metagRoot

F495906

General Info

Members	Datasets	Scaffolds	Average Seq Length
1859	640	1776	202

Family's Representative Sequence

Representative Sequence	3300006038\|Ga0075365_10071626\|Ga0075365_100716262
Length	225
Sequence	MKFSHELIEKNSGLLILLVILTVSVGGLVEIVPLHFQKSTTQPVAGLQPYTALQLAGRDVYLREGCYNCHSQMIRPFRAETERYGHYSVAGEFVYDHPFQWGSKRTGPDLHRVGGRYSDEWHRIHLNNPRDLVPESNMPAYPWLANARLEPQELPPKMRALRAVGVPYSDAQIAAAPDEVKGKTELDALVAYLQVLGTAIKSRGAPAPAARPAQAGTATGRREEK

Samples

	Sample ID	Description	Type	Environment
1	2162886007	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1	Metagenome	Rhizosphere
2	2526164512	Azovibrio restrictus DSM 23866	Isolate	Unclassified
3	2547132374	Acidovorax radicis N35	Isolate	Unclassified
4	2548876994	Herbaspirillum lusitanum P6-12	Isolate	Nodule
5	2574179768	Azoarcus communis DSM 12120	Isolate	Unclassified
6	2599185155	Pseudomonas sp. NFACC10-1	Isolate	Rhizoplane
7	2599185226	Variovorax sp. NFACC27	Isolate	Rhizoplane
8	2599185227	Variovorax sp. NFACC28	Isolate	Rhizoplane
9	2599185229	Variovorax sp. NFACC29	Isolate	Endosphere
10	2600255292	Janthinobacterium lividum NFR18	Isolate	Rhizoplane
11	2643221554	Duganella sp. Root1480D1	Isolate	Unclassified
12	2643221556	Massilia sp. Root1485	Isolate	Unclassified
13	2643221570	Acidovorax sp. Root568	Isolate	Unclassified
14	2643221596	Acidovorax sp. Root70	Isolate	Unclassified
15	2643221609	Acidovorax sp. Root217	Isolate	Unclassified
16	2643221611	Acidovorax sp. Root219	Isolate	Unclassified
17	2643221628	Variovorax sp. Root318D1	Isolate	Unclassified
18	2643221638	Duganella sp. Root336D2	Isolate	Unclassified
19	2643221645	Massilia sp. Root351	Isolate	Unclassified
20	2643221652	Acidovorax sp. Root402	Isolate	Unclassified
21	2643221664	Massilia sp. Root418	Isolate	Unclassified
22	2643221672	Variovorax sp. Root434	Isolate	Unclassified
23	2643221684	Massilia sp. Root133	Isolate	Unclassified
24	2643221717	Acidovorax sp. Root267	Isolate	Unclassified
25	2721755523	Delftia sp. HK171	Isolate	Unclassified
26	2738541277	Variovorax sp. GV051	Isolate	Unclassified
27	2738541280	Massilia sp. GV090	Isolate	Unclassified
28	2738541297	Duganella sp. GV083	Isolate	Unclassified
29	2738541300	Massilia sp. GV016	Isolate	Unclassified
30	2738541357	Duganella sp. GV053	Isolate	Unclassified
31	2738543003	Duganella sp. GV066	Isolate	Unclassified
32	2738543012	Acidovorax sp. CF301	Isolate	Unclassified
33	2738543013	Variovorax sp. BT01	Isolate	Unclassified
34	2738543018	Massilia sp. GV045	Isolate	Unclassified
35	2738543019	Variovorax sp. GV040	Isolate	Unclassified
36	2738543026	Duganella sp. GV089	Isolate	Unclassified
37	2738543029	Duganella sp. GV039	Isolate	Unclassified
38	2738543030	Massilia sp. GV097	Isolate	Unclassified
39	2816332133	Acidovorax radicis 2721A	Isolate	Unclassified
40	2818991445	Herbaspirillum hiltneri 3195	Isolate	Unclassified
41	2818991446	Variovorax sp. 1180	Isolate	Unclassified
42	2821131069	Duganella sp. 1224	Isolate	Unclassified
43	2831265667	Variovorax guangxiensis DSM 27352	Isolate	Rhizosphere
44	2831864461	Roseateles noduli HZ7	Isolate	Nodule
45	2839138175	Delftia acidovorans B15	Isolate	Rhizosphere
46	2842677519	Variovorax sp. R-72495	Isolate	Unclassified
47	2842711865	Duganella sp. R-73148	Isolate	Unclassified
48	2842718218	Acidovorax sp. R-73343	Isolate	Unclassified
49	2842733646	Variovorax sp. R-72446	Isolate	Unclassified
50	2857547612	Janthinobacterium sp. R-74502	Isolate	Unclassified
51	2857553236	Duganella sp. R-74557	Isolate	Unclassified
52	2857558681	Duganella sp. R-74565	Isolate	Unclassified
53	2857564685	Duganella sp. R-74599	Isolate	Unclassified
54	2881101125	Ramlibacter rhizophilus CCTCC AB2015357	Isolate	Rhizosphere
55	2884811622	Herbaspirillum sp. 3C11	Isolate	Unclassified
56	2884836552	Herbaspirillum sp. 3R-11	Isolate	Unclassified
57	2884852848	Herbaspirillum sp. 3R11	Isolate	Unclassified
58	2885080285	Janthinobacterium sp. AD80	Isolate	Rhizosphere
59	2886848708	Mitsuaria sp. TWR114	Isolate	Rhizosphere
60	2894023352	Diaphorobacter ruginosibacter DSM 27467	Isolate	Nodule
61	2896154374	Herbaspirillum sp. 3R-3a1	Isolate	Nodule
62	2899924645	Variovorax sp. 369	Isolate	Unclassified
63	2904424332	Duganella sp. 1411	Isolate	Rhizosphere
64	2904449895	Variovorax sp. 1763	Isolate	Rhizosphere
65	2904456579	Variovorax sp. 2002	Isolate	Unclassified
66	2919462493	Variovorax sp. 3319	Isolate	Rhizosphere
67	2919476304	Duganella sp. 3397	Isolate	Unclassified
68	2928037797	Variovorax sp. 1126	Isolate	Unclassified
69	2928044640	Variovorax sp. 1128	Isolate	Unclassified
70	2928051484	Variovorax sp. 1133	Isolate	Unclassified
71	2928064002	Variovorax sp. 1140	Isolate	Rhizosphere
72	2928070936	Variovorax gossypii 1167	Isolate	Unclassified
73	2928084124	Variovorax paradoxus 1218	Isolate	Unclassified
74	2928115317	Pseudacidovorax sp. 1753	Isolate	Rhizosphere
75	2929520902	Variovorax beijingensis 502	Isolate	Unclassified
76	2932410948	Janthinobacterium lividum 2829	Isolate	Rhizosphere
77	2932416698	Janthinobacterium lividum 2830	Isolate	Rhizosphere
78	2932422444	Comamonas sp. 4034	Isolate	Rhizosphere
79	2954767861	Variovorax sp. TBS-050B	Isolate	Rhizosphere
80	2974320154	Acidovorax wautersii SORGH_AS 335	Isolate	Unclassified
81	2990710928	Acidovorax delafieldii SLBN-75	Isolate	Rhizosphere
82	3007252601	Pseudomonas punonensis D1-6	Isolate	Unclassified
83	3300002704	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB	Metagenome	Unclassified
84	3300002705	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS	Metagenome	Unclassified
85	3300002737	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA	Metagenome	Endosphere
86	3300002738	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA	Metagenome	Unclassified
87	3300002741	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL	Metagenome	Unclassified
88	3300002773	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS	Metagenome	Endosphere
89	3300002774	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA	Metagenome	Endosphere
90	3300002987	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB	Metagenome	Endosphere
91	3300003187	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB	Metagenome	Endosphere
92	3300003215	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF	Metagenome	Endosphere
93	3300003322	Sugarcane root Sample L2	Metagenome	Unclassified
94	3300003354	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS	Metagenome	Endosphere
95	3300003374	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF	Metagenome	Endosphere
96	3300003578	Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only)	Metatranscriptome	Unclassified
97	3300003752	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2	Metagenome	Endosphere
98	3300003758	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2	Metagenome	Endosphere
99	3300003759	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2	Metagenome	Endosphere
100	3300003761	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2	Metagenome	Endosphere
101	3300003762	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2	Metagenome	Endosphere
102	3300003763	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2	Metagenome	Endosphere
103	3300003771	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2	Metagenome	Endosphere
104	3300003773	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2	Metagenome	Endosphere
105	3300003775	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2	Metagenome	Endosphere
106	3300003784	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2	Metagenome	Endosphere
107	3300003790	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2	Metagenome	Endosphere
108	3300003791	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2	Metagenome	Endosphere
109	3300003792	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2	Metagenome	Endosphere
110	3300003794	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2	Metagenome	Endosphere
111	3300004625	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2	Metagenome	Endosphere
112	3300005262	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3)	Metagenome	Endosphere
113	3300005288	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2)	Metagenome	Rhizosphere
114	3300005289	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2)	Metagenome	Rhizosphere
115	3300005290	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3)	Metagenome	Rhizosphere
116	3300005293	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2)	Metagenome	Rhizosphere
117	3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Metagenome	Rhizosphere
118	3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Metagenome	Rhizosphere
119	3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Metagenome	Rhizosphere
120	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
121	3300005333	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG	Metagenome	Rhizosphere
122	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
123	3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Metagenome	Rhizosphere
124	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
125	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
126	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
127	3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Metagenome	Rhizosphere
128	3300005343	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG	Metagenome	Rhizosphere
129	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
130	3300005345	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG	Metagenome	Rhizosphere
131	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
132	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
133	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
134	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
135	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
136	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
137	3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Metagenome	Rhizosphere
138	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
139	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
140	3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Metagenome	Rhizosphere
141	3300005438	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG	Metagenome	Rhizosphere
142	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
143	3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Metagenome	Rhizosphere
144	3300005445	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG	Metagenome	Rhizosphere
145	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
146	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
147	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
148	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
149	3300005466	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG	Metagenome	Rhizosphere
150	3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Metagenome	Rhizosphere
151	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
152	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
153	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
154	3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Metagenome	Rhizosphere
155	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
156	3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Metagenome	Rhizosphere
157	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
158	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
159	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
160	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
161	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
162	3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Metagenome	Rhizosphere
163	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
164	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
165	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
166	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
167	3300005834	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2	Metagenome	Rhizosphere
168	3300005840	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2	Metagenome	Rhizosphere
169	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
170	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
171	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
172	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
173	3300006038	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Metagenome	Endosphere
174	3300006042	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3	Metagenome	Endosphere
175	3300006048	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3	Metagenome	Endosphere
176	3300006051	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Metagenome	Endosphere
177	3300006058	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1	Metagenome	Rhizosphere
178	3300006177	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2	Metagenome	Endosphere
179	3300006178	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2	Metagenome	Endosphere
180	3300006186	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4	Metagenome	Endosphere
181	3300006195	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1	Metagenome	Endosphere
182	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
183	3300006353	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5	Metagenome	Endosphere
184	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
185	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
186	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
187	3300006880	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Metagenome	Rhizosphere
188	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
189	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
190	3300006944	Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW	Metagenome	Nodule
191	3300006946	Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG	Metagenome	Nodule
192	3300006948	Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15	Metagenome	Nodule
193	3300009011	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG	Metagenome	Rhizosphere
194	3300009036	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG	Metagenome	Rhizosphere
195	3300009092	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG	Metagenome	Rhizosphere
196	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
197	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
198	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
199	3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Metagenome	Rhizosphere
200	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
201	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
202	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
203	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
204	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
205	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
206	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
207	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
208	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
209	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
210	3300012497	Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510	Metagenome	Rhizosphere
211	3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Metagenome	Rhizosphere
212	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
213	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
214	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
215	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
216	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
217	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
218	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
219	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
220	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
221	3300014497	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG	Metagenome	Rhizosphere
222	3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Metagenome	Rhizosphere
223	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
224	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
225	3300015261	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG	Metagenome	Rhizosphere
226	3300015262	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG	Metagenome	Rhizosphere
227	3300015265	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG	Metagenome	Rhizosphere
228	3300015683	Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04	Metagenome	Rhizosphere
229	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
230	3300021361	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2	Metagenome	Rhizosphere
231	3300025206	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2)	Metagenome	Unclassified
232	3300025208	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2)	Metagenome	Endosphere
233	3300025228	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
234	3300025229	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
235	3300025230	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2)	Metagenome	Endosphere
236	3300025233	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2)	Metagenome	Endosphere
237	3300025242	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
238	3300025245	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3)	Metagenome	Endosphere
239	3300025246	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2)	Metagenome	Unclassified
240	3300025250	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2)	Metagenome	Unclassified
241	3300025253	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
242	3300025254	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2)	Metagenome	Endosphere
243	3300025256	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2)	Metagenome	Unclassified
244	3300025258	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3)	Metagenome	Endosphere
245	3300025263	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3)	Metagenome	Endosphere
246	3300025272	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
247	3300025273	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3)	Metagenome	Endosphere
248	3300025284	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2)	Metagenome	Endosphere
249	3300025291	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3)	Metagenome	Endosphere
250	3300025292	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
251	3300025294	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2)	Metagenome	Endosphere
252	3300025295	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3)	Metagenome	Endosphere
253	3300025297	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2)	Metagenome	Endosphere
254	3300025298	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
255	3300025299	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3)	Metagenome	Endosphere
256	3300025302	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2)	Metagenome	Endosphere
257	3300025303	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
258	3300025304	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
259	3300025315	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2)	Metagenome	Rhizosphere
260	3300025321	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
261	3300025711	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
262	3300025728	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
263	3300025893	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
264	3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
265	3300025900	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
266	3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2)	Metagenome	Rhizosphere
267	3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
268	3300025906	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
269	3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
270	3300025908	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
271	3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
272	3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
273	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
274	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
275	3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
276	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
277	3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
278	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
279	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
280	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
281	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
282	3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
283	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
284	3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
285	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
286	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
287	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
288	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
289	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
290	3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
291	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
292	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
293	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
294	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
295	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
296	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
297	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
298	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
299	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
300	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
301	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
302	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
303	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
304	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
305	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
306	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
307	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
308	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
309	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
310	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
311	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
312	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
313	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
314	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
315	3300027111	Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2)	Metagenome	Nodule
316	3300027252	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2)	Metagenome	Rhizosphere
317	3300027360	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2)	Metagenome	Rhizosphere
318	3300027552	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2)	Metagenome	Rhizosphere
319	3300027665	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2)	Metagenome	Rhizosphere
320	3300027666	Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2)	Metagenome	Nodule
321	3300027682	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2)	Metagenome	Rhizosphere
322	3300027717	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2)	Metagenome	Rhizosphere
323	3300027876	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2)	Metagenome	Rhizosphere
324	3300027907	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3)	Metagenome	Rhizosphere
325	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
326	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
327	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
328	3300028577	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG	Metagenome	Rhizosphere
329	3300028653	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG	Metagenome	Rhizosphere
330	3300028666	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG	Metagenome	Rhizosphere
331	3300028794	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM	Metagenome	Unclassified
332	3300030731	Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3	Metagenome	Rhizosphere
333	3300030732	Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1	Metagenome	Rhizosphere
334	3300030733	Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2	Metagenome	Rhizosphere
335	3300030735	Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4	Metagenome	Rhizosphere
336	3300030736	Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6	Metagenome	Rhizosphere
337	3300030742	Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9	Metagenome	Rhizosphere
338	3300030744	Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7	Metagenome	Rhizosphere
339	3300031235	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG	Metagenome	Rhizosphere
340	3300031238	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG	Metagenome	Rhizosphere
341	3300031239	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG	Metagenome	Rhizosphere
342	3300031240	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG	Metagenome	Rhizosphere
343	3300031241	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG	Metagenome	Rhizosphere
344	3300031242	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG	Metagenome	Rhizosphere
345	3300031247	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG	Metagenome	Rhizosphere
346	3300031249	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG	Metagenome	Rhizosphere
347	3300031250	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG	Metagenome	Rhizosphere
348	3300031251	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG	Metagenome	Rhizosphere
349	3300031344	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG	Metagenome	Rhizosphere
350	3300031456	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM	Metagenome	Unclassified
351	3300031507	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM	Metagenome	Unclassified
352	3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Metagenome	Rhizosphere
353	3300031595	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG	Metagenome	Rhizosphere
354	3300031649	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM	Metagenome	Unclassified
355	3300031665	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3	Metagenome	Rhizosphere
356	3300031691	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA	Metagenome	Rhizosphere
357	3300031711	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG	Metagenome	Rhizosphere
358	3300031727	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5	Metagenome	Rhizosphere
359	3300031728	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC	Metagenome	Rhizosphere
360	3300031730	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM	Metagenome	Unclassified
361	3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Metagenome	Rhizosphere
362	3300031733	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1	Metagenome	Rhizosphere
363	3300031824	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2	Metagenome	Rhizosphere
364	3300031838	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM	Metagenome	Unclassified
365	3300031901	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2	Metagenome	Rhizosphere
366	3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Metagenome	Rhizosphere
367	3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Metagenome	Rhizosphere
368	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
369	3300032004	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3	Metagenome	Rhizosphere
370	3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Metagenome	Rhizosphere
371	3300032133	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA	Metagenome	Rhizosphere
372	3300032137	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC	Metagenome	Rhizosphere
373	3300032139	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB	Metagenome	Rhizosphere
374	3300032168	Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
375	3300033179	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM	Metagenome	Unclassified
376	3300033180	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM	Metagenome	Unclassified
377	3300033524	Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
378	3300033527	Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
379	3300033528	Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
380	3300033529	Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
381	3300033541	Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
382	3300035086	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4	Metagenome	Rhizosphere
383	3300035089	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2	Metagenome	Rhizosphere
384	3300035091	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4	Metagenome	Rhizosphere
385	3300035092	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11	Metagenome	Rhizosphere
386	3300035111	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11	Metagenome	Rhizosphere
387	3300035113	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12	Metagenome	Rhizosphere
388	3300035114	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3	Metagenome	Rhizosphere
389	3300035117	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1	Metagenome	Rhizosphere
390	3300035119	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4	Metagenome	Rhizosphere
391	3300035120	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5	Metagenome	Rhizosphere
392	3300035121	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3	Metagenome	Rhizosphere
393	3300035171	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4	Metagenome	Rhizosphere
394	3300035172	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3	Metagenome	Rhizosphere
395	3300035398	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1	Metagenome	Rhizosphere
396	3300035410	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12	Metagenome	Rhizosphere
397	3300035692	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11	Metagenome	Rhizosphere
398	3300035695	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19	Metagenome	Rhizosphere
399	3300035724	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1	Metagenome	Rhizosphere
400	3300035725	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8	Metagenome	Rhizosphere
401	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
402	3300036647	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA	Metagenome	Rhizosphere
403	3300036712	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA	Metagenome	Rhizosphere
404	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
405	3300037312	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2	Metagenome	Rhizosphere
406	3300037418	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3	Metagenome	Rhizosphere
407	3300037466	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1	Metagenome	Rhizosphere
408	3300037471	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11	Metagenome	Rhizosphere
409	3300037588	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA	Metagenome	Rhizosphere
410	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
411	3300038725	Seagrass microbial communities from Seahorse Key, FL, USA - HV0818	Metagenome	Unclassified
412	3300039062	Seagrass microbial communities from Seahorse Key, FL, USA - HH0818	Metagenome	Unclassified
413	3300039110	Seagrass microbial communities from Seahorse Key, FL, USA - SV0319	Metagenome	Unclassified
414	3300039447	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2	Metagenome	Rhizosphere
415	3300041404	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272	Metagenome	Rhizosphere
416	3300041407	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416	Metagenome	Rhizosphere
417	3300041410	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596	Metagenome	Rhizosphere
418	3300041411	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708	Metagenome	Rhizosphere
419	3300041452	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG	Metagenome	Rhizoplane
420	3300041458	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG	Metagenome	Rhizoplane
421	3300041486	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG	Metagenome	Rhizoplane
422	3300041492	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG	Metagenome	Unclassified
423	3300041498	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG	Metagenome	Unclassified
424	3300041997	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607	Metagenome	Rhizosphere
425	3300041999	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297	Metagenome	Rhizosphere
426	3300042004	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619	Metagenome	Rhizosphere
427	3300042005	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216	Metagenome	Rhizosphere
428	3300042006	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437	Metagenome	Rhizosphere
429	3300042007	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290	Metagenome	Rhizosphere
430	3300042010	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431	Metagenome	Rhizosphere
431	3300042012	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213	Metagenome	Rhizosphere
432	3300042014	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275	Metagenome	Rhizosphere
433	3300042015	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287	Metagenome	Rhizosphere
434	3300042123	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228	Metagenome	Rhizosphere
435	3300042133	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134	Metagenome	Rhizosphere
436	3300042134	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126	Metagenome	Rhizosphere
437	3300042135	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127	Metagenome	Rhizosphere
438	3300042139	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442	Metagenome	Rhizosphere
439	3300042145	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581	Metagenome	Rhizosphere
440	3300042147	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618	Metagenome	Rhizosphere
441	3300042156	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593	Metagenome	Rhizosphere
442	3300042185	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592	Metagenome	Rhizosphere
443	3300042435	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613	Metagenome	Rhizosphere
444	3300042532	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92	Metagenome	Rhizosphere
445	3300042876	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED	Metagenome	Rhizosphere
446	3300044656	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R	Metagenome	Rhizosphere
447	3300044672	Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E	Metagenome	Unclassified
448	3300044673	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED	Metagenome	Rhizosphere
449	3300044683	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R	Metagenome	Rhizosphere
450	3300044684	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R	Metagenome	Rhizosphere
451	3300044706	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R	Metagenome	Rhizosphere
452	3300044712	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED	Metagenome	Rhizosphere
453	3300044719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R	Metagenome	Rhizosphere
454	3300044765	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R	Metagenome	Rhizosphere
455	3300045049	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R	Metagenome	Rhizosphere
456	3300045051	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED	Metagenome	Rhizosphere
457	3300046452	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere	Metagenome	Rhizosphere
458	3300046453	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere	Metagenome	Rhizosphere
459	3300046454	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere	Metagenome	Rhizosphere
460	3300046455	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere	Metagenome	Rhizosphere
461	3300046457	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere	Metagenome	Rhizosphere
462	3300046459	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere	Metagenome	Rhizosphere
463	3300046460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere	Metagenome	Rhizosphere
464	3300046461	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere	Metagenome	Rhizosphere
465	3300046462	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere	Metagenome	Rhizosphere
466	3300046463	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere	Metagenome	Rhizosphere
467	3300046471	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere	Metagenome	Rhizosphere
468	3300046472	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere	Metagenome	Rhizosphere
469	3300046473	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere	Metagenome	Rhizosphere
470	3300046474	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere	Metagenome	Rhizosphere
471	3300046475	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere	Metagenome	Rhizosphere
472	3300046476	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere	Metagenome	Rhizosphere
473	3300046491	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere	Metagenome	Rhizosphere
474	3300046492	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere	Metagenome	Rhizosphere
475	3300046499	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere	Metagenome	Rhizosphere
476	3300046500	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere	Metagenome	Rhizosphere
477	3300046501	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere	Metagenome	Rhizosphere
478	3300046506	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere	Metagenome	Rhizosphere
479	3300046507	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere	Metagenome	Rhizosphere
480	3300046511	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere	Metagenome	Rhizosphere
481	3300046512	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere	Metagenome	Rhizosphere
482	3300046513	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere	Metagenome	Rhizosphere
483	3300046514	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere	Metagenome	Rhizosphere
484	3300046515	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere	Metagenome	Rhizosphere
485	3300046517	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere	Metagenome	Rhizosphere
486	3300046518	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere	Metagenome	Rhizosphere
487	3300046519	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere	Metagenome	Rhizosphere
488	3300046520	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere	Metagenome	Rhizosphere
489	3300046522	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere	Metagenome	Rhizosphere
490	3300046523	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere	Metagenome	Rhizosphere
491	3300046524	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere	Metagenome	Rhizosphere
492	3300046525	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere	Metagenome	Rhizosphere
493	3300046526	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere	Metagenome	Rhizosphere
494	3300046528	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere	Metagenome	Rhizosphere
495	3300046529	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere	Metagenome	Rhizosphere
496	3300046530	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere	Metagenome	Rhizosphere
497	3300046531	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere	Metagenome	Rhizosphere
498	3300046535	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere	Metagenome	Rhizosphere
499	3300046537	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere	Metagenome	Rhizosphere
500	3300046538	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere	Metagenome	Rhizosphere
501	3300046539	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere	Metagenome	Rhizosphere
502	3300046542	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere	Metagenome	Rhizosphere
503	3300046543	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere	Metagenome	Rhizosphere
504	3300046557	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere	Metagenome	Rhizosphere
505	3300046558	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere	Metagenome	Rhizosphere
506	3300046615	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere	Metagenome	Rhizosphere
507	3300046616	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere	Metagenome	Rhizosphere
508	3300046642	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere	Metagenome	Rhizosphere
509	3300046648	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere	Metagenome	Rhizosphere
510	3300046660	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere	Metagenome	Rhizosphere
511	3300046663	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere	Metagenome	Rhizosphere
512	3300046664	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere	Metagenome	Rhizosphere
513	3300046665	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere	Metagenome	Rhizosphere
514	3300046674	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere	Metagenome	Rhizosphere
515	3300046678	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere	Metagenome	Rhizosphere
516	3300046679	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere	Metagenome	Rhizosphere
517	3300046680	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere	Metagenome	Rhizosphere
518	3300046681	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere	Metagenome	Rhizosphere
519	3300046683	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere	Metagenome	Rhizosphere
520	3300046684	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere	Metagenome	Rhizosphere
521	3300046689	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere	Metagenome	Rhizosphere
522	3300046690	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere	Metagenome	Rhizosphere
523	3300046691	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere	Metagenome	Rhizosphere
524	3300046692	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere	Metagenome	Rhizosphere
525	3300046694	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere	Metagenome	Rhizosphere
526	3300046794	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere	Metagenome	Rhizosphere
527	3300046809	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere	Metagenome	Rhizosphere
528	3300046810	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere	Metagenome	Rhizosphere
529	3300047315	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere	Metagenome	Rhizosphere
530	3300047317	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere	Metagenome	Rhizosphere
531	3300047318	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere	Metagenome	Rhizosphere
532	3300047319	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere	Metagenome	Rhizosphere
533	3300047320	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere	Metagenome	Rhizosphere
534	3300047321	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere	Metagenome	Rhizosphere
535	3300047323	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere	Metagenome	Rhizosphere
536	3300047443	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere	Metagenome	Rhizosphere
537	3300047444	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere	Metagenome	Rhizosphere
538	3300047445	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere	Metagenome	Rhizosphere
539	3300047446	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere	Metagenome	Rhizosphere
540	3300047447	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere	Metagenome	Rhizosphere
541	3300047469	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere	Metagenome	Rhizosphere
542	3300047470	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere	Metagenome	Rhizosphere
543	3300047472	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere	Metagenome	Rhizosphere
544	3300047673	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere	Metagenome	Rhizosphere
545	3300048089	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere	Metagenome	Rhizosphere
546	3300048090	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere	Metagenome	Rhizosphere
547	3300048091	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere	Metagenome	Rhizosphere
548	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
549	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
550	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
551	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
552	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
553	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
554	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
555	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
556	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
557	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
558	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
559	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
560	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
561	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
562	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
563	3300048919	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled	Metagenome	Unclassified
564	3300048920	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15	Metagenome	Unclassified
565	3300048921	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15	Metagenome	Unclassified
566	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
567	3300048925	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled	Metagenome	Unclassified
568	3300048926	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled	Metagenome	Unclassified
569	3300048927	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15	Metagenome	Unclassified
570	3300048928	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15	Metagenome	Unclassified
571	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
572	3300049459	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere	Metagenome	Rhizosphere
573	3300049460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere	Metagenome	Rhizosphere
574	3300049513	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control	Metagenome	Rhizosphere
575	3300049514	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought	Metagenome	Rhizosphere
576	3300049523	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control	Metagenome	Rhizosphere
577	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
578	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
579	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
580	3300049578	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03	Metagenome	Rhizosphere
581	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
582	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
583	3300049584	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02	Metagenome	Rhizosphere
584	3300049587	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02	Metagenome	Rhizosphere
585	3300049588	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03	Metagenome	Rhizosphere
586	3300049589	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01	Metagenome	Rhizosphere
587	3300049665	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought	Metagenome	Rhizosphere
588	3300049679	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought	Metagenome	Rhizosphere
589	3300049741	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01	Metagenome	Rhizosphere
590	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
591	3300049743	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03	Metagenome	Rhizosphere
592	3300049759	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought	Metagenome	Rhizosphere
593	3300049766	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought	Metagenome	Rhizosphere
594	3300049775	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought	Metagenome	Rhizosphere
595	3300049776	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought	Metagenome	Rhizosphere
596	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
597	3300050489	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation	Metagenome	Endosphere
598	3300050490	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation	Metagenome	Endosphere
599	3300050491	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation	Metagenome	Endosphere
600	3300050492	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation	Metagenome	Endosphere
601	3300050493	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation	Metagenome	Endosphere
602	3300050494	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation	Metagenome	Endosphere
603	3300050495	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation	Metagenome	Endosphere
604	3300050496	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation	Metagenome	Endosphere
605	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
606	3300050508	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation	Metagenome	Rhizosphere
607	3300050510	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation	Metagenome	Rhizosphere
608	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
609	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
610	3300050516	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation	Metagenome	Endosphere
611	3300053077	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere	Metagenome	Rhizosphere
612	3300053078	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere	Metagenome	Rhizosphere
613	3300053079	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere	Metagenome	Endosphere
614	3300053080	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere	Metagenome	Endosphere
615	3300053084	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere	Metagenome	Rhizosphere
616	3300053085	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere	Metagenome	Rhizosphere
617	3300053088	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere	Metagenome	Endosphere
618	3300053090	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere	Metagenome	Endosphere
619	3300053092	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere	Metagenome	Endosphere
620	3300053108	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere	Metagenome	Endosphere
621	3300053110	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere	Metagenome	Endosphere
622	3300053117	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere	Metagenome	Endosphere
623	3300053121	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere	Metagenome	Endosphere
624	3300053122	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere	Metagenome	Endosphere
625	3300053125	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere	Metagenome	Endosphere
626	3300053134	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere	Metagenome	Endosphere
627	3300053136	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere	Metagenome	Endosphere
628	3300053138	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere	Metagenome	Endosphere
629	3300053139	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere	Metagenome	Endosphere
630	3300053141	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere	Metagenome	Endosphere
631	3300053153	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere	Metagenome	Endosphere
632	3300053156	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere	Metagenome	Endosphere
633	3300053161	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere	Metagenome	Endosphere
634	3300053177	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere	Metagenome	Endosphere
635	3300053178	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere	Metagenome	Endosphere
636	3300053729	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere	Metagenome	Endosphere
637	3300053730	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere	Metagenome	Endosphere
638	3300055283	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere	Metagenome	Endosphere
639	3300059421	Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810	Metagenome	Rhizosphere
640	8047673197	Telluria mixta LMG 11547	Isolate	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	94.57
Metatranscriptomes	1.02
Isolates	4.41

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	14.31
Nodule	0.75
Rhizoplane	2.69
Rhizosphere	74.34
Stem	0
Stem Tuber	0
Unclassified	7.91

