 3538 | nmdc:mga08y16_139567_c1 | |||
| 3539 | nmdc:mga08y16_171037_c1 | |||
| 3540 | nmdc:mga08y16_21413_c1 | |||
| 3541 | nmdc:mga08y16_296484_c1 | |||
| 3542 | nmdc:mga08y16_316692_c1 | |||
| 3543 | nmdc:mga08y16_5359_c1 | |||
| 3544 | nmdc:mga08y16_63289_c1 | |||
| 3545 | nmdc:mga0n895_15896_c1 | |||
| 3546 | nmdc:mga0n895_170676_c1 | |||
| 3547 | nmdc:mga0n895_2207_c1 | |||
| 3548 | nmdc:mga0n895_30612_c1 | |||
| 3549 | nmdc:mga0n895_83313_c1 | |||
| 3550 | nmdc:mga0rr50_121476_c1 | |||
| 3551 | nmdc:mga0rr50_19863_c1 | |||
| 3552 | nmdc:mga0rr50_224297_c1 | |||
| 3553 | nmdc:mga0rr50_519292_c1 | |||
| 3554 | nmdc:mga0rr50_60126_c1 | |||
| 3555 | nmdc:mga0rr50_653383_c1 | |||
| 3556 | nmdc:mga08x19_156817_c1 | |||
| 3557 | nmdc:mga08x19_208239_c1 | |||
| 3558 | nmdc:mga08x19_21206_c1 | |||
| 3559 | nmdc:mga08x19_69_c1 | |||
| 3560 | nmdc:mga08x19_9966_c1 | |||
| 3561 | nmdc:mga0a205_21733_c1 | |||
| 3562 | nmdc:mga0a205_431202_c1 | |||
| 3563 | nmdc:mga0a205_468445_c1 | |||
| 3564 | nmdc:mga0sz30_1901_c1 | |||
| 3565 | nmdc:mga0sz30_32122_c1 | |||
| 3566 | nmdc:mga0sz30_9747_c2 | |||
| 3567 | Ga0495601_0066610 | |||
| 3568 | Ga0495601_0076451 | |||
| 3569 | Ga0495612_0157560 | |||
| 3570 | Ga0495655_0000251 | |||
| 3571 | Ga0495595_0028754 | |||
| 3572 | Ga0495595_0032219 | |||
| 3573 | Ga0495619_0004327 | |||
| 3574 | Ga0495619_0196442 | |||
| 3575 | Ga0495619_0454718 | |||
| 3576 | Ga0500643_000019 | |||
| 3577 | Ga0500643_014322 | |||
| 3578 | Ga0500644_0003737 | |||
| 3579 | Ga0500646_0002953 | |||
| 3580 | Ga0500651_0003961 | |||
| 3581 | Ga0500566_0000487 | |||
| 3582 | Ga0500641_0042791 | |||
| 3583 | Ga0500641_0131552 | |||
| 3584 | Ga0500555_011538 | |||
| 3585 | Ga0500556_0000036 | |||
| 3586 | Ga0500556_0001299 | |||
| 3587 | Ga0500572_004255 | |||
| 3588 | Ga0500595_024485 | |||
| 3589 | Ga0500595_048346 | |||
| 3590 | Ga0500595_065616 | |||
| 3591 | Ga0500607_060523 | |||
| 3592 | Ga0500621_044069 | |||
| 3593 | Ga0500642_0272533 | |||
| 3594 | Ga0500652_048904 | |||
| 3595 | Ga0500658_0098157 | |||
| 3596 | Ga0500559_0039340 | |||
| 3597 | Ga0500559_0047072 | |||
| 3598 | Ga0500568_0000309 | |||
| 3599 | Ga0500568_0031708 | |||
| 3600 | Ga0500588_0003081 | |||
| 3601 | Ga0500588_0028064 | |||
| 3602 | Ga0500604_0001638 | |||
| 3603 | Ga0500604_0006127 | |||
| 3604 | Ga0500604_0022165 | |||
| 3605 | Ga0500604_0030493 | |||
| 3606 | Ga0500616_0002280 | |||
| 3607 | Ga0500616_0009256 | |||
| 3608 | Ga0500616_0019054 | |||
| 3609 | Ga0500616_0024006 | |||
| 3610 | Ga0500616_0032619 | |||
| 3611 | Ga0500616_0056137 | |||
| 3612 | Ga0500619_054403 | |||
| 3613 | Ga0500620_000626 | |||
| 3614 | Ga0500620_018206 | |||
| 3615 | Ga0500627_0185884 | |||
| 3616 | Ga0500634_0000025 | |||
| 3617 | Ga0500638_003723 | |||
| 3618 | Ga0500636_0000194 | |||
| 3619 | Ga0500637_0178773 | |||
| 3620 | Ga0500645_056068 | |||
| 3621 | Ga0500609_003263 | |||
| 3622 | Ga0500552_011425 | |||
| 3623 | Ga0501084_0006046 | |||
| 3624 | Ga0501084_0009681 | |||
| 3625 | Ga0501084_0023106 | |||
| 3626 | Ga0501084_0049863 | |||
| 3627 | Ga0501084_0068743 | |||
| 3628 | Ga0501084_0124882 | |||
| 3629 | Ga0501084_0149033 | |||
| 3630 | Ga0501084_0250923 | |||
| 3631 | Ga0501084_0553673 | |||
| 3632 | Ga0587077_051409 | |||
| 3633 | Ga0587077_080517 | |||
| 3634 | Ga0587082_059591 | |||
| 3635 | Ga0587082_059824 | |||
| 3636 | Ga0587091_050805 | |||
| 3637 | Ga0587101_027942 | |||
| 3638 | Ga0587101_033312 | |||
| 3639 | Ga0587109_069466 | |||
| 3640 | Ga0587113_015543 | |||
| 3641 | Ga0587115_051677 | |||
| 3642 | Ga0587130_013116 | |||
| 3643 | Ga0587062_006809 | |||