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	SwRhRL2b_contig_1306698	2162886007	Bacteria	3940
2	SwRhRL2b_contig_509084	2162886007	Bacteria	934
3	JGI25155J39150_1000045	3300002704	Bacteria	85779
4	JGI25156J39149_1000054	3300002705	Bacteria	88728
5	JGI25162J39368_1003970	3300002737	Bacteria	3768
6	JGI25154J39366_1000083	3300002738	Bacteria	88728
7	JGI25154J39366_1001206	3300002738	Bacteria	9789
8	JGI25157J39369_1000208	3300002741	Bacteria	48951
9	JGI25152J39213_1002579	3300002773	Bacteria	6785
10	JGI25150J39212_1002242	3300002774	Bacteria	4906
11	JGI25150J39212_1005296	3300002774	Bacteria	2769
12	JGI25159J45721_1001029	3300002987	Bacteria	11977
13	JGI25159J45721_1002111	3300002987	Bacteria	7804
14	JGI25151J46595_10003350	3300003187	Bacteria	8879
15	JGI25153J46596_10012384	3300003215	Bacteria	3684
16	rootL2_10014620	3300003322	Bacteria	7420
17	JGI25160J50197_1000331	3300003354	Bacteria	32173
18	JGI25160J50197_1000446	3300003354	Bacteria	25789
19	JGI25160J50197_1003875	3300003354	Bacteria	6564
20	JGI25161J50226_1000064	3300003374	Bacteria	99448
21	JGI25161J50226_1000734	3300003374	Bacteria	12666
22	JGI25161J50226_1002857	3300003374	Bacteria	4221
23	Ga0006562J51391_1042917	3300003578	Bacteria	2008
24	Ga0055539_1008425	3300003752	Bacteria	1290
25	Ga0055532_1000099	3300003758	Bacteria	93811
26	Ga0055525_1000001	3300003759	Bacteria	1016948
27	Ga0055535_1000115	3300003761	Bacteria	86313
28	Ga0055535_1000123	3300003761	Bacteria	83521
29	Ga0055542_1000028	3300003762	Bacteria	251458
30	Ga0055529_1000015	3300003763	Bacteria	366950
31	Ga0055529_1000159	3300003763	Bacteria	93013
32	Ga0055526_1000007	3300003771	Bacteria	321998
33	Ga0055526_1000054	3300003771	Bacteria	113702
34	Ga0055526_1000885	3300003771	Bacteria	22279
35	Ga0055526_1003390	3300003771	Bacteria	10148
36	Ga0055526_1011491	3300003771	Bacteria	3978
37	Ga0055526_1020119	3300003771	Bacteria	2394
38	Ga0055526_1029198	3300003771	Bacteria	1644
39	Ga0055537_1000005	3300003773	Bacteria	160497
40	Ga0055537_1000043	3300003773	Bacteria	90816
41	Ga0055537_1000046	3300003773	Bacteria	88251
42	Ga0055537_1000068	3300003773	Bacteria	75642
43	Ga0055537_1003477	3300003773	Bacteria	4834
44	Ga0055537_1007444	3300003773	Bacteria	2638
45	Ga0055537_1008895	3300003773	Bacteria	2265
46	Ga0055524_1000012	3300003775	Bacteria	260384
47	Ga0055524_1000038	3300003775	Bacteria	162683
48	Ga0055524_1000467	3300003775	Bacteria	32384
49	Ga0055524_1006360	3300003775	Bacteria	5129
50	Ga0055524_1012222	3300003775	Bacteria	3307
51	Ga0055524_1013944	3300003775	Bacteria	3003
52	Ga0055524_1022864	3300003775	Bacteria	2028
53	Ga0055524_1024771	3300003775	Bacteria	1893
54	Ga0055534_1000080	3300003784	Bacteria	75642
55	Ga0055534_1000127	3300003784	Bacteria	57100
56	Ga0055534_1001049	3300003784	Bacteria	12013
57	Ga0055534_1007706	3300003784	Bacteria	2526
58	Ga0055528_1000063	3300003790	Bacteria	85587
59	Ga0055528_1000159	3300003790	Bacteria	56331
60	Ga0055528_1000520	3300003790	Bacteria	30143
61	Ga0055528_1002287	3300003790	Bacteria	10381
62	Ga0055530_10017831	3300003791	Bacteria	2209
63	Ga0055530_10021566	3300003791	Bacteria	1895
64	Ga0055530_10021948	3300003791	Bacteria	1868
65	Ga0055530_10023367	3300003791	Bacteria	1778
66	Ga0055540_1017655	3300003792	Bacteria	1984
67	Ga0055531_10049383	3300003794	Bacteria	1124
68	Ga0055531_10049412	3300003794	Bacteria	1124
69	Ga0055531_10073154	3300003794	Bacteria	782
70	Ga0055543_1000284	3300004625	Bacteria	36825
71	Ga0055543_1001698	3300004625	Bacteria	8318
72	Ga0055543_1003201	3300004625	Bacteria	4979
73	Ga0055543_1032914	3300004625	Bacteria	898
74	Ga0055543_1032919	3300004625	Bacteria	898
75	Ga0065165_1000034	3300005262	Bacteria	214644
76	Ga0065165_1000233	3300005262	Bacteria	96768
77	Ga0065165_1003016	3300005262	Bacteria	12704
78	Ga0065165_1018435	3300005262	Bacteria	2526
79	Ga0065165_1021614	3300005262	Bacteria	2230
80	Ga0065165_1074008	3300005262	Bacteria	898
81	Ga0065165_1074022	3300005262	Bacteria	898
82	Ga0065714_10008082	3300005288	Bacteria	4227
83	Ga0065714_10069048	3300005288	Bacteria	4414
84	Ga0065714_10115433	3300005288	Bacteria	1416
85	Ga0065714_10118388	3300005288	Bacteria	1379
86	Ga0065714_10218600	3300005288	Bacteria	837
87	Ga0065704_10074085	3300005289	Bacteria	6551
88	Ga0065712_10210356	3300005290	Bacteria	1060
89	Ga0065715_10120870	3300005293	Bacteria	2246
90	Ga0070658_10066568	3300005327	Bacteria	2943
91	Ga0070658_10149795	3300005327	Bacteria	1953
92	Ga0070658_10328054	3300005327	Bacteria	1307
93	Ga0070676_10122784	3300005328	Bacteria	1632
94	Ga0070690_100027408	3300005330	Bacteria	3522
95	Ga0070690_100066571	3300005330	Bacteria	2332
96	Ga0070670_100002673	3300005331	Bacteria	14724
97	Ga0070670_100028403	3300005331	Bacteria	4814
98	Ga0070670_100064997	3300005331	Bacteria	3130
99	Ga0070670_100149079	3300005331	Bacteria	2024
100	Ga0070670_100187648	3300005331	Bacteria	1795
101	Ga0070670_100530685	3300005331	Bacteria	1049
102	Ga0070677_10108307	3300005333	Bacteria	1236
103	Ga0068869_100000492	3300005334	Bacteria	21961
104	Ga0068869_100108707	3300005334	Bacteria	2107
105	Ga0068869_100148901	3300005334	Bacteria	1814
106	Ga0068869_100697351	3300005334	Bacteria	865
107	Ga0070666_10106830	3300005335	Bacteria	1933
108	Ga0070680_100076925	3300005336	Bacteria	2748
109	Ga0070680_100313678	3300005336	Bacteria	1331
110	Ga0068868_100143982	3300005338	Bacteria	1959
111	Ga0068868_100593153	3300005338	Bacteria	981
112	Ga0068868_100720317	3300005338	Bacteria	894
113	Ga0070660_100008707	3300005339	Bacteria	7103
114	Ga0070660_100016021	3300005339	Bacteria	5430
115	Ga0070689_100079545	3300005340	Bacteria	2571
116	Ga0070687_100047149	3300005343	Bacteria	2209
117	Ga0070661_100017505	3300005344	Bacteria	5086
118	Ga0070661_100140107	3300005344	Bacteria	1822
119	Ga0070661_100848188	3300005344	Bacteria	752
120	Ga0070692_10071435	3300005345	Bacteria	1850
121	Ga0070692_10147454	3300005345	Bacteria	1337
122	Ga0070668_100005466	3300005347	Bacteria	9432
123	Ga0070668_100023220	3300005347	Bacteria	4691
124	Ga0070668_100686841	3300005347	Bacteria	902
125	Ga0070669_100042568	3300005353	Bacteria	3305
126	Ga0070675_100003762	3300005354	Bacteria	11520
127	Ga0070675_100039354	3300005354	Bacteria	3858
128	Ga0070675_100066280	3300005354	Bacteria	2986
129	Ga0070675_100357302	3300005354	Bacteria	1296
130	Ga0070675_100514219	3300005354	Bacteria	1080
131	Ga0070671_100057372	3300005355	Bacteria	3240
132	Ga0070671_100349676	3300005355	Bacteria	1261
133	Ga0070674_100158641	3300005356	Bacteria	1714
134	Ga0070674_100190454	3300005356	Bacteria	1578
135	Ga0070674_100923377	3300005356	Bacteria	762
136	Ga0070673_100052053	3300005364	Bacteria	3211
137	Ga0070673_100060311	3300005364	Bacteria	3006
138	Ga0070673_100061792	3300005364	Bacteria	2973
139	Ga0070688_100318070	3300005365	Bacteria	1130
140	Ga0070688_100403010	3300005365	Bacteria	1013
141	Ga0070659_100000456	3300005366	Bacteria	30202
142	Ga0070659_100098672	3300005366	Bacteria	2349
143	Ga0070659_100293269	3300005366	Bacteria	1355
144	Ga0070667_100137940	3300005367	Bacteria	2133
145	Ga0070667_100179349	3300005367	Bacteria	1873
146	Ga0070667_100219334	3300005367	Bacteria	1693
147	Ga0070667_100721477	3300005367	Bacteria	923
148	Ga0070714_100582861	3300005435	Bacteria	1073
149	Ga0070701_10040180	3300005438	Bacteria	2377
150	Ga0070700_100145693	3300005441	Bacteria	1614
151	Ga0070700_100201396	3300005441	Bacteria	1399
152	Ga0070694_100708484	3300005444	Bacteria	819
153	Ga0070694_100760738	3300005444	Bacteria	792
154	Ga0070708_100371715	3300005445	Bacteria	1348
155	Ga0070663_100730636	3300005455	Bacteria	844
156	Ga0070678_100018733	3300005456	Bacteria	4494
157	Ga0070678_100028455	3300005456	Bacteria	3812
158	Ga0070678_100063692	3300005456	Bacteria	2729
159	Ga0070678_100171986	3300005456	Bacteria	1765
160	Ga0070678_100407961	3300005456	Bacteria	1182
161	Ga0070662_100134737	3300005457	Bacteria	1908
162	Ga0070662_100220990	3300005457	Bacteria	1511
163	Ga0070662_100280255	3300005457	Bacteria	1349
164	Ga0070662_100381310	3300005457	Bacteria	1160
165	Ga0068867_100015366	3300005459	Bacteria	5429
166	Ga0068867_100068818	3300005459	Bacteria	2642
167	Ga0068867_100227633	3300005459	Bacteria	1505
168	Ga0068867_100264712	3300005459	Bacteria	1403
169	Ga0068867_100515921	3300005459	Bacteria	1030
170	Ga0068867_100615376	3300005459	Bacteria	949
171	Ga0070685_10043564	3300005466	Bacteria	2566
172	Ga0070698_100010835	3300005471	Bacteria	9702
173	Ga0070679_100333372	3300005530	Bacteria	1466
174	Ga0068853_100315577	3300005539	Bacteria	1448
175	Ga0070672_100065748	3300005543	Bacteria	2869
176	Ga0070672_100067616	3300005543	Bacteria	2832
177	Ga0070672_100102877	3300005543	Bacteria	2319
178	Ga0070672_100407247	3300005543	Bacteria	1166
179	Ga0070686_100042934	3300005544	Bacteria	2834
180	Ga0070686_100525628	3300005544	Bacteria	922
181	Ga0070665_100028940	3300005548	Bacteria	5577
182	Ga0070665_100072441	3300005548	Bacteria	3453
183	Ga0070704_101006955	3300005549	Bacteria	754
184	Ga0068855_100059076	3300005563	Bacteria	4488
185	Ga0068855_100120767	3300005563	Bacteria	2999
186	Ga0068855_100161127	3300005563	Bacteria	2546
187	Ga0068855_100308135	3300005563	Bacteria	1752
188	Ga0068855_100321407	3300005563	Bacteria	1710
189	Ga0068855_100694517	3300005563	Bacteria	1089
190	Ga0068855_100819405	3300005563	Bacteria	988
191	Ga0070664_100049799	3300005564	Bacteria	3543
192	Ga0070664_100083686	3300005564	Bacteria	2753
193	Ga0070664_100088236	3300005564	Bacteria	2682
194	Ga0070664_100091541	3300005564	Bacteria	2632
195	Ga0070664_100185331	3300005564	Bacteria	1852
196	Ga0070664_100271136	3300005564	Bacteria	1529
197	Ga0070664_100384500	3300005564	Bacteria	1281
198	Ga0068857_100001302	3300005577	Bacteria	19609
199	Ga0068857_100317281	3300005577	Bacteria	1439
200	Ga0068854_100073039	3300005578	Bacteria	2513
201	Ga0068854_100100719	3300005578	Bacteria	2166
202	Ga0068854_100763546	3300005578	Bacteria	840
203	Ga0068856_100000748	3300005614	Bacteria	35225
204	Ga0068856_100189791	3300005614	Bacteria	2069
205	Ga0070702_100183294	3300005615	Bacteria	1372
206	Ga0068852_100277164	3300005616	Bacteria	1615
207	Ga0068852_100393089	3300005616	Bacteria	1362
208	Ga0068852_100438792	3300005616	Bacteria	1291
209	Ga0068859_100004203	3300005617	Bacteria	14701
210	Ga0068859_100043409	3300005617	Bacteria	4518
211	Ga0068859_100376173	3300005617	Bacteria	1516
212	Ga0068859_100708574	3300005617	Bacteria	1097
213	Ga0068859_100730213	3300005617	Bacteria	1080
214	Ga0068864_100001909	3300005618	Bacteria	17108
215	Ga0068864_100067928	3300005618	Bacteria	3096
216	Ga0068864_100110129	3300005618	Bacteria	2452
217	Ga0068861_100035999	3300005719	Bacteria	3671
218	Ga0068861_100045143	3300005719	Bacteria	3316
219	Ga0068851_10013697	3300005834	Bacteria	3839
220	Ga0068870_10080809	3300005840	Bacteria	1796
221	Ga0068863_100003624	3300005841	Bacteria	15249
222	Ga0068863_100039081	3300005841	Bacteria	4516
223	Ga0068863_100319274	3300005841	Bacteria	1508
224	Ga0068863_100531105	3300005841	Bacteria	1160
225	Ga0068863_100600971	3300005841	Bacteria	1089
226	Ga0068858_100019496	3300005842	Bacteria	6343
227	Ga0068858_100022639	3300005842	Bacteria	5860
228	Ga0068858_100915254	3300005842	Bacteria	858
229	Ga0068860_100101198	3300005843	Bacteria	2749
230	Ga0068860_100260942	3300005843	Bacteria	1689
231	Ga0068862_100429806	3300005844	Bacteria	1241
232	Ga0075365_10002031	3300006038	Bacteria	9618
233	Ga0075365_10021862	3300006038	Bacteria	3997
234	Ga0075365_10071626	3300006038	Bacteria	2334
235	Ga0075368_10009041	3300006042	Bacteria	3576
236	Ga0075363_100007021	3300006048	Bacteria	5149
237	Ga0075363_100090335	3300006048	Bacteria	1685
238	Ga0075364_10007877	3300006051	Bacteria	6344
239	Ga0075364_10038410	3300006051	Bacteria	3101
240	Ga0075364_10199447	3300006051	Bacteria	1356
241	Ga0075364_10204004	3300006051	Bacteria	1340
242	Ga0075432_10000955	3300006058	Bacteria	9132
243	Ga0075432_10005523	3300006058	Bacteria	4307
244	Ga0075362_10010930	3300006177	Bacteria	3562
245	Ga0075362_10021605	3300006177	Bacteria	2704
246	Ga0075362_10030744	3300006177	Bacteria	2319
247	Ga0075362_10038048	3300006177	Bacteria	2112
248	Ga0075367_10065153	3300006178	Bacteria	2181
249	Ga0075367_10226823	3300006178	Bacteria	1170
250	Ga0075369_10003025	3300006186	Bacteria	6079
251	Ga0075369_10005152	3300006186	Bacteria	4870
252	Ga0075369_10032712	3300006186	Bacteria	2201
253	Ga0075369_10069955	3300006186	Bacteria	1544
254	Ga0075366_10003336	3300006195	Bacteria	8450
255	Ga0075366_10011755	3300006195	Bacteria	4950
256	Ga0075366_10026452	3300006195	Bacteria	3399
257	Ga0075366_10030973	3300006195	Bacteria	3147
258	Ga0075366_10031880	3300006195	Bacteria	3102
259	Ga0075366_10106714	3300006195	Bacteria	1684
260	Ga0075366_10119712	3300006195	Bacteria	1586
261	Ga0075366_10173468	3300006195	Bacteria	1309
262	Ga0097621_100003378	3300006237	Bacteria	10987
263	Ga0097621_100527097	3300006237	Bacteria	1073
264	Ga0097621_100670109	3300006237	Bacteria	953
265	Ga0075370_10003278	3300006353	Bacteria	7677
266	Ga0075370_10006560	3300006353	Bacteria	5863
267	Ga0075370_10012403	3300006353	Bacteria	4503
268	Ga0075370_10256475	3300006353	Bacteria	1037
269	Ga0075370_10296164	3300006353	Bacteria	962
270	Ga0075428_100444540	3300006844	Bacteria	1389
271	Ga0075431_100003705	3300006847	Bacteria	14849
272	Ga0075431_100006058	3300006847	Bacteria	11988
273	Ga0075431_100323389	3300006847	Bacteria	1555
274	Ga0075431_100697715	3300006847	Bacteria	993
275	Ga0075434_100237856	3300006871	Bacteria	1841
276	Ga0075429_100000326	3300006880	Bacteria	34334
277	Ga0075429_100101170	3300006880	Bacteria	2516
278	Ga0068865_100083640	3300006881	Bacteria	2297
279	Ga0068865_100187172	3300006881	Bacteria	1598
280	Ga0068865_100687832	3300006881	Bacteria	873
281	Ga0097620_100004203	3300006931	Bacteria	14701
282	Ga0097620_100043409	3300006931	Bacteria	4518
283	Ga0097620_100376142	3300006931	Bacteria	1516
284	Ga0097620_100708606	3300006931	Bacteria	1097
285	Ga0097620_100730261	3300006931	Bacteria	1080
286	Ga0099823_1022095	3300006944	Bacteria	5906
287	Ga0079104_1000034	3300006946	Bacteria	199368
288	Ga0079104_1045583	3300006946	Bacteria	1000
289	Ga0099826_10000008	3300006948	Bacteria	380974
290	Ga0099826_10000158	3300006948	Bacteria	28172
291	Ga0099826_10200163	3300006948	Bacteria	1094
292	Ga0105251_10057022	3300009011	Bacteria	1847
293	Ga0105244_10000631	3300009036	Bacteria	31164
294	Ga0105244_10000730	3300009036	Bacteria	28251
295	Ga0105244_10001568	3300009036	Bacteria	18161
296	Ga0105244_10030858	3300009036	Bacteria	2848
297	Ga0105244_10054716	3300009036	Bacteria	2024
298	Ga0105244_10065396	3300009036	Bacteria	1822
299	Ga0105250_10012732	3300009092	Bacteria	3465
300	Ga0105240_10001225	3300009093	Bacteria	44616
301	Ga0105240_10002667	3300009093	Bacteria	28399
302	Ga0105240_10032761	3300009093	Bacteria	6724
303	Ga0105240_10034597	3300009093	Bacteria	6516
304	Ga0105240_10038896	3300009093	Bacteria	6098
305	Ga0105240_11025539	3300009093	Bacteria	881
306	Ga0111539_10151246	3300009094	Bacteria	2717
307	Ga0111539_10256613	3300009094	Bacteria	2036
308	Ga0105245_10040363	3300009098	Bacteria	4157
309	Ga0105245_10093546	3300009098	Bacteria	2770
310	Ga0105245_10184861	3300009098	Bacteria	1993
311	Ga0105245_10318769	3300009098	Bacteria	1531
312	Ga0105245_10392655	3300009098	Bacteria	1385
313	Ga0105247_10580439	3300009101	Bacteria	828
314	Ga0114129_10008954	3300009147	Bacteria	14267
315	Ga0105243_10000392	3300009148	Bacteria	46166
316	Ga0105243_10002832	3300009148	Bacteria	14397
317	Ga0105243_10006138	3300009148	Bacteria	9293
318	Ga0105243_10052781	3300009148	Bacteria	3222
319	Ga0105243_10103814	3300009148	Bacteria	2364
320	Ga0105243_10218403	3300009148	Bacteria	1683
321	Ga0105243_10478944	3300009148	Bacteria	1174
322	Ga0105241_10030171	3300009174	Bacteria	4051
323	Ga0105241_10042024	3300009174	Bacteria	3457
324	Ga0105242_10004957	3300009176	Bacteria	10300
325	Ga0105248_10005948	3300009177	Bacteria	13399
326	Ga0105248_10051154	3300009177	Bacteria	4636
327	Ga0105248_10185122	3300009177	Bacteria	2347
328	Ga0105248_10598571	3300009177	Bacteria	1244
329	Ga0105237_10007850	3300009545	Bacteria	11633
330	Ga0105238_10061265	3300009551	Bacteria	3766
331	Ga0105238_10576346	3300009551	Bacteria	1131
332	Ga0105249_10193650	3300009553	Bacteria	1985
333	Ga0105239_10019525	3300010375	Bacteria	7481
334	Ga0105239_10043053	3300010375	Bacteria	4948
335	Ga0105239_10122601	3300010375	Bacteria	2888
336	Ga0105246_10040239	3300011119	Bacteria	3154
337	Ga0157319_1000013	3300012497	Bacteria	154883
338	Ga0157373_10034715	3300013100	Bacteria	3623
339	Ga0157373_10200505	3300013100	Bacteria	1407
340	Ga0157370_10053116	3300013104	Bacteria	3865
341	Ga0157370_10081600	3300013104	Bacteria	3042
342	Ga0157370_10633257	3300013104	Bacteria	978
343	Ga0157369_10005435	3300013105	Bacteria	14814
344	Ga0157369_10082919	3300013105	Bacteria	3430
345	Ga0157369_10298042	3300013105	Bacteria	1678
346	Ga0157374_10032164	3300013296	Bacteria	4775
347	Ga0157374_10225821	3300013296	Bacteria	1839
348	Ga0157374_10397803	3300013296	Bacteria	1374
349	Ga0157378_10227091	3300013297	Bacteria	1777
350	Ga0157378_10346050	3300013297	Bacteria	1451
351	Ga0157378_10533894	3300013297	Bacteria	1176
352	Ga0163162_11045192	3300013306	Bacteria	924
353	Ga0163162_11417413	3300013306	Bacteria	791
354	Ga0157372_10393160	3300013307	Bacteria	1616
355	Ga0157372_11082902	3300013307	Bacteria	927
356	Ga0157375_10005919	3300013308	Bacteria	10659
357	Ga0157375_10175494	3300013308	Bacteria	2292
358	Ga0157375_10178704	3300013308	Bacteria	2273
359	Ga0157375_10244621	3300013308	Bacteria	1954
360	Ga0157375_10246644	3300013308	Bacteria	1946
361	Ga0157375_10494142	3300013308	Bacteria	1388
362	Ga0157375_10723555	3300013308	Bacteria	1148
363	Ga0163163_10005831	3300014325	Bacteria	10709
364	Ga0163163_10417956	3300014325	Bacteria	1400
365	Ga0163163_10710808	3300014325	Bacteria	1068
366	Ga0157380_10326419	3300014326	Bacteria	1425
367	Ga0157380_11165381	3300014326	Bacteria	813
368	Ga0182008_10008176	3300014497	Bacteria	5725
369	Ga0182008_10016915	3300014497	Bacteria	3783
370	Ga0182008_10072366	3300014497	Bacteria	1696
371	Ga0182008_10121291	3300014497	Bacteria	1299
372	Ga0157377_10000029	3300014745	Bacteria	134270
373	Ga0157379_10086742	3300014968	Bacteria	2806
374	Ga0157376_10003300	3300014969	Bacteria	11110
375	Ga0157376_10005167	3300014969	Bacteria	9103
376	Ga0157376_10363339	3300014969	Bacteria	1389
377	Ga0157376_10839875	3300014969	Bacteria	933
378	Ga0182006_1000007	3300015261	Bacteria	452190
379	Ga0182006_1000023	3300015261	Bacteria	275031
380	Ga0182006_1000910	3300015261	Bacteria	19716
381	Ga0182006_1030379	3300015261	Bacteria	2184
382	Ga0182006_1069705	3300015261	Bacteria	1306
383	Ga0182007_10000022	3300015262	Bacteria	189018
384	Ga0182007_10000340	3300015262	Bacteria	29721
385	Ga0182005_1000006	3300015265	Bacteria	515188
386	Ga0182005_1000010	3300015265	Bacteria	434103
387	Ga0183362_10001	3300015683	Bacteria	2046624
388	Ga0163161_10000441	3300017792	Bacteria	34632
389	Ga0163161_10007311	3300017792	Bacteria	7620
390	Ga0163161_10092976	3300017792	Bacteria	2234
391	Ga0163161_10095045	3300017792	Bacteria	2210
392	Ga0163161_10146329	3300017792	Bacteria	1792
393	Ga0163161_10157368	3300017792	Bacteria	1730
394	Ga0213872_10000087	3300021361	Bacteria	84858
395	Ga0213872_10000139	3300021361	Bacteria	65459
396	Ga0213872_10000157	3300021361	Bacteria	62892
397	Ga0213872_10000166	3300021361	Bacteria	59987
398	Ga0213872_10000703	3300021361	Bacteria	25156
399	Ga0213872_10067364	3300021361	Bacteria	1616
400	Ga0213872_10129573	3300021361	Bacteria	1112
401	Ga0209435_100034	3300025206	Bacteria	144486
402	Ga0209436_100040	3300025208	Bacteria	75392
403	Ga0209436_104332	3300025208	Bacteria	3528
404	Ga0209436_104684	3300025208	Bacteria	3324
405	Ga0209672_101025	3300025228	Bacteria	12108
406	Ga0209147_100004	3300025229	Bacteria	1371850
407	Ga0209147_100906	3300025229	Bacteria	13388
408	Ga0209563_100007	3300025230	Bacteria	1579402
409	Ga0209437_100072	3300025233	Bacteria	305152
410	Ga0209437_101483	3300025233	Bacteria	5640
411	Ga0209258_100060	3300025242	Bacteria	319881
412	Ga0209258_100067	3300025242	Bacteria	287603
413	Ga0209258_100617	3300025242	Bacteria	28339
414	Ga0207425_1000009	3300025245	Bacteria	593135
415	Ga0207425_1000036	3300025245	Bacteria	225783
416	Ga0207425_1001550	3300025245	Bacteria	9376
417	Ga0207425_1004878	3300025245	Bacteria	3930
418	Ga0207425_1019059	3300025245	Bacteria	1483
419	Ga0207425_1028724	3300025245	Bacteria	1126
420	Ga0209646_1000042	3300025246	Bacteria	343923
421	Ga0209646_1000118	3300025246	Bacteria	149446
422	Ga0209026_1000106	3300025250	Bacteria	149446
423	Ga0209677_102284	3300025253	Bacteria	7391
424	Ga0209677_103806	3300025253	Bacteria	4677
425	Ga0209148_1000067	3300025254	Bacteria	338678
426	Ga0209759_1000190	3300025256	Bacteria	97956
427	Ga0209759_1000282	3300025256	Bacteria	71259
428	Ga0209129_1000051	3300025258	Bacteria	267104
429	Ga0209129_1000296	3300025258	Bacteria	46753
430	Ga0209129_1001419	3300025258	Bacteria	13384
431	Ga0209129_1012173	3300025258	Bacteria	1996
432	Ga0209129_1019010	3300025258	Bacteria	1307
433	Ga0209565_1000004	3300025263	Bacteria	983150
434	Ga0209565_1000073	3300025263	Bacteria	164695
435	Ga0209565_1000074	3300025263	Bacteria	164237
436	Ga0209565_1000662	3300025263	Bacteria	21980
437	Ga0209565_1001352	3300025263	Bacteria	11094
438	Ga0209565_1001767	3300025263	Bacteria	8797
439	Ga0209455_1000031	3300025272	Bacteria	519952
440	Ga0209455_1000136	3300025272	Bacteria	146375
441	Ga0209673_1000127	3300025273	Bacteria	164695
442	Ga0209673_1000129	3300025273	Bacteria	164238
443	Ga0209673_1000221	3300025273	Bacteria	112739
444	Ga0209673_1010219	3300025273	Bacteria	3976
445	Ga0209130_1000016	3300025284	Bacteria	395540
446	Ga0209130_1000094	3300025284	Bacteria	145569
447	Ga0209130_1000217	3300025284	Bacteria	75515
448	Ga0209130_1000827	3300025284	Bacteria	26056
449	Ga0209130_1039874	3300025284	Bacteria	912
450	Ga0209675_1000029	3300025291	Bacteria	281053
451	Ga0209675_1000061	3300025291	Bacteria	181096
452	Ga0209675_1000072	3300025291	Bacteria	164237
453	Ga0209675_1000839	3300025291	Bacteria	20131
454	Ga0209675_1001859	3300025291	Bacteria	11450
455	Ga0209675_1002958	3300025291	Bacteria	8382
456	Ga0209675_1043247	3300025291	Bacteria	971
457	Ga0209676_1000098	3300025292	Bacteria	234305
458	Ga0209676_1000123	3300025292	Bacteria	195351
459	Ga0209025_1000104	3300025294	Bacteria	226895
460	Ga0209025_1004319	3300025294	Bacteria	12434
461	Ga0209025_1006691	3300025294	Bacteria	8847
462	Ga0209025_1007278	3300025294	Bacteria	8307
463	Ga0209025_1020430	3300025294	Bacteria	3625
464	Ga0209025_1058269	3300025294	Bacteria	1468
465	Ga0209025_1064996	3300025294	Bacteria	1336
466	Ga0209564_1000010	3300025295	Bacteria	885399
467	Ga0209564_1000042	3300025295	Bacteria	392805
468	Ga0209564_1000160	3300025295	Bacteria	164214
469	Ga0209564_1000172	3300025295	Bacteria	155715
470	Ga0209564_1000681	3300025295	Bacteria	50123
471	Ga0209564_1000734	3300025295	Bacteria	46683
472	Ga0209564_1002295	3300025295	Bacteria	15586
473	Ga0209564_1009057	3300025295	Bacteria	4795
474	Ga0209564_1024136	3300025295	Bacteria	2086
475	Ga0209758_1000050	3300025297	Bacteria	345008
476	Ga0209758_1000054	3300025297	Bacteria	337655
477	Ga0209758_1000379	3300025297	Bacteria	77337
478	Ga0209758_1027259	3300025297	Bacteria	2446
479	Ga0209758_1053220	3300025297	Bacteria	1392
480	Ga0209050_1000040	3300025298	Bacteria	408492
481	Ga0209050_1000188	3300025298	Bacteria	138865
482	Ga0209050_1000309	3300025298	Bacteria	99432
483	Ga0209050_1003348	3300025298	Bacteria	11947
484	Ga0209050_1006588	3300025298	Bacteria	6819
485	Ga0209050_1040010	3300025298	Bacteria	1313
486	Ga0209256_1000001	3300025299	Bacteria	2166974
487	Ga0209256_1000018	3300025299	Bacteria	568467
488	Ga0209256_1000023	3300025299	Bacteria	461150
489	Ga0209256_1000125	3300025299	Bacteria	165336
490	Ga0209256_1000307	3300025299	Bacteria	85852
491	Ga0209256_1000553	3300025299	Bacteria	53682
492	Ga0209256_1001137	3300025299	Bacteria	30308
493	Ga0209256_1001737	3300025299	Bacteria	20841
494	Ga0209256_1001812	3300025299	Bacteria	20078
495	Ga0207426_1000025	3300025302	Bacteria	532921
496	Ga0207426_1000202	3300025302	Bacteria	143712
497	Ga0207426_1001267	3300025302	Bacteria	22033
498	Ga0207426_1087482	3300025302	Bacteria	831
499	Ga0209051_1000091	3300025303	Bacteria	173683
500	Ga0209051_1000098	3300025303	Bacteria	165284
501	Ga0209051_1000298	3300025303	Bacteria	78777
502	Ga0209051_1006395	3300025303	Bacteria	6647
503	Ga0209051_1009224	3300025303	Bacteria	5106
504	Ga0209051_1064873	3300025303	Bacteria	1129
505	Ga0209257_1000054	3300025304	Bacteria	416957
506	Ga0209257_1001091	3300025304	Bacteria	35384
507	Ga0209257_1001249	3300025304	Bacteria	31428
508	Ga0209257_1005944	3300025304	Bacteria	8198
509	Ga0209257_1079162	3300025304	Bacteria	847
510	Ga0207697_10005112	3300025315	Bacteria	6141
511	Ga0207656_10027007	3300025321	Bacteria	2345
512	Ga0207696_1010406	3300025711	Bacteria	3409
513	Ga0207655_1001409	3300025728	Bacteria	22356
514	Ga0207655_1002256	3300025728	Bacteria	15935
515	Ga0207655_1002948	3300025728	Bacteria	13082
516	Ga0207655_1009228	3300025728	Bacteria	6153
517	Ga0207655_1042961	3300025728	Bacteria	1918
518	Ga0207655_1081238	3300025728	Bacteria	1169
519	Ga0207682_10005184	3300025893	Bacteria	5335
520	Ga0207642_10055604	3300025899	Bacteria	1811
521	Ga0207710_10121369	3300025900	Bacteria	1248
522	Ga0207688_10008591	3300025901	Bacteria	5560
523	Ga0207688_10073008	3300025901	Bacteria	1950
524	Ga0207688_10125964	3300025901	Bacteria	1498
525	Ga0207688_10607084	3300025901	Bacteria	690
526	Ga0207680_10240595	3300025903	Bacteria	1247
527	Ga0207680_10314256	3300025903	Bacteria	1094
528	Ga0207699_10380839	3300025906	Bacteria	1001
529	Ga0207645_10036449	3300025907	Bacteria	3157
530	Ga0207645_10327401	3300025907	Bacteria	1023
531	Ga0207643_10011009	3300025908	Bacteria	4881
532	Ga0207705_10077856	3300025909	Bacteria	2412
533	Ga0207705_10198265	3300025909	Bacteria	1520
534	Ga0207705_10300250	3300025909	Bacteria	1232
535	Ga0207654_10049560	3300025911	Bacteria	2409
536	Ga0207654_10524333	3300025911	Bacteria	839
537	Ga0207695_10005170	3300025913	Bacteria	17468
538	Ga0207695_10010892	3300025913	Bacteria	11069
539	Ga0207695_10019098	3300025913	Bacteria	7905
540	Ga0207695_10023486	3300025913	Bacteria	6964
541	Ga0207695_10070967	3300025913	Bacteria	3558
542	Ga0207695_10412653	3300025913	Bacteria	1235
543	Ga0207671_10118751	3300025914	Bacteria	2020
544	Ga0207662_10085775	3300025918	Bacteria	1928
545	Ga0207662_10138765	3300025918	Bacteria	1538
546	Ga0207662_10147284	3300025918	Bacteria	1495
547	Ga0207657_10001579	3300025919	Bacteria	24470
548	Ga0207657_10018104	3300025919	Bacteria	6739
549	Ga0207657_10025513	3300025919	Bacteria	5449
550	Ga0207657_10214428	3300025919	Bacteria	1544
551	Ga0207649_10015582	3300025920	Bacteria	4270
552	Ga0207649_10209244	3300025920	Bacteria	1382
553	Ga0207649_10354759	3300025920	Bacteria	1086
554	Ga0207649_10992981	3300025920	Bacteria	660
555	Ga0207652_10022988	3300025921	Bacteria	5165
556	Ga0207681_10066241	3300025923	Bacteria	2500
557	Ga0207681_10181944	3300025923	Bacteria	1602
558	Ga0207681_10294784	3300025923	Bacteria	1281
559	Ga0207694_10055579	3300025924	Bacteria	3073
560	Ga0207694_10194304	3300025924	Bacteria	1649
561	Ga0207694_10247970	3300025924	Bacteria	1456
562	Ga0207694_10289665	3300025924	Bacteria	1346
563	Ga0207650_10007503	3300025925	Bacteria	7436
564	Ga0207650_10062409	3300025925	Bacteria	2784
565	Ga0207650_10064331	3300025925	Bacteria	2745
566	Ga0207650_10152410	3300025925	Bacteria	1825
567	Ga0207650_10188295	3300025925	Bacteria	1648
568	Ga0207650_10346520	3300025925	Bacteria	1221
569	Ga0207650_10399384	3300025925	Bacteria	1137
570	Ga0207650_10598537	3300025925	Bacteria	927
571	Ga0207650_10709438	3300025925	Bacteria	850
572	Ga0207659_10022051	3300025926	Bacteria	4237
573	Ga0207659_10088804	3300025926	Bacteria	2303
574	Ga0207687_10275078	3300025927	Bacteria	1347
575	Ga0207687_10346692	3300025927	Bacteria	1209
576	Ga0207687_10363306	3300025927	Bacteria	1182
577	Ga0207687_10390513	3300025927	Bacteria	1142
578	Ga0207664_10374537	3300025929	Bacteria	1263
579	Ga0207644_10396146	3300025931	Bacteria	1128
580	Ga0207690_10288701	3300025932	Bacteria	1280
581	Ga0207690_10556229	3300025932	Bacteria	933
582	Ga0207706_10006375	3300025933	Bacteria	10957
583	Ga0207706_10022691	3300025933	Bacteria	5634
584	Ga0207706_10317414	3300025933	Bacteria	1356
585	Ga0207686_10023539	3300025934	Bacteria	3559
586	Ga0207709_10000019	3300025935	Bacteria	402225
587	Ga0207709_10000130	3300025935	Bacteria	110843
588	Ga0207709_10002008	3300025935	Bacteria	13202
589	Ga0207709_10085497	3300025935	Bacteria	2045
590	Ga0207709_10115986	3300025935	Bacteria	1800
591	Ga0207709_10217772	3300025935	Bacteria	1375
592	Ga0207709_10335788	3300025935	Bacteria	1136
593	Ga0207670_10189199	3300025936	Bacteria	1556
594	Ga0207670_10946399	3300025936	Bacteria	723
595	Ga0207669_10156545	3300025937	Bacteria	1603
596	Ga0207704_10036911	3300025938	Bacteria	2817
597	Ga0207704_10485112	3300025938	Bacteria	993
598	Ga0207691_10008219	3300025940	Bacteria	10024
599	Ga0207691_10078797	3300025940	Bacteria	2965
600	Ga0207711_10024546	3300025941	Bacteria	5053
601	Ga0207711_10495224	3300025941	Bacteria	1139
602	Ga0207689_10000320	3300025942	Bacteria	44520
603	Ga0207689_10047496	3300025942	Bacteria	3544
604	Ga0207689_10135955	3300025942	Bacteria	2024
605	Ga0207689_10305214	3300025942	Bacteria	1319
606	Ga0207679_10028672	3300025945	Bacteria	3866
607	Ga0207679_10056475	3300025945	Bacteria	2898
608	Ga0207679_10103535	3300025945	Bacteria	2231
609	Ga0207679_10377782	3300025945	Bacteria	1241
610	Ga0207679_10678106	3300025945	Bacteria	934
611	Ga0207679_11193944	3300025945	Bacteria	698
612	Ga0207667_10049546	3300025949	Bacteria	4436
613	Ga0207667_10086607	3300025949	Bacteria	3242
614	Ga0207667_10094500	3300025949	Bacteria	3087
615	Ga0207667_10136832	3300025949	Bacteria	2522
616	Ga0207667_10153920	3300025949	Bacteria	2366
617	Ga0207667_10377163	3300025949	Bacteria	1445
618	Ga0207667_10775809	3300025949	Bacteria	957
619	Ga0207651_10000343	3300025960	Bacteria	19827
620	Ga0207651_10103229	3300025960	Bacteria	2121
621	Ga0207651_10141409	3300025960	Bacteria	1859
622	Ga0207651_10413386	3300025960	Bacteria	1150
623	Ga0207651_10484296	3300025960	Bacteria	1067
624	Ga0207668_10259511	3300025972	Bacteria	1415
625	Ga0207640_10003416	3300025981	Bacteria	8552
626	Ga0207640_10079885	3300025981	Bacteria	2231
627	Ga0207640_10124724	3300025981	Bacteria	1852
628	Ga0207658_10074170	3300025986	Bacteria	2585
629	Ga0207658_10079414	3300025986	Bacteria	2510
630	Ga0207677_10426660	3300026023	Bacteria	1131
631	Ga0207677_10789276	3300026023	Bacteria	849
632	Ga0207703_10013024	3300026035	Bacteria	6481
633	Ga0207703_10532254	3300026035	Bacteria	1106
634	Ga0207703_10545139	3300026035	Bacteria	1093
635	Ga0207639_10088465	3300026041	Bacteria	2471
636	Ga0207678_10410241	3300026067	Bacteria	1174
637	Ga0207708_10018413	3300026075	Bacteria	5260
638	Ga0207708_10020274	3300026075	Bacteria	5015
639	Ga0207702_10001631	3300026078	Bacteria	22179
640	Ga0207702_10126536	3300026078	Bacteria	2295
641	Ga0207641_10003573	3300026088	Bacteria	13744
642	Ga0207641_10571342	3300026088	Bacteria	1104
643	Ga0207641_10615054	3300026088	Bacteria	1065
644	Ga0207648_10017375	3300026089	Bacteria	6546
645	Ga0207648_10043226	3300026089	Bacteria	3956
646	Ga0207648_10103315	3300026089	Bacteria	2499
647	Ga0207648_10238188	3300026089	Bacteria	1620
648	Ga0207676_10001593	3300026095	Bacteria	16712
649	Ga0207676_10151726	3300026095	Bacteria	1996
650	Ga0207676_10352709	3300026095	Bacteria	1361
651	Ga0207676_10943143	3300026095	Bacteria	848
652	Ga0207674_10013940	3300026116	Bacteria	8891
653	Ga0207674_10173168	3300026116	Bacteria	2111
654	Ga0207674_10232511	3300026116	Bacteria	1791
655	Ga0207674_10502463	3300026116	Bacteria	1171
656	Ga0207674_10553841	3300026116	Bacteria	1111
657	Ga0207675_100076526	3300026118	Bacteria	3134
658	Ga0207675_100095365	3300026118	Bacteria	2799
659	Ga0207675_100143415	3300026118	Bacteria	2270
660	Ga0207675_100179541	3300026118	Bacteria	2027
661	Ga0207675_100276761	3300026118	Bacteria	1630
662	Ga0207675_101081662	3300026118	Bacteria	821
663	Ga0207683_10232372	3300026121	Bacteria	1682
664	Ga0207683_10934425	3300026121	Bacteria	805
665	Ga0207698_10038136	3300026142	Bacteria	3547
666	Ga0207698_10074715	3300026142	Bacteria	2705
667	Ga0209281_1000005	3300027111	Bacteria	1242284
668	Ga0209281_1004072	3300027111	Bacteria	4509
669	Ga0209973_1000141	3300027252	Bacteria	4460
670	Ga0209969_1000506	3300027360	Bacteria	5252
671	Ga0209982_1016086	3300027552	Bacteria	1137
672	Ga0209983_1001965	3300027665	Bacteria	4557
673	Ga0209282_1000005	3300027666	Bacteria	380858
674	Ga0209282_1015352	3300027666	Bacteria	4874
675	Ga0209971_1006957	3300027682	Bacteria	2683
676	Ga0209998_10050995	3300027717	Bacteria	958
677	Ga0209974_10001315	3300027876	Bacteria	8931
678	Ga0209974_10022552	3300027876	Bacteria	2085
679	Ga0209974_10041269	3300027876	Bacteria	1536
680	Ga0209974_10046050	3300027876	Bacteria	1458
681	Ga0209974_10095657	3300027876	Bacteria	1034
682	Ga0207428_10175809	3300027907	Bacteria	1619
683	Ga0268266_10028107	3300028379	Bacteria	4782
684	Ga0268266_10587182	3300028379	Bacteria	1069
685	Ga0268266_10600091	3300028379	Bacteria	1057
686	Ga0268266_10891865	3300028379	Bacteria	860
687	Ga0268265_10371316	3300028380	Bacteria	1313
688	Ga0268264_10236964	3300028381	Bacteria	1688
689	Ga0265318_10002709	3300028577	Bacteria	9295
690	Ga0265323_10048937	3300028653	Bacteria	1506
691	Ga0265336_10000048	3300028666	Bacteria	121572
692	Ga0307515_10000736	3300028794	Bacteria	75689
693	Ga0307515_10001095	3300028794	Bacteria	62092
694	Ga0307515_10215622	3300028794	Bacteria	1751
695	Ga0316177_1003817	3300030731	Bacteria	7536
696	Ga0316176_1149365	3300030732	Bacteria	4172
697	Ga0314311_1083999	3300030733	Bacteria	4359
698	Ga0316178_1017927	3300030735	Bacteria	3412
699	Ga0316180_1046521	3300030736	Bacteria	2980
700	Ga0316183_1151240	3300030742	Bacteria	10848
701	Ga0316181_1052698	3300030744	Bacteria	2448
702	Ga0265330_10000032	3300031235	Bacteria	130592
703	Ga0265332_10000001	3300031238	Bacteria	863783
704	Ga0265332_10000010	3300031238	Bacteria	289041
705	Ga0265332_10003349	3300031238	Bacteria	7763
706	Ga0265328_10000027	3300031239	Bacteria	114609
707	Ga0265328_10008502	3300031239	Bacteria	4228
708	Ga0265320_10080146	3300031240	Bacteria	1525
709	Ga0265325_10003737	3300031241	Bacteria	9830
710	Ga0265325_10009531	3300031241	Bacteria	5665
711	Ga0265329_10011235	3300031242	Bacteria	3259
712	Ga0265340_10039273	3300031247	Bacteria	2337
713	Ga0265339_10148047	3300031249	Bacteria	1190
714	Ga0265339_10273977	3300031249	Bacteria	811
715	Ga0265331_10000851	3300031250	Bacteria	24815
716	Ga0265331_10003732	3300031250	Bacteria	9678
717	Ga0265327_10000307	3300031251	Bacteria	95145
718	Ga0265327_10059269	3300031251	Bacteria	1961
719	Ga0265327_10062141	3300031251	Bacteria	1902
720	Ga0265316_10010873	3300031344	Bacteria	8263
721	Ga0265316_10091425	3300031344	Bacteria	2321
722	Ga0307513_10001949	3300031456	Bacteria	29203
723	Ga0307513_10072473	3300031456	Bacteria	3590
724	Ga0307513_10296746	3300031456	Bacteria	1385
725	Ga0307509_10001394	3300031507	Bacteria	40983
726	Ga0307509_10045285	3300031507	Bacteria	4746
727	Ga0307408_100000144	3300031548	Bacteria	79329
728	Ga0307408_100000435	3300031548	Bacteria	37222
729	Ga0307408_100002435	3300031548	Bacteria	13086
730	Ga0307408_100002837	3300031548	Bacteria	12018
731	Ga0307408_100039531	3300031548	Bacteria	3335
732	Ga0307408_100050469	3300031548	Bacteria	2992
733	Ga0307408_100064395	3300031548	Bacteria	2685
734	Ga0307408_100094347	3300031548	Bacteria	2265
735	Ga0307408_100125666	3300031548	Bacteria	1994
736	Ga0307408_100131286	3300031548	Bacteria	1954
737	Ga0307408_100219015	3300031548	Bacteria	1552
738	Ga0307408_100381816	3300031548	Bacteria	1204
739	Ga0307408_100397873	3300031548	Bacteria	1182
740	Ga0307408_100410259	3300031548	Bacteria	1165
741	Ga0307408_100441259	3300031548	Bacteria	1127
742	Ga0265313_10126267	3300031595	Bacteria	1112
743	Ga0307514_10000528	3300031649	Bacteria	74778
744	Ga0307514_10071427	3300031649	Bacteria	2603
745	Ga0316575_10008551	3300031665	Bacteria	3732
746	Ga0316575_10017079	3300031665	Bacteria	2752
747	Ga0316575_10200858	3300031665	Bacteria	830
748	Ga0316575_10218490	3300031665	Bacteria	795
749	Ga0316579_10001461	3300031691	Bacteria	8594
750	Ga0316579_10006624	3300031691	Bacteria	4734
751	Ga0316579_10009212	3300031691	Bacteria	4145
752	Ga0316579_10013259	3300031691	Bacteria	3544
753	Ga0265314_10000022	3300031711	Bacteria	297299
754	Ga0265314_10001467	3300031711	Bacteria	26276
755	Ga0265314_10008153	3300031711	Bacteria	9015
756	Ga0265314_10016398	3300031711	Bacteria	5853
757	Ga0265314_10404716	3300031711	Bacteria	737
758	Ga0265314_10424522	3300031711	Bacteria	714
759	Ga0316576_10015346	3300031727	Bacteria	5139
760	Ga0316576_10022886	3300031727	Bacteria	4346
761	Ga0316576_10079540	3300031727	Bacteria	2430
762	Ga0316576_10093050	3300031727	Bacteria	2246
763	Ga0316576_10127131	3300031727	Bacteria	1916
764	Ga0316576_10205793	3300031727	Bacteria	1482
765	Ga0316576_10484354	3300031727	Bacteria	911
766	Ga0316578_10002664	3300031728	Bacteria	7931
767	Ga0316578_10019723	3300031728	Bacteria	3717
768	Ga0316578_10057296	3300031728	Bacteria	2289
769	Ga0316578_10074158	3300031728	Bacteria	2017
770	Ga0316578_10075870	3300031728	Bacteria	1995
771	Ga0316578_10095743	3300031728	Bacteria	1777
772	Ga0316578_10147100	3300031728	Bacteria	1419
773	Ga0316578_10303419	3300031728	Bacteria	954
774	Ga0307516_10001084	3300031730	Bacteria	37862
775	Ga0307516_10002697	3300031730	Bacteria	23475
776	Ga0307405_10152970	3300031731	Bacteria	1624
777	Ga0307405_10230312	3300031731	Bacteria	1365
778	Ga0316577_10011550	3300031733	Bacteria	4785
779	Ga0316577_10045083	3300031733	Bacteria	2465
780	Ga0316577_10091212	3300031733	Bacteria	1705
781	Ga0316577_10138767	3300031733	Bacteria	1369
782	Ga0307413_10123465	3300031824	Bacteria	1758
783	Ga0307518_10058054	3300031838	Bacteria	2811
784	Ga0307406_10000205	3300031901	Bacteria	35442
785	Ga0307406_10003021	3300031901	Bacteria	9153
786	Ga0307406_10052256	3300031901	Bacteria	2598
787	Ga0307406_10147180	3300031901	Bacteria	1676
788	Ga0307406_10151832	3300031901	Bacteria	1653
789	Ga0307412_10019709	3300031911	Bacteria	4092
790	Ga0307412_10019731	3300031911	Bacteria	4089
791	Ga0307412_10024700	3300031911	Bacteria	3712
792	Ga0307412_10121573	3300031911	Bacteria	1880
793	Ga0307412_10149151	3300031911	Bacteria	1723
794	Ga0307412_10176262	3300031911	Bacteria	1603
795	Ga0307412_10235972	3300031911	Bacteria	1411
796	Ga0307409_100797135	3300031995	Bacteria	952
797	Ga0307416_100013859	3300032002	Bacteria	5496
798	Ga0307416_100124232	3300032002	Bacteria	2308
799	Ga0307416_100152041	3300032002	Bacteria	2124
800	Ga0307416_100408899	3300032002	Bacteria	1397
801	Ga0307416_101363031	3300032002	Bacteria	815
802	Ga0307414_10202003	3300032004	Bacteria	1617
803	Ga0307414_10343547	3300032004	Bacteria	1278
804	Ga0307411_10025348	3300032005	Bacteria	3552
805	Ga0307411_10071044	3300032005	Bacteria	2358
806	Ga0307411_10165341	3300032005	Bacteria	1662
807	Ga0307411_10321759	3300032005	Bacteria	1249
808	Ga0316583_10002136	3300032133	Bacteria	6807
809	Ga0316583_10003305	3300032133	Bacteria	5673
810	Ga0316583_10010949	3300032133	Bacteria	3267
811	Ga0316583_10011204	3300032133	Bacteria	3228
812	Ga0316583_10014086	3300032133	Bacteria	2884
813	Ga0316583_10198640	3300032133	Bacteria	696
814	Ga0316585_10003108	3300032137	Bacteria	4533
815	Ga0316585_10006899	3300032137	Bacteria	3259
816	Ga0316580_10007449	3300032139	Bacteria	3261
817	Ga0316580_10053026	3300032139	Bacteria	1249
818	Ga0316593_10002883	3300032168	Bacteria	4174
819	Ga0316593_10007166	3300032168	Bacteria	3052
820	Ga0316593_10014164	3300032168	Bacteria	2373
821	Ga0316593_10019478	3300032168	Bacteria	2098
822	Ga0316593_10029503	3300032168	Bacteria	1775
823	Ga0316593_10032218	3300032168	Bacteria	1711
824	Ga0316593_10068620	3300032168	Bacteria	1223
825	Ga0307507_10061183	3300033179	Bacteria	3507
826	Ga0307510_10465554	3300033180	Bacteria	705
827	Ga0316592_1010041	3300033524	Bacteria	1902
828	Ga0316586_1045938	3300033527	Bacteria	775
829	Ga0316588_1014449	3300033528	Bacteria	1728
830	Ga0316587_1002676	3300033529	Bacteria	2410
831	Ga0316587_1018323	3300033529	Bacteria	1178
832	Ga0316587_1036058	3300033529	Bacteria	885
833	Ga0316596_1001228	3300033541	Bacteria	5064
834	Ga0316596_1016404	3300033541	Bacteria	1856
835	Ga0316596_1016865	3300033541	Bacteria	1831
836	Ga0316596_1056126	3300033541	Bacteria	1047
837	Ga0316596_1126591	3300033541	Bacteria	697
838	Ga0373934_0000061	3300035086	Bacteria	37034
839	Ga0373934_0004954	3300035086	Bacteria	4935
840	Ga0373934_0195176	3300035086	Bacteria	833
841	Ga0373934_0198873	3300035086	Bacteria	825
842	Ga0373944_0124964	3300035089	Bacteria	890
843	Ga0373951_0038069	3300035091	Bacteria	1152
844	Ga0373952_0013212	3300035092	Bacteria	1634
845	Ga0373923_0043166	3300035111	Bacteria	1865
846	Ga0373923_0134951	3300035111	Bacteria	1112
847	Ga0373936_0095397	3300035113	Bacteria	1250
848	Ga0373939_0259229	3300035114	Bacteria	679
849	Ga0373953_0048015	3300035117	Bacteria	1718
850	Ga0373956_0000003	3300035119	Bacteria	81669
851	Ga0373956_0187864	3300035119	Bacteria	978
852	Ga0373957_0006728	3300035120	Bacteria	3638
853	Ga0373957_0053964	3300035120	Bacteria	1542
854	Ga0373960_0046500	3300035121	Bacteria	1274
855	Ga0373946_0024763	3300035171	Bacteria	2355
856	Ga0373946_0328505	3300035171	Bacteria	761
857	Ga0373955_0029096	3300035172	Bacteria	2870
858	Ga0373955_0056385	3300035172	Bacteria	2155
859	Ga0316574_0000379	3300035398	Bacteria	17294
860	Ga0316574_0009987	3300035398	Bacteria	5340
861	Ga0316574_0010363	3300035398	Bacteria	5265
862	Ga0316574_0021639	3300035398	Bacteria	3820
863	Ga0316574_0053432	3300035398	Bacteria	2522
864	Ga0316574_0068113	3300035398	Bacteria	2244
865	Ga0316574_0124951	3300035398	Bacteria	1653
866	Ga0316574_0132289	3300035398	Bacteria	1605
867	Ga0316574_0203974	3300035398	Bacteria	1270
868	Ga0316574_0216853	3300035398	Bacteria	1227
869	Ga0316574_0293874	3300035398	Bacteria	1034
870	Ga0316574_0304901	3300035398	Bacteria	1012
871	Ga0373924_0007329	3300035410	Bacteria	3979
872	Ga0373935_0049767	3300035692	Bacteria	2657
873	Ga0373927_0033886	3300035695	Bacteria	3323
874	Ga0373927_0117145	3300035695	Bacteria	1737
875	Ga0373933_0000742	3300035724	Bacteria	19915
876	Ga0373933_0122491	3300035724	Bacteria	1629
877	Ga0373947_0127136	3300035725	Bacteria	1624
878	Ga0373937_0000196	3300036401	Bacteria	59256
879	Ga0373937_0025419	3300036401	Bacteria	5345
880	Ga0373937_0029330	3300036401	Bacteria	4983
881	Ga0373937_0253612	3300036401	Bacteria	1658
882	Ga0373937_1038512	3300036401	Bacteria	768
883	Ga0316582_0002686	3300036647	Bacteria	8430
884	Ga0316582_0013612	3300036647	Bacteria	4584
885	Ga0316582_0014349	3300036647	Bacteria	4493
886	Ga0316582_0050404	3300036647	Bacteria	2637
887	Ga0316582_0063430	3300036647	Bacteria	2375
888	Ga0316582_0066713	3300036647	Bacteria	2320
889	Ga0316582_0084297	3300036647	Bacteria	2080
890	Ga0316582_0122270	3300036647	Bacteria	1742
891	Ga0316582_0236202	3300036647	Bacteria	1251
892	Ga0316582_0272828	3300036647	Bacteria	1160
893	Ga0316582_0346040	3300036647	Bacteria	1022
894	Ga0316582_0456613	3300036647	Bacteria	881
895	Ga0316584_0002755	3300036712	Bacteria	11245
896	Ga0316584_0003985	3300036712	Bacteria	9714
897	Ga0316584_0013673	3300036712	Bacteria	5754
898	Ga0316584_0025283	3300036712	Bacteria	4354
899	Ga0316584_0025285	3300036712	Bacteria	4353
900	Ga0316584_0027404	3300036712	Bacteria	4194
901	Ga0316584_0044544	3300036712	Bacteria	3308
902	Ga0316584_0103651	3300036712	Bacteria	2129
903	Ga0316584_0134518	3300036712	Bacteria	1846
904	Ga0316584_0311496	3300036712	Bacteria	1138
905	Ga0316584_0322025	3300036712	Bacteria	1115
906	Ga0373925_0179901	3300037068	Bacteria	1673
907	Ga0373925_0188106	3300037068	Bacteria	1637
908	Ga0373925_0695365	3300037068	Bacteria	838
909	Ga0395899_0004277	3300037312	Bacteria	11166
910	Ga0395899_0009167	3300037312	Bacteria	7600
911	Ga0395899_0017209	3300037312	Bacteria	5508
912	Ga0395899_0019216	3300037312	Bacteria	5193
913	Ga0395899_0064772	3300037312	Bacteria	2686
914	Ga0395900_0000826	3300037418	Bacteria	40904
915	Ga0395900_0017822	3300037418	Bacteria	7248
916	Ga0395900_0019747	3300037418	Bacteria	6868
917	Ga0395900_0064542	3300037418	Bacteria	3762
918	Ga0395900_0074854	3300037418	Bacteria	3480
919	Ga0395900_0114290	3300037418	Bacteria	2770
920	Ga0395900_0131159	3300037418	Bacteria	2568
921	Ga0395900_0196452	3300037418	Bacteria	2043
922	Ga0395900_0265093	3300037418	Bacteria	1714
923	Ga0395900_0358538	3300037418	Bacteria	1430
924	Ga0395900_0446356	3300037418	Bacteria	1250
925	Ga0395900_0674214	3300037418	Bacteria	969
926	Ga0395898_0082471	3300037466	Bacteria	3099
927	Ga0395898_0150607	3300037466	Bacteria	2226
928	Ga0395898_0160588	3300037466	Bacteria	2149
929	Ga0395898_0402810	3300037466	Bacteria	1304
930	Ga0395905_0000132	3300037471	Bacteria	123636
931	Ga0395905_0000613	3300037471	Bacteria	47773
932	Ga0395905_0041777	3300037471	Bacteria	4303
933	Ga0395905_0047814	3300037471	Bacteria	4008
934	Ga0395905_0061299	3300037471	Bacteria	3518
935	Ga0395905_0074256	3300037471	Bacteria	3187
936	Ga0395905_0109113	3300037471	Bacteria	2598
937	Ga0395905_0123194	3300037471	Bacteria	2437
938	Ga0395905_0138524	3300037471	Bacteria	2289
939	Ga0395905_0140214	3300037471	Bacteria	2274
940	Ga0395905_0322128	3300037471	Bacteria	1435
941	Ga0395905_0416377	3300037471	Bacteria	1239
942	Ga0395905_0468459	3300037471	Bacteria	1158
943	Ga0316581_0000220	3300037588	Bacteria	9745
944	Ga0316581_0002012	3300037588	Bacteria	4767
945	Ga0316581_0022587	3300037588	Bacteria	1855
946	Ga0316581_0035500	3300037588	Bacteria	1511
947	Ga0316581_0044468	3300037588	Bacteria	1356
948	Ga0395901_0000033	3300038443	Bacteria	232357
949	Ga0395901_0001938	3300038443	Bacteria	21317
950	Ga0395901_0010151	3300038443	Bacteria	9541
951	Ga0395901_0022786	3300038443	Bacteria	6421
952	Ga0395901_0027576	3300038443	Bacteria	5837
953	Ga0395901_0029144	3300038443	Bacteria	5681
954	Ga0395901_0031647	3300038443	Bacteria	5453
955	Ga0395901_0053698	3300038443	Bacteria	4187
956	Ga0395901_0332105	3300038443	Bacteria	1571
957	Ga0395901_0420113	3300038443	Bacteria	1371
958	Ga0400484_04693	3300038725	Bacteria	3250
959	Ga0400483_051857	3300039062	Bacteria	1583
960	Ga0400483_144157	3300039062	Bacteria	2033
961	Ga0400487_11716	3300039110	Bacteria	2878
962	Ga0400487_53586	3300039110	Bacteria	4399
963	Ga0436361_0062004	3300039447	Bacteria	42438
964	Ga0436361_0492958	3300039447	Bacteria	54051
965	Ga0436361_0595316	3300039447	Bacteria	75842
966	Ga0436361_0601748	3300039447	Bacteria	6174
967	Ga0436361_0657731	3300039447	Bacteria	46245
968	Ga0436361_0908337	3300039447	Bacteria	39649
969	Ga0436361_0931472	3300039447	Bacteria	5962
970	Ga0436361_0998063	3300039447	Bacteria	37334
971	Ga0436361_1110972	3300039447	Bacteria	868
972	Ga0439436_0000104	3300041404	Bacteria	20033
973	Ga0439436_0039090	3300041404	Bacteria	1363
974	Ga0439447_012613	3300041407	Bacteria	2422
975	Ga0439447_034107	3300041407	Bacteria	1266
976	Ga0439461_0013848	3300041410	Bacteria	1526
977	Ga0439466_0001768	3300041411	Bacteria	8448
978	Ga0451793_1439699	3300041452	Bacteria	1088
979	Ga0451798_0715964	3300041458	Bacteria	920
980	Ga0451807_0043679	3300041486	Bacteria	1439
981	Ga0451835_0757521	3300041492	Bacteria	751
982	Ga0451841_0545369	3300041498	Bacteria	1122
983	Ga0439431_0003442	3300041997	Bacteria	3486
984	Ga0439433_0003975	3300041999	Bacteria	3181
985	Ga0439445_0059349	3300042004	Bacteria	1044
986	Ga0439448_0006050	3300042005	Bacteria	3468
987	Ga0439448_0041102	3300042005	Bacteria	1495
988	Ga0439432_001812	3300042006	Bacteria	8009
989	Ga0439432_022718	3300042006	Bacteria	2071
990	Ga0439449_0001978	3300042007	Bacteria	8063
991	Ga0439449_0006498	3300042007	Bacteria	4466
992	Ga0439449_0139665	3300042007	Bacteria	901
993	Ga0439452_004953	3300042010	Bacteria	4363
994	Ga0439452_027719	3300042010	Bacteria	1420
995	Ga0439455_0011338	3300042012	Bacteria	1978
996	Ga0439457_006525	3300042014	Bacteria	2856
997	Ga0439457_015810	3300042014	Bacteria	1684
998	Ga0439462_0007850	3300042015	Bacteria	2679
999	Ga0439462_0015372	3300042015	Bacteria	1972
1000	Ga0450921_001571	3300042123	Bacteria	1403
1001	Ga0450921_012836	3300042123	Bacteria	731
1002	Ga0450896_019677	3300042133	Bacteria	984
1003	Ga0450898_028513	3300042134	Bacteria	1014
1004	Ga0450899_003695	3300042135	Bacteria	1643
1005	Ga0450904_000694	3300042139	Bacteria	5972
1006	Ga0450906_009542	3300042145	Bacteria	1849
1007	Ga0450906_018185	3300042145	Bacteria	1262
1008	Ga0450910_002001	3300042147	Bacteria	2644
1009	Ga0439446_0079219	3300042156	Bacteria	1015
1010	Ga0450909_017014	3300042185	Bacteria	1075
1011	Ga0439434_0000355	3300042435	Bacteria	13126
1012	Ga0439434_0045839	3300042435	Bacteria	1349
1013	Ga0439434_0093547	3300042435	Bacteria	963
1014	Ga0439434_0104054	3300042435	Bacteria	916
1015	Ga0439434_0126706	3300042435	Bacteria	836
1016	Ga0450893_0002078	3300042532	Bacteria	3118
1017	Ga0451577_0000519	3300042876	Bacteria	64350
1018	Ga0451577_0025984	3300042876	Bacteria	5306
1019	Ga0451577_0034908	3300042876	Bacteria	4531
1020	Ga0451577_0036616	3300042876	Bacteria	4416
1021	Ga0451577_0040398	3300042876	Bacteria	4188
1022	Ga0451577_0132985	3300042876	Bacteria	2232
1023	Ga0451577_0145316	3300042876	Bacteria	2132
1024	Ga0451577_0185715	3300042876	Bacteria	1875
1025	Ga0451577_0233760	3300042876	Bacteria	1662
1026	Ga0451577_0333054	3300042876	Bacteria	1377
1027	Ga0451577_0344880	3300042876	Bacteria	1351
1028	Ga0451577_0353632	3300042876	Bacteria	1333
1029	Ga0451577_0878404	3300042876	Bacteria	808
1030	Ga0451577_0904936	3300042876	Bacteria	794
1031	Ga0466969_0053625	3300044656	Bacteria	1977
1032	Ga0466982_0228515	3300044672	Bacteria	1100
1033	Ga0453683_0043464	3300044673	Bacteria	2820
1034	Ga0453683_0156024	3300044673	Bacteria	1443
1035	Ga0453683_0226275	3300044673	Bacteria	1190
1036	Ga0453683_0283910	3300044673	Bacteria	1057
1037	Ga0453683_0495164	3300044673	Bacteria	793
1038	Ga0466965_0116363	3300044683	Bacteria	1377
1039	Ga0466966_0039284	3300044684	Bacteria	3048
1040	Ga0466966_0088722	3300044684	Bacteria	1921
1041	Ga0466964_0000038	3300044706	Bacteria	27277
1042	Ga0453684_0000419	3300044712	Bacteria	173463
1043	Ga0453684_0000917	3300044712	Bacteria	97990
1044	Ga0453684_0001204	3300044712	Bacteria	79823
1045	Ga0453684_0008979	3300044712	Bacteria	17663
1046	Ga0453684_0013398	3300044712	Bacteria	13324
1047	Ga0453684_0074099	3300044712	Bacteria	4288
1048	Ga0453684_0180539	3300044712	Bacteria	2478
1049	Ga0453684_0185789	3300044712	Bacteria	2436
1050	Ga0453684_0220791	3300044712	Bacteria	2196
1051	Ga0453684_0374914	3300044712	Bacteria	1599
1052	Ga0453684_0517316	3300044712	Bacteria	1319
1053	Ga0453684_0520701	3300044712	Bacteria	1314
1054	Ga0453684_0601484	3300044712	Bacteria	1205
1055	Ga0453684_1076940	3300044712	Bacteria	850
1056	Ga0466971_0051483	3300044719	Bacteria	1854
1057	Ga0466970_0006191	3300044765	Bacteria	5965
1058	Ga0466959_0080831	3300045049	Bacteria	2342
1059	Ga0451576_0000335	3300045051	Bacteria	113806
1060	Ga0451576_0033644	3300045051	Bacteria	5448
1061	Ga0451576_0112235	3300045051	Bacteria	2837
1062	Ga0451576_0198041	3300045051	Bacteria	2098
1063	Ga0451576_0347359	3300045051	Bacteria	1553
1064	Ga0451576_0441572	3300045051	Bacteria	1366
1065	Ga0451576_0487775	3300045051	Bacteria	1294
1066	Ga0451576_0680251	3300045051	Bacteria	1081
1067	Ga0451576_0892704	3300045051	Bacteria	933
1068	Ga0451576_1593008	3300045051	Bacteria	677
1069	Ga0495617_000020	3300046452	Bacteria	230257
1070	Ga0495617_000055	3300046452	Bacteria	102065
1071	Ga0495617_000197	3300046452	Bacteria	37981
1072	Ga0495617_000809	3300046452	Bacteria	15126
1073	Ga0495617_005769	3300046452	Bacteria	4372
1074	Ga0495617_008224	3300046452	Bacteria	3600
1075	Ga0495627_000004	3300046453	Bacteria	640612
1076	Ga0495627_000123	3300046453	Bacteria	94862
1077	Ga0495627_008222	3300046453	Bacteria	3925
1078	Ga0495627_012156	3300046453	Bacteria	3065
1079	Ga0495627_087848	3300046453	Bacteria	896
1080	Ga0495627_099982	3300046453	Bacteria	828
1081	Ga0495592_0351504	3300046454	Bacteria	945
1082	Ga0495603_0060162	3300046455	Bacteria	2244
1083	Ga0495603_0088375	3300046455	Bacteria	1813
1084	Ga0495590_0000012	3300046457	Bacteria	303377
1085	Ga0495590_0002304	3300046457	Bacteria	7952
1086	Ga0495590_0011927	3300046457	Bacteria	3237
1087	Ga0495590_0015419	3300046457	Bacteria	2774
1088	Ga0495629_0079155	3300046459	Bacteria	2295
1089	Ga0495629_0329418	3300046459	Bacteria	1043
1090	Ga0495638_0000047	3300046460	Bacteria	216004
1091	Ga0495638_0002024	3300046460	Bacteria	17261
1092	Ga0495638_0009661	3300046460	Bacteria	6746
1093	Ga0495638_0011357	3300046460	Bacteria	6138
1094	Ga0495638_0011670	3300046460	Bacteria	6051
1095	Ga0495638_0063804	3300046460	Bacteria	2270
1096	Ga0495638_0276047	3300046460	Bacteria	915
1097	Ga0495641_0012156	3300046461	Bacteria	4837
1098	Ga0495651_0000105	3300046462	Bacteria	61688
1099	Ga0495651_0012584	3300046462	Bacteria	6530
1100	Ga0495651_0104782	3300046462	Bacteria	2099
1101	Ga0495651_0541847	3300046462	Bacteria	740
1102	Ga0495653_0000082	3300046463	Bacteria	80285
1103	Ga0495653_0016021	3300046463	Bacteria	6109
1104	Ga0495650_0000226	3300046471	Bacteria	115930
1105	Ga0495650_0000437	3300046471	Bacteria	66997
1106	Ga0495650_0000462	3300046471	Bacteria	63149
1107	Ga0495650_0001511	3300046471	Bacteria	22114
1108	Ga0495650_0051312	3300046471	Bacteria	1700
1109	Ga0495650_0124254	3300046471	Bacteria	947
1110	Ga0495580_0054128	3300046472	Bacteria	2831
1111	Ga0495582_0003405	3300046473	Bacteria	8955
1112	Ga0495582_0049246	3300046473	Bacteria	2320
1113	Ga0495582_0092765	3300046473	Bacteria	1685
1114	Ga0495605_0000018	3300046474	Bacteria	270187
1115	Ga0495605_0000035	3300046474	Bacteria	208069
1116	Ga0495605_0003120	3300046474	Bacteria	9985
1117	Ga0495605_0005369	3300046474	Bacteria	7466
1118	Ga0495605_0018918	3300046474	Bacteria	3687
1119	Ga0495605_0029583	3300046474	Bacteria	2816
1120	Ga0495605_0045893	3300046474	Bacteria	2150
1121	Ga0495605_0070446	3300046474	Bacteria	1653
1122	Ga0495605_0075974	3300046474	Bacteria	1579
1123	Ga0495639_0032738	3300046475	Bacteria	2319
1124	Ga0495639_0041764	3300046475	Bacteria	2067
1125	Ga0495639_0061601	3300046475	Bacteria	1720
1126	Ga0495662_0028518	3300046476	Bacteria	2694
1127	Ga0495584_0000006	3300046491	Bacteria	301775
1128	Ga0495584_0000570	3300046491	Bacteria	24884
1129	Ga0495584_0001531	3300046491	Bacteria	13751
1130	Ga0495584_0002419	3300046491	Bacteria	10590
1131	Ga0495584_0002756	3300046491	Bacteria	9828
1132	Ga0495584_0010792	3300046491	Bacteria	4689
1133	Ga0495584_0020430	3300046491	Bacteria	3364
1134	Ga0495584_0022925	3300046491	Bacteria	3168
1135	Ga0495584_0025346	3300046491	Bacteria	3007
1136	Ga0495584_0065643	3300046491	Bacteria	1826
1137	Ga0495584_0201189	3300046491	Bacteria	1012
1138	Ga0495584_0321205	3300046491	Bacteria	786
1139	Ga0495585_0000005	3300046492	Bacteria	328103
1140	Ga0495585_0000049	3300046492	Bacteria	119546
1141	Ga0495585_0000162	3300046492	Bacteria	71606
1142	Ga0495585_0003133	3300046492	Bacteria	11336
1143	Ga0495585_0006337	3300046492	Bacteria	7347
1144	Ga0495585_0009264	3300046492	Bacteria	5915
1145	Ga0495585_0013680	3300046492	Bacteria	4744
1146	Ga0495585_0016627	3300046492	Bacteria	4263
1147	Ga0495585_0024583	3300046492	Bacteria	3452
1148	Ga0495585_0040572	3300046492	Bacteria	2613
1149	Ga0495585_0051559	3300046492	Bacteria	2279
1150	Ga0495585_0113856	3300046492	Bacteria	1436
1151	Ga0495585_0119866	3300046492	Bacteria	1392
1152	Ga0495585_0134916	3300046492	Bacteria	1296
1153	Ga0495585_0243599	3300046492	Bacteria	899
1154	Ga0495594_0086059	3300046499	Bacteria	1758
1155	Ga0495594_0097795	3300046499	Bacteria	1649
1156	Ga0495594_0288980	3300046499	Bacteria	934
1157	Ga0495594_0321508	3300046499	Bacteria	881
1158	Ga0495594_0367811	3300046499	Bacteria	818
1159	Ga0495596_0000013	3300046500	Bacteria	125228
1160	Ga0495596_0000570	3300046500	Bacteria	23022
1161	Ga0495596_0004436	3300046500	Bacteria	6830
1162	Ga0495596_0005617	3300046500	Bacteria	5895
1163	Ga0495596_0007448	3300046500	Bacteria	4936
1164	Ga0495596_0064713	3300046500	Bacteria	1422
1165	Ga0495607_0000447	3300046501	Bacteria	41522
1166	Ga0495607_0001792	3300046501	Bacteria	18328
1167	Ga0495607_0002443	3300046501	Bacteria	15135
1168	Ga0495607_0004972	3300046501	Bacteria	9649
1169	Ga0495607_0005432	3300046501	Bacteria	9128
1170	Ga0495607_0007839	3300046501	Bacteria	7348
1171	Ga0495607_0015793	3300046501	Bacteria	4884
1172	Ga0495607_0024570	3300046501	Bacteria	3754
1173	Ga0495607_0040921	3300046501	Bacteria	2755
1174	Ga0495607_0051010	3300046501	Bacteria	2405
1175	Ga0495607_0061603	3300046501	Bacteria	2131
1176	Ga0495607_0068780	3300046501	Bacteria	1984
1177	Ga0495607_0126950	3300046501	Bacteria	1332
1178	Ga0495607_0142334	3300046501	Bacteria	1235
1179	Ga0495607_0176672	3300046501	Bacteria	1074
1180	Ga0495583_0000008	3300046506	Bacteria	411092
1181	Ga0495583_0000092	3300046506	Bacteria	158865
1182	Ga0495583_0000316	3300046506	Bacteria	76314
1183	Ga0495583_0000480	3300046506	Bacteria	58370
1184	Ga0495583_0000596	3300046506	Bacteria	49267
1185	Ga0495583_0001098	3300046506	Bacteria	29951
1186	Ga0495583_0001357	3300046506	Bacteria	25354
1187	Ga0495583_0005766	3300046506	Bacteria	8279
1188	Ga0495583_0016772	3300046506	Bacteria	3919