| 3644 | Ga0587062_050607 | |||
| 3645 | Ga0587068_057336 | |||
| 3646 | Ga0587069_046331 | |||
| 3647 | Ga0587076_063858 | |||
| 3648 | Ga0587079_059224 | |||
| 3649 | Ga0587110_013617 | |||
| 3650 | Ga0587120_008602 | |||
| 3651 | Ga0587124_010216 | |||
| 3652 | Ga0587111_0066355 | |||
| 3653 | Ga0587111_0068265 | |||
| 3654 | Ga0587111_0096492 | |||
| 3655 | Ga0501082_0002218 | |||
| 3656 | Ga0501082_0008244 | |||
| 3657 | Ga0501082_0015022 | |||
| 3658 | Ga0501082_0021725 | |||
| 3659 | Ga0501082_0033112 | |||
| 3660 | Ga0501082_0038987 | |||
| 3661 | Ga0501082_0050351 | |||
| 3662 | Ga0501082_0058924 | |||
| 3663 | Ga0501082_0072665 | |||
| 3664 | Ga0501082_0109419 | |||
| 3665 | Ga0501082_0165672 | |||
| 3666 | Ga0501082_0190851 | |||
| 3667 | Ga0501082_0331408 | |||
| 3668 | Ga0501082_0348487 | |||
| 3669 | Ga0501082_0374891 | |||
| 3670 | Ga0501082_0402469 | |||
| 3671 | Ga0501082_0431388 | |||
| 3672 | Ga0501082_0508428 | |||
| 3673 | Ga0501082_0716932 | |||
| 3674 | Ga0501082_0752630 | |||
| 3675 | Ga0501082_0920630 | |||
| 3676 | Ga0501082_1191385 | |||
| 3677 | Ga0466962_0000476 | |||
| 3678 | Ga0466962_0168384 | |||
| 3679 | Ga0530510_0005850 | |||
| 3680 | Ga0530510_0007021 | |||
| 3681 | Ga0530510_0026303 | |||
| 3682 | Ga0530510_0165872 | |||
| 3683 | Ga0530510_0203259 | |||
| 3684 | Ga0530510_0298869 | |||
| 3685 | Ga0530510_0395637 | |||
| 3686 | Ga0530510_0710982 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2cqj-assembly1.cif.gz_A | solution structure of the s4 domain of u3 small nucleolar ribonucleoprotein protein imp3 homolog | 0.9308 | 94 | 136 |
| 4v5z-assembly1.cif.gz_Ad | structure of a mammalian 80s ribosome obtained by docking homology models of the rna and proteins into an 8.7 a cryo-em map | 0.9272 | 48 | 148 |
| 1ksv-assembly1.cif.gz_A | structure of rsua | 0.9249 | 94 | 143 |
| 4v5z-assembly1.cif.gz_Ad | structure of a mammalian 80s ribosome obtained by docking homology models of the rna and proteins into an 8.7 a cryo-em map | 0.8932 | 48 | 148 |
| 3dh3-assembly4.cif.gz_D | crystal structure of rluf in complex with a 22 nucleotide rna substrate | 0.8913 | 95 | 143 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A0P0Y445_123_179_3.10.290.10 | Alpha Beta;Roll;Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A;RNA-binding S4 domain | 0.9846 | 94 | 137 | 3.10.290.10 |
| af_Q9XPI8_145_195_3.10.290.10 | Alpha Beta;Roll;Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A;RNA-binding S4 domain | 0.9769 | 93 | 142 | 3.10.290.10 |
| af_Q4DSJ7_105_180_3.10.290.10 | Alpha Beta;Roll;Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A;RNA-binding S4 domain | 0.9737 | 93 | 137 | 3.10.290.10 |
| af_C6TBL4_107_182_3.10.290.10 | Alpha Beta;Roll;Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A;RNA-binding S4 domain | 0.97 | 94 | 136 | 3.10.290.10 |
| af_A0A144A2N8_107_181_3.10.290.10 | Alpha Beta;Roll;Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A;RNA-binding S4 domain | 0.9609 | 94 | 136 | 3.10.290.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3G7CER1-F1-model_v4 | Small ribosomal subunit protein uS4c | 0.9767 | 61 | 145 |
GO:0003735
GO:0009507 GO:0015935 GO:0019843 GO:0042274 |
| AF-I1E303-F1-model_v4 | Small subunit ribosomal protein S4 | 0.9688 | 80 | 185 |
GO:0003735
GO:0015935 GO:0019843 GO:0042274 |
| AF-A0A327K132-F1-model_v4 | Small ribosomal subunit protein uS4 | 0.9653 | 53 | 139 |
GO:0003735
GO:0015935 GO:0019843 GO:0042274 |
| AF-A0A7K0F5T4-F1-model_v4 | deleted | 0.9584 | 55 | 156 |
|
| AF-T1A5M6-F1-model_v4 | 30S ribosomal protein S4 | 0.9542 | 92 | 161 |
GO:0003735
GO:0015935 GO:0019843 GO:0042274 |