1189	Ga0495583_0059940	3300046506	Bacteria	1703
1190	Ga0495583_0081467	3300046506	Bacteria	1405
1191	Ga0495583_0109940	3300046506	Bacteria	1168
1192	Ga0495606_0000066	3300046507	Bacteria	181028
1193	Ga0495606_0000101	3300046507	Bacteria	146752
1194	Ga0495606_0000161	3300046507	Bacteria	117607
1195	Ga0495606_0000409	3300046507	Bacteria	72543
1196	Ga0495606_0000814	3300046507	Bacteria	47442
1197	Ga0495606_0000830	3300046507	Bacteria	46705
1198	Ga0495606_0002636	3300046507	Bacteria	20465
1199	Ga0495606_0003322	3300046507	Bacteria	17176
1200	Ga0495606_0013156	3300046507	Bacteria	6567
1201	Ga0495606_0018361	3300046507	Bacteria	5247
1202	Ga0495606_0025163	3300046507	Bacteria	4270
1203	Ga0495606_0061775	3300046507	Bacteria	2394
1204	Ga0495606_0097832	3300046507	Bacteria	1792
1205	Ga0495606_0118968	3300046507	Bacteria	1583
1206	Ga0495606_0136659	3300046507	Bacteria	1451
1207	Ga0495608_0207429	3300046511	Bacteria	1233
1208	Ga0495610_0000014	3300046512	Bacteria	444708
1209	Ga0495610_0002023	3300046512	Bacteria	17347
1210	Ga0495610_0005574	3300046512	Bacteria	8902
1211	Ga0495610_0005660	3300046512	Bacteria	8810
1212	Ga0495610_0009501	3300046512	Bacteria	6139
1213	Ga0495616_0000020	3300046513	Bacteria	162840
1214	Ga0495616_0000125	3300046513	Bacteria	66710
1215	Ga0495616_0001133	3300046513	Bacteria	18867
1216	Ga0495616_0001323	3300046513	Bacteria	17297
1217	Ga0495616_0017458	3300046513	Bacteria	3958
1218	Ga0495616_0022220	3300046513	Bacteria	3427
1219	Ga0495616_0023004	3300046513	Bacteria	3358
1220	Ga0495616_0032520	3300046513	Bacteria	2724
1221	Ga0495616_0041507	3300046513	Bacteria	2346
1222	Ga0495616_0042080	3300046513	Bacteria	2327
1223	Ga0495616_0148602	3300046513	Bacteria	1061
1224	Ga0495618_0012194	3300046514	Bacteria	5217
1225	Ga0495620_0024912	3300046515	Bacteria	2839
1226	Ga0495620_0029572	3300046515	Bacteria	2533
1227	Ga0495630_0002338	3300046517	Bacteria	13181
1228	Ga0495631_0000295	3300046518	Bacteria	34905
1229	Ga0495631_0000530	3300046518	Bacteria	25592
1230	Ga0495631_0002141	3300046518	Bacteria	11411
1231	Ga0495631_0004107	3300046518	Bacteria	7818
1232	Ga0495631_0006181	3300046518	Bacteria	6204
1233	Ga0495631_0018425	3300046518	Bacteria	3286
1234	Ga0495631_0028420	3300046518	Bacteria	2550
1235	Ga0495631_0048553	3300046518	Bacteria	1861
1236	Ga0495631_0060839	3300046518	Bacteria	1638
1237	Ga0495632_0000029	3300046519	Bacteria	171022
1238	Ga0495632_0000093	3300046519	Bacteria	91309
1239	Ga0495632_0001267	3300046519	Bacteria	21431
1240	Ga0495632_0005633	3300046519	Bacteria	8237
1241	Ga0495632_0009088	3300046519	Bacteria	6017
1242	Ga0495637_0000293	3300046520	Bacteria	38928
1243	Ga0495637_0001526	3300046520	Bacteria	13538
1244	Ga0495637_0025140	3300046520	Bacteria	2686
1245	Ga0495643_0000234	3300046522	Bacteria	84022
1246	Ga0495643_0000388	3300046522	Bacteria	58226
1247	Ga0495643_0001128	3300046522	Bacteria	26369
1248	Ga0495643_0003381	3300046522	Bacteria	11738
1249	Ga0495643_0045076	3300046522	Bacteria	2395
1250	Ga0495643_0050552	3300046522	Bacteria	2238
1251	Ga0495643_0075485	3300046522	Bacteria	1764
1252	Ga0495643_0113364	3300046522	Bacteria	1376
1253	Ga0495643_0267233	3300046522	Bacteria	792
1254	Ga0495644_0000379	3300046523	Bacteria	20217
1255	Ga0495644_0002875	3300046523	Bacteria	6826
1256	Ga0495644_0009357	3300046523	Bacteria	3779
1257	Ga0495644_0023838	3300046523	Bacteria	2329
1258	Ga0495644_0024595	3300046523	Bacteria	2290
1259	Ga0495644_0025272	3300046523	Bacteria	2255
1260	Ga0495644_0031794	3300046523	Bacteria	1995
1261	Ga0495644_0047181	3300046523	Bacteria	1618
1262	Ga0495644_0160588	3300046523	Bacteria	861
1263	Ga0495648_0000019	3300046524	Bacteria	276407
1264	Ga0495648_0000033	3300046524	Bacteria	199184
1265	Ga0495648_0000207	3300046524	Bacteria	68660
1266	Ga0495648_0000527	3300046524	Bacteria	41184
1267	Ga0495648_0005556	3300046524	Bacteria	10456
1268	Ga0495648_0007648	3300046524	Bacteria	8616
1269	Ga0495648_0025773	3300046524	Bacteria	3973
1270	Ga0495648_0037659	3300046524	Bacteria	3104
1271	Ga0495648_0038786	3300046524	Bacteria	3040
1272	Ga0495648_0102115	3300046524	Bacteria	1580
1273	Ga0495663_0002070	3300046525	Bacteria	6143
1274	Ga0495666_0020595	3300046526	Bacteria	3266
1275	Ga0495666_0090091	3300046526	Bacteria	1447
1276	Ga0495642_0000005	3300046528	Bacteria	176726
1277	Ga0495642_0000111	3300046528	Bacteria	46419
1278	Ga0495642_0004661	3300046528	Bacteria	5311
1279	Ga0495642_0009857	3300046528	Bacteria	3660
1280	Ga0495642_0041558	3300046528	Bacteria	1870
1281	Ga0495642_0045669	3300046528	Bacteria	1790
1282	Ga0495642_0050674	3300046528	Bacteria	1707
1283	Ga0495642_0065157	3300046528	Bacteria	1516
1284	Ga0495642_0124205	3300046528	Bacteria	1108
1285	Ga0495642_0300518	3300046528	Bacteria	703
1286	Ga0495652_0037438	3300046529	Bacteria	4209
1287	Ga0495652_0046650	3300046529	Bacteria	3718
1288	Ga0495652_0149700	3300046529	Bacteria	1825
1289	Ga0495654_0000014	3300046530	Bacteria	312126
1290	Ga0495654_0003975	3300046530	Bacteria	8904
1291	Ga0495654_0009835	3300046530	Bacteria	5226
1292	Ga0495654_0017364	3300046530	Bacteria	3785
1293	Ga0495654_0027638	3300046530	Bacteria	2906
1294	Ga0495654_0116109	3300046530	Bacteria	1216
1295	Ga0495654_0278220	3300046530	Bacteria	689
1296	Ga0495665_0013415	3300046531	Bacteria	4430
1297	Ga0495665_0045808	3300046531	Bacteria	2323
1298	Ga0495665_0050197	3300046531	Bacteria	2211
1299	Ga0495586_0031016	3300046535	Bacteria	2862
1300	Ga0495598_0055818	3300046537	Bacteria	1204
1301	Ga0495609_0000122	3300046538	Bacteria	87165
1302	Ga0495609_0000127	3300046538	Bacteria	82467
1303	Ga0495609_0000377	3300046538	Bacteria	38049
1304	Ga0495609_0000421	3300046538	Bacteria	35331
1305	Ga0495609_0003050	3300046538	Bacteria	9844
1306	Ga0495609_0016190	3300046538	Bacteria	3476
1307	Ga0495609_0034137	3300046538	Bacteria	2307
1308	Ga0495609_0037541	3300046538	Bacteria	2185
1309	Ga0495609_0038173	3300046538	Bacteria	2166
1310	Ga0495609_0039218	3300046538	Bacteria	2133
1311	Ga0495609_0097297	3300046538	Bacteria	1276
1312	Ga0495609_0152089	3300046538	Bacteria	984
1313	Ga0495621_0002177	3300046539	Bacteria	5212
1314	Ga0495597_0000075	3300046542	Bacteria	86570
1315	Ga0495597_0000244	3300046542	Bacteria	49472
1316	Ga0495597_0000277	3300046542	Bacteria	46764
1317	Ga0495597_0000378	3300046542	Bacteria	38615
1318	Ga0495597_0000613	3300046542	Bacteria	29235
1319	Ga0495597_0001275	3300046542	Bacteria	18575
1320	Ga0495597_0004294	3300046542	Bacteria	7873
1321	Ga0495597_0004483	3300046542	Bacteria	7659
1322	Ga0495597_0024107	3300046542	Bacteria	2809
1323	Ga0495597_0048672	3300046542	Bacteria	1875
1324	Ga0495597_0049851	3300046542	Bacteria	1849
1325	Ga0495597_0069760	3300046542	Bacteria	1516
1326	Ga0495645_0136125	3300046543	Bacteria	1718
1327	Ga0495622_0000037	3300046557	Bacteria	119690
1328	Ga0495622_0000155	3300046557	Bacteria	58297
1329	Ga0495622_0057462	3300046557	Bacteria	1803
1330	Ga0495622_0105406	3300046557	Bacteria	1291
1331	Ga0495633_0000086	3300046558	Bacteria	124357
1332	Ga0495633_0000091	3300046558	Bacteria	122383
1333	Ga0495633_0000297	3300046558	Bacteria	56662
1334	Ga0495633_0002740	3300046558	Bacteria	12191
1335	Ga0495633_0002917	3300046558	Bacteria	11736
1336	Ga0495633_0003169	3300046558	Bacteria	11120
1337	Ga0495633_0005227	3300046558	Bacteria	8007
1338	Ga0495633_0012297	3300046558	Bacteria	4562
1339	Ga0495633_0013563	3300046558	Bacteria	4288
1340	Ga0495633_0028627	3300046558	Bacteria	2713
1341	Ga0495633_0032504	3300046558	Bacteria	2520
1342	Ga0495633_0063533	3300046558	Bacteria	1727
1343	Ga0495633_0079197	3300046558	Bacteria	1530
1344	Ga0495633_0197289	3300046558	Bacteria	924
1345	Ga0495656_0003025	3300046615	Bacteria	5652
1346	Ga0495656_0006282	3300046615	Bacteria	4162
1347	Ga0495656_0028061	3300046615	Bacteria	2255
1348	Ga0495656_0049039	3300046615	Bacteria	1797
1349	Ga0495668_0000066	3300046616	Bacteria	178533
1350	Ga0495668_0000579	3300046616	Bacteria	44604
1351	Ga0495668_0000712	3300046616	Bacteria	40090
1352	Ga0495668_0000987	3300046616	Bacteria	31002
1353	Ga0495668_0001514	3300046616	Bacteria	22099
1354	Ga0495668_0002104	3300046616	Bacteria	17216
1355	Ga0495668_0006539	3300046616	Bacteria	7615
1356	Ga0495668_0007925	3300046616	Bacteria	6703
1357	Ga0495668_0009537	3300046616	Bacteria	5951
1358	Ga0495668_0014164	3300046616	Bacteria	4685
1359	Ga0495668_0025338	3300046616	Bacteria	3370
1360	Ga0495668_0030873	3300046616	Bacteria	3021
1361	Ga0495668_0086129	3300046616	Bacteria	1723
1362	Ga0495668_0162207	3300046616	Bacteria	1224
1363	Ga0495668_0212030	3300046616	Bacteria	1060
1364	Ga0495668_0269496	3300046616	Bacteria	932
1365	Ga0495668_0291305	3300046616	Bacteria	894
1366	Ga0495634_0066291	3300046642	Bacteria	2390
1367	Ga0495611_0002764	3300046648	Bacteria	7871
1368	Ga0495611_0004783	3300046648	Bacteria	5818
1369	Ga0495611_0005095	3300046648	Bacteria	5631
1370	Ga0495611_0009182	3300046648	Bacteria	4174
1371	Ga0495611_0064339	3300046648	Bacteria	1670
1372	Ga0495611_0090448	3300046648	Bacteria	1414
1373	Ga0495611_0101088	3300046648	Bacteria	1339
1374	Ga0495611_0155059	3300046648	Bacteria	1069
1375	Ga0495625_0000301	3300046660	Bacteria	76108
1376	Ga0495625_0000432	3300046660	Bacteria	63013
1377	Ga0495625_0000931	3300046660	Bacteria	39360
1378	Ga0495625_0001069	3300046660	Bacteria	35654
1379	Ga0495625_0002528	3300046660	Bacteria	19665
1380	Ga0495625_0002580	3300046660	Bacteria	19464
1381	Ga0495625_0004594	3300046660	Bacteria	12980
1382	Ga0495625_0007654	3300046660	Bacteria	9364
1383	Ga0495625_0024019	3300046660	Bacteria	4647
1384	Ga0495625_0029530	3300046660	Bacteria	4098
1385	Ga0495625_0093097	3300046660	Bacteria	2081
1386	Ga0495635_0172552	3300046663	Bacteria	1470
1387	Ga0495635_0300677	3300046663	Bacteria	1076
1388	Ga0495659_0000074	3300046664	Bacteria	42753
1389	Ga0495659_0000368	3300046664	Bacteria	17465
1390	Ga0495659_0009976	3300046664	Bacteria	3038
1391	Ga0495661_0000198	3300046665	Bacteria	69566
1392	Ga0495661_0000254	3300046665	Bacteria	61490
1393	Ga0495661_0000654	3300046665	Bacteria	34904
1394	Ga0495661_0003108	3300046665	Bacteria	12456
1395	Ga0495661_0014208	3300046665	Bacteria	5335
1396	Ga0495661_0014465	3300046665	Bacteria	5285
1397	Ga0495661_0034197	3300046665	Bacteria	3199
1398	Ga0495661_0045002	3300046665	Bacteria	2701
1399	Ga0495661_0104359	3300046665	Bacteria	1589
1400	Ga0495661_0191829	3300046665	Bacteria	1075
1401	Ga0495661_0227352	3300046665	Bacteria	963
1402	Ga0495588_0000055	3300046674	Bacteria	280059
1403	Ga0495588_0004945	3300046674	Bacteria	5913
1404	Ga0495588_0018614	3300046674	Bacteria	3389
1405	Ga0495588_0123235	3300046674	Bacteria	1366
1406	Ga0495588_0220415	3300046674	Bacteria	1001
1407	Ga0495599_0094250	3300046678	Bacteria	1867
1408	Ga0495623_0049510	3300046679	Bacteria	2662
1409	Ga0495646_0003302	3300046680	Bacteria	10043
1410	Ga0495646_0350254	3300046680	Bacteria	774
1411	Ga0495647_0024140	3300046681	Bacteria	2211
1412	Ga0495658_0020266	3300046683	Bacteria	3486
1413	Ga0495669_0000053	3300046684	Bacteria	79258
1414	Ga0495669_0003999	3300046684	Bacteria	6067
1415	Ga0495669_0013249	3300046684	Bacteria	3512
1416	Ga0495669_0018939	3300046684	Bacteria	2966
1417	Ga0495669_0023877	3300046684	Bacteria	2663
1418	Ga0495669_0033489	3300046684	Bacteria	2261
1419	Ga0495669_0037160	3300046684	Bacteria	2154
1420	Ga0495613_0011139	3300046689	Bacteria	6678
1421	Ga0495624_0087733	3300046690	Bacteria	1921
1422	Ga0495670_0000840	3300046691	Bacteria	14864
1423	Ga0495670_0003303	3300046691	Bacteria	7948
1424	Ga0495670_0003637	3300046691	Bacteria	7574
1425	Ga0495670_0014555	3300046691	Bacteria	3867
1426	Ga0495670_0014746	3300046691	Bacteria	3846
1427	Ga0495670_0036166	3300046691	Bacteria	2460
1428	Ga0495670_0043803	3300046691	Bacteria	2233
1429	Ga0495670_0065274	3300046691	Bacteria	1834
1430	Ga0495670_0127579	3300046691	Bacteria	1325
1431	Ga0495670_0191841	3300046691	Bacteria	1080
1432	Ga0495670_0197970	3300046691	Bacteria	1063
1433	Ga0495671_0000005	3300046692	Bacteria	509397
1434	Ga0495671_0000294	3300046692	Bacteria	41764
1435	Ga0495671_0000493	3300046692	Bacteria	30406
1436	Ga0495671_0001143	3300046692	Bacteria	18230
1437	Ga0495671_0001848	3300046692	Bacteria	13620
1438	Ga0495671_0015630	3300046692	Bacteria	4062
1439	Ga0495671_0022530	3300046692	Bacteria	3299
1440	Ga0495671_0027049	3300046692	Bacteria	2966
1441	Ga0495671_0050544	3300046692	Bacteria	2069
1442	Ga0495671_0105621	3300046692	Bacteria	1375
1443	Ga0495649_0001632	3300046694	Bacteria	16686
1444	Ga0495649_0002914	3300046694	Bacteria	11836
1445	Ga0495649_0003129	3300046694	Bacteria	11336
1446	Ga0495649_0008680	3300046694	Bacteria	6102
1447	Ga0495649_0017973	3300046694	Bacteria	3985
1448	Ga0495649_0033827	3300046694	Bacteria	2813
1449	Ga0495649_0095827	3300046694	Bacteria	1579
1450	Ga0495649_0128173	3300046694	Bacteria	1340
1451	Ga0495649_0149064	3300046694	Bacteria	1229
1452	Ga0495589_0000049	3300046794	Bacteria	116553
1453	Ga0495589_0000248	3300046794	Bacteria	44186
1454	Ga0495589_0000732	3300046794	Bacteria	21182
1455	Ga0495589_0017384	3300046794	Bacteria	3691
1456	Ga0495589_0034199	3300046794	Bacteria	2552
1457	Ga0495589_0057199	3300046794	Bacteria	1918
1458	Ga0495589_0249152	3300046794	Bacteria	830
1459	Ga0495600_0002368	3300046809	Bacteria	10773
1460	Ga0495660_0000167	3300046810	Bacteria	71094
1461	Ga0495660_0000419	3300046810	Bacteria	35881
1462	Ga0495660_0002961	3300046810	Bacteria	10619
1463	Ga0495660_0007004	3300046810	Bacteria	6646
1464	Ga0495660_0011538	3300046810	Bacteria	5126
1465	Ga0495660_0012541	3300046810	Bacteria	4921
1466	Ga0495660_0078059	3300046810	Bacteria	1741
1467	Ga0495660_0101932	3300046810	Bacteria	1476
1468	Ga0495660_0111899	3300046810	Bacteria	1392
1469	Ga0495660_0149120	3300046810	Bacteria	1156
1470	Ga0495660_0294370	3300046810	Bacteria	738
1471	Ga0495581_0048644	3300047315	Bacteria	2448
1472	Ga0495581_0113361	3300047315	Bacteria	1576
1473	Ga0495604_0123627	3300047317	Bacteria	1869
1474	Ga0495604_0205430	3300047317	Bacteria	1364
1475	Ga0495636_0001381	3300047318	Bacteria	9172
1476	Ga0495636_0001424	3300047318	Bacteria	9048
1477	Ga0495636_0024068	3300047318	Bacteria	2467
1478	Ga0495636_0037829	3300047318	Bacteria	1993
1479	Ga0495636_0237142	3300047318	Bacteria	840
1480	Ga0495674_0009959	3300047319	Bacteria	9014
1481	Ga0495672_0000026	3300047320	Bacteria	340319
1482	Ga0495672_0000226	3300047320	Bacteria	80307
1483	Ga0495672_0005477	3300047320	Bacteria	10063
1484	Ga0495672_0023423	3300047320	Bacteria	3996
1485	Ga0495672_0027083	3300047320	Bacteria	3648
1486	Ga0495672_0036485	3300047320	Bacteria	3018
1487	Ga0495672_0119803	3300047320	Bacteria	1400
1488	Ga0495676_0000030	3300047321	Bacteria	133637
1489	Ga0495676_0001586	3300047321	Bacteria	19725
1490	Ga0495676_0063085	3300047321	Bacteria	2890
1491	Ga0495676_0155754	3300047321	Bacteria	1621
1492	Ga0495676_0159584	3300047321	Bacteria	1597
1493	Ga0495683_0000072	3300047323	Bacteria	104027
1494	Ga0495683_0011411	3300047323	Bacteria	4675
1495	Ga0495683_0042743	3300047323	Bacteria	2284
1496	Ga0495683_0049462	3300047323	Bacteria	2105
1497	Ga0495683_0059375	3300047323	Bacteria	1898
1498	Ga0495683_0064958	3300047323	Bacteria	1801
1499	Ga0495687_000024	3300047443	Bacteria	316676
1500	Ga0495687_000213	3300047443	Bacteria	83235
1501	Ga0495687_000456	3300047443	Bacteria	50293
1502	Ga0495687_000855	3300047443	Bacteria	32474
1503	Ga0495687_000970	3300047443	Bacteria	29214
1504	Ga0495687_003707	3300047443	Bacteria	10857
1505	Ga0495675_0006291	3300047444	Bacteria	7268
1506	Ga0495677_0000017	3300047445	Bacteria	121483
1507	Ga0495677_0000478	3300047445	Bacteria	17034
1508	Ga0495677_0000650	3300047445	Bacteria	14031
1509	Ga0495677_0003557	3300047445	Bacteria	6044
1510	Ga0495677_0007617	3300047445	Bacteria	4040
1511	Ga0495677_0025232	3300047445	Bacteria	2156
1512	Ga0495677_0026044	3300047445	Bacteria	2122
1513	Ga0495677_0066522	3300047445	Bacteria	1340
1514	Ga0495677_0084292	3300047445	Bacteria	1193
1515	Ga0495677_0125832	3300047445	Bacteria	979
1516	Ga0495679_014141	3300047446	Bacteria	2969
1517	Ga0495679_020250	3300047446	Bacteria	2319
1518	Ga0495679_036364	3300047446	Bacteria	1555
1519	Ga0495679_138107	3300047446	Bacteria	659
1520	Ga0495685_000263	3300047447	Bacteria	18095
1521	Ga0495685_005104	3300047447	Bacteria	4274
1522	Ga0495685_031735	3300047447	Bacteria	1815
1523	Ga0495673_0000008	3300047469	Bacteria	752462
1524	Ga0495673_0000009	3300047469	Bacteria	731993
1525	Ga0495673_0000012	3300047469	Bacteria	656908
1526	Ga0495673_0007222	3300047469	Bacteria	6419
1527	Ga0495673_0014443	3300047469	Bacteria	4107
1528	Ga0495681_0003096	3300047470	Bacteria	11665
1529	Ga0495681_0006805	3300047470	Bacteria	7437
1530	Ga0495681_0011676	3300047470	Bacteria	5212
1531	Ga0495681_0030978	3300047470	Bacteria	2715
1532	Ga0495681_0044896	3300047470	Bacteria	2119
1533	Ga0495681_0045113	3300047470	Bacteria	2112
1534	Ga0495681_0057222	3300047470	Bacteria	1811
1535	Ga0495681_0152756	3300047470	Bacteria	967
1536	Ga0495686_0000062	3300047472	Bacteria	235234
1537	Ga0495686_0000431	3300047472	Bacteria	65240
1538	Ga0495686_0002226	3300047472	Bacteria	18792
1539	Ga0495686_0009040	3300047472	Bacteria	7230
1540	Ga0495686_0141169	3300047472	Bacteria	1421
1541	Ga0495686_0216533	3300047472	Bacteria	1091
1542	Ga0495686_0286751	3300047472	Bacteria	913
1543	Ga0495593_0002258	3300047673	Bacteria	11560
1544	Ga0495593_0097923	3300047673	Bacteria	1506
1545	Ga0495614_0005764	3300048089	Bacteria	5577
1546	Ga0495614_0005891	3300048089	Bacteria	5524
1547	Ga0495615_0034185	3300048090	Bacteria	1236
1548	Ga0495626_0000202	3300048091	Bacteria	72266
1549	Ga0495626_0001340	3300048091	Bacteria	19924
1550	Ga0495626_0002145	3300048091	Bacteria	14272
1551	Ga0495626_0003033	3300048091	Bacteria	11062
1552	Ga0495626_0003131	3300048091	Bacteria	10834
1553	Ga0495626_0003253	3300048091	Bacteria	10510
1554	Ga0495626_0025563	3300048091	Bacteria	2887
1555	Ga0495626_0055457	3300048091	Bacteria	1816
1556	Ga0495626_0057990	3300048091	Bacteria	1771
1557	Ga0495626_0066183	3300048091	Bacteria	1634
1558	Ga0495626_0116021	3300048091	Bacteria	1155
1559	Ga0495626_0133461	3300048091	Bacteria	1058
1560	Ga0496100_0067238	3300048903	Bacteria	2379
1561	Ga0496101_0088622	3300048904	Bacteria	2298
1562	Ga0496101_0105505	3300048904	Bacteria	2115
1563	Ga0496101_0112307	3300048904	Bacteria	2052
1564	Ga0496101_0220403	3300048904	Bacteria	1472
1565	Ga0496102_0000071	3300048905	Bacteria	154320
1566	Ga0496102_0007543	3300048905	Bacteria	9299
1567	Ga0496102_0114322	3300048905	Bacteria	2518
1568	Ga0496102_0190543	3300048905	Bacteria	1932
1569	Ga0496102_0215802	3300048905	Bacteria	1808
1570	Ga0496102_0371626	3300048905	Bacteria	1346
1571	Ga0496102_0671238	3300048905	Bacteria	959
1572	Ga0496103_0006209	3300048906	Bacteria	7137
1573	Ga0496103_0030941	3300048906	Bacteria	3258
1574	Ga0496103_0033175	3300048906	Bacteria	3154
1575	Ga0496103_0149781	3300048906	Bacteria	1494
1576	Ga0496103_0187094	3300048906	Bacteria	1331
1577	Ga0496103_0232947	3300048906	Bacteria	1185
1578	Ga0496103_0271408	3300048906	Bacteria	1091
1579	Ga0496104_0305437	3300048907	Bacteria	1503
1580	Ga0496105_0039488	3300048908	Bacteria	3890
1581	Ga0496106_0349899	3300048909	Bacteria	1187
1582	Ga0496107_0040387	3300048910	Bacteria	3349
1583	Ga0496107_0152631	3300048910	Bacteria	1709
1584	Ga0496108_0127045	3300048911	Bacteria	2190
1585	Ga0496108_0682952	3300048911	Bacteria	891
1586	Ga0496109_0050631	3300048912	Bacteria	3782
1587	Ga0496109_0461162	3300048912	Bacteria	1200
1588	Ga0496110_0001557	3300048913	Bacteria	16711
1589	Ga0496110_0086963	3300048913	Bacteria	2791
1590	Ga0496110_0229656	3300048913	Bacteria	1687
1591	Ga0496110_0786231	3300048913	Bacteria	856
1592	Ga0496111_0067637	3300048914	Bacteria	2595
1593	Ga0496112_0407376	3300048915	Bacteria	1299
1594	Ga0496112_0420883	3300048915	Bacteria	1275
1595	Ga0496114_0082089	3300048917	Bacteria	2724
1596	Ga0496114_0100276	3300048917	Bacteria	2471
1597	Ga0496114_0110739	3300048917	Bacteria	2352
1598	Ga0496114_0372696	3300048917	Bacteria	1264
1599	Ga0496115_0023301	3300048918	Bacteria	4803
1600	Ga0496115_0381794	3300048918	Bacteria	1146
1601	Ga0496115_0550392	3300048918	Bacteria	922
1602	Ga0496116_0002196	3300048919	Bacteria	20783
1603	Ga0496116_0008492	3300048919	Bacteria	8903
1604	Ga0496116_0011139	3300048919	Bacteria	7476
1605	Ga0496117_0000005	3300048920	Bacteria	777468
1606	Ga0496117_0022171	3300048920	Bacteria	5099
1607	Ga0496118_0000022	3300048921	Bacteria	438602
1608	Ga0496118_0019623	3300048921	Bacteria	6034
1609	Ga0496118_0044587	3300048921	Bacteria	3471
1610	Ga0496121_0004994	3300048924	Bacteria	17366
1611	Ga0496121_0006051	3300048924	Bacteria	15233
1612	Ga0496121_0084891	3300048924	Bacteria	2494
1613	Ga0496121_0114687	3300048924	Bacteria	2047
1614	Ga0496121_0194091	3300048924	Bacteria	1453
1615	Ga0496121_0448104	3300048924	Bacteria	832
1616	Ga0496122_0000121	3300048925	Bacteria	181589
1617	Ga0496122_0000263	3300048925	Bacteria	117762
1618	Ga0496122_0001420	3300048925	Bacteria	38777
1619	Ga0496122_0001857	3300048925	Bacteria	32205
1620	Ga0496122_0078180	3300048925	Bacteria	2318
1621	Ga0496122_0136788	3300048925	Bacteria	1542
1622	Ga0496122_0247478	3300048925	Bacteria	1000
1623	Ga0496123_0000040	3300048926	Bacteria	258569
1624	Ga0496123_0000156	3300048926	Bacteria	139362
1625	Ga0496123_0000600	3300048926	Bacteria	61187
1626	Ga0496123_0006176	3300048926	Bacteria	11711
1627	Ga0496123_0027586	3300048926	Bacteria	4226
1628	Ga0496123_0034198	3300048926	Bacteria	3645
1629	Ga0496123_0053763	3300048926	Bacteria	2658
1630	Ga0496123_0144098	3300048926	Bacteria	1297
1631	Ga0496123_0163530	3300048926	Bacteria	1183
1632	Ga0496123_0200329	3300048926	Bacteria	1024
1633	Ga0496124_0016024	3300048927	Bacteria	7154
1634	Ga0496124_0058411	3300048927	Bacteria	3245
1635	Ga0496124_0060934	3300048927	Bacteria	3164
1636	Ga0496124_0071187	3300048927	Bacteria	2883
1637	Ga0496124_0077267	3300048927	Bacteria	2746
1638	Ga0496124_0077481	3300048927	Bacteria	2742
1639	Ga0496124_0166993	3300048927	Bacteria	1709
1640	Ga0496124_0180765	3300048927	Bacteria	1623
1641	Ga0496124_0251543	3300048927	Bacteria	1307
1642	Ga0496124_0297730	3300048927	Bacteria	1167
1643	Ga0496124_0333575	3300048927	Bacteria	1080
1644	Ga0496124_0346743	3300048927	Bacteria	1052
1645	Ga0496124_0410756	3300048927	Bacteria	936
1646	Ga0496125_0000672	3300048928	Bacteria	57073
1647	Ga0496125_0000720	3300048928	Bacteria	54770
1648	Ga0496125_0000995	3300048928	Bacteria	44209
1649	Ga0496125_0001215	3300048928	Bacteria	38708
1650	Ga0496125_0072287	3300048928	Bacteria	2688
1651	Ga0496125_0210209	3300048928	Bacteria	1264
1652	Ga0496125_0416342	3300048928	Bacteria	780
1653	Ga0496126_0102352	3300048929	Bacteria	2504
1654	Ga0496126_0380146	3300048929	Bacteria	1150
1655	Ga0496126_0606461	3300048929	Bacteria	862
1656	Ga0495678_000012	3300049459	Bacteria	333905
1657	Ga0495678_000035	3300049459	Bacteria	200957
1658	Ga0495678_000130	3300049459	Bacteria	88909
1659	Ga0495678_000232	3300049459	Bacteria	63796
1660	Ga0495678_000782	3300049459	Bacteria	28498
1661	Ga0495678_001730	3300049459	Bacteria	16272
1662	Ga0495678_002896	3300049459	Bacteria	11050
1663	Ga0495678_025648	3300049459	Bacteria	2528
1664	Ga0495678_039677	3300049459	Bacteria	1897
1665	Ga0495678_076832	3300049459	Bacteria	1209
1666	Ga0495682_0000210	3300049460	Bacteria	47048
1667	Ga0495682_0001032	3300049460	Bacteria	16423
1668	Ga0495682_0001446	3300049460	Bacteria	12830
1669	Ga0495682_0004102	3300049460	Bacteria	6324
1670	Ga0495682_0005703	3300049460	Bacteria	5140
1671	Ga0495682_0012843	3300049460	Bacteria	3199
1672	Ga0495682_0059274	3300049460	Bacteria	1383
1673	Ga0501290_007925	3300049513	Bacteria	1338
1674	Ga0501291_015618	3300049514	Bacteria	1150
1675	Ga0501300_007592	3300049523	Bacteria	1589
1676	Ga0501034_0000206	3300049571	Bacteria	112130
1677	Ga0501034_0084080	3300049571	Bacteria	3184
1678	Ga0501034_0135961	3300049571	Bacteria	2439
1679	Ga0501036_0277408	3300049572	Bacteria	1403
1680	Ga0501039_0761340	3300049575	Bacteria	756
1681	Ga0501042_0510025	3300049578	Bacteria	873
1682	Ga0501046_0341978	3300049580	Bacteria	1087
1683	Ga0501047_0026561	3300049581	Bacteria	5571
1684	Ga0501068_0055744	3300049584	Bacteria	2395
1685	Ga0501071_0250307	3300049587	Bacteria	1337
1686	Ga0501072_0001267	3300049588	Bacteria	18869
1687	Ga0501072_0578509	3300049588	Bacteria	886
1688	Ga0501073_0023535	3300049589	Bacteria	4423
1689	Ga0501227_051574	3300049665	Bacteria	1039
1690	Ga0501249_001082	3300049679	Bacteria	5782
1691	Ga0501249_004689	3300049679	Bacteria	2782
1692	Ga0501079_0005200	3300049741	Bacteria	9672
1693	Ga0501080_0008329	3300049742	Bacteria	9393
1694	Ga0501080_0024133	3300049742	Bacteria	5637
1695	Ga0501080_0085521	3300049742	Bacteria	2930
1696	Ga0501081_0209057	3300049743	Bacteria	1417
1697	Ga0501262_000019	3300049759	Bacteria	23083
1698	Ga0501269_000461	3300049766	Bacteria	8895
1699	Ga0501279_000878	3300049775	Bacteria	3965
1700	Ga0501279_005950	3300049775	Bacteria	1607
1701	Ga0501279_007263	3300049775	Bacteria	1469
1702	Ga0501280_000095	3300049776	Bacteria	23459
1703	Ga0501035_0028204	3300049822	Bacteria	5124
1704	nmdc:mga03683_43326_c1	3300050489	Bacteria	1856
1705	nmdc:mga03683_70164_c1	3300050489	Bacteria	1496
1706	nmdc:mga03683_80114_c1	3300050489	Bacteria	1409
1707	nmdc:mga03n38_314709_c1	3300050490	Bacteria	844
1708	nmdc:mga00v17_311613_c1	3300050491	Bacteria	1022
1709	nmdc:mga00v17_423106_c1	3300050491	Bacteria	865
1710	nmdc:mga00v17_86090_c1	3300050491	Bacteria	1969
1711	nmdc:mga0yw44_22522_c1	3300050492	Bacteria	3535
1712	nmdc:mga0yw44_8270_c1	3300050492	Bacteria	5170
1713	nmdc:mga0k408_101346_c1	3300050493	Bacteria	1698
1714	nmdc:mga0k408_112143_c1	3300050493	Bacteria	1612
1715	nmdc:mga0k408_19801_c1	3300050493	Bacteria	3764
1716	nmdc:mga0k408_5475_c1	3300050493	Bacteria	6759
1717	nmdc:mga0k408_61527_c2	3300050493	Bacteria	1780
1718	nmdc:mga0k408_68154_c1	3300050493	Bacteria	2075
1719	nmdc:mga06z11_40101_c1	3300050494	Bacteria	2335
1720	nmdc:mga04h51_8520_c1	3300050495	Bacteria	2746
1721	nmdc:mga07m45_18462_c1	3300050496	Bacteria	3765
1722	nmdc:mga07m45_203182_c1	3300050496	Bacteria	1153
1723	nmdc:mga07m45_241411_c1	3300050496	Bacteria	1051
1724	nmdc:mga07m45_2775_c1	3300050496	Bacteria	8275
1725	nmdc:mga07m45_60505_c1	3300050496	Bacteria	2144
1726	nmdc:mga07m45_613030_c1	3300050496	Bacteria	628
1727	nmdc:mga07m45_7745_c1	3300050496	Bacteria	5496
1728	nmdc:mga07m45_79585_c1	3300050496	Bacteria	1871
1729	nmdc:mga05p37_1073_c1	3300050507	Bacteria	31314
1730	nmdc:mga09592_2292_c1	3300050508	Bacteria	15432
1731	nmdc:mga09592_93450_c1	3300050508	Bacteria	2572
1732	nmdc:mga06r32_3362_c1	3300050510	Bacteria	14319
1733	nmdc:mga06r32_496801_c1	3300050510	Bacteria	1197
1734	nmdc:mga06r32_51646_c1	3300050510	Bacteria	3935
1735	nmdc:mga08y16_235623_c1	3300050511	Bacteria	1893
1736	nmdc:mga08y16_720960_c1	3300050511	Bacteria	995
1737	nmdc:mga0n895_287020_c1	3300050512	Bacteria	1668
1738	nmdc:mga0sz30_40875_c1	3300050516	Bacteria	1949
1739	nmdc:mga0sz30_52972_c1	3300050516	Bacteria	1723
1740	nmdc:mga0sz30_97077_c1	3300050516	Bacteria	1285
1741	Ga0495601_0339544	3300053077	Bacteria	977
1742	Ga0495612_0123430	3300053078	Bacteria	1115
1743	Ga0500610_0215706	3300053079	Bacteria	912
1744	Ga0500635_0000031	3300053080	Bacteria	99344
1745	Ga0495595_0002788	3300053084	Bacteria	6870
1746	Ga0495595_0284322	3300053084	Bacteria	831
1747	Ga0495619_0066386	3300053085	Bacteria	2407
1748	Ga0495619_0226161	3300053085	Bacteria	1296
1749	Ga0500644_0003670	3300053088	Bacteria	3810
1750	Ga0500646_0027665	3300053090	Bacteria	1544
1751	Ga0500583_0172445	3300053092	Bacteria	1077
1752	Ga0500562_089627	3300053108	Bacteria	834
1753	Ga0500571_000117	3300053110	Bacteria	25994
1754	Ga0500593_000535	3300053117	Bacteria	14946
1755	Ga0500593_028848	3300053117	Bacteria	2479
1756	Ga0500607_001551	3300053121	Bacteria	20371
1757	Ga0500608_025912	3300053122	Bacteria	2749
1758	Ga0500618_000088	3300053125	Bacteria	74892
1759	Ga0500618_063965	3300053125	Bacteria	827
1760	Ga0500658_0000018	3300053134	Bacteria	141217
1761	Ga0500559_0015042	3300053136	Bacteria	3271
1762	Ga0500564_079376	3300053138	Bacteria	1472
1763	Ga0500568_0064838	3300053139	Bacteria	1407
1764	Ga0500574_001122	3300053141	Bacteria	3822
1765	Ga0500616_0098630	3300053153	Bacteria	1432
1766	Ga0500622_0005018	3300053156	Bacteria	8065
1767	Ga0500634_0002332	3300053161	Bacteria	7960
1768	Ga0500636_0004688	3300053177	Bacteria	7761
1769	Ga0500636_0047433	3300053177	Bacteria	2530
1770	Ga0500636_0106223	3300053177	Bacteria	1591
1771	Ga0500637_0214823	3300053178	Bacteria	1090
1772	Ga0500625_011079	3300053729	Bacteria	4084
1773	Ga0500645_000155	3300053730	Bacteria	53212
1774	Ga0500645_012193	3300053730	Bacteria	2782
1775	Ga0500661_012902	3300055283	Bacteria	1507
1776	Ga0590071_109778	3300059421	Bacteria	699

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300042876	Ga0451577_0904936	Ga0451577_0904936_26_625	155
2	3300042876	Ga0451577_0025984	Ga0451577_0025984_4653_5264	164
3	3300044673	Ga0453683_0156024	Ga0453683_0156024_549_1178	164
4	3300044712	Ga0453684_0220791	Ga0453684_0220791_1118_1729	164
5	3300044712	Ga0453684_1076940	Ga0453684_1076940_189_818	164
6	3300053139	Ga0500568_0064838	Ga0500568_0064838_658_1359	169
7	3300053092	Ga0500583_0172445	Ga0500583_0172445_212_913	172
8	3300045051	Ga0451576_0347359	Ga0451576_0347359_514_1149	177
9	3300044712	Ga0453684_0517316	Ga0453684_0517316_350_994	179
10	3300046452	Ga0495617_005769	Ga0495617_005769_3466_4080	179
11	3300046457	Ga0495590_0011927	Ga0495590_0011927_2328_2942	179
12	3300046460	Ga0495638_0009661	Ga0495638_0009661_641_1255	179
13	3300046474	Ga0495605_0005369	Ga0495605_0005369_761_1375	179
14	3300046491	Ga0495584_0000570	Ga0495584_0000570_10140_10754	179
15	3300046491	Ga0495584_0022925	Ga0495584_0022925_477_1091	179
16	3300046492	Ga0495585_0013680	Ga0495585_0013680_1029_1643	179
17	3300046501	Ga0495607_0068780	Ga0495607_0068780_119_733	179
18	3300046506	Ga0495583_0000316	Ga0495583_0000316_30366_30980	179
19	3300046513	Ga0495616_0001323	Ga0495616_0001323_9861_10475	179
20	3300046513	Ga0495616_0023004	Ga0495616_0023004_2012_2626	179
21	3300046523	Ga0495644_0002875	Ga0495644_0002875_4770_5384	179
22	3300046524	Ga0495648_0000207	Ga0495648_0000207_1698_2312	179
23	3300046538	Ga0495609_0000421	Ga0495609_0000421_4352_4966	179
24	3300046557	Ga0495622_0057462	Ga0495622_0057462_889_1503	179
25	3300046558	Ga0495633_0002917	Ga0495633_0002917_1833_2447	179
26	3300046615	Ga0495656_0003025	Ga0495656_0003025_404_1018	179
27	3300046660	Ga0495625_0024019	Ga0495625_0024019_3042_3656	179
28	3300046664	Ga0495659_0009976	Ga0495659_0009976_507_1121	179
29	3300046665	Ga0495661_0191829	Ga0495661_0191829_172_786	179
30	3300046680	Ga0495646_0350254	Ga0495646_0350254_207_764	179
31	3300046691	Ga0495670_0003637	Ga0495670_0003637_6460_7074	179
32	3300046691	Ga0495670_0043803	Ga0495670_0043803_633_1247	179
33	3300046692	Ga0495671_0022530	Ga0495671_0022530_2383_2997	179
34	3300047318	Ga0495636_0001424	Ga0495636_0001424_6038_6652	179
35	3300047320	Ga0495672_0005477	Ga0495672_0005477_1226_1840	179
36	3300047323	Ga0495683_0011411	Ga0495683_0011411_2004_2618	179
37	3300047443	Ga0495687_000213	Ga0495687_000213_22686_23300	179
38	3300047445	Ga0495677_0025232	Ga0495677_0025232_99_713	179
39	3300047445	Ga0495677_0026044	Ga0495677_0026044_1551_2111	179
40	3300047446	Ga0495679_138107	Ga0495679_138107_12_626	179
41	3300047447	Ga0495685_000263	Ga0495685_000263_3621_4235	179
42	3300047469	Ga0495673_0007222	Ga0495673_0007222_407_1021	179
43	3300047472	Ga0495686_0286751	Ga0495686_0286751_246_860	179
44	3300049459	Ga0495678_000782	Ga0495678_000782_1837_2451	179
45	3300049460	Ga0495682_0005703	Ga0495682_0005703_1635_2249	179
46	3300005563	Ga0068855_100819405	Ga0068855_1008194051	180
47	3300046491	Ga0495584_0321205	Ga0495584_0321205_35_649	180
48	3300046499	Ga0495594_0097795	Ga0495594_0097795_831_1463	180
49	3300046531	Ga0495665_0050197	Ga0495665_0050197_1187_1819	180
50	3300046535	Ga0495586_0031016	Ga0495586_0031016_1754_2368	180
51	3300047315	Ga0495581_0113361	Ga0495581_0113361_373_987	180
52	3300047321	Ga0495676_0159584	Ga0495676_0159584_440_1072	180
53	3300048089	Ga0495614_0005891	Ga0495614_0005891_117_731	180
54	3300048091	Ga0495626_0003131	Ga0495626_0003131_728_1342	180
55	3300036647	Ga0316582_0456613	Ga0316582_0456613_288_860	181
56	3300050496	nmdc:mga07m45_203182_c1	nmdc:mga07m45_203182_c1_10_555	181
57	3300046499	Ga0495594_0288980	Ga0495594_0288980_251_865	183
58	3300050496	nmdc:mga07m45_613030_c1	nmdc:mga07m45_613030_c1_23_586	183
59	3300005455	Ga0070663_100730636	Ga0070663_1007306361	184
60	3300005719	Ga0068861_100045143	Ga0068861_1000451434	184
61	3300006847	Ga0075431_100006058	Ga0075431_1000060583	184
62	3300006880	Ga0075429_100101170	Ga0075429_1001011702	184
63	3300026067	Ga0207678_10410241	Ga0207678_104102412	184
64	3300026118	Ga0207675_100143415	Ga0207675_1001434153	184
65	3300026118	Ga0207675_100276761	Ga0207675_1002767613	184
66	3300031995	Ga0307409_100797135	Ga0307409_1007971353	184
67	3300048925	Ga0496122_0247478	Ga0496122_0247478_164_787	184
68	3300050508	nmdc:mga09592_93450_c1	nmdc:mga09592_93450_c1_977_1558	184
69	3300050510	nmdc:mga06r32_51646_c1	nmdc:mga06r32_51646_c1_3254_3835	184
70	3300035086	Ga0373934_0195176	Ga0373934_0195176_103_714	186
71	3300003761	Ga0055535_1000115	Ga0055535_100011550	187
72	3300003762	Ga0055542_1000028	Ga0055542_1000028113	187
73	3300005834	Ga0068851_10013697	Ga0068851_100136976	187
74	3300025228	Ga0209672_101025	Ga0209672_1010255	187
75	3300025229	Ga0209147_100906	Ga0209147_10090614	187
76	3300025242	Ga0209258_100067	Ga0209258_100067140	187
77	3300025254	Ga0209148_1000067	Ga0209148_1000067183	187
78	3300025321	Ga0207656_10027007	Ga0207656_100270072	187
79	3300002774	JGI25150J39212_1005296	JGI25150J39212_10052962	188
80	3300005456	Ga0070678_100407961	Ga0070678_1004079611	188
81	3300025258	Ga0209129_1000296	Ga0209129_100029650	188
82	3300025295	Ga0209564_1000734	Ga0209564_100073450	188
83	3300025297	Ga0209758_1000050	Ga0209758_100005050	188
84	3300025299	Ga0209256_1000023	Ga0209256_100002350	188
85	3300025302	Ga0207426_1000202	Ga0207426_1000202106	188
86	3300045051	Ga0451576_0000335	Ga0451576_0000335_56479_57090	188
87	3300046492	Ga0495585_0243599	Ga0495585_0243599_211_825	188
88	3300046501	Ga0495607_0126950	Ga0495607_0126950_615_1229	188
89	3300047320	Ga0495672_0023423	Ga0495672_0023423_132_746	188
90	3300047445	Ga0495677_0007617	Ga0495677_0007617_3151_3765	188
91	3300049571	Ga0501034_0084080	Ga0501034_0084080_282_905	188
92	3300049580	Ga0501046_0341978	Ga0501046_0341978_263_886	188
93	3300049581	Ga0501047_0026561	Ga0501047_0026561_3615_4238	188
94	3300049742	Ga0501080_0008329	Ga0501080_0008329_384_1007	188
95	3300005564	Ga0070664_100083686	Ga0070664_1000836864	189
96	3300005578	Ga0068854_100763546	Ga0068854_1007635462	189
97	3300005616	Ga0068852_100277164	Ga0068852_1002771643	189
98	3300006195	Ga0075366_10031880	Ga0075366_100318803	189
99	3300006847	Ga0075431_100323389	Ga0075431_1003233892	189
100	3300009036	Ga0105244_10000730	Ga0105244_1000073021	189
101	3300009148	Ga0105243_10002832	Ga0105243_1000283210	189
102	3300013100	Ga0157373_10200505	Ga0157373_102005053	189
103	3300015261	Ga0182006_1000910	Ga0182006_100091013	189
104	3300017792	Ga0163161_10146329	Ga0163161_101463293	189
105	3300025728	Ga0207655_1001409	Ga0207655_100140915	189
106	3300025924	Ga0207694_10289665	Ga0207694_102896653	189
107	3300025935	Ga0207709_10002008	Ga0207709_1000200811	189
108	3300025945	Ga0207679_10056475	Ga0207679_100564752	189
109	3300025949	Ga0207667_10775809	Ga0207667_107758092	189
110	3300026142	Ga0207698_10074715	Ga0207698_100747152	189
111	3300027717	Ga0209998_10050995	Ga0209998_100509952	189
112	3300028794	Ga0307515_10215622	Ga0307515_102156222	189
113	3300031456	Ga0307513_10001949	Ga0307513_1000194913	189
114	3300036401	Ga0373937_0029330	Ga0373937_0029330_4142_4756	189
115	3300046507	Ga0495606_0000066	Ga0495606_0000066_122221_122817	189
116	3300046616	Ga0495668_0086129	Ga0495668_0086129_348_971	189
117	3300048919	Ga0496116_0011139	Ga0496116_0011139_6392_7030	189
118	3300048920	Ga0496117_0022171	Ga0496117_0022171_1468_2106	189
119	3300048921	Ga0496118_0019623	Ga0496118_0019623_4126_4764	189
120	3300048924	Ga0496121_0084891	Ga0496121_0084891_1737_2375	189
121	3300048927	Ga0496124_0077267	Ga0496124_0077267_503_1141	189
122	3300048928	Ga0496125_0072287	Ga0496125_0072287_171_809	189
123	3300050510	nmdc:mga06r32_496801_c1	nmdc:mga06r32_496801_c1_226_837	189
124	iso_pu_bacteria	2526164512	2526213434	189
125	iso_pu_bacteria	2599185155	2599330462	189
126	iso_pu_bacteria	3007252601	3007253296	189
127	3300003791	Ga0055530_10021948	Ga0055530_100219483	190
128	3300005367	Ga0070667_100179349	Ga0070667_1001793492	190
129	3300005457	Ga0070662_100280255	Ga0070662_1002802553	190
130	3300006195	Ga0075366_10173468	Ga0075366_101734682	190
131	3300013306	Ga0163162_11417413	Ga0163162_114174131	190
132	3300013308	Ga0157375_10494142	Ga0157375_104941422	190
133	3300017792	Ga0163161_10007311	Ga0163161_100073116	190
134	3300025292	Ga0209676_1000123	Ga0209676_100012343	190
135	3300025298	Ga0209050_1000188	Ga0209050_10001886	190
136	3300025303	Ga0209051_1000091	Ga0209051_100009143	190
137	3300025933	Ga0207706_10317414	Ga0207706_103174143	190
138	3300028794	Ga0307515_10000736	Ga0307515_1000073655	190
139	3300031456	Ga0307513_10296746	Ga0307513_102967462	190
140	3300042135	Ga0450899_003695	Ga0450899_003695_767_1411	190
141	3300046460	Ga0495638_0276047	Ga0495638_0276047_166_795	190
142	3300046513	Ga0495616_0032520	Ga0495616_0032520_1637_2266	190
143	3300046515	Ga0495620_0029572	Ga0495620_0029572_1310_1939	190
144	3300046518	Ga0495631_0000530	Ga0495631_0000530_24425_25054	190
145	3300046520	Ga0495637_0025140	Ga0495637_0025140_1061_1690	190
146	3300046663	Ga0495635_0300677	Ga0495635_0300677_284_913	190
147	3300047321	Ga0495676_0001586	Ga0495676_0001586_3086_3715	190
148	3300047673	Ga0495593_0097923	Ga0495593_0097923_205_834	190
149	3300048089	Ga0495614_0005764	Ga0495614_0005764_4473_5102	190
150	3300048926	Ga0496123_0027586	Ga0496123_0027586_281_910	190
151	3300050489	nmdc:mga03683_80114_c1	nmdc:mga03683_80114_c1_203_847	190
152	3300053108	Ga0500562_089627	Ga0500562_089627_175_804	190
153	3300053110	Ga0500571_000117	Ga0500571_000117_544_1173	190
154	3300053134	Ga0500658_0000018	Ga0500658_0000018_131583_132212	190
155	3300053138	Ga0500564_079376	Ga0500564_079376_339_968	190
156	3300053141	Ga0500574_001122	Ga0500574_001122_1733_2362	190
157	3300053153	Ga0500616_0098630	Ga0500616_0098630_113_742	190
158	3300053177	Ga0500636_0106223	Ga0500636_0106223_387_1016	190
159	3300005336	Ga0070680_100076925	Ga0070680_1000769253	191
160	3300005343	Ga0070687_100047149	Ga0070687_1000471492	191
161	3300005444	Ga0070694_100760738	Ga0070694_1007607381	191
162	3300005539	Ga0068853_100315577	Ga0068853_1003155772	191
163	3300005549	Ga0070704_101006955	Ga0070704_1010069551	191
164	3300005577	Ga0068857_100317281	Ga0068857_1003172812	191
165	3300005617	Ga0068859_100004203	Ga0068859_1000042039	191
166	3300005842	Ga0068858_100915254	Ga0068858_1009152542	191
167	3300006931	Ga0097620_100004203	Ga0097620_1000042038	191
168	3300009094	Ga0111539_10256613	Ga0111539_102566134	191
169	3300009174	Ga0105241_10030171	Ga0105241_100301712	191
170	3300009553	Ga0105249_10193650	Ga0105249_101936502	191
171	3300010375	Ga0105239_10122601	Ga0105239_101226014	191
172	3300013307	Ga0157372_10393160	Ga0157372_103931603	191
173	3300014325	Ga0163163_10710808	Ga0163163_107108083	191
174	3300025303	Ga0209051_1000298	Ga0209051_100029856	191
175	3300025901	Ga0207688_10607084	Ga0207688_106070841	191
176	3300025918	Ga0207662_10147284	Ga0207662_101472843	191
177	3300025933	Ga0207706_10006375	Ga0207706_1000637513	191
178	3300025949	Ga0207667_10094500	Ga0207667_100945004	191
179	3300026035	Ga0207703_10532254	Ga0207703_105322542	191
180	3300026041	Ga0207639_10088465	Ga0207639_100884652	191
181	3300026116	Ga0207674_10173168	Ga0207674_101731683	191
182	3300031731	Ga0307405_10230312	Ga0307405_102303123	191
183	3300031901	Ga0307406_10003021	Ga0307406_100030212	191
184	3300032002	Ga0307416_101363031	Ga0307416_1013630312	191
185	3300042876	Ga0451577_0233760	Ga0451577_0233760_718_1332	191
186	3300044712	Ga0453684_0074099	Ga0453684_0074099_2200_2814	191
187	3300045051	Ga0451576_0112235	Ga0451576_0112235_806_1420	191
188	3300048905	Ga0496102_0371626	Ga0496102_0371626_463_1089	191
189	3300048906	Ga0496103_0232947	Ga0496103_0232947_145_771	191
190	3300049587	Ga0501071_0250307	Ga0501071_0250307_363_974	191
191	3300049588	Ga0501072_0578509	Ga0501072_0578509_20_631	191
192	3300049741	Ga0501079_0005200	Ga0501079_0005200_19_630	191
193	iso_pu_bacteria	2548876994	2550692774	191
194	iso_pu_bacteria	2574179768	2574432907	191
195	iso_pu_bacteria	2600255292	2601671532	191
196	iso_pu_bacteria	2643221554	2643792454	191
197	iso_pu_bacteria	2643221556	2643800027	191
198	iso_pu_bacteria	2643221638	2644217029	191
199	iso_pu_bacteria	2643221645	2644250647	191
200	iso_pu_bacteria	2643221664	2644358959	191
201	iso_pu_bacteria	2643221684	2644475027	191
202	iso_pu_bacteria	2738541280	2738738594	191
203	iso_pu_bacteria	2738541297	2738826323	191
204	iso_pu_bacteria	2738541300	2738842597	191
205	iso_pu_bacteria	2738541357	2739150120	191
206	iso_pu_bacteria	2738543003	2739192039	191
207	iso_pu_bacteria	2738543018	2739273344	191
208	iso_pu_bacteria	2738543026	2739318516	191
209	iso_pu_bacteria	2738543029	2739336757	191
210	iso_pu_bacteria	2738543030	2739342388	191
211	iso_pu_bacteria	2818991445	2819593682	191
212	iso_pu_bacteria	2821131069	2821134868	191
213	iso_pu_bacteria	2857547612	2857548634	191
214	iso_pu_bacteria	2857553236	2857558442	191
215	iso_pu_bacteria	2857564685	2857569745	191
216	iso_pu_bacteria	2884811622	2884815858	191
217	iso_pu_bacteria	2884836552	2884837883	191
218	iso_pu_bacteria	2884852848	2884854175	191
219	iso_pu_bacteria	2885080285	2885082233	191
220	iso_pu_bacteria	2896154374	2896154708	191
221	iso_pu_bacteria	2904424332	2904428245	191
222	iso_pu_bacteria	2919476304	2919476528	191
223	iso_pu_bacteria	2932410948	2932416033	191
224	iso_pu_bacteria	2932416698	2932421954	191
225	iso_pu_bacteria	8047673197	8047673535	191
226	3300003187	JGI25151J46595_10003350	JGI25151J46595_1000335010	192
227	3300003771	Ga0055526_1029198	Ga0055526_10291982	192
228	3300003773	Ga0055537_1000068	Ga0055537_100006847	192
229	3300003773	Ga0055537_1008895	Ga0055537_10088954	192
230	3300003784	Ga0055534_1000080	Ga0055534_100008047	192
231	3300003790	Ga0055528_1000159	Ga0055528_100015934	192
232	3300003790	Ga0055528_1000520	Ga0055528_10005202	192
233	3300003794	Ga0055531_10073154	Ga0055531_100731541	192
234	3300005288	Ga0065714_10218600	Ga0065714_102186002	192
235	3300005366	Ga0070659_100293269	Ga0070659_1002932692	192
236	3300005578	Ga0068854_100100719	Ga0068854_1001007191	192
237	3300005616	Ga0068852_100393089	Ga0068852_1003930892	192
238	3300006038	Ga0075365_10002031	Ga0075365_100020312	192
239	3300006051	Ga0075364_10007877	Ga0075364_100078772	192
240	3300006058	Ga0075432_10005523	Ga0075432_100055235	192
241	3300006177	Ga0075362_10030744	Ga0075362_100307443	192
242	3300006186	Ga0075369_10069955	Ga0075369_100699553	192
243	3300006195	Ga0075366_10119712	Ga0075366_101197123	192
244	3300006353	Ga0075370_10003278	Ga0075370_100032782	192
245	3300006353	Ga0075370_10012403	Ga0075370_100124037	192
246	3300006948	Ga0099826_10000158	Ga0099826_1000015823	192
247	3300009093	Ga0105240_10032761	Ga0105240_100327616	192
248	3300009148	Ga0105243_10000392	Ga0105243_100003924	192
249	3300009148	Ga0105243_10052781	Ga0105243_100527812	192
250	3300009545	Ga0105237_10007850	Ga0105237_100078504	192
251	3300010375	Ga0105239_10043053	Ga0105239_100430532	192
252	3300013100	Ga0157373_10034715	Ga0157373_100347154	192
253	3300013104	Ga0157370_10081600	Ga0157370_100816004	192
254	3300013105	Ga0157369_10005435	Ga0157369_1000543513	192
255	3300014497	Ga0182008_10072366	Ga0182008_100723662	192
256	3300025258	Ga0209129_1001419	Ga0209129_100141910	192
257	3300025263	Ga0209565_1000073	Ga0209565_1000073134	192
258	3300025263	Ga0209565_1001352	Ga0209565_10013527	192
259	3300025273	Ga0209673_1000127	Ga0209673_100012733	192
260	3300025291	Ga0209675_1000029	Ga0209675_100002933	192
261	3300025291	Ga0209675_1002958	Ga0209675_10029582	192
262	3300025291	Ga0209675_1043247	Ga0209675_10432471	192
263	3300025292	Ga0209676_1000098	Ga0209676_1000098106	192
264	3300025294	Ga0209025_1000104	Ga0209025_100010464	192
265	3300025294	Ga0209025_1020430	Ga0209025_10204302	192
266	3300025294	Ga0209025_1058269	Ga0209025_10582693	192
267	3300025295	Ga0209564_1002295	Ga0209564_100229513	192
268	3300025295	Ga0209564_1024136	Ga0209564_10241362	192
269	3300025298	Ga0209050_1040010	Ga0209050_10400103	192
270	3300025303	Ga0209051_1000098	Ga0209051_1000098106	192
271	3300025303	Ga0209051_1064873	Ga0209051_10648732	192
272	3300025304	Ga0209257_1005944	Ga0209257_100594411	192
273	3300025906	Ga0207699_10380839	Ga0207699_103808392	192
274	3300025913	Ga0207695_10023486	Ga0207695_100234869	192
275	3300025914	Ga0207671_10118751	Ga0207671_101187512	192
276	3300025932	Ga0207690_10288701	Ga0207690_102887013	192
277	3300025935	Ga0207709_10000130	Ga0207709_1000013039	192
278	3300025935	Ga0207709_10115986	Ga0207709_101159862	192
279	3300025981	Ga0207640_10079885	Ga0207640_100798854	192
280	3300027666	Ga0209282_1015352	Ga0209282_10153522	192
281	3300030731	Ga0316177_1003817	Ga0316177_10038174	192
282	3300030732	Ga0316176_1149365	Ga0316176_11493655	192
283	3300030733	Ga0314311_1083999	Ga0314311_10839992	192
284	3300030735	Ga0316178_1017927	Ga0316178_10179274	192
285	3300030736	Ga0316180_1046521	Ga0316180_10465214	192
286	3300030742	Ga0316183_1151240	Ga0316183_11512403	192
287	3300030744	Ga0316181_1052698	Ga0316181_10526982	192
288	3300031241	Ga0265325_10009531	Ga0265325_100095314	192
289	3300031548	Ga0307408_100039531	Ga0307408_1000395312	192
290	3300031548	Ga0307408_100050469	Ga0307408_1000504694	192
291	3300031548	Ga0307408_100064395	Ga0307408_1000643952	192
292	3300031649	Ga0307514_10071427	Ga0307514_100714272	192
293	3300031731	Ga0307405_10152970	Ga0307405_101529702	192
294	3300031824	Ga0307413_10123465	Ga0307413_101234652	192
295	3300031901	Ga0307406_10151832	Ga0307406_101518323	192
296	3300031911	Ga0307412_10019731	Ga0307412_100197316	192
297	3300031911	Ga0307412_10121573	Ga0307412_101215732	192
298	3300031911	Ga0307412_10176262	Ga0307412_101762623	192
299	3300031911	Ga0307412_10235972	Ga0307412_102359722	192
300	3300032002	Ga0307416_100124232	Ga0307416_1001242321	192
301	3300032002	Ga0307416_100408899	Ga0307416_1004088993	192
302	3300032004	Ga0307414_10202003	Ga0307414_102020033	192
303	3300032005	Ga0307411_10025348	Ga0307411_100253484	192
304	3300032133	Ga0316583_10010949	Ga0316583_100109491	192
305	3300032133	Ga0316583_10014086	Ga0316583_100140863	192
306	3300032133	Ga0316583_10198640	Ga0316583_101986401	192
307	3300032139	Ga0316580_10053026	Ga0316580_100530262	192
308	3300035086	Ga0373934_0000061	Ga0373934_0000061_1400_2011	192
309	3300035086	Ga0373934_0004954	Ga0373934_0004954_3054_3665	192
310	3300035089	Ga0373944_0124964	Ga0373944_0124964_11_625	192
311	3300035111	Ga0373923_0043166	Ga0373923_0043166_961_1572	192
312	3300035113	Ga0373936_0095397	Ga0373936_0095397_135_746	192
313	3300035117	Ga0373953_0048015	Ga0373953_0048015_735_1346	192
314	3300035119	Ga0373956_0000003	Ga0373956_0000003_50044_50655	192
315	3300035120	Ga0373957_0006728	Ga0373957_0006728_591_1202	192
316	3300035120	Ga0373957_0053964	Ga0373957_0053964_850_1461	192
317	3300035171	Ga0373946_0024763	Ga0373946_0024763_680_1291	192
318	3300035172	Ga0373955_0029096	Ga0373955_0029096_798_1409	192
319	3300035172	Ga0373955_0056385	Ga0373955_0056385_1007_1618	192
320	3300035398	Ga0316574_0293874	Ga0316574_0293874_221_826	192
321	3300035410	Ga0373924_0007329	Ga0373924_0007329_883_1494	192
322	3300035692	Ga0373935_0049767	Ga0373935_0049767_1340_1951	192
323	3300035695	Ga0373927_0033886	Ga0373927_0033886_983_1594	192
324	3300035724	Ga0373933_0000742	Ga0373933_0000742_10589_11200	192
325	3300035724	Ga0373933_0122491	Ga0373933_0122491_856_1467	192
326	3300035725	Ga0373947_0127136	Ga0373947_0127136_520_1131	192
327	3300036401	Ga0373937_0000196	Ga0373937_0000196_31884_32495	192
328	3300036401	Ga0373937_0253612	Ga0373937_0253612_742_1353	192
329	3300036647	Ga0316582_0050404	Ga0316582_0050404_1534_2142	192
330	3300037068	Ga0373925_0188106	Ga0373925_0188106_898_1509	192
331	3300039062	Ga0400483_051857	Ga0400483_051857_690_1292	192
332	3300041404	Ga0439436_0000104	Ga0439436_0000104_621_1247	192
333	3300041407	Ga0439447_012613	Ga0439447_012613_1413_2039	192
334	3300041410	Ga0439461_0013848	Ga0439461_0013848_102_728	192
335	3300041411	Ga0439466_0001768	Ga0439466_0001768_2501_3127	192
336	3300041997	Ga0439431_0003442	Ga0439431_0003442_195_821	192
337	3300041999	Ga0439433_0003975	Ga0439433_0003975_550_1176	192
338	3300042006	Ga0439432_001812	Ga0439432_001812_6108_6734	192
339	3300042007	Ga0439449_0001978	Ga0439449_0001978_1544_2170	192
340	3300042010	Ga0439452_004953	Ga0439452_004953_2329_2955	192
341	3300042014	Ga0439457_006525	Ga0439457_006525_1385_2011	192
342	3300042015	Ga0439462_0015372	Ga0439462_0015372_433_1059	192
343	3300042123	Ga0450921_001571	Ga0450921_001571_208_840	192
344	3300042134	Ga0450898_028513	Ga0450898_028513_211_843	192
345	3300042145	Ga0450906_018185	Ga0450906_018185_227_859	192
346	3300042435	Ga0439434_0000355	Ga0439434_0000355_7773_8399	192
347	3300042435	Ga0439434_0093547	Ga0439434_0093547_130_762	192
348	3300042876	Ga0451577_0000519	Ga0451577_0000519_43652_44263	192
349	3300042876	Ga0451577_0036616	Ga0451577_0036616_970_1581	192
350	3300042876	Ga0451577_0132985	Ga0451577_0132985_1543_2154	192
351	3300042876	Ga0451577_0185715	Ga0451577_0185715_786_1397	192
352	3300044673	Ga0453683_0283910	Ga0453683_0283910_275_886	192
353	3300044712	Ga0453684_0000419	Ga0453684_0000419_35095_35706	192
354	3300044712	Ga0453684_0013398	Ga0453684_0013398_1846_2457	192
355	3300045051	Ga0451576_0441572	Ga0451576_0441572_253_879	192
356	3300046461	Ga0495641_0012156	Ga0495641_0012156_838_1449	192
357	3300046462	Ga0495651_0000105	Ga0495651_0000105_53960_54571	192
358	3300046462	Ga0495651_0012584	Ga0495651_0012584_1351_1962	192
359	3300046463	Ga0495653_0016021	Ga0495653_0016021_2349_2960	192
360	3300046472	Ga0495580_0054128	Ga0495580_0054128_129_740	192
361	3300046473	Ga0495582_0049246	Ga0495582_0049246_710_1321	192
362	3300046475	Ga0495639_0061601	Ga0495639_0061601_818_1429	192
363	3300046476	Ga0495662_0028518	Ga0495662_0028518_1278_1889	192
364	3300046511	Ga0495608_0207429	Ga0495608_0207429_174_785	192
365	3300046514	Ga0495618_0012194	Ga0495618_0012194_2320_2931	192
366	3300046517	Ga0495630_0002338	Ga0495630_0002338_6851_7462	192
367	3300046526	Ga0495666_0090091	Ga0495666_0090091_472_1083	192
368	3300046529	Ga0495652_0037438	Ga0495652_0037438_2702_3313	192
369	3300046531	Ga0495665_0013415	Ga0495665_0013415_480_1091	192
370	3300046642	Ga0495634_0066291	Ga0495634_0066291_538_1149	192
371	3300046660	Ga0495625_0000301	Ga0495625_0000301_46217_46849	192
372	3300046663	Ga0495635_0172552	Ga0495635_0172552_292_903	192
373	3300046678	Ga0495599_0094250	Ga0495599_0094250_619_1230	192
374	3300046681	Ga0495647_0024140	Ga0495647_0024140_1399_2010	192
375	3300046683	Ga0495658_0020266	Ga0495658_0020266_1634_2245	192
376	3300046809	Ga0495600_0002368	Ga0495600_0002368_2397_3008	192
377	3300047317	Ga0495604_0123627	Ga0495604_0123627_790_1401	192
378	3300047319	Ga0495674_0009959	Ga0495674_0009959_1671_2282	192
379	3300047444	Ga0495675_0006291	Ga0495675_0006291_6057_6668	192
380	3300048909	Ga0496106_0349899	Ga0496106_0349899_530_1135	192
381	3300048927	Ga0496124_0180765	Ga0496124_0180765_551_1183	192
382	3300049679	Ga0501249_004689	Ga0501249_004689_1697_2326	192
383	3300049759	Ga0501262_000019	Ga0501262_000019_617_1246	192
384	3300050489	nmdc:mga03683_70164_c1	nmdc:mga03683_70164_c1_540_1166	192
385	3300050490	nmdc:mga03n38_314709_c1	nmdc:mga03n38_314709_c1_25_657	192
386	3300050492	nmdc:mga0yw44_8270_c1	nmdc:mga0yw44_8270_c1_1060_1692	192
387	3300050493	nmdc:mga0k408_101346_c1	nmdc:mga0k408_101346_c1_217_846	192
388	3300050496	nmdc:mga07m45_2775_c1	nmdc:mga07m45_2775_c1_3461_4090	192
389	3300053078	Ga0495612_0123430	Ga0495612_0123430_129_740	192
390	3300053079	Ga0500610_0215706	Ga0500610_0215706_188_817	192
391	3300053084	Ga0495595_0002788	Ga0495595_0002788_779_1390	192
392	3300053085	Ga0495619_0066386	Ga0495619_0066386_1634_2245	192
393	3300053121	Ga0500607_001551	Ga0500607_001551_267_896	192
394	3300053122	Ga0500608_025912	Ga0500608_025912_232_861	192
395	3300053730	Ga0500645_000155	Ga0500645_000155_34241_34870	192
396	3300005288	Ga0065714_10118388	Ga0065714_101183881	193
397	3300005290	Ga0065712_10210356	Ga0065712_102103562	193
398	3300005328	Ga0070676_10122784	Ga0070676_101227842	193
399	3300005330	Ga0070690_100066571	Ga0070690_1000665714	193
400	3300005331	Ga0070670_100149079	Ga0070670_1001490794	193
401	3300005331	Ga0070670_100187648	Ga0070670_1001876483	193
402	3300005333	Ga0070677_10108307	Ga0070677_101083071	193
403	3300005334	Ga0068869_100697351	Ga0068869_1006973512	193
404	3300005338	Ga0068868_100143982	Ga0068868_1001439821	193
405	3300005340	Ga0070689_100079545	Ga0070689_1000795452	193
406	3300005345	Ga0070692_10147454	Ga0070692_101474542	193
407	3300005347	Ga0070668_100023220	Ga0070668_1000232208	193
408	3300005354	Ga0070675_100066280	Ga0070675_1000662805	193
409	3300005354	Ga0070675_100357302	Ga0070675_1003573023	193
410	3300005355	Ga0070671_100057372	Ga0070671_1000573725	193
411	3300005355	Ga0070671_100349676	Ga0070671_1003496762	193
412	3300005356	Ga0070674_100158641	Ga0070674_1001586412	193
413	3300005364	Ga0070673_100061792	Ga0070673_1000617925	193
414	3300005367	Ga0070667_100137940	Ga0070667_1001379401	193
415	3300005441	Ga0070700_100201396	Ga0070700_1002013962	193
416	3300005456	Ga0070678_100018733	Ga0070678_1000187333	193
417	3300005457	Ga0070662_100220990	Ga0070662_1002209902	193
418	3300005459	Ga0068867_100068818	Ga0068867_1000688181	193
419	3300005466	Ga0070685_10043564	Ga0070685_100435643	193
420	3300005543	Ga0070672_100065748	Ga0070672_1000657485	193
421	3300005543	Ga0070672_100407247	Ga0070672_1004072472	193
422	3300005544	Ga0070686_100042934	Ga0070686_1000429342	193
423	3300005564	Ga0070664_100271136	Ga0070664_1002711362	193
424	3300005615	Ga0070702_100183294	Ga0070702_1001832942	193
425	3300005618	Ga0068864_100067928	Ga0068864_1000679282	193
426	3300005840	Ga0068870_10080809	Ga0068870_100808092	193
427	3300005841	Ga0068863_100039081	Ga0068863_1000390815	193
428	3300005841	Ga0068863_100531105	Ga0068863_1005311053	193
429	3300005843	Ga0068860_100101198	Ga0068860_1001011981	193
430	3300006177	Ga0075362_10021605	Ga0075362_100216054	193
431	3300006353	Ga0075370_10006560	Ga0075370_100065602	193
432	3300006881	Ga0068865_100083640	Ga0068865_1000836402	193
433	3300009036	Ga0105244_10000631	Ga0105244_1000063131	193
434	3300009094	Ga0111539_10151246	Ga0111539_101512462	193
435	3300009098	Ga0105245_10318769	Ga0105245_103187692	193
436	3300009101	Ga0105247_10580439	Ga0105247_105804392	193
437	3300009148	Ga0105243_10218403	Ga0105243_102184032	193
438	3300009148	Ga0105243_10478944	Ga0105243_104789442	193
439	3300009177	Ga0105248_10051154	Ga0105248_100511542	193
440	3300009177	Ga0105248_10185122	Ga0105248_101851222	193
441	3300013306	Ga0163162_11045192	Ga0163162_110451922	193
442	3300013308	Ga0157375_10246644	Ga0157375_102466444	193
443	3300014968	Ga0157379_10086742	Ga0157379_100867425	193
444	3300014969	Ga0157376_10839875	Ga0157376_108398752	193
445	3300015261	Ga0182006_1030379	Ga0182006_10303792	193
446	3300017792	Ga0163161_10092976	Ga0163161_100929764	193
447	3300017792	Ga0163161_10157368	Ga0163161_101573682	193
448	3300025315	Ga0207697_10005112	Ga0207697_100051122	193
449	3300025728	Ga0207655_1009228	Ga0207655_10092282	193
450	3300025893	Ga0207682_10005184	Ga0207682_100051842	193
451	3300025899	Ga0207642_10055604	Ga0207642_100556044	193
452	3300025901	Ga0207688_10008591	Ga0207688_100085915	193
453	3300025903	Ga0207680_10314256	Ga0207680_103142562	193
454	3300025907	Ga0207645_10036449	Ga0207645_100364492	193
455	3300025908	Ga0207643_10011009	Ga0207643_100110095	193
456	3300025918	Ga0207662_10138765	Ga0207662_101387652	193
457	3300025923	Ga0207681_10294784	Ga0207681_102947842	193
458	3300025925	Ga0207650_10064331	Ga0207650_100643312	193
459	3300025925	Ga0207650_10152410	Ga0207650_101524102	193
460	3300025933	Ga0207706_10022691	Ga0207706_100226914	193
461	3300025935	Ga0207709_10217772	Ga0207709_102177722	193
462	3300025935	Ga0207709_10335788	Ga0207709_103357882	193
463	3300025936	Ga0207670_10189199	Ga0207670_101891994	193
464	3300025937	Ga0207669_10156545	Ga0207669_101565453	193
465	3300025938	Ga0207704_10485112	Ga0207704_104851122	193
466	3300025942	Ga0207689_10047496	Ga0207689_100474962	193
467	3300025960	Ga0207651_10103229	Ga0207651_101032294	193
468	3300025972	Ga0207668_10259511	Ga0207668_102595114	193
469	3300025986	Ga0207658_10079414	Ga0207658_100794145	193
470	3300026075	Ga0207708_10018413	Ga0207708_100184135	193
471	3300026088	Ga0207641_10571342	Ga0207641_105713424	193
472	3300026089	Ga0207648_10043226	Ga0207648_100432265	193
473	3300026095	Ga0207676_10151726	Ga0207676_101517262	193
474	3300026118	Ga0207675_100095365	Ga0207675_1000953652	193
475	3300027907	Ga0207428_10175809	Ga0207428_101758092	193
476	3300028577	Ga0265318_10002709	Ga0265318_100027097	193
477	3300028653	Ga0265323_10048937	Ga0265323_100489372	193
478	3300031238	Ga0265332_10000010	Ga0265332_10000010122	193
479	3300031238	Ga0265332_10003349	Ga0265332_100033493	193
480	3300031239	Ga0265328_10008502	Ga0265328_100085026	193
481	3300031240	Ga0265320_10080146	Ga0265320_100801464	193
482	3300031242	Ga0265329_10011235	Ga0265329_100112355	193
483	3300031249	Ga0265339_10148047	Ga0265339_101480473	193
484	3300031250	Ga0265331_10003732	Ga0265331_1000373211	193
485	3300031344	Ga0265316_10010873	Ga0265316_100108735	193
486	3300031344	Ga0265316_10091425	Ga0265316_100914252	193
487	3300031548	Ga0307408_100094347	Ga0307408_1000943472	193
488	3300031595	Ga0265313_10126267	Ga0265313_101262672	193
489	3300031665	Ga0316575_10008551	Ga0316575_100085514	193
490	3300031691	Ga0316579_10001461	Ga0316579_1000146112	193
491	3300031691	Ga0316579_10006624	Ga0316579_100066245	193
492	3300031711	Ga0265314_10001467	Ga0265314_1000146710	193
493	3300031711	Ga0265314_10404716	Ga0265314_104047161	193
494	3300031711	Ga0265314_10424522	Ga0265314_104245221	193
495	3300031727	Ga0316576_10015346	Ga0316576_100153464	193
496	3300031727	Ga0316576_10022886	Ga0316576_100228866	193
497	3300031727	Ga0316576_10127131	Ga0316576_101271312	193
498	3300031727	Ga0316576_10205793	Ga0316576_102057933	193
499	3300031727	Ga0316576_10484354	Ga0316576_104843542	193
500	3300031728	Ga0316578_10057296	Ga0316578_100572962	193
501	3300031728	Ga0316578_10074158	Ga0316578_100741583	193
502	3300031728	Ga0316578_10075870	Ga0316578_100758701	193
503	3300031728	Ga0316578_10095743	Ga0316578_100957432	193
504	3300031728	Ga0316578_10303419	Ga0316578_103034191	193
505	3300031733	Ga0316577_10011550	Ga0316577_100115506	193
506	3300031733	Ga0316577_10045083	Ga0316577_100450833	193
507	3300031733	Ga0316577_10091212	Ga0316577_100912122	193
508	3300031733	Ga0316577_10138767	Ga0316577_101387672	193
509	3300031911	Ga0307412_10024700	Ga0307412_100247002	193
510	3300031911	Ga0307412_10149151	Ga0307412_101491513	193
511	3300032005	Ga0307411_10165341	Ga0307411_101653412	193
512	3300032133	Ga0316583_10002136	Ga0316583_100021365	193
513	3300032137	Ga0316585_10006899	Ga0316585_100068993	193
514	3300032168	Ga0316593_10002883	Ga0316593_100028833	193
515	3300032168	Ga0316593_10014164	Ga0316593_100141643	193
516	3300032168	Ga0316593_10019478	Ga0316593_100194782	193
517	3300032168	Ga0316593_10029503	Ga0316593_100295033	193
518	3300032168	Ga0316593_10032218	Ga0316593_100322183	193
519	3300032168	Ga0316593_10068620	Ga0316593_100686202	193
520	3300033524	Ga0316592_1010041	Ga0316592_10100413	193
521	3300033529	Ga0316587_1018323	Ga0316587_10183232	193
522	3300033541	Ga0316596_1016404	Ga0316596_10164042	193
523	3300033541	Ga0316596_1126591	Ga0316596_11265911	193
524	3300035091	Ga0373951_0038069	Ga0373951_0038069_501_1136	193
525	3300035092	Ga0373952_0013212	Ga0373952_0013212_871_1476	193
526	3300035171	Ga0373946_0328505	Ga0373946_0328505_19_624	193
527	3300035398	Ga0316574_0000379	Ga0316574_0000379_11216_11824	193
528	3300035398	Ga0316574_0009987	Ga0316574_0009987_3446_4075	193
529	3300035398	Ga0316574_0068113	Ga0316574_0068113_1076_1687	193
530	3300035398	Ga0316574_0132289	Ga0316574_0132289_140_751	193
531	3300035398	Ga0316574_0216853	Ga0316574_0216853_294_902	193
532	3300035398	Ga0316574_0304901	Ga0316574_0304901_201_809	193
533	3300036647	Ga0316582_0002686	Ga0316582_0002686_4776_5405	193
534	3300036647	Ga0316582_0013612	Ga0316582_0013612_2514_3122	193
535	3300036647	Ga0316582_0014349	Ga0316582_0014349_3770_4399	193
536	3300036647	Ga0316582_0084297	Ga0316582_0084297_1175_1783	193
537	3300036647	Ga0316582_0236202	Ga0316582_0236202_633_1241	193
538	3300036647	Ga0316582_0272828	Ga0316582_0272828_54_683	193
539	3300036712	Ga0316584_0002755	Ga0316584_0002755_6465_7073	193
540	3300036712	Ga0316584_0003985	Ga0316584_0003985_1356_1964	193
541	3300036712	Ga0316584_0025283	Ga0316584_0025283_2231_2839	193
542	3300036712	Ga0316584_0027404	Ga0316584_0027404_572_1180	193
543	3300036712	Ga0316584_0044544	Ga0316584_0044544_1076_1684	193
544	3300036712	Ga0316584_0103651	Ga0316584_0103651_173_802	193
545	3300036712	Ga0316584_0134518	Ga0316584_0134518_692_1300	193
546	3300037588	Ga0316581_0000220	Ga0316581_0000220_9093_9701	193
547	3300037588	Ga0316581_0002012	Ga0316581_0002012_2242_2871	193
548	3300037588	Ga0316581_0022587	Ga0316581_0022587_34_642	193
549	3300039110	Ga0400487_11716	Ga0400487_11716_39_644	193
550	3300041404	Ga0439436_0039090	Ga0439436_0039090_318_962	193
551	3300041407	Ga0439447_034107	Ga0439447_034107_69_713	193
552	3300042004	Ga0439445_0059349	Ga0439445_0059349_220_864	193
553	3300042006	Ga0439432_022718	Ga0439432_022718_873_1517	193
554	3300042007	Ga0439449_0006498	Ga0439449_0006498_783_1427	193
555	3300042010	Ga0439452_027719	Ga0439452_027719_705_1313	193
556	3300042014	Ga0439457_015810	Ga0439457_015810_228_872	193
557	3300042015	Ga0439462_0007850	Ga0439462_0007850_45_689	193
558	3300042123	Ga0450921_012836	Ga0450921_012836_88_714	193
559	3300042133	Ga0450896_019677	Ga0450896_019677_303_947	193
560	3300042145	Ga0450906_009542	Ga0450906_009542_508_1152	193
561	3300042147	Ga0450910_002001	Ga0450910_002001_490_1134	193
562	3300042435	Ga0439434_0104054	Ga0439434_0104054_112_756	193
563	3300042876	Ga0451577_0034908	Ga0451577_0034908_3459_4073	193
564	3300042876	Ga0451577_0040398	Ga0451577_0040398_795_1430	193
565	3300042876	Ga0451577_0878404	Ga0451577_0878404_162_782	193
566	3300044673	Ga0453683_0226275	Ga0453683_0226275_61_696	193
567	3300044712	Ga0453684_0000917	Ga0453684_0000917_20311_20946	193
568	3300044712	Ga0453684_0008979	Ga0453684_0008979_604_1239	193
569	3300044712	Ga0453684_0180539	Ga0453684_0180539_570_1205	193
570	3300044712	Ga0453684_0185789	Ga0453684_0185789_170_784	193
571	3300044712	Ga0453684_0374914	Ga0453684_0374914_480_1100	193
572	3300044712	Ga0453684_0520701	Ga0453684_0520701_229_864	193
573	3300044712	Ga0453684_0601484	Ga0453684_0601484_423_1043	193
574	3300045051	Ga0451576_0198041	Ga0451576_0198041_694_1323	193
575	3300045051	Ga0451576_0487775	Ga0451576_0487775_193_828	193
576	3300045051	Ga0451576_0680251	Ga0451576_0680251_221_832	193
577	3300045051	Ga0451576_0892704	Ga0451576_0892704_214_828	193
578	3300045051	Ga0451576_1593008	Ga0451576_1593008_25_660	193
579	3300046453	Ga0495627_012156	Ga0495627_012156_1755_2378	193
580	3300046459	Ga0495629_0079155	Ga0495629_0079155_354_968	193
581	3300046515	Ga0495620_0024912	Ga0495620_0024912_1861_2484	193
582	3300046530	Ga0495654_0278220	Ga0495654_0278220_55_669	193
583	3300046537	Ga0495598_0055818	Ga0495598_0055818_201_815	193
584	3300046692	Ga0495671_0027049	Ga0495671_0027049_1805_2428	193
585	3300048927	Ga0496124_0297730	Ga0496124_0297730_181_789	193
586	3300049513	Ga0501290_007925	Ga0501290_007925_579_1217	193
587	3300049571	Ga0501034_0135961	Ga0501034_0135961_17_625	193
588	3300049575	Ga0501039_0761340	Ga0501039_0761340_22_654	193
589	3300050496	nmdc:mga07m45_241411_c1	nmdc:mga07m45_241411_c1_388_1020	193
590	3300050496	nmdc:mga07m45_7745_c1	nmdc:mga07m45_7745_c1_1337_1963	193
591	3300050511	nmdc:mga08y16_720960_c1	nmdc:mga08y16_720960_c1_168_782	193
592	3300053088	Ga0500644_0003670	Ga0500644_0003670_600_1229	193
593	3300053117	Ga0500593_000535	Ga0500593_000535_13881_14504	193
594	3300053117	Ga0500593_028848	Ga0500593_028848_506_1135	193
595	3300053161	Ga0500634_0002332	Ga0500634_0002332_7217_7840	193
596	3300053177	Ga0500636_0004688	Ga0500636_0004688_1290_1904	193
597	3300053729	Ga0500625_011079	Ga0500625_011079_119_733	193
598	iso_pu_bacteria	2842711865	2842715718	193
599	iso_pu_bacteria	2857558681	2857558878	193
600	3300005471	Ga0070698_100010835	Ga0070698_1000108358	194
601	3300006847	Ga0075431_100003705	Ga0075431_10000370510	194
602	3300006880	Ga0075429_100000326	Ga0075429_10000032621	194
603	3300006948	Ga0099826_10200163	Ga0099826_102001632	194
604	3300009147	Ga0114129_10008954	Ga0114129_100089548	194
605	3300026142	Ga0207698_10038136	Ga0207698_100381363	194
606	3300031665	Ga0316575_10017079	Ga0316575_100170791	194
607	3300031665	Ga0316575_10200858	Ga0316575_102008582	194
608	3300031665	Ga0316575_10218490	Ga0316575_102184901	194
609	3300031691	Ga0316579_10009212	Ga0316579_100092123	194
610	3300031691	Ga0316579_10013259	Ga0316579_100132593	194
611	3300031727	Ga0316576_10079540	Ga0316576_100795402	194
612	3300031727	Ga0316576_10093050	Ga0316576_100930502	194
613	3300031728	Ga0316578_10002664	Ga0316578_100026643	194
614	3300031728	Ga0316578_10019723	Ga0316578_100197233	194
615	3300031728	Ga0316578_10147100	Ga0316578_101471003	194
616	3300032133	Ga0316583_10003305	Ga0316583_100033053	194
617	3300032133	Ga0316583_10011204	Ga0316583_100112041	194
618	3300032137	Ga0316585_10003108	Ga0316585_100031085	194
619	3300032139	Ga0316580_10007449	Ga0316580_100074495	194
620	3300033527	Ga0316586_1045938	Ga0316586_10459381	194
621	3300033529	Ga0316587_1002676	Ga0316587_10026761	194
622	3300033529	Ga0316587_1036058	Ga0316587_10360582	194
623	3300033541	Ga0316596_1001228	Ga0316596_10012285	194
624	3300033541	Ga0316596_1016865	Ga0316596_10168653	194
625	3300033541	Ga0316596_1056126	Ga0316596_10561262	194
626	3300035398	Ga0316574_0010363	Ga0316574_0010363_2828_3442	194
627	3300035398	Ga0316574_0021639	Ga0316574_0021639_706_1320	194
628	3300035398	Ga0316574_0053432	Ga0316574_0053432_1065_1679	194
629	3300035398	Ga0316574_0124951	Ga0316574_0124951_218_832	194
630	3300035398	Ga0316574_0203974	Ga0316574_0203974_23_637	194
631	3300036647	Ga0316582_0063430	Ga0316582_0063430_503_1117	194
632	3300036647	Ga0316582_0066713	Ga0316582_0066713_702_1316	194
633	3300036647	Ga0316582_0122270	Ga0316582_0122270_177_794	194
634	3300036647	Ga0316582_0346040	Ga0316582_0346040_157_771	194
635	3300036712	Ga0316584_0013673	Ga0316584_0013673_455_1069	194
636	3300036712	Ga0316584_0025285	Ga0316584_0025285_1003_1617	194
637	3300036712	Ga0316584_0311496	Ga0316584_0311496_103_717	194
638	3300036712	Ga0316584_0322025	Ga0316584_0322025_417_1028	194
639	3300037418	Ga0395900_0114290	Ga0395900_0114290_1290_1904	194
640	3300037588	Ga0316581_0035500	Ga0316581_0035500_200_814	194
641	3300037588	Ga0316581_0044468	Ga0316581_0044468_37_654	194
642	3300038725	Ga0400484_04693	Ga0400484_04693_1820_2437	194
643	3300039110	Ga0400487_53586	Ga0400487_53586_2190_2807	194
644	3300042156	Ga0439446_0079219	Ga0439446_0079219_156_767	194
645	3300042185	Ga0450909_017014	Ga0450909_017014_75_701	194
646	3300042435	Ga0439434_0045839	Ga0439434_0045839_209_841	194
647	3300046539	Ga0495621_0002177	Ga0495621_0002177_4217_4861	194
648	3300049523	Ga0501300_007592	Ga0501300_007592_217_831	194
649	3300049776	Ga0501280_000095	Ga0501280_000095_4768_5382	194
650	3300050507	nmdc:mga05p37_1073_c1	nmdc:mga05p37_1073_c1_84_695	194
651	3300050508	nmdc:mga09592_2292_c1	nmdc:mga09592_2292_c1_4172_4783	194
652	3300050510	nmdc:mga06r32_3362_c1	nmdc:mga06r32_3362_c1_11366_11977	194
653	3300002704	JGI25155J39150_1000045	JGI25155J39150_100004549	195
654	3300002705	JGI25156J39149_1000054	JGI25156J39149_100005433	195
655	3300002737	JGI25162J39368_1003970	JGI25162J39368_10039704	195
656	3300002738	JGI25154J39366_1000083	JGI25154J39366_100008333	195
657	3300002738	JGI25154J39366_1001206	JGI25154J39366_10012064	195
658	3300002741	JGI25157J39369_1000208	JGI25157J39369_100020818	195
659	3300002773	JGI25152J39213_1002579	JGI25152J39213_10025795	195
660	3300002774	JGI25150J39212_1002242	JGI25150J39212_10022424	195
661	3300002987	JGI25159J45721_1001029	JGI25159J45721_100102913	195
662	3300003215	JGI25153J46596_10012384	JGI25153J46596_100123844	195
663	3300003354	JGI25160J50197_1003875	JGI25160J50197_10038752	195
664	3300003374	JGI25161J50226_1000734	JGI25161J50226_10007342	195
665	3300003374	JGI25161J50226_1002857	JGI25161J50226_10028572	195
666	3300003758	Ga0055532_1000099	Ga0055532_100009940	195
667	3300003759	Ga0055525_1000001	Ga0055525_1000001667	195
668	3300003763	Ga0055529_1000015	Ga0055529_1000015185	195
669	3300003771	Ga0055526_1000007	Ga0055526_1000007220	195
670	3300003771	Ga0055526_1000054	Ga0055526_100005467	195
671	3300003771	Ga0055526_1000885	Ga0055526_100088521	195
672	3300003771	Ga0055526_1003390	Ga0055526_10033902	195
673	3300003771	Ga0055526_1011491	Ga0055526_10114912	195
674	3300003771	Ga0055526_1020119	Ga0055526_10201192	195
675	3300003773	Ga0055537_1000005	Ga0055537_100000578	195
676	3300003773	Ga0055537_1000043	Ga0055537_100004374	195
677	3300003773	Ga0055537_1000046	Ga0055537_100004636	195
678	3300003773	Ga0055537_1003477	Ga0055537_10034774	195
679	3300003773	Ga0055537_1007444	Ga0055537_10074444	195
680	3300003775	Ga0055524_1000012	Ga0055524_1000012187	195
681	3300003775	Ga0055524_1000038	Ga0055524_100003886	195
682	3300003775	Ga0055524_1006360	Ga0055524_10063602	195
683	3300003775	Ga0055524_1012222	Ga0055524_10122224	195
684	3300003775	Ga0055524_1013944	Ga0055524_10139442	195
685	3300003775	Ga0055524_1022864	Ga0055524_10228642	195
686	3300003784	Ga0055534_1000127	Ga0055534_10001274	195
687	3300003784	Ga0055534_1001049	Ga0055534_100104913	195
688	3300003784	Ga0055534_1007706	Ga0055534_10077063	195
689	3300003790	Ga0055528_1000063	Ga0055528_100006378	195
690	3300003790	Ga0055528_1002287	Ga0055528_100228712	195
691	3300003791	Ga0055530_10023367	Ga0055530_100233672	195
692	3300003794	Ga0055531_10049383	Ga0055531_100493832	195
693	3300003794	Ga0055531_10049412	Ga0055531_100494122	195
694	3300004625	Ga0055543_1001698	Ga0055543_10016988	195
695	3300004625	Ga0055543_1032914	Ga0055543_10329142	195
696	3300004625	Ga0055543_1032919	Ga0055543_10329191	195
697	3300005262	Ga0065165_1000034	Ga0065165_1000034133	195
698	3300005262	Ga0065165_1003016	Ga0065165_10030162	195
699	3300005262	Ga0065165_1018435	Ga0065165_10184354	195
700	3300005262	Ga0065165_1021614	Ga0065165_10216142	195
701	3300005262	Ga0065165_1074008	Ga0065165_10740082	195
702	3300005262	Ga0065165_1074022	Ga0065165_10740221	195
703	3300005288	Ga0065714_10008082	Ga0065714_100080822	195
704	3300005293	Ga0065715_10120870	Ga0065715_101208702	195
705	3300005327	Ga0070658_10066568	Ga0070658_100665682	195
706	3300005331	Ga0070670_100002673	Ga0070670_10000267312	195
707	3300005331	Ga0070670_100028403	Ga0070670_1000284034	195
708	3300005331	Ga0070670_100064997	Ga0070670_1000649974	195
709	3300005331	Ga0070670_100530685	Ga0070670_1005306852	195
710	3300005334	Ga0068869_100000492	Ga0068869_10000049214	195
711	3300005334	Ga0068869_100108707	Ga0068869_1001087074	195
712	3300005336	Ga0070680_100313678	Ga0070680_1003136781	195
713	3300005338	Ga0068868_100720317	Ga0068868_1007203172	195
714	3300005339	Ga0070660_100008707	Ga0070660_1000087076	195
715	3300005344	Ga0070661_100017505	Ga0070661_1000175053	195
716	3300005344	Ga0070661_100140107	Ga0070661_1001401071	195
717	3300005344	Ga0070661_100848188	Ga0070661_1008481881	195
718	3300005345	Ga0070692_10071435	Ga0070692_100714352	195
719	3300005347	Ga0070668_100005466	Ga0070668_1000054662	195
720	3300005353	Ga0070669_100042568	Ga0070669_1000425682	195
721	3300005354	Ga0070675_100003762	Ga0070675_10000376212	195
722	3300005354	Ga0070675_100039354	Ga0070675_1000393542	195
723	3300005354	Ga0070675_100514219	Ga0070675_1005142191	195
724	3300005356	Ga0070674_100923377	Ga0070674_1009233771	195
725	3300005364	Ga0070673_100052053	Ga0070673_1000520532	195
726	3300005365	Ga0070688_100318070	Ga0070688_1003180702	195
727	3300005365	Ga0070688_100403010	Ga0070688_1004030103	195
728	3300005366	Ga0070659_100000456	Ga0070659_10000045620	195
729	3300005366	Ga0070659_100098672	Ga0070659_1000986722	195
730	3300005367	Ga0070667_100219334	Ga0070667_1002193342	195
731	3300005367	Ga0070667_100721477	Ga0070667_1007214772	195
732	3300005438	Ga0070701_10040180	Ga0070701_100401803	195
733	3300005441	Ga0070700_100145693	Ga0070700_1001456931	195
734	3300005444	Ga0070694_100708484	Ga0070694_1007084841	195
735	3300005456	Ga0070678_100028455	Ga0070678_1000284551	195
736	3300005457	Ga0070662_100134737	Ga0070662_1001347372	195
737	3300005457	Ga0070662_100381310	Ga0070662_1003813102	195
738	3300005459	Ga0068867_100015366	Ga0068867_1000153666	195
739	3300005459	Ga0068867_100227633	Ga0068867_1002276332	195
740	3300005459	Ga0068867_100264712	Ga0068867_1002647122	195
741	3300005459	Ga0068867_100515921	Ga0068867_1005159211	195
742	3300005459	Ga0068867_100615376	Ga0068867_1006153761	195
743	3300005543	Ga0070672_100067616	Ga0070672_1000676163	195
744	3300005543	Ga0070672_100102877	Ga0070672_1001028773	195
745	3300005548	Ga0070665_100028940	Ga0070665_1000289404	195
746	3300005563	Ga0068855_100059076	Ga0068855_1000590764	195
747	3300005563	Ga0068855_100161127	Ga0068855_1001611273	195
748	3300005563	Ga0068855_100308135	Ga0068855_1003081352	195
749	3300005564	Ga0070664_100049799	Ga0070664_1000497994	195
750	3300005564	Ga0070664_100088236	Ga0070664_1000882363	195
751	3300005564	Ga0070664_100091541	Ga0070664_1000915413	195
752	3300005564	Ga0070664_100185331	Ga0070664_1001853313	195
753	3300005564	Ga0070664_100384500	Ga0070664_1003845003	195
754	3300005616	Ga0068852_100438792	Ga0068852_1004387922	195
755	3300005617	Ga0068859_100043409	Ga0068859_1000434095	195
756	3300005617	Ga0068859_100376173	Ga0068859_1003761732	195
757	3300005617	Ga0068859_100708574	Ga0068859_1007085741	195
758	3300005617	Ga0068859_100730213	Ga0068859_1007302132	195
759	3300005618	Ga0068864_100001909	Ga0068864_10000190915	195
760	3300005618	Ga0068864_100110129	Ga0068864_1001101294	195
761	3300005841	Ga0068863_100003624	Ga0068863_1000036248	195
762	3300005841	Ga0068863_100319274	Ga0068863_1003192742	195
763	3300005842	Ga0068858_100019496	Ga0068858_1000194964	195
764	3300005842	Ga0068858_100022639	Ga0068858_1000226394	195
765	3300005843	Ga0068860_100260942	Ga0068860_1002609422	195
766	3300005844	Ga0068862_100429806	Ga0068862_1004298063	195
767	3300006038	Ga0075365_10021862	Ga0075365_100218621	195
768	3300006038	Ga0075365_10071626	Ga0075365_100716262	195
769	3300006042	Ga0075368_10009041	Ga0075368_100090414	195
770	3300006048	Ga0075363_100007021	Ga0075363_1000070212	195
771	3300006051	Ga0075364_10199447	Ga0075364_101994472	195
772	3300006058	Ga0075432_10000955	Ga0075432_100009554	195
773	3300006177	Ga0075362_10010930	Ga0075362_100109302	195
774	3300006178	Ga0075367_10065153	Ga0075367_100651532	195
775	3300006178	Ga0075367_10226823	Ga0075367_102268232	195
776	3300006186	Ga0075369_10003025	Ga0075369_100030257	195
777	3300006186	Ga0075369_10005152	Ga0075369_100051524	195
778	3300006186	Ga0075369_10032712	Ga0075369_100327123	195
779	3300006195	Ga0075366_10003336	Ga0075366_100033368	195
780	3300006195	Ga0075366_10011755	Ga0075366_100117552	195
781	3300006195	Ga0075366_10026452	Ga0075366_100264523	195
782	3300006195	Ga0075366_10106714	Ga0075366_101067143	195
783	3300006237	Ga0097621_100003378	Ga0097621_1000033787	195
784	3300006237	Ga0097621_100527097	Ga0097621_1005270973	195
785	3300006237	Ga0097621_100670109	Ga0097621_1006701092	195
786	3300006353	Ga0075370_10296164	Ga0075370_102961641	195
787	3300006847	Ga0075431_100697715	Ga0075431_1006977152	195
788	3300006871	Ga0075434_100237856	Ga0075434_1002378562	195
789	3300006881	Ga0068865_100187172	Ga0068865_1001871722	195
790	3300006881	Ga0068865_100687832	Ga0068865_1006878322	195
791	3300006931	Ga0097620_100043409	Ga0097620_1000434092	195
792	3300006931	Ga0097620_100376142	Ga0097620_1003761422	195
793	3300006931	Ga0097620_100708606	Ga0097620_1007086062	195
794	3300006931	Ga0097620_100730261	Ga0097620_1007302612	195
795	3300006946	Ga0079104_1045583	Ga0079104_10455832	195
796	3300006948	Ga0099826_10000008	Ga0099826_10000008155	195
797	3300009011	Ga0105251_10057022	Ga0105251_100570223	195
798	3300009036	Ga0105244_10001568	Ga0105244_100015685	195
799	3300009036	Ga0105244_10030858	Ga0105244_100308584	195
800	3300009036	Ga0105244_10054716	Ga0105244_100547163	195
801	3300009036	Ga0105244_10065396	Ga0105244_100653963	195
802	3300009093	Ga0105240_10002667	Ga0105240_1000266711	195
803	3300009093	Ga0105240_10038896	Ga0105240_1003889610	195
804	3300009093	Ga0105240_11025539	Ga0105240_110255391	195
805	3300009098	Ga0105245_10040363	Ga0105245_100403633	195
806	3300009098	Ga0105245_10184861	Ga0105245_101848612	195
807	3300009098	Ga0105245_10392655	Ga0105245_103926552	195
808	3300009174	Ga0105241_10042024	Ga0105241_100420243	195
809	3300009177	Ga0105248_10005948	Ga0105248_100059489	195
810	3300009551	Ga0105238_10061265	Ga0105238_100612654	195
811	3300009551	Ga0105238_10576346	Ga0105238_105763462	195
812	3300011119	Ga0105246_10040239	Ga0105246_100402394	195
813	3300013104	Ga0157370_10053116	Ga0157370_100531163	195
814	3300013105	Ga0157369_10298042	Ga0157369_102980423	195
815	3300013296	Ga0157374_10397803	Ga0157374_103978032	195
816	3300013297	Ga0157378_10227091	Ga0157378_102270912	195
817	3300013297	Ga0157378_10346050	Ga0157378_103460502	195
818	3300013297	Ga0157378_10533894	Ga0157378_105338943	195
819	3300013307	Ga0157372_11082902	Ga0157372_110829021	195
820	3300013308	Ga0157375_10005919	Ga0157375_100059199	195
821	3300013308	Ga0157375_10175494	Ga0157375_101754943	195
822	3300013308	Ga0157375_10178704	Ga0157375_101787043	195
823	3300013308	Ga0157375_10244621	Ga0157375_102446213	195
824	3300013308	Ga0157375_10723555	Ga0157375_107235552	195
825	3300014325	Ga0163163_10005831	Ga0163163_100058312	195
826	3300014325	Ga0163163_10417956	Ga0163163_104179562	195
827	3300014326	Ga0157380_10326419	Ga0157380_103264193	195
828	3300014326	Ga0157380_11165381	Ga0157380_111653811	195
829	3300014497	Ga0182008_10016915	Ga0182008_100169154	195
830	3300014497	Ga0182008_10121291	Ga0182008_101212911	195
831	3300014969	Ga0157376_10003300	Ga0157376_100033008	195
832	3300014969	Ga0157376_10363339	Ga0157376_103633393	195
833	3300015261	Ga0182006_1000007	Ga0182006_1000007370	195
834	3300015261	Ga0182006_1000023	Ga0182006_1000023181	195
835	3300015261	Ga0182006_1069705	Ga0182006_10697052	195
836	3300015262	Ga0182007_10000022	Ga0182007_10000022116	195
837	3300015265	Ga0182005_1000006	Ga0182005_1000006139	195
838	3300015265	Ga0182005_1000010	Ga0182005_1000010347	195
839	3300015683	Ga0183362_10001	Ga0183362_100011040	195
840	3300017792	Ga0163161_10095045	Ga0163161_100950452	195
841	3300021361	Ga0213872_10000087	Ga0213872_1000008734	195
842	3300021361	Ga0213872_10000157	Ga0213872_1000015739	195
843	3300021361	Ga0213872_10000703	Ga0213872_1000070323	195
844	3300021361	Ga0213872_10129573	Ga0213872_101295732	195
845	3300025206	Ga0209435_100034	Ga0209435_100034107	195
846	3300025208	Ga0209436_100040	Ga0209436_10004075	195
847	3300025208	Ga0209436_104332	Ga0209436_1043322	195
848	3300025229	Ga0209147_100004	Ga0209147_100004148	195
849	3300025230	Ga0209563_100007	Ga0209563_100007432	195
850	3300025233	Ga0209437_100072	Ga0209437_100072200	195
851	3300025233	Ga0209437_101483	Ga0209437_1014834	195
852	3300025245	Ga0207425_1000009	Ga0207425_1000009186	195
853	3300025245	Ga0207425_1000036	Ga0207425_1000036149	195
854	3300025245	Ga0207425_1001550	Ga0207425_100155010	195
855	3300025245	Ga0207425_1028724	Ga0207425_10287242	195
856	3300025246	Ga0209646_1000042	Ga0209646_1000042278	195
857	3300025246	Ga0209646_1000118	Ga0209646_1000118107	195
858	3300025250	Ga0209026_1000106	Ga0209026_1000106107	195
859	3300025253	Ga0209677_103806	Ga0209677_1038063	195
860	3300025256	Ga0209759_1000190	Ga0209759_100019034	195
861	3300025258	Ga0209129_1000051	Ga0209129_1000051109	195
862	3300025258	Ga0209129_1012173	Ga0209129_10121733	195
863	3300025258	Ga0209129_1019010	Ga0209129_10190102	195
864	3300025263	Ga0209565_1000004	Ga0209565_1000004448	195
865	3300025263	Ga0209565_1000074	Ga0209565_100007477	195
866	3300025263	Ga0209565_1000662	Ga0209565_100066221	195
867	3300025263	Ga0209565_1001767	Ga0209565_10017678	195
868	3300025272	Ga0209455_1000031	Ga0209455_1000031186	195
869	3300025273	Ga0209673_1000129	Ga0209673_100012984	195
870	3300025273	Ga0209673_1000221	Ga0209673_100022179	195
871	3300025284	Ga0209130_1000016	Ga0209130_100001675	195
872	3300025284	Ga0209130_1000217	Ga0209130_10002172	195
873	3300025284	Ga0209130_1000827	Ga0209130_100082731	195
874	3300025284	Ga0209130_1039874	Ga0209130_10398742	195
875	3300025291	Ga0209675_1000061	Ga0209675_100006148	195
876	3300025291	Ga0209675_1000072	Ga0209675_100007284	195
877	3300025291	Ga0209675_1000839	Ga0209675_100083921	195
878	3300025291	Ga0209675_1001859	Ga0209675_10018592	195
879	3300025294	Ga0209025_1004319	Ga0209025_10043192	195
880	3300025294	Ga0209025_1006691	Ga0209025_10066919	195
881	3300025294	Ga0209025_1007278	Ga0209025_10072782	195
882	3300025295	Ga0209564_1000010	Ga0209564_1000010455	195
883	3300025295	Ga0209564_1000042	Ga0209564_100004262	195
884	3300025295	Ga0209564_1000160	Ga0209564_100016083	195
885	3300025295	Ga0209564_1000172	Ga0209564_100017284	195
886	3300025295	Ga0209564_1000681	Ga0209564_100068113	195
887	3300025295	Ga0209564_1009057	Ga0209564_10090574	195
888	3300025297	Ga0209758_1000054	Ga0209758_1000054186	195
889	3300025297	Ga0209758_1000379	Ga0209758_100037961	195
890	3300025297	Ga0209758_1027259	Ga0209758_10272592	195
891	3300025298	Ga0209050_1000040	Ga0209050_100004014	195
892	3300025298	Ga0209050_1000309	Ga0209050_100030917	195
893	3300025299	Ga0209256_1000001	Ga0209256_1000001519	195
894	3300025299	Ga0209256_1000018	Ga0209256_1000018160	195
895	3300025299	Ga0209256_1000125	Ga0209256_100012584	195
896	3300025299	Ga0209256_1000307	Ga0209256_100030721	195
897	3300025299	Ga0209256_1000553	Ga0209256_100055322	195
898	3300025299	Ga0209256_1001812	Ga0209256_10018124	195
899	3300025302	Ga0207426_1001267	Ga0207426_100126724	195
900	3300025302	Ga0207426_1087482	Ga0207426_10874822	195
901	3300025303	Ga0209051_1009224	Ga0209051_10092242	195
902	3300025304	Ga0209257_1000054	Ga0209257_1000054384	195
903	3300025304	Ga0209257_1079162	Ga0209257_10791622	195
904	3300025728	Ga0207655_1002256	Ga0207655_100225611	195
905	3300025728	Ga0207655_1002948	Ga0207655_100294810	195
906	3300025728	Ga0207655_1042961	Ga0207655_10429613	195
907	3300025728	Ga0207655_1081238	Ga0207655_10812383	195
908	3300025900	Ga0207710_10121369	Ga0207710_101213692	195
909	3300025901	Ga0207688_10073008	Ga0207688_100730082	195
910	3300025901	Ga0207688_10125964	Ga0207688_101259642	195
911	3300025907	Ga0207645_10327401	Ga0207645_103274012	195
912	3300025909	Ga0207705_10077856	Ga0207705_100778563	195
913	3300025911	Ga0207654_10049560	Ga0207654_100495602	195
914	3300025911	Ga0207654_10524333	Ga0207654_105243332	195
915	3300025913	Ga0207695_10005170	Ga0207695_1000517011	195
916	3300025913	Ga0207695_10019098	Ga0207695_1001909810	195
917	3300025913	Ga0207695_10412653	Ga0207695_104126531	195
918	3300025918	Ga0207662_10085775	Ga0207662_100857753	195
919	3300025919	Ga0207657_10001579	Ga0207657_100015799	195
920	3300025919	Ga0207657_10018104	Ga0207657_100181048	195
921	3300025919	Ga0207657_10214428	Ga0207657_102144282	195
922	3300025920	Ga0207649_10015582	Ga0207649_100155824	195
923	3300025920	Ga0207649_10209244	Ga0207649_102092441	195
924	3300025920	Ga0207649_10354759	Ga0207649_103547592	195
925	3300025920	Ga0207649_10992981	Ga0207649_109929811	195
926	3300025923	Ga0207681_10066241	Ga0207681_100662412	195
927	3300025923	Ga0207681_10181944	Ga0207681_101819442	195
928	3300025924	Ga0207694_10194304	Ga0207694_101943042	195
929	3300025924	Ga0207694_10247970	Ga0207694_102479703	195
930	3300025925	Ga0207650_10007503	Ga0207650_100075032	195
931	3300025925	Ga0207650_10062409	Ga0207650_100624094	195
932	3300025925	Ga0207650_10188295	Ga0207650_101882953	195
933	3300025925	Ga0207650_10346520	Ga0207650_103465202	195
934	3300025925	Ga0207650_10399384	Ga0207650_103993842	195
935	3300025925	Ga0207650_10709438	Ga0207650_107094381	195
936	3300025926	Ga0207659_10022051	Ga0207659_100220515	195
937	3300025926	Ga0207659_10088804	Ga0207659_100888043	195
938	3300025927	Ga0207687_10275078	Ga0207687_102750783	195
939	3300025927	Ga0207687_10346692	Ga0207687_103466921	195
940	3300025927	Ga0207687_10390513	Ga0207687_103905132	195
941	3300025931	Ga0207644_10396146	Ga0207644_103961461	195
942	3300025932	Ga0207690_10556229	Ga0207690_105562293	195
943	3300025935	Ga0207709_10085497	Ga0207709_100854971	195
944	3300025936	Ga0207670_10946399	Ga0207670_109463991	195
945	3300025938	Ga0207704_10036911	Ga0207704_100369113	195
946	3300025940	Ga0207691_10008219	Ga0207691_100082196	195
947	3300025940	Ga0207691_10078797	Ga0207691_100787972	195
948	3300025941	Ga0207711_10024546	Ga0207711_100245464	195
949	3300025942	Ga0207689_10000320	Ga0207689_1000032023	195
950	3300025942	Ga0207689_10135955	Ga0207689_101359551	195
951	3300025945	Ga0207679_10028672	Ga0207679_100286724	195
952	3300025945	Ga0207679_10103535	Ga0207679_101035352	195
953	3300025945	Ga0207679_10377782	Ga0207679_103777823	195
954	3300025945	Ga0207679_10678106	Ga0207679_106781061	195
955	3300025945	Ga0207679_11193944	Ga0207679_111939441	195
956	3300025949	Ga0207667_10086607	Ga0207667_100866072	195
957	3300025949	Ga0207667_10136832	Ga0207667_101368324	195
958	3300025949	Ga0207667_10377163	Ga0207667_103771632	195
959	3300025960	Ga0207651_10141409	Ga0207651_101414093	195
960	3300025960	Ga0207651_10484296	Ga0207651_104842961	195
961	3300025981	Ga0207640_10124724	Ga0207640_101247242	195
962	3300025986	Ga0207658_10074170	Ga0207658_100741703	195
963	3300026023	Ga0207677_10789276	Ga0207677_107892762	195
964	3300026035	Ga0207703_10013024	Ga0207703_100130244	195
965	3300026035	Ga0207703_10545139	Ga0207703_105451393	195
966	3300026075	Ga0207708_10020274	Ga0207708_100202741	195
967	3300026088	Ga0207641_10003573	Ga0207641_1000357312	195
968	3300026088	Ga0207641_10615054	Ga0207641_106150541	195
969	3300026089	Ga0207648_10017375	Ga0207648_100173757	195
970	3300026089	Ga0207648_10103315	Ga0207648_101033152	195
971	3300026089	Ga0207648_10238188	Ga0207648_102381882	195
972	3300026095	Ga0207676_10001593	Ga0207676_100015938	195
973	3300026095	Ga0207676_10352709	Ga0207676_103527091	195
974	3300026116	Ga0207674_10232511	Ga0207674_102325113	195
975	3300026116	Ga0207674_10502463	Ga0207674_105024632	195
976	3300026118	Ga0207675_100179541	Ga0207675_1001795414	195
977	3300026118	Ga0207675_101081662	Ga0207675_1010816621	195
978	3300026121	Ga0207683_10232372	Ga0207683_102323722	195
979	3300026121	Ga0207683_10934425	Ga0207683_109344252	195
980	3300027111	Ga0209281_1004072	Ga0209281_10040725	195
981	3300027360	Ga0209969_1000506	Ga0209969_10005065	195
982	3300027665	Ga0209983_1001965	Ga0209983_10019654	195
983	3300027666	Ga0209282_1000005	Ga0209282_1000005155	195
984	3300027876	Ga0209974_10041269	Ga0209974_100412692	195
985	3300027876	Ga0209974_10046050	Ga0209974_100460502	195
986	3300028379	Ga0268266_10028107	Ga0268266_100281073	195
987	3300028379	Ga0268266_10587182	Ga0268266_105871821	195
988	3300028380	Ga0268265_10371316	Ga0268265_103713161	195
989	3300028381	Ga0268264_10236964	Ga0268264_102369643	195
990	3300031251	Ga0265327_10059269	Ga0265327_100592692	195
991	3300031507	Ga0307509_10001394	Ga0307509_1000139436	195
992	3300031548	Ga0307408_100000144	Ga0307408_10000014470	195
993	3300031548	Ga0307408_100002435	Ga0307408_1000024352	195
994	3300031548	Ga0307408_100002837	Ga0307408_10000283714	195
995	3300031548	Ga0307408_100131286	Ga0307408_1001312863	195
996	3300031548	Ga0307408_100410259	Ga0307408_1004102593	195
997	3300031548	Ga0307408_100441259	Ga0307408_1004412591	195
998	3300031711	Ga0265314_10016398	Ga0265314_100163986	195
999	3300031838	Ga0307518_10058054	Ga0307518_100580542	195
1000	3300032002	Ga0307416_100013859	Ga0307416_1000138594	195
1001	3300032004	Ga0307414_10343547	Ga0307414_103435472	195
1002	3300032005	Ga0307411_10321759	Ga0307411_103217591	195
1003	3300032168	Ga0316593_10007166	Ga0316593_100071662	195
1004	3300033179	Ga0307507_10061183	Ga0307507_100611833	195
1005	3300033528	Ga0316588_1014449	Ga0316588_10144492	195
1006	3300035086	Ga0373934_0198873	Ga0373934_0198873_119_733	195
1007	3300035114	Ga0373939_0259229	Ga0373939_0259229_28_642	195
1008	3300035119	Ga0373956_0187864	Ga0373956_0187864_85_711	195
1009	3300035695	Ga0373927_0117145	Ga0373927_0117145_827_1441	195
1010	3300036401	Ga0373937_0025419	Ga0373937_0025419_3721_4335	195
1011	3300036401	Ga0373937_1038512	Ga0373937_1038512_59_685	195
1012	3300037068	Ga0373925_0179901	Ga0373925_0179901_855_1469	195
1013	3300037068	Ga0373925_0695365	Ga0373925_0695365_142_756	195
1014	3300037312	Ga0395899_0004277	Ga0395899_0004277_9026_9640	195
1015	3300037312	Ga0395899_0009167	Ga0395899_0009167_4455_5069	195
1016	3300037312	Ga0395899_0017209	Ga0395899_0017209_4296_4910	195
1017	3300037312	Ga0395899_0019216	Ga0395899_0019216_1467_2081	195
1018	3300037312	Ga0395899_0064772	Ga0395899_0064772_1335_1949	195
1019	3300037418	Ga0395900_0000826	Ga0395900_0000826_13521_14156	195
1020	3300037418	Ga0395900_0017822	Ga0395900_0017822_5419_6033	195
1021	3300037418	Ga0395900_0019747	Ga0395900_0019747_738_1352	195
1022	3300037418	Ga0395900_0074854	Ga0395900_0074854_1378_1992	195
1023	3300037418	Ga0395900_0131159	Ga0395900_0131159_1547_2161	195
1024	3300037418	Ga0395900_0196452	Ga0395900_0196452_103_717	195
1025	3300037418	Ga0395900_0358538	Ga0395900_0358538_28_642	195
1026	3300037418	Ga0395900_0446356	Ga0395900_0446356_439_1053	195
1027	3300037418	Ga0395900_0674214	Ga0395900_0674214_315_929	195
1028	3300037466	Ga0395898_0082471	Ga0395898_0082471_1772_2386	195
1029	3300037466	Ga0395898_0150607	Ga0395898_0150607_149_763	195
1030	3300037466	Ga0395898_0160588	Ga0395898_0160588_460_1074	195
1031	3300037466	Ga0395898_0402810	Ga0395898_0402810_365_979	195
1032	3300037471	Ga0395905_0000132	Ga0395905_0000132_12934_13560	195
1033	3300037471	Ga0395905_0041777	Ga0395905_0041777_2677_3294	195
1034	3300037471	Ga0395905_0047814	Ga0395905_0047814_2721_3350	195
1035	3300037471	Ga0395905_0123194	Ga0395905_0123194_211_825	195
1036	3300037471	Ga0395905_0140214	Ga0395905_0140214_202_816	195
1037	3300037471	Ga0395905_0322128	Ga0395905_0322128_659_1273	195
1038	3300037471	Ga0395905_0416377	Ga0395905_0416377_442_1056	195
1039	3300037471	Ga0395905_0468459	Ga0395905_0468459_282_896	195
1040	3300038443	Ga0395901_0000033	Ga0395901_0000033_157141_157755	195
1041	3300038443	Ga0395901_0001938	Ga0395901_0001938_6645_7259	195
1042	3300038443	Ga0395901_0010151	Ga0395901_0010151_866_1477	195
1043	3300038443	Ga0395901_0022786	Ga0395901_0022786_2295_2909	195
1044	3300038443	Ga0395901_0029144	Ga0395901_0029144_1020_1634	195
1045	3300038443	Ga0395901_0031647	Ga0395901_0031647_2200_2814	195
1046	3300038443	Ga0395901_0332105	Ga0395901_0332105_222_884	195
1047	3300038443	Ga0395901_0420113	Ga0395901_0420113_400_1014	195
1048	3300039447	Ga0436361_0492958	Ga0436361_0492958_20915_21529	195
1049	3300039447	Ga0436361_0595316	Ga0436361_0595316_40527_41141	195
1050	3300039447	Ga0436361_0998063	Ga0436361_0998063_4221_4835	195
1051	3300039447	Ga0436361_1110972	Ga0436361_1110972_188_802	195
1052	3300041498	Ga0451841_0545369	Ga0451841_0545369_360_989	195
1053	3300042005	Ga0439448_0006050	Ga0439448_0006050_868_1482	195
1054	3300042005	Ga0439448_0041102	Ga0439448_0041102_591_1205	195
1055	3300042007	Ga0439449_0139665	Ga0439449_0139665_260_874	195
1056	3300042012	Ga0439455_0011338	Ga0439455_0011338_1020_1634	195
1057	3300042139	Ga0450904_000694	Ga0450904_000694_5285_5902	195
1058	3300042876	Ga0451577_0333054	Ga0451577_0333054_217_852	195
1059	3300042876	Ga0451577_0344880	Ga0451577_0344880_352_987	195
1060	3300044656	Ga0466969_0053625	Ga0466969_0053625_819_1433	195
1061	3300044673	Ga0453683_0495164	Ga0453683_0495164_55_669	195
1062	3300044683	Ga0466965_0116363	Ga0466965_0116363_474_1088	195
1063	3300044684	Ga0466966_0039284	Ga0466966_0039284_643_1257	195
1064	3300044684	Ga0466966_0088722	Ga0466966_0088722_324_938	195
1065	3300044706	Ga0466964_0000038	Ga0466964_0000038_25595_26209	195
1066	3300044712	Ga0453684_0001204	Ga0453684_0001204_37089_37712	195
1067	3300044719	Ga0466971_0051483	Ga0466971_0051483_947_1561	195
1068	3300045049	Ga0466959_0080831	Ga0466959_0080831_1042_1656	195
1069	3300046452	Ga0495617_000020	Ga0495617_000020_185785_186399	195
1070	3300046452	Ga0495617_000055	Ga0495617_000055_40235_40849	195
1071	3300046452	Ga0495617_000197	Ga0495617_000197_34624_35256	195
1072	3300046452	Ga0495617_000809	Ga0495617_000809_14129_14743	195
1073	3300046452	Ga0495617_008224	Ga0495617_008224_2299_2913	195
1074	3300046453	Ga0495627_000004	Ga0495627_000004_280172_280786	195
1075	3300046453	Ga0495627_000123	Ga0495627_000123_53750_54364	195
1076	3300046453	Ga0495627_008222	Ga0495627_008222_2701_3330	195
1077	3300046453	Ga0495627_099982	Ga0495627_099982_88_702	195
1078	3300046454	Ga0495592_0351504	Ga0495592_0351504_42_656	195
1079	3300046455	Ga0495603_0060162	Ga0495603_0060162_428_1042	195
1080	3300046455	Ga0495603_0088375	Ga0495603_0088375_899_1513	195
1081	3300046457	Ga0495590_0000012	Ga0495590_0000012_167130_167750	195
1082	3300046457	Ga0495590_0002304	Ga0495590_0002304_121_735	195
1083	3300046457	Ga0495590_0015419	Ga0495590_0015419_1434_2066	195
1084	3300046459	Ga0495629_0329418	Ga0495629_0329418_117_731	195
1085	3300046460	Ga0495638_0000047	Ga0495638_0000047_150444_151064	195
1086	3300046460	Ga0495638_0002024	Ga0495638_0002024_531_1145	195
1087	3300046460	Ga0495638_0011357	Ga0495638_0011357_5466_6080	195
1088	3300046460	Ga0495638_0011670	Ga0495638_0011670_4696_5316	195
1089	3300046460	Ga0495638_0063804	Ga0495638_0063804_172_804	195
1090	3300046462	Ga0495651_0541847	Ga0495651_0541847_86_709	195
1091	3300046463	Ga0495653_0000082	Ga0495653_0000082_79134_79748	195
1092	3300046471	Ga0495650_0000226	Ga0495650_0000226_112067_112681	195
1093	3300046471	Ga0495650_0000437	Ga0495650_0000437_38494_39108	195
1094	3300046471	Ga0495650_0000462	Ga0495650_0000462_12923_13537	195
1095	3300046471	Ga0495650_0001511	Ga0495650_0001511_19097_19711	195
1096	3300046471	Ga0495650_0051312	Ga0495650_0051312_726_1346	195
1097	3300046471	Ga0495650_0124254	Ga0495650_0124254_19_648	195
1098	3300046473	Ga0495582_0003405	Ga0495582_0003405_5534_6148	195
1099	3300046473	Ga0495582_0092765	Ga0495582_0092765_575_1189	195
1100	3300046474	Ga0495605_0000035	Ga0495605_0000035_141705_142319	195
1101	3300046474	Ga0495605_0003120	Ga0495605_0003120_312_926	195
1102	3300046474	Ga0495605_0018918	Ga0495605_0018918_2752_3366	195
1103	3300046474	Ga0495605_0029583	Ga0495605_0029583_495_1133	195
1104	3300046474	Ga0495605_0045893	Ga0495605_0045893_753_1367	195
1105	3300046474	Ga0495605_0070446	Ga0495605_0070446_684_1298	195
1106	3300046474	Ga0495605_0075974	Ga0495605_0075974_673_1287	195
1107	3300046475	Ga0495639_0041764	Ga0495639_0041764_628_1248	195
1108	3300046491	Ga0495584_0000006	Ga0495584_0000006_278079_278711	195
1109	3300046491	Ga0495584_0001531	Ga0495584_0001531_11224_11838	195
1110	3300046491	Ga0495584_0002419	Ga0495584_0002419_159_773	195
1111	3300046491	Ga0495584_0002756	Ga0495584_0002756_8500_9132	195
1112	3300046491	Ga0495584_0010792	Ga0495584_0010792_1172_1786	195
1113	3300046491	Ga0495584_0020430	Ga0495584_0020430_230_844	195
1114	3300046491	Ga0495584_0025346	Ga0495584_0025346_931_1566	195
1115	3300046491	Ga0495584_0065643	Ga0495584_0065643_461_1093	195
1116	3300046491	Ga0495584_0201189	Ga0495584_0201189_25_639	195
1117	3300046492	Ga0495585_0000005	Ga0495585_0000005_292823_293455	195
1118	3300046492	Ga0495585_0000049	Ga0495585_0000049_38958_39590	195
1119	3300046492	Ga0495585_0000162	Ga0495585_0000162_501_1133	195
1120	3300046492	Ga0495585_0003133	Ga0495585_0003133_10189_10821	195
1121	3300046492	Ga0495585_0006337	Ga0495585_0006337_370_1005	195
1122	3300046492	Ga0495585_0009264	Ga0495585_0009264_564_1178	195
1123	3300046492	Ga0495585_0016627	Ga0495585_0016627_866_1480	195
1124	3300046492	Ga0495585_0024583	Ga0495585_0024583_683_1297	195
1125	3300046492	Ga0495585_0040572	Ga0495585_0040572_691_1305	195
1126	3300046492	Ga0495585_0051559	Ga0495585_0051559_686_1318	195
1127	3300046492	Ga0495585_0113856	Ga0495585_0113856_615_1247	195
1128	3300046492	Ga0495585_0119866	Ga0495585_0119866_101_733	195
1129	3300046492	Ga0495585_0134916	Ga0495585_0134916_376_990	195
1130	3300046499	Ga0495594_0086059	Ga0495594_0086059_241_855	195
1131	3300046499	Ga0495594_0321508	Ga0495594_0321508_178_792	195
1132	3300046499	Ga0495594_0367811	Ga0495594_0367811_68_682	195
1133	3300046500	Ga0495596_0000013	Ga0495596_0000013_568_1200	195
1134	3300046500	Ga0495596_0000570	Ga0495596_0000570_9839_10453	195
1135	3300046500	Ga0495596_0004436	Ga0495596_0004436_3513_4142	195
1136	3300046500	Ga0495596_0005617	Ga0495596_0005617_4504_5118	195
1137	3300046500	Ga0495596_0007448	Ga0495596_0007448_2501_3145	195
1138	3300046500	Ga0495596_0064713	Ga0495596_0064713_710_1324	195
1139	3300046501	Ga0495607_0000447	Ga0495607_0000447_11912_12532	195
1140	3300046501	Ga0495607_0001792	Ga0495607_0001792_722_1336	195
1141	3300046501	Ga0495607_0002443	Ga0495607_0002443_13847_14482	195
1142	3300046501	Ga0495607_0004972	Ga0495607_0004972_3791_4405	195
1143	3300046501	Ga0495607_0005432	Ga0495607_0005432_7993_8610	195
1144	3300046501	Ga0495607_0007839	Ga0495607_0007839_1809_2423	195
1145	3300046501	Ga0495607_0015793	Ga0495607_0015793_4229_4843	195
1146	3300046501	Ga0495607_0024570	Ga0495607_0024570_282_914	195
1147	3300046501	Ga0495607_0040921	Ga0495607_0040921_477_1115	195
1148	3300046501	Ga0495607_0051010	Ga0495607_0051010_1175_1789	195
1149	3300046501	Ga0495607_0061603	Ga0495607_0061603_656_1270	195
1150	3300046501	Ga0495607_0142334	Ga0495607_0142334_169_783	195
1151	3300046501	Ga0495607_0176672	Ga0495607_0176672_277_891	195
1152	3300046506	Ga0495583_0000008	Ga0495583_0000008_347211_347825	195
1153	3300046506	Ga0495583_0000092	Ga0495583_0000092_62548_63168	195
1154	3300046506	Ga0495583_0000480	Ga0495583_0000480_2308_2922	195
1155	3300046506	Ga0495583_0000596	Ga0495583_0000596_28529_29158	195
1156	3300046506	Ga0495583_0001098	Ga0495583_0001098_27952_28581	195
1157	3300046506	Ga0495583_0001357	Ga0495583_0001357_617_1231	195
1158	3300046506	Ga0495583_0005766	Ga0495583_0005766_6552_7166	195
1159	3300046506	Ga0495583_0016772	Ga0495583_0016772_2938_3552	195
1160	3300046506	Ga0495583_0059940	Ga0495583_0059940_370_1002	195
1161	3300046506	Ga0495583_0081467	Ga0495583_0081467_756_1385	195
1162	3300046506	Ga0495583_0109940	Ga0495583_0109940_235_849	195
1163	3300046507	Ga0495606_0000101	Ga0495606_0000101_60401_61015	195
1164	3300046507	Ga0495606_0000161	Ga0495606_0000161_77600_78214	195
1165	3300046507	Ga0495606_0000409	Ga0495606_0000409_609_1223	195
1166	3300046507	Ga0495606_0000814	Ga0495606_0000814_15699_16319	195
1167	3300046507	Ga0495606_0002636	Ga0495606_0002636_8804_9418	195
1168	3300046507	Ga0495606_0003322	Ga0495606_0003322_611_1240	195
1169	3300046507	Ga0495606_0013156	Ga0495606_0013156_5191_5805	195
1170	3300046507	Ga0495606_0018361	Ga0495606_0018361_4141_4773	195
1171	3300046507	Ga0495606_0025163	Ga0495606_0025163_3333_3947	195
1172	3300046507	Ga0495606_0097832	Ga0495606_0097832_332_946	195
1173	3300046507	Ga0495606_0118968	Ga0495606_0118968_555_1169	195
1174	3300046507	Ga0495606_0136659	Ga0495606_0136659_614_1228	195
1175	3300046512	Ga0495610_0000014	Ga0495610_0000014_70485_71099	195
1176	3300046512	Ga0495610_0002023	Ga0495610_0002023_877_1491	195
1177	3300046512	Ga0495610_0005574	Ga0495610_0005574_5436_6050	195
1178	3300046512	Ga0495610_0009501	Ga0495610_0009501_182_796	195
1179	3300046513	Ga0495616_0000020	Ga0495616_0000020_159319_159933	195
1180	3300046513	Ga0495616_0000125	Ga0495616_0000125_8930_9547	195
1181	3300046513	Ga0495616_0001133	Ga0495616_0001133_416_1030	195
1182	3300046513	Ga0495616_0017458	Ga0495616_0017458_2545_3159	195
1183	3300046513	Ga0495616_0022220	Ga0495616_0022220_347_961	195
1184	3300046513	Ga0495616_0041507	Ga0495616_0041507_1113_1745	195
1185	3300046513	Ga0495616_0042080	Ga0495616_0042080_340_954	195
1186	3300046513	Ga0495616_0148602	Ga0495616_0148602_175_807	195
1187	3300046518	Ga0495631_0000295	Ga0495631_0000295_7739_8353	195
1188	3300046518	Ga0495631_0002141	Ga0495631_0002141_4468_5082	195
1189	3300046518	Ga0495631_0004107	Ga0495631_0004107_6804_7418	195
1190	3300046518	Ga0495631_0006181	Ga0495631_0006181_5013_5627	195
1191	3300046518	Ga0495631_0018425	Ga0495631_0018425_716_1336	195
1192	3300046518	Ga0495631_0028420	Ga0495631_0028420_1304_1936	195
1193	3300046518	Ga0495631_0048553	Ga0495631_0048553_309_923	195
1194	3300046518	Ga0495631_0060839	Ga0495631_0060839_747_1361	195
1195	3300046519	Ga0495632_0000029	Ga0495632_0000029_115353_115982	195
1196	3300046519	Ga0495632_0000093	Ga0495632_0000093_34645_35259	195
1197	3300046519	Ga0495632_0001267	Ga0495632_0001267_20365_20997	195
1198	3300046519	Ga0495632_0005633	Ga0495632_0005633_5162_5776	195
1199	3300046519	Ga0495632_0009088	Ga0495632_0009088_4710_5348	195
1200	3300046520	Ga0495637_0001526	Ga0495637_0001526_12569_13183	195
1201	3300046522	Ga0495643_0000234	Ga0495643_0000234_63227_63841	195
1202	3300046522	Ga0495643_0000388	Ga0495643_0000388_57066_57686	195
1203	3300046522	Ga0495643_0001128	Ga0495643_0001128_1442_2077	195
1204	3300046522	Ga0495643_0003381	Ga0495643_0003381_471_1085	195
1205	3300046522	Ga0495643_0050552	Ga0495643_0050552_1033_1647	195
1206	3300046522	Ga0495643_0075485	Ga0495643_0075485_723_1337	195
1207	3300046522	Ga0495643_0113364	Ga0495643_0113364_175_813	195
1208	3300046522	Ga0495643_0267233	Ga0495643_0267233_128_742	195
1209	3300046523	Ga0495644_0000379	Ga0495644_0000379_6332_6946	195
1210	3300046523	Ga0495644_0009357	Ga0495644_0009357_3105_3719	195
1211	3300046523	Ga0495644_0023838	Ga0495644_0023838_1195_1827	195
1212	3300046523	Ga0495644_0024595	Ga0495644_0024595_62_676	195
1213	3300046523	Ga0495644_0025272	Ga0495644_0025272_872_1501	195
1214	3300046523	Ga0495644_0031794	Ga0495644_0031794_539_1183	195
1215	3300046523	Ga0495644_0047181	Ga0495644_0047181_380_994	195
1216	3300046523	Ga0495644_0160588	Ga0495644_0160588_120_734	195
1217	3300046524	Ga0495648_0000019	Ga0495648_0000019_208607_209227	195
1218	3300046524	Ga0495648_0000033	Ga0495648_0000033_163908_164540	195
1219	3300046524	Ga0495648_0000527	Ga0495648_0000527_336_950	195
1220	3300046524	Ga0495648_0007648	Ga0495648_0007648_494_1108	195
1221	3300046524	Ga0495648_0025773	Ga0495648_0025773_2743_3357	195
1222	3300046524	Ga0495648_0037659	Ga0495648_0037659_526_1140	195
1223	3300046524	Ga0495648_0038786	Ga0495648_0038786_223_837	195
1224	3300046524	Ga0495648_0102115	Ga0495648_0102115_744_1358	195
1225	3300046525	Ga0495663_0002070	Ga0495663_0002070_5204_5818	195
1226	3300046526	Ga0495666_0020595	Ga0495666_0020595_1179_1811	195
1227	3300046528	Ga0495642_0000005	Ga0495642_0000005_103853_104467	195
1228	3300046528	Ga0495642_0000111	Ga0495642_0000111_11161_11775	195
1229	3300046528	Ga0495642_0004661	Ga0495642_0004661_97_726	195
1230	3300046528	Ga0495642_0009857	Ga0495642_0009857_2610_3260	195
1231	3300046528	Ga0495642_0045669	Ga0495642_0045669_654_1289	195
1232	3300046528	Ga0495642_0050674	Ga0495642_0050674_987_1601	195
1233	3300046528	Ga0495642_0065157	Ga0495642_0065157_316_930	195
1234	3300046528	Ga0495642_0124205	Ga0495642_0124205_26_640	195
1235	3300046528	Ga0495642_0300518	Ga0495642_0300518_34_648	195
1236	3300046529	Ga0495652_0046650	Ga0495652_0046650_2352_2966	195
1237	3300046529	Ga0495652_0149700	Ga0495652_0149700_15_647	195
1238	3300046530	Ga0495654_0003975	Ga0495654_0003975_1278_1892	195
1239	3300046530	Ga0495654_0009835	Ga0495654_0009835_4020_4634	195
1240	3300046530	Ga0495654_0017364	Ga0495654_0017364_2591_3205	195
1241	3300046530	Ga0495654_0027638	Ga0495654_0027638_2160_2774	195
1242	3300046530	Ga0495654_0116109	Ga0495654_0116109_244_858	195
1243	3300046531	Ga0495665_0045808	Ga0495665_0045808_202_834	195
1244	3300046538	Ga0495609_0000122	Ga0495609_0000122_29388_30005	195
1245	3300046538	Ga0495609_0000127	Ga0495609_0000127_81032_81646	195
1246	3300046538	Ga0495609_0000377	Ga0495609_0000377_16057_16671	195
1247	3300046538	Ga0495609_0003050	Ga0495609_0003050_8833_9447	195
1248	3300046538	Ga0495609_0016190	Ga0495609_0016190_138_752	195
1249	3300046538	Ga0495609_0034137	Ga0495609_0034137_1348_1962	195
1250	3300046538	Ga0495609_0037541	Ga0495609_0037541_291_905	195
1251	3300046538	Ga0495609_0038173	Ga0495609_0038173_914_1528	195
1252	3300046538	Ga0495609_0039218	Ga0495609_0039218_730_1350	195
1253	3300046538	Ga0495609_0097297	Ga0495609_0097297_252_872	195
1254	3300046538	Ga0495609_0152089	Ga0495609_0152089_195_809	195
1255	3300046542	Ga0495597_0000075	Ga0495597_0000075_50726_51346	195
1256	3300046542	Ga0495597_0000244	Ga0495597_0000244_15481_16095	195
1257	3300046542	Ga0495597_0000277	Ga0495597_0000277_45521_46198	195
1258	3300046542	Ga0495597_0001275	Ga0495597_0001275_11621_12235	195
1259	3300046542	Ga0495597_0004294	Ga0495597_0004294_810_1439	195
1260	3300046542	Ga0495597_0004483	Ga0495597_0004483_756_1370	195
1261	3300046542	Ga0495597_0024107	Ga0495597_0024107_2028_2660	195
1262	3300046542	Ga0495597_0048672	Ga0495597_0048672_945_1559	195
1263	3300046542	Ga0495597_0049851	Ga0495597_0049851_1102_1716	195
1264	3300046542	Ga0495597_0069760	Ga0495597_0069760_714_1328	195
1265	3300046543	Ga0495645_0136125	Ga0495645_0136125_403_1017	195
1266	3300046557	Ga0495622_0000037	Ga0495622_0000037_67820_68440	195
1267	3300046557	Ga0495622_0000155	Ga0495622_0000155_598_1218	195
1268	3300046557	Ga0495622_0105406	Ga0495622_0105406_163_795	195
1269	3300046558	Ga0495633_0000086	Ga0495633_0000086_8837_9457	195
1270	3300046558	Ga0495633_0000091	Ga0495633_0000091_61419_62033	195
1271	3300046558	Ga0495633_0002740	Ga0495633_0002740_640_1275	195
1272	3300046558	Ga0495633_0003169	Ga0495633_0003169_657_1271	195
1273	3300046558	Ga0495633_0005227	Ga0495633_0005227_441_1055	195
1274	3300046558	Ga0495633_0012297	Ga0495633_0012297_3162_3794	195
1275	3300046558	Ga0495633_0013563	Ga0495633_0013563_837_1469	195
1276	3300046558	Ga0495633_0028627	Ga0495633_0028627_552_1166	195
1277	3300046558	Ga0495633_0032504	Ga0495633_0032504_286_918	195
1278	3300046558	Ga0495633_0063533	Ga0495633_0063533_16_648	195
1279	3300046558	Ga0495633_0079197	Ga0495633_0079197_310_942	195
1280	3300046558	Ga0495633_0197289	Ga0495633_0197289_285_899	195
1281	3300046615	Ga0495656_0006282	Ga0495656_0006282_3029_3661	195
1282	3300046615	Ga0495656_0049039	Ga0495656_0049039_1000_1617	195
1283	3300046616	Ga0495668_0000066	Ga0495668_0000066_102108_102722	195
1284	3300046616	Ga0495668_0000579	Ga0495668_0000579_449_1063	195
1285	3300046616	Ga0495668_0000712	Ga0495668_0000712_38041_38655	195
1286	3300046616	Ga0495668_0000987	Ga0495668_0000987_593_1222	195
1287	3300046616	Ga0495668_0001514	Ga0495668_0001514_13915_14529	195
1288	3300046616	Ga0495668_0002104	Ga0495668_0002104_12272_12886	195
1289	3300046616	Ga0495668_0006539	Ga0495668_0006539_619_1239	195
1290	3300046616	Ga0495668_0007925	Ga0495668_0007925_4759_5373	195
1291	3300046616	Ga0495668_0009537	Ga0495668_0009537_712_1326	195
1292	3300046616	Ga0495668_0014164	Ga0495668_0014164_683_1315	195
1293	3300046616	Ga0495668_0025338	Ga0495668_0025338_2195_2809	195
1294	3300046616	Ga0495668_0030873	Ga0495668_0030873_1760_2389	195
1295	3300046616	Ga0495668_0162207	Ga0495668_0162207_486_1106	195
1296	3300046616	Ga0495668_0212030	Ga0495668_0212030_380_1009	195
1297	3300046616	Ga0495668_0269496	Ga0495668_0269496_200_814	195
1298	3300046616	Ga0495668_0291305	Ga0495668_0291305_248_868	195
1299	3300046648	Ga0495611_0002764	Ga0495611_0002764_1800_2420	195
1300	3300046648	Ga0495611_0004783	Ga0495611_0004783_4840_5454	195
1301	3300046648	Ga0495611_0005095	Ga0495611_0005095_759_1373	195
1302	3300046648	Ga0495611_0009182	Ga0495611_0009182_1210_1842	195
1303	3300046648	Ga0495611_0064339	Ga0495611_0064339_673_1305	195
1304	3300046648	Ga0495611_0090448	Ga0495611_0090448_599_1213	195
1305	3300046648	Ga0495611_0101088	Ga0495611_0101088_394_1023	195
1306	3300046648	Ga0495611_0155059	Ga0495611_0155059_295_930	195
1307	3300046660	Ga0495625_0000432	Ga0495625_0000432_756_1376	195
1308	3300046660	Ga0495625_0000931	Ga0495625_0000931_26371_26985	195
1309	3300046660	Ga0495625_0001069	Ga0495625_0001069_437_1051	195
1310	3300046660	Ga0495625_0002528	Ga0495625_0002528_1870_2484	195
1311	3300046660	Ga0495625_0002580	Ga0495625_0002580_9606_10220	195
1312	3300046660	Ga0495625_0004594	Ga0495625_0004594_12343_12957	195
1313	3300046660	Ga0495625_0029530	Ga0495625_0029530_383_1015	195
1314	3300046660	Ga0495625_0093097	Ga0495625_0093097_1123_1752	195
1315	3300046664	Ga0495659_0000074	Ga0495659_0000074_6970_7584	195
1316	3300046664	Ga0495659_0000368	Ga0495659_0000368_9606_10220	195
1317	3300046665	Ga0495661_0000198	Ga0495661_0000198_316_930	195
1318	3300046665	Ga0495661_0000254	Ga0495661_0000254_30627_31244	195
1319	3300046665	Ga0495661_0000654	Ga0495661_0000654_17103_17717	195
1320	3300046665	Ga0495661_0003108	Ga0495661_0003108_11382_12017	195
1321	3300046665	Ga0495661_0014208	Ga0495661_0014208_1997_2611	195
1322	3300046665	Ga0495661_0014465	Ga0495661_0014465_437_1069	195
1323	3300046665	Ga0495661_0034197	Ga0495661_0034197_1987_2619	195
1324	3300046665	Ga0495661_0045002	Ga0495661_0045002_739_1353	195
1325	3300046665	Ga0495661_0104359	Ga0495661_0104359_321_953	195
1326	3300046665	Ga0495661_0227352	Ga0495661_0227352_223_837	195
1327	3300046674	Ga0495588_0000055	Ga0495588_0000055_178492_179106	195
1328	3300046674	Ga0495588_0004945	Ga0495588_0004945_4712_5326	195
1329	3300046674	Ga0495588_0018614	Ga0495588_0018614_227_841	195
1330	3300046674	Ga0495588_0123235	Ga0495588_0123235_296_910	195
1331	3300046674	Ga0495588_0220415	Ga0495588_0220415_370_984	195
1332	3300046679	Ga0495623_0049510	Ga0495623_0049510_1571_2203	195
1333	3300046680	Ga0495646_0003302	Ga0495646_0003302_3707_4321	195
1334	3300046684	Ga0495669_0000053	Ga0495669_0000053_12582_13196	195
1335	3300046684	Ga0495669_0003999	Ga0495669_0003999_626_1240	195
1336	3300046684	Ga0495669_0013249	Ga0495669_0013249_619_1233	195
1337	3300046684	Ga0495669_0018939	Ga0495669_0018939_1049_1663	195
1338	3300046684	Ga0495669_0023877	Ga0495669_0023877_1485_2099	195
1339	3300046684	Ga0495669_0033489	Ga0495669_0033489_1269_1901	195
1340	3300046684	Ga0495669_0037160	Ga0495669_0037160_1090_1719	195
1341	3300046689	Ga0495613_0011139	Ga0495613_0011139_703_1317	195
1342	3300046690	Ga0495624_0087733	Ga0495624_0087733_929_1543	195
1343	3300046691	Ga0495670_0000840	Ga0495670_0000840_14022_14657	195
1344	3300046691	Ga0495670_0003303	Ga0495670_0003303_699_1331	195
1345	3300046691	Ga0495670_0014555	Ga0495670_0014555_391_1005	195
1346	3300046691	Ga0495670_0014746	Ga0495670_0014746_679_1311	195
1347	3300046691	Ga0495670_0036166	Ga0495670_0036166_1528_2142	195
1348	3300046691	Ga0495670_0065274	Ga0495670_0065274_592_1224	195
1349	3300046691	Ga0495670_0127579	Ga0495670_0127579_34_648	195
1350	3300046691	Ga0495670_0191841	Ga0495670_0191841_279_899	195
1351	3300046691	Ga0495670_0197970	Ga0495670_0197970_218_832	195
1352	3300046692	Ga0495671_0000005	Ga0495671_0000005_377002_377616	195
1353	3300046692	Ga0495671_0000294	Ga0495671_0000294_454_1068	195
1354	3300046692	Ga0495671_0000493	Ga0495671_0000493_783_1397	195
1355	3300046692	Ga0495671_0001143	Ga0495671_0001143_1078_1707	195
1356	3300046692	Ga0495671_0001848	Ga0495671_0001848_159_788	195
1357	3300046692	Ga0495671_0015630	Ga0495671_0015630_676_1290	195
1358	3300046692	Ga0495671_0050544	Ga0495671_0050544_721_1335	195
1359	3300046692	Ga0495671_0105621	Ga0495671_0105621_485_1099	195
1360	3300046694	Ga0495649_0001632	Ga0495649_0001632_6645_7259	195
1361	3300046694	Ga0495649_0002914	Ga0495649_0002914_10469_11083	195
1362	3300046694	Ga0495649_0003129	Ga0495649_0003129_10546_11160	195
1363	3300046694	Ga0495649_0008680	Ga0495649_0008680_666_1295	195
1364	3300046694	Ga0495649_0017973	Ga0495649_0017973_670_1284	195
1365	3300046694	Ga0495649_0033827	Ga0495649_0033827_426_1040	195
1366	3300046694	Ga0495649_0095827	Ga0495649_0095827_487_1101	195
1367	3300046694	Ga0495649_0128173	Ga0495649_0128173_321_956	195
1368	3300046694	Ga0495649_0149064	Ga0495649_0149064_376_1005	195
1369	3300046794	Ga0495589_0000049	Ga0495589_0000049_103631_104248	195
1370	3300046794	Ga0495589_0000248	Ga0495589_0000248_12308_12943	195
1371	3300046794	Ga0495589_0000732	Ga0495589_0000732_644_1258	195
1372	3300046794	Ga0495589_0017384	Ga0495589_0017384_2765_3379	195
1373	3300046794	Ga0495589_0034199	Ga0495589_0034199_1486_2100	195
1374	3300046794	Ga0495589_0057199	Ga0495589_0057199_241_873	195
1375	3300046794	Ga0495589_0249152	Ga0495589_0249152_187_816	195
1376	3300046810	Ga0495660_0000167	Ga0495660_0000167_39328_39963	195
1377	3300046810	Ga0495660_0000419	Ga0495660_0000419_3987_4601	195
1378	3300046810	Ga0495660_0002961	Ga0495660_0002961_6778_7392	195
1379	3300046810	Ga0495660_0007004	Ga0495660_0007004_1414_2028	195
1380	3300046810	Ga0495660_0011538	Ga0495660_0011538_4359_4979	195
1381	3300046810	Ga0495660_0012541	Ga0495660_0012541_498_1112	195
1382	3300046810	Ga0495660_0078059	Ga0495660_0078059_623_1252	195
1383	3300046810	Ga0495660_0101932	Ga0495660_0101932_369_983	195
1384	3300046810	Ga0495660_0111899	Ga0495660_0111899_431_1045	195
1385	3300046810	Ga0495660_0149120	Ga0495660_0149120_342_971	195
1386	3300046810	Ga0495660_0294370	Ga0495660_0294370_85_699	195
1387	3300047315	Ga0495581_0048644	Ga0495581_0048644_1452_2084	195
1388	3300047317	Ga0495604_0205430	Ga0495604_0205430_263_886	195
1389	3300047318	Ga0495636_0001381	Ga0495636_0001381_1914_2528	195
1390	3300047318	Ga0495636_0024068	Ga0495636_0024068_1498_2112	195
1391	3300047318	Ga0495636_0037829	Ga0495636_0037829_491_1105	195
1392	3300047318	Ga0495636_0237142	Ga0495636_0237142_193_807	195
1393	3300047320	Ga0495672_0000026	Ga0495672_0000026_156546_157160	195
1394	3300047320	Ga0495672_0000226	Ga0495672_0000226_25815_26429	195
1395	3300047320	Ga0495672_0027083	Ga0495672_0027083_2485_3120	195
1396	3300047320	Ga0495672_0036485	Ga0495672_0036485_2072_2686	195
1397	3300047320	Ga0495672_0119803	Ga0495672_0119803_222_836	195
1398	3300047321	Ga0495676_0000030	Ga0495676_0000030_59793_60407	195
1399	3300047321	Ga0495676_0063085	Ga0495676_0063085_1809_2423	195
1400	3300047321	Ga0495676_0155754	Ga0495676_0155754_397_1011	195
1401	3300047323	Ga0495683_0000072	Ga0495683_0000072_100051_100683	195
1402	3300047323	Ga0495683_0042743	Ga0495683_0042743_1359_1973	195
1403	3300047323	Ga0495683_0049462	Ga0495683_0049462_130_759	195
1404	3300047323	Ga0495683_0059375	Ga0495683_0059375_1118_1747	195
1405	3300047323	Ga0495683_0064958	Ga0495683_0064958_314_946	195
1406	3300047443	Ga0495687_000024	Ga0495687_000024_29388_30005	195
1407	3300047443	Ga0495687_000456	Ga0495687_000456_14428_15057	195
1408	3300047443	Ga0495687_000855	Ga0495687_000855_31132_31767	195
1409	3300047443	Ga0495687_000970	Ga0495687_000970_4017_4631	195
1410	3300047443	Ga0495687_003707	Ga0495687_003707_7939_8553	195
1411	3300047445	Ga0495677_0000017	Ga0495677_0000017_91486_92103	195
1412	3300047445	Ga0495677_0000478	Ga0495677_0000478_495_1109	195
1413	3300047445	Ga0495677_0000650	Ga0495677_0000650_11504_12118	195
1414	3300047445	Ga0495677_0003557	Ga0495677_0003557_4942_5577	195
1415	3300047445	Ga0495677_0066522	Ga0495677_0066522_16_630	195
1416	3300047445	Ga0495677_0084292	Ga0495677_0084292_171_806	195
1417	3300047445	Ga0495677_0125832	Ga0495677_0125832_290_904	195
1418	3300047446	Ga0495679_014141	Ga0495679_014141_511_1125	195
1419	3300047446	Ga0495679_020250	Ga0495679_020250_491_1108	195
1420	3300047446	Ga0495679_036364	Ga0495679_036364_372_986	195
1421	3300047447	Ga0495685_005104	Ga0495685_005104_1875_2489	195
1422	3300047447	Ga0495685_031735	Ga0495685_031735_922_1536	195
1423	3300047469	Ga0495673_0000008	Ga0495673_0000008_469569_470183	195
1424	3300047469	Ga0495673_0000009	Ga0495673_0000009_415350_415964	195
1425	3300047469	Ga0495673_0000012	Ga0495673_0000012_295598_296212	195
1426	3300047469	Ga0495673_0014443	Ga0495673_0014443_2804_3418	195
1427	3300047470	Ga0495681_0003096	Ga0495681_0003096_9138_9752	195
1428	3300047470	Ga0495681_0006805	Ga0495681_0006805_592_1221	195
1429	3300047470	Ga0495681_0011676	Ga0495681_0011676_3974_4588	195
1430	3300047470	Ga0495681_0030978	Ga0495681_0030978_1850_2464	195
1431	3300047470	Ga0495681_0044896	Ga0495681_0044896_223_852	195
1432	3300047470	Ga0495681_0045113	Ga0495681_0045113_385_999	195
1433	3300047470	Ga0495681_0057222	Ga0495681_0057222_452_1084	195
1434	3300047470	Ga0495681_0152756	Ga0495681_0152756_282_902	195
1435	3300047472	Ga0495686_0000062	Ga0495686_0000062_197507_198133	195
1436	3300047472	Ga0495686_0000431	Ga0495686_0000431_45570_46199	195
1437	3300047472	Ga0495686_0002226	Ga0495686_0002226_2738_3352	195
1438	3300047472	Ga0495686_0141169	Ga0495686_0141169_513_1127	195
1439	3300047472	Ga0495686_0216533	Ga0495686_0216533_320_934	195
1440	3300047673	Ga0495593_0002258	Ga0495593_0002258_8509_9141	195
1441	3300048090	Ga0495615_0034185	Ga0495615_0034185_168_782	195
1442	3300048091	Ga0495626_0000202	Ga0495626_0000202_40627_41262	195
1443	3300048091	Ga0495626_0001340	Ga0495626_0001340_8728_9342	195
1444	3300048091	Ga0495626_0002145	Ga0495626_0002145_604_1218	195
1445	3300048091	Ga0495626_0003033	Ga0495626_0003033_579_1193	195
1446	3300048091	Ga0495626_0003253	Ga0495626_0003253_8078_8692	195
1447	3300048091	Ga0495626_0025563	Ga0495626_0025563_784_1398	195
1448	3300048091	Ga0495626_0055457	Ga0495626_0055457_908_1546	195
1449	3300048091	Ga0495626_0057990	Ga0495626_0057990_413_1027	195
1450	3300048091	Ga0495626_0066183	Ga0495626_0066183_368_982	195
1451	3300048091	Ga0495626_0116021	Ga0495626_0116021_344_973	195
1452	3300048091	Ga0495626_0133461	Ga0495626_0133461_73_702	195
1453	3300048904	Ga0496101_0088622	Ga0496101_0088622_657_1271	195
1454	3300048904	Ga0496101_0105505	Ga0496101_0105505_1122_1736	195
1455	3300048904	Ga0496101_0220403	Ga0496101_0220403_525_1145	195
1456	3300048905	Ga0496102_0000071	Ga0496102_0000071_75894_76508	195
1457	3300048905	Ga0496102_0000071	Ga0496102_0000071_90884_91498	195
1458	3300048905	Ga0496102_0114322	Ga0496102_0114322_182_796	195
1459	3300048905	Ga0496102_0190543	Ga0496102_0190543_949_1563	195
1460	3300048905	Ga0496102_0215802	Ga0496102_0215802_283_897	195
1461	3300048905	Ga0496102_0671238	Ga0496102_0671238_112_726	195
1462	3300048906	Ga0496103_0006209	Ga0496103_0006209_899_1513	195
1463	3300048906	Ga0496103_0030941	Ga0496103_0030941_2243_2857	195
1464	3300048906	Ga0496103_0033175	Ga0496103_0033175_306_920	195
1465	3300048906	Ga0496103_0187094	Ga0496103_0187094_634_1248	195
1466	3300048906	Ga0496103_0271408	Ga0496103_0271408_106_720	195
1467	3300048910	Ga0496107_0152631	Ga0496107_0152631_870_1484	195
1468	3300048911	Ga0496108_0127045	Ga0496108_0127045_1488_2108	195
1469	3300048911	Ga0496108_0682952	Ga0496108_0682952_242_856	195
1470	3300048912	Ga0496109_0461162	Ga0496109_0461162_446_1060	195
1471	3300048913	Ga0496110_0001557	Ga0496110_0001557_614_1243	195
1472	3300048913	Ga0496110_0086963	Ga0496110_0086963_2067_2696	195
1473	3300048913	Ga0496110_0786231	Ga0496110_0786231_186_800	195
1474	3300048915	Ga0496112_0407376	Ga0496112_0407376_183_797	195
1475	3300048915	Ga0496112_0420883	Ga0496112_0420883_31_663	195
1476	3300048917	Ga0496114_0100276	Ga0496114_0100276_1003_1623	195
1477	3300048917	Ga0496114_0372696	Ga0496114_0372696_543_1157	195
1478	3300048918	Ga0496115_0023301	Ga0496115_0023301_3648_4262	195
1479	3300048918	Ga0496115_0381794	Ga0496115_0381794_165_779	195
1480	3300048918	Ga0496115_0550392	Ga0496115_0550392_110_742	195
1481	3300048919	Ga0496116_0002196	Ga0496116_0002196_4933_5547	195
1482	3300048919	Ga0496116_0008492	Ga0496116_0008492_7890_8504	195
1483	3300048920	Ga0496117_0000005	Ga0496117_0000005_62765_63379	195
1484	3300048921	Ga0496118_0000022	Ga0496118_0000022_375224_375838	195
1485	3300048921	Ga0496118_0044587	Ga0496118_0044587_2669_3283	195
1486	3300048924	Ga0496121_0004994	Ga0496121_0004994_11489_12103	195
1487	3300048924	Ga0496121_0006051	Ga0496121_0006051_10886_11500	195
1488	3300048924	Ga0496121_0114687	Ga0496121_0114687_1237_1851	195
1489	3300048924	Ga0496121_0194091	Ga0496121_0194091_283_897	195
1490	3300048924	Ga0496121_0448104	Ga0496121_0448104_35_649	195
1491	3300048925	Ga0496122_0000121	Ga0496122_0000121_43296_43910	195
1492	3300048925	Ga0496122_0000263	Ga0496122_0000263_4266_4880	195
1493	3300048925	Ga0496122_0001857	Ga0496122_0001857_550_1164	195
1494	3300048925	Ga0496122_0078180	Ga0496122_0078180_339_953	195
1495	3300048926	Ga0496123_0000040	Ga0496123_0000040_43596_44210	195
1496	3300048926	Ga0496123_0000156	Ga0496123_0000156_138273_138887	195
1497	3300048926	Ga0496123_0006176	Ga0496123_0006176_470_1084	195
1498	3300048926	Ga0496123_0034198	Ga0496123_0034198_2459_3073	195
1499	3300048926	Ga0496123_0053763	Ga0496123_0053763_437_1051	195
1500	3300048926	Ga0496123_0200329	Ga0496123_0200329_127_741	195
1501	3300048927	Ga0496124_0058411	Ga0496124_0058411_2394_3008	195
1502	3300048927	Ga0496124_0060934	Ga0496124_0060934_501_1115	195
1503	3300048927	Ga0496124_0077481	Ga0496124_0077481_1795_2409	195
1504	3300048927	Ga0496124_0166993	Ga0496124_0166993_383_997	195
1505	3300048927	Ga0496124_0251543	Ga0496124_0251543_550_1164	195
1506	3300048927	Ga0496124_0333575	Ga0496124_0333575_330_959	195
1507	3300048927	Ga0496124_0346743	Ga0496124_0346743_50_664	195
1508	3300048927	Ga0496124_0410756	Ga0496124_0410756_196_810	195
1509	3300048928	Ga0496125_0000672	Ga0496125_0000672_534_1148	195
1510	3300048928	Ga0496125_0000720	Ga0496125_0000720_29621_30235	195
1511	3300048928	Ga0496125_0000995	Ga0496125_0000995_39355_39969	195
1512	3300048928	Ga0496125_0210209	Ga0496125_0210209_571_1185	195
1513	3300048928	Ga0496125_0416342	Ga0496125_0416342_135_749	195
1514	3300048929	Ga0496126_0380146	Ga0496126_0380146_207_821	195
1515	3300049459	Ga0495678_000012	Ga0495678_000012_291016_291630	195
1516	3300049459	Ga0495678_000035	Ga0495678_000035_195183_195797	195
1517	3300049459	Ga0495678_000130	Ga0495678_000130_750_1364	195
1518	3300049459	Ga0495678_000232	Ga0495678_000232_49363_49992	195
1519	3300049459	Ga0495678_001730	Ga0495678_001730_14984_15613	195
1520	3300049459	Ga0495678_002896	Ga0495678_002896_2036_2656	195
1521	3300049459	Ga0495678_025648	Ga0495678_025648_278_892	195
1522	3300049459	Ga0495678_039677	Ga0495678_039677_967_1587	195
1523	3300049459	Ga0495678_076832	Ga0495678_076832_491_1105	195
1524	3300049460	Ga0495682_0000210	Ga0495682_0000210_46115_46744	195
1525	3300049460	Ga0495682_0001032	Ga0495682_0001032_2597_3211	195
1526	3300049460	Ga0495682_0001446	Ga0495682_0001446_327_941	195
1527	3300049460	Ga0495682_0004102	Ga0495682_0004102_2154_2792	195
1528	3300049460	Ga0495682_0012843	Ga0495682_0012843_637_1266	195
1529	3300049460	Ga0495682_0059274	Ga0495682_0059274_609_1223	195
1530	3300049514	Ga0501291_015618	Ga0501291_015618_212_826	195
1531	3300049571	Ga0501034_0000206	Ga0501034_0000206_34984_35604	195
1532	3300049572	Ga0501036_0277408	Ga0501036_0277408_400_1014	195
1533	3300049578	Ga0501042_0510025	Ga0501042_0510025_63_686	195
1534	3300049584	Ga0501068_0055744	Ga0501068_0055744_1424_2044	195
1535	3300049588	Ga0501072_0001267	Ga0501072_0001267_17425_18045	195
1536	3300049589	Ga0501073_0023535	Ga0501073_0023535_506_1126	195
1537	3300049665	Ga0501227_051574	Ga0501227_051574_239_856	195
1538	3300049679	Ga0501249_001082	Ga0501249_001082_4692_5306	195
1539	3300049742	Ga0501080_0024133	Ga0501080_0024133_4774_5394	195
1540	3300049742	Ga0501080_0085521	Ga0501080_0085521_1670_2290	195
1541	3300049743	Ga0501081_0209057	Ga0501081_0209057_645_1286	195
1542	3300049766	Ga0501269_000461	Ga0501269_000461_2418_3032	195
1543	3300049775	Ga0501279_000878	Ga0501279_000878_2434_3048	195
1544	3300049775	Ga0501279_005950	Ga0501279_005950_658_1272	195
1545	3300049775	Ga0501279_007263	Ga0501279_007263_667_1281	195
1546	3300049822	Ga0501035_0028204	Ga0501035_0028204_692_1306	195
1547	3300050491	nmdc:mga00v17_311613_c1	nmdc:mga00v17_311613_c1_185_799	195
1548	3300050492	nmdc:mga0yw44_22522_c1	nmdc:mga0yw44_22522_c1_2589_3215	195
1549	3300050493	nmdc:mga0k408_19801_c1	nmdc:mga0k408_19801_c1_1178_1792	195
1550	3300050493	nmdc:mga0k408_5475_c1	nmdc:mga0k408_5475_c1_2207_2926	195
1551	3300050493	nmdc:mga0k408_61527_c2	nmdc:mga0k408_61527_c2_433_1047	195
1552	3300050493	nmdc:mga0k408_68154_c1	nmdc:mga0k408_68154_c1_476_1081	195
1553	3300050494	nmdc:mga06z11_40101_c1	nmdc:mga06z11_40101_c1_95_814	195
1554	3300050495	nmdc:mga04h51_8520_c1	nmdc:mga04h51_8520_c1_660_1379	195
1555	3300050496	nmdc:mga07m45_60505_c1	nmdc:mga07m45_60505_c1_27_746	195
1556	3300050511	nmdc:mga08y16_235623_c1	nmdc:mga08y16_235623_c1_668_1288	195
1557	3300050512	nmdc:mga0n895_287020_c1	nmdc:mga0n895_287020_c1_437_1051	195
1558	3300050516	nmdc:mga0sz30_40875_c1	nmdc:mga0sz30_40875_c1_507_1121	195
1559	3300050516	nmdc:mga0sz30_52972_c1	nmdc:mga0sz30_52972_c1_989_1681	195
1560	3300050516	nmdc:mga0sz30_97077_c1	nmdc:mga0sz30_97077_c1_98_853	195
1561	3300053077	Ga0495601_0339544	Ga0495601_0339544_169_792	195
1562	3300053084	Ga0495595_0284322	Ga0495595_0284322_147_761	195
1563	3300053085	Ga0495619_0226161	Ga0495619_0226161_554_1177	195
1564	3300053090	Ga0500646_0027665	Ga0500646_0027665_442_1143	195
1565	3300053125	Ga0500618_000088	Ga0500618_000088_53324_53938	195
1566	3300053178	Ga0500637_0214823	Ga0500637_0214823_379_1071	195
1567	iso_pu_bacteria	2831864461	2831868159	195
1568	iso_pu_bacteria	2886848708	2886852895	195
1569	iso_pu_bacteria	2894023352	2894026637	195
1570	3300002987	JGI25159J45721_1002111	JGI25159J45721_10021115	196
1571	3300003354	JGI25160J50197_1000331	JGI25160J50197_100033126	196
1572	3300003354	JGI25160J50197_1000446	JGI25160J50197_100044626	196
1573	3300003374	JGI25161J50226_1000064	JGI25161J50226_100006484	196
1574	3300003578	Ga0006562J51391_1042917	Ga0006562J51391_10429172	196
1575	3300003752	Ga0055539_1008425	Ga0055539_10084252	196
1576	3300003791	Ga0055530_10021566	Ga0055530_100215663	196
1577	3300004625	Ga0055543_1000284	Ga0055543_100028416	196
1578	3300005563	Ga0068855_100694517	Ga0068855_1006945172	196
1579	3300005577	Ga0068857_100001302	Ga0068857_1000013022	196
1580	3300005578	Ga0068854_100073039	Ga0068854_1000730394	196
1581	3300005614	Ga0068856_100000748	Ga0068856_10000074810	196
1582	3300006051	Ga0075364_10038410	Ga0075364_100384104	196
1583	3300006177	Ga0075362_10038048	Ga0075362_100380483	196
1584	3300006353	Ga0075370_10256475	Ga0075370_102564752	196
1585	3300009093	Ga0105240_10034597	Ga0105240_100345974	196
1586	3300009148	Ga0105243_10103814	Ga0105243_101038144	196
1587	3300010375	Ga0105239_10019525	Ga0105239_100195252	196
1588	3300013105	Ga0157369_10082919	Ga0157369_100829192	196
1589	3300025208	Ga0209436_104684	Ga0209436_1046843	196
1590	3300025242	Ga0209258_100617	Ga0209258_1006172	196
1591	3300025245	Ga0207425_1004878	Ga0207425_10048782	196
1592	3300025245	Ga0207425_1019059	Ga0207425_10190593	196
1593	3300025253	Ga0209677_102284	Ga0209677_1022842	196
1594	3300025284	Ga0209130_1000094	Ga0209130_1000094123	196
1595	3300025294	Ga0209025_1064996	Ga0209025_10649962	196
1596	3300025297	Ga0209758_1053220	Ga0209758_10532203	196
1597	3300025298	Ga0209050_1006588	Ga0209050_10065882	196
1598	3300025302	Ga0207426_1000025	Ga0207426_1000025436	196
1599	3300025913	Ga0207695_10010892	Ga0207695_100108928	196
1600	3300025981	Ga0207640_10003416	Ga0207640_100034162	196
1601	3300026078	Ga0207702_10001631	Ga0207702_100016317	196
1602	3300026116	Ga0207674_10013940	Ga0207674_100139402	196
1603	3300031251	Ga0265327_10062141	Ga0265327_100621412	196
1604	3300031507	Ga0307509_10045285	Ga0307509_100452854	196
1605	3300031730	Ga0307516_10002697	Ga0307516_100026979	196
1606	3300031901	Ga0307406_10052256	Ga0307406_100522562	196
1607	3300035111	Ga0373923_0134951	Ga0373923_0134951_197_826	196
1608	3300035121	Ga0373960_0046500	Ga0373960_0046500_582_1202	196
1609	3300041486	Ga0451807_0043679	Ga0451807_0043679_306_938	196
1610	3300042435	Ga0439434_0126706	Ga0439434_0126706_126_755	196
1611	3300046507	Ga0495606_0061775	Ga0495606_0061775_516_1136	196
1612	3300046512	Ga0495610_0005660	Ga0495610_0005660_1306_1926	196
1613	3300046660	Ga0495625_0007654	Ga0495625_0007654_8565_9185	196
1614	3300050489	nmdc:mga03683_43326_c1	nmdc:mga03683_43326_c1_811_1440	196
1615	3300050491	nmdc:mga00v17_423106_c1	nmdc:mga00v17_423106_c1_188_817	196
1616	3300053136	Ga0500559_0015042	Ga0500559_0015042_898_1530	196
1617	3300053730	Ga0500645_012193	Ga0500645_012193_1752_2381	196
1618	3300055283	Ga0500661_012902	Ga0500661_012902_680_1309	196
1619	iso_pu_bacteria	2643221628	2644159706	196
1620	iso_pu_bacteria	2643221672	2644399640	196
1621	iso_pu_bacteria	2738541277	2738722274	196
1622	iso_pu_bacteria	2738543019	2739282638	196
1623	iso_pu_bacteria	2818991446	2819598654	196
1624	iso_pu_bacteria	2842677519	2842678549	196
1625	iso_pu_bacteria	2842733646	2842735524	196
1626	iso_pu_bacteria	2899924645	2899926729	196
1627	iso_pu_bacteria	2919462493	2919465036	196
1628	iso_pu_bacteria	2928037797	2928043822	196
1629	iso_pu_bacteria	2928044640	2928050593	196
1630	iso_pu_bacteria	2928051484	2928056949	196
1631	iso_pu_bacteria	2928064002	2928070713	196
1632	iso_pu_bacteria	2928084124	2928084599	196
1633	iso_pu_bacteria	2928115317	2928116235	196
1634	iso_pu_bacteria	2932422444	2932422722	196
1635	3300003761	Ga0055535_1000123	Ga0055535_100012340	197
1636	3300003763	Ga0055529_1000159	Ga0055529_100015944	197
1637	3300021361	Ga0213872_10000166	Ga0213872_1000016626	197
1638	3300021361	Ga0213872_10067364	Ga0213872_100673642	197
1639	3300025242	Ga0209258_100060	Ga0209258_10006039	197
1640	3300025256	Ga0209759_1000282	Ga0209759_100028236	197
1641	3300025272	Ga0209455_1000136	Ga0209455_100013644	197
1642	3300031250	Ga0265331_10000851	Ga0265331_1000085112	197
1643	3300031251	Ga0265327_10000307	Ga0265327_1000030768	197
1644	3300031548	Ga0307408_100000435	Ga0307408_1000004352	197
1645	3300031730	Ga0307516_10001084	Ga0307516_1000108435	197
1646	3300031901	Ga0307406_10000205	Ga0307406_100002052	197
1647	3300037418	Ga0395900_0064542	Ga0395900_0064542_1974_2600	197
1648	3300037471	Ga0395905_0000613	Ga0395905_0000613_32302_32925	197
1649	3300037471	Ga0395905_0061299	Ga0395905_0061299_643_1269	197
1650	3300037471	Ga0395905_0074256	Ga0395905_0074256_1189_1818	197
1651	3300037471	Ga0395905_0109113	Ga0395905_0109113_128_754	197
1652	3300038443	Ga0395901_0027576	Ga0395901_0027576_748_1374	197
1653	3300039447	Ga0436361_0601748	Ga0436361_0601748_466_1086	197
1654	3300039447	Ga0436361_0657731	Ga0436361_0657731_14189_14809	197
1655	3300039447	Ga0436361_0908337	Ga0436361_0908337_26837_27457	197
1656	3300041458	Ga0451798_0715964	Ga0451798_0715964_250_876	197
1657	3300046453	Ga0495627_087848	Ga0495627_087848_73_696	197
1658	3300046474	Ga0495605_0000018	Ga0495605_0000018_197498_198124	197
1659	3300046507	Ga0495606_0000830	Ga0495606_0000830_39214_39840	197
1660	3300046520	Ga0495637_0000293	Ga0495637_0000293_19116_19742	197
1661	3300046524	Ga0495648_0005556	Ga0495648_0005556_8255_8881	197
1662	3300046530	Ga0495654_0000014	Ga0495654_0000014_19200_19826	197
1663	3300046542	Ga0495597_0000378	Ga0495597_0000378_37375_38001	197
1664	3300046558	Ga0495633_0000297	Ga0495633_0000297_34777_35400	197
1665	3300053080	Ga0500635_0000031	Ga0500635_0000031_49828_50460	197
1666	3300053177	Ga0500636_0047433	Ga0500636_0047433_503_1135	197
1667	iso_pu_bacteria	2547132374	2548498327	197
1668	iso_pu_bacteria	2643221570	2643867601	197
1669	iso_pu_bacteria	2643221596	2643990522	197
1670	iso_pu_bacteria	2643221609	2644062904	197
1671	iso_pu_bacteria	2643221611	2644070587	197
1672	iso_pu_bacteria	2643221652	2644294963	197
1673	iso_pu_bacteria	2643221717	2644648866	197
1674	iso_pu_bacteria	2721755523	2722884583	197
1675	iso_pu_bacteria	2738543012	2739243781	197
1676	iso_pu_bacteria	2816332133	2816472621	197
1677	iso_pu_bacteria	2839138175	2839143181	197
1678	iso_pu_bacteria	2842718218	2842720256	197
1679	iso_pu_bacteria	2974320154	2974322765	197
1680	iso_pu_bacteria	2990710928	2990713084	197
1681	3300003322	rootL2_10014620	rootL2_100146209	198
1682	3300003775	Ga0055524_1000467	Ga0055524_100046726	198
1683	3300003775	Ga0055524_1024771	Ga0055524_10247712	198
1684	3300003791	Ga0055530_10017831	Ga0055530_100178312	198
1685	3300003792	Ga0055540_1017655	Ga0055540_10176554	198
1686	3300004625	Ga0055543_1003201	Ga0055543_10032016	198
1687	3300005262	Ga0065165_1000233	Ga0065165_100023357	198
1688	3300005327	Ga0070658_10149795	Ga0070658_101497952	198
1689	3300005327	Ga0070658_10328054	Ga0070658_103280542	198
1690	3300006195	Ga0075366_10030973	Ga0075366_100309734	198
1691	3300006944	Ga0099823_1022095	Ga0099823_10220956	198
1692	3300012497	Ga0157319_1000013	Ga0157319_100001312	198
1693	3300013296	Ga0157374_10032164	Ga0157374_100321644	198
1694	3300021361	Ga0213872_10000139	Ga0213872_1000013951	198
1695	3300025273	Ga0209673_1010219	Ga0209673_10102194	198
1696	3300025298	Ga0209050_1003348	Ga0209050_100334811	198
1697	3300025299	Ga0209256_1001137	Ga0209256_100113725	198
1698	3300025299	Ga0209256_1001737	Ga0209256_100173717	198
1699	3300025303	Ga0209051_1006395	Ga0209051_10063954	198
1700	3300025304	Ga0209257_1001091	Ga0209257_10010919	198
1701	3300025304	Ga0209257_1001249	Ga0209257_10012499	198
1702	3300025909	Ga0207705_10198265	Ga0207705_101982652	198
1703	3300027682	Ga0209971_1006957	Ga0209971_10069572	198
1704	3300027876	Ga0209974_10022552	Ga0209974_100225522	198
1705	3300028794	Ga0307515_10001095	Ga0307515_1000109532	198
1706	3300031235	Ga0265330_10000032	Ga0265330_1000003237	198
1707	3300031238	Ga0265332_10000001	Ga0265332_1000000190	198
1708	3300031241	Ga0265325_10003737	Ga0265325_100037374	198
1709	3300031247	Ga0265340_10039273	Ga0265340_100392732	198
1710	3300031456	Ga0307513_10072473	Ga0307513_100724734	198
1711	3300031548	Ga0307408_100125666	Ga0307408_1001256663	198
1712	3300031548	Ga0307408_100219015	Ga0307408_1002190152	198
1713	3300031649	Ga0307514_10000528	Ga0307514_1000052838	198
1714	3300031711	Ga0265314_10000022	Ga0265314_1000002290	198
1715	3300031911	Ga0307412_10019709	Ga0307412_100197092	198
1716	3300033180	Ga0307510_10465554	Ga0307510_104655541	198
1717	3300037418	Ga0395900_0265093	Ga0395900_0265093_407_1033	198
1718	3300038443	Ga0395901_0053698	Ga0395901_0053698_479_1105	198
1719	3300039447	Ga0436361_0062004	Ga0436361_0062004_16062_16706	198
1720	3300044672	Ga0466982_0228515	Ga0466982_0228515_290_919	198
1721	3300044765	Ga0466970_0006191	Ga0466970_0006191_3549_4178	198
1722	3300048926	Ga0496123_0144098	Ga0496123_0144098_635_1258	198
1723	3300048927	Ga0496124_0016024	Ga0496124_0016024_523_1149	198
1724	3300050493	nmdc:mga0k408_112143_c1	nmdc:mga0k408_112143_c1_529_1155	198
1725	3300050496	nmdc:mga07m45_18462_c1	nmdc:mga07m45_18462_c1_477_1103	198
1726	3300053156	Ga0500622_0005018	Ga0500622_0005018_7140_7766	198
1727	iso_pu_bacteria	2738543013	2739249082	198
1728	iso_pu_bacteria	2881101125	2881105508	198
1729	iso_pu_bacteria	2954767861	2954772192	198
1730	3300005288	Ga0065714_10069048	Ga0065714_100690484	199
1731	3300005288	Ga0065714_10115433	Ga0065714_101154332	199
1732	3300005334	Ga0068869_100148901	Ga0068869_1001489012	199
1733	3300005335	Ga0070666_10106830	Ga0070666_101068302	199
1734	3300005338	Ga0068868_100593153	Ga0068868_1005931531	199
1735	3300005339	Ga0070660_100016021	Ga0070660_1000160214	199
1736	3300005356	Ga0070674_100190454	Ga0070674_1001904542	199
1737	3300005435	Ga0070714_100582861	Ga0070714_1005828612	199
1738	3300005445	Ga0070708_100371715	Ga0070708_1003717153	199
1739	3300005456	Ga0070678_100171986	Ga0070678_1001719862	199
1740	3300005530	Ga0070679_100333372	Ga0070679_1003333723	199
1741	3300005563	Ga0068855_100120767	Ga0068855_1001207672	199
1742	3300005563	Ga0068855_100321407	Ga0068855_1003214073	199
1743	3300005614	Ga0068856_100189791	Ga0068856_1001897913	199
1744	3300005841	Ga0068863_100600971	Ga0068863_1006009712	199
1745	3300006051	Ga0075364_10204004	Ga0075364_102040043	199
1746	3300009093	Ga0105240_10001225	Ga0105240_1000122532	199
1747	3300009098	Ga0105245_10093546	Ga0105245_100935462	199
1748	3300009176	Ga0105242_10004957	Ga0105242_100049579	199
1749	3300013104	Ga0157370_10633257	Ga0157370_106332572	199
1750	3300014497	Ga0182008_10008176	Ga0182008_100081764	199
1751	3300014745	Ga0157377_10000029	Ga0157377_1000002922	199
1752	3300014969	Ga0157376_10005167	Ga0157376_100051678	199
1753	3300015262	Ga0182007_10000340	Ga0182007_1000034029	199
1754	3300025903	Ga0207680_10240595	Ga0207680_102405951	199
1755	3300025909	Ga0207705_10300250	Ga0207705_103002502	199
1756	3300025913	Ga0207695_10070967	Ga0207695_100709674	199
1757	3300025919	Ga0207657_10025513	Ga0207657_100255134	199
1758	3300025921	Ga0207652_10022988	Ga0207652_100229883	199
1759	3300025924	Ga0207694_10055579	Ga0207694_100555793	199
1760	3300025927	Ga0207687_10363306	Ga0207687_103633061	199
1761	3300025929	Ga0207664_10374537	Ga0207664_103745372	199
1762	3300025934	Ga0207686_10023539	Ga0207686_100235395	199
1763	3300025942	Ga0207689_10305214	Ga0207689_103052141	199
1764	3300025949	Ga0207667_10049546	Ga0207667_100495463	199
1765	3300025949	Ga0207667_10153920	Ga0207667_101539204	199
1766	3300025960	Ga0207651_10413386	Ga0207651_104133863	199
1767	3300026023	Ga0207677_10426660	Ga0207677_104266602	199
1768	3300026078	Ga0207702_10126536	Ga0207702_101265363	199
1769	3300026095	Ga0207676_10943143	Ga0207676_109431432	199
1770	3300027876	Ga0209974_10095657	Ga0209974_100956572	199
1771	3300028379	Ga0268266_10891865	Ga0268266_108918651	199
1772	3300031548	Ga0307408_100397873	Ga0307408_1003978731	199
1773	3300031901	Ga0307406_10147180	Ga0307406_101471803	199
1774	3300037471	Ga0395905_0138524	Ga0395905_0138524_1287_1913	199
1775	3300042532	Ga0450893_0002078	Ga0450893_0002078_187_813	199
1776	3300042876	Ga0451577_0145316	Ga0451577_0145316_355_975	199
1777	3300042876	Ga0451577_0353632	Ga0451577_0353632_576_1202	199
1778	3300044673	Ga0453683_0043464	Ga0453683_0043464_1268_1894	199
1779	3300045051	Ga0451576_0033644	Ga0451576_0033644_4601_5227	199
1780	3300046475	Ga0495639_0032738	Ga0495639_0032738_1576_2199	199
1781	3300046528	Ga0495642_0041558	Ga0495642_0041558_950_1573	199
1782	3300046615	Ga0495656_0028061	Ga0495656_0028061_1015_1641	199
1783	3300048903	Ga0496100_0067238	Ga0496100_0067238_1436_2059	199
1784	3300048904	Ga0496101_0112307	Ga0496101_0112307_792_1415	199
1785	3300048905	Ga0496102_0007543	Ga0496102_0007543_545_1168	199
1786	3300048906	Ga0496103_0149781	Ga0496103_0149781_797_1420	199
1787	3300048907	Ga0496104_0305437	Ga0496104_0305437_515_1138	199
1788	3300048908	Ga0496105_0039488	Ga0496105_0039488_463_1086	199
1789	3300048910	Ga0496107_0040387	Ga0496107_0040387_2614_3237	199
1790	3300048912	Ga0496109_0050631	Ga0496109_0050631_1772_2395	199
1791	3300048913	Ga0496110_0229656	Ga0496110_0229656_891_1514	199
1792	3300048914	Ga0496111_0067637	Ga0496111_0067637_471_1094	199
1793	3300048917	Ga0496114_0110739	Ga0496114_0110739_952_1575	199
1794	3300048925	Ga0496122_0001420	Ga0496122_0001420_824_1450	199
1795	3300048926	Ga0496123_0000600	Ga0496123_0000600_485_1111	199
1796	3300048927	Ga0496124_0071187	Ga0496124_0071187_327_953	199
1797	3300048929	Ga0496126_0606461	Ga0496126_0606461_179_805	199
1798	3300050491	nmdc:mga00v17_86090_c1	nmdc:mga00v17_86090_c1_1014_1646	199
1799	3300053125	Ga0500618_063965	Ga0500618_063965_18_644	199
1800	3300059421	Ga0590071_109778	Ga0590071_109778_43_669	199
1801	iso_pu_bacteria	2904449895	2904454284	199
1802	iso_pu_bacteria	2904456579	2904462720	199
1803	iso_pu_bacteria	2929520902	2929527168	199
1804	3300005347	Ga0070668_100686841	Ga0070668_1006868412	200
1805	3300005364	Ga0070673_100060311	Ga0070673_1000603114	200
1806	3300005456	Ga0070678_100063692	Ga0070678_1000636922	200
1807	3300005548	Ga0070665_100072441	Ga0070665_1000724413	200
1808	3300006048	Ga0075363_100090335	Ga0075363_1000903352	200
1809	3300006844	Ga0075428_100444540	Ga0075428_1004445402	200
1810	3300009177	Ga0105248_10598571	Ga0105248_105985712	200
1811	3300017792	Ga0163161_10000441	Ga0163161_1000044110	200
1812	3300025925	Ga0207650_10598537	Ga0207650_105985372	200
1813	3300025941	Ga0207711_10495224	Ga0207711_104952242	200
1814	3300025960	Ga0207651_10000343	Ga0207651_100003436	200
1815	3300026116	Ga0207674_10553841	Ga0207674_105538412	200
1816	3300027252	Ga0209973_1000141	Ga0209973_10001412	200
1817	3300027876	Ga0209974_10001315	Ga0209974_100013155	200
1818	3300028379	Ga0268266_10600091	Ga0268266_106000912	200
1819	3300031239	Ga0265328_10000027	Ga0265328_1000002727	200
1820	3300039062	Ga0400483_144157	Ga0400483_144157_701_1327	200
1821	3300039447	Ga0436361_0931472	Ga0436361_0931472_1660_2295	200
1822	3300041452	Ga0451793_1439699	Ga0451793_1439699_351_980	200
1823	3300046462	Ga0495651_0104782	Ga0495651_0104782_825_1448	200
1824	3300046522	Ga0495643_0045076	Ga0495643_0045076_102_731	200
1825	3300046542	Ga0495597_0000613	Ga0495597_0000613_501_1154	200
1826	3300048917	Ga0496114_0082089	Ga0496114_0082089_2020_2646	200
1827	3300050496	nmdc:mga07m45_79585_c1	nmdc:mga07m45_79585_c1_585_1217	200
1828	iso_pu_bacteria	2599185226	2599673968	200
1829	iso_pu_bacteria	2599185227	2599678715	200
1830	iso_pu_bacteria	2599185229	2599690180	200
1831	iso_pu_bacteria	2831265667	2831266554	200
1832	iso_pu_bacteria	2928070936	2928073385	200
1833	2162886007	SwRhRL2b_contig_1306698	SwRhRL2b_0933.00000390	201
1834	2162886007	SwRhRL2b_contig_509084	SwRhRL2b_0038.00001230	201
1835	3300005289	Ga0065704_10074085	Ga0065704_100740854	201
1836	3300005330	Ga0070690_100027408	Ga0070690_1000274084	201
1837	3300005544	Ga0070686_100525628	Ga0070686_1005256281	201
1838	3300005719	Ga0068861_100035999	Ga0068861_1000359994	201
1839	3300006946	Ga0079104_1000034	Ga0079104_1000034171	201
1840	3300009092	Ga0105250_10012732	Ga0105250_100127324	201
1841	3300009148	Ga0105243_10006138	Ga0105243_100061385	201
1842	3300013296	Ga0157374_10225821	Ga0157374_102258211	201
1843	3300025711	Ga0207696_1010406	Ga0207696_10104065	201
1844	3300025935	Ga0207709_10000019	Ga0207709_1000001940	201
1845	3300026118	Ga0207675_100076526	Ga0207675_1000765264	201
1846	3300027111	Ga0209281_1000005	Ga0209281_1000005169	201
1847	3300027552	Ga0209982_1016086	Ga0209982_10160861	201
1848	3300028666	Ga0265336_10000048	Ga0265336_1000004899	201
1849	3300031249	Ga0265339_10273977	Ga0265339_102739772	201
1850	3300031548	Ga0307408_100381816	Ga0307408_1003818162	201
1851	3300031711	Ga0265314_10008153	Ga0265314_100081537	201
1852	3300032002	Ga0307416_100152041	Ga0307416_1001520412	201
1853	3300032005	Ga0307411_10071044	Ga0307411_100710442	201
1854	3300041492	Ga0451835_0757521	Ga0451835_0757521_99_731	201
1855	3300047472	Ga0495686_0009040	Ga0495686_0009040_243_893	201
1856	3300048925	Ga0496122_0136788	Ga0496122_0136788_594_1217	201
1857	3300048926	Ga0496123_0163530	Ga0496123_0163530_50_673	201
1858	3300048928	Ga0496125_0001215	Ga0496125_0001215_689_1312	201
1859	3300048929	Ga0496126_0102352	Ga0496126_0102352_1606_2229	201

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02433

FixO

Cytochrome C oxidase, mono-heme subunit/FixO

5

184

0.98 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
8snh-assembly1.cif.gz_F	cytochrome bc1-cbb3 supercomplex from pseudomonas aeruginosa	0.8079	11	201
5djq-assembly4.cif.gz_L	the structure of cbb3 cytochrome oxidase.	0.8071	11	200
6xkw-assembly1.cif.gz_o	r. capsulatus ciii2civ bipartite super-complex (sc-2a) with ccoh/cy	0.7803	14	199
5djq-assembly4.cif.gz_L	the structure of cbb3 cytochrome oxidase.	0.7759	11	200
8snh-assembly1.cif.gz_F	cytochrome bc1-cbb3 supercomplex from pseudomonas aeruginosa	0.77	11	201

ID	Description	Score	Start	End	Superfamily
3mk7E02	Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain	0.8826	42	200	1.10.760.10
3mk7E02	Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain	0.8617	42	200	1.10.760.10
1k3gA00	Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain	0.652	106	196	1.10.760.10
2yevE02	Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins -	0.6005	38	196	2.60.40.420
1w2lA00	Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain	0.5546	52	194	1.10.760.10

ID	Description	Score	Start	End	GO Terms
AF-A0A090SH65-F1-model_v4	deleted	0.9866	138	197
AF-A0A4Q3P7K5-F1-model_v4	deleted	0.9864	117	201
AF-A0A7C1TLI8-F1-model_v4	Cytochrome-c oxidase, cbb3-type subunit II	0.9852	125	201	GO:0009055 GO:0020037
AF-A0A356HDG4-F1-model_v4	deleted	0.9819	120	198
AF-A0A1H7CUC5-F1-model_v4	Cytochrome c oxidase cbb3-type subunit 2	0.9776	113	200	GO:0009055 GO:0020037

Feature Viewer

pLDDT	pTM	Quality
79.55	0.72	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F495906

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF02433

FixO

Cytochrome C oxidase, mono-heme subunit/FixO

5

184

0.98

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map