F495993

General Info

Members Datasets Scaffolds Average Seq Length
1893 765 3786 408

Family's Representative Sequence

Representative Sequence 3300003771|Ga0055526_1007031|Ga0055526_10070316
Length 482
Sequence MNRRVAVTGMAGISPLGNDWASVRERLGQYRNAVVHMEEWDNYEGLNTRLGAPAAPFELSDRFNRKTTRSMGRVSLLATRATELALEDAGLLDHPLLKSGDMGVAFGSSVGSTSAIGDFGRMLEERSTKGLNATTYIKMMGHTAPVNVGVFFGLTGRVITTSSACTSGSQGIGYAYEAIKTGKQLAMVAGGAEELCPTEAAVFDILFATSVRNDAPETTPRPFDVNRDGLVIGEGAGCLVLEDLEHAEARGATIYAELVGFGTNSDGRHVTQPSADTMRRAMELALQDAGLQPSDIGYINAHGTATAQGDMAESQATHEVFGSNTPISSLKSYMGHTLGACGALEAWISIEMMREGWYAPTINLXQSDPXCAVLDYIAGTGRRIDCDYVMSNNFAFGGINTSLIFKRYGKXXGRADADLAGRCERDDGRQPAALPGLADAGRAGAPWALRARTAPPPVRRRPHPAADGAGTSASRAASAGPA

Samples

Sample ID Description Type Environment
1 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
2 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
3 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
4 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
5 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
6 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
7 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
8 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
9 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
10 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
11 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
12 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
13 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
14 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
15 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
16 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
17 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
18 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
19 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
20 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
21 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
22 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
23 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
24 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
25 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
26 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
27 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
28 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
29 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
30 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
31 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
32 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
33 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
34 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
35 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
36 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
37 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
38 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
39 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
40 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
41 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
42 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
43 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
44 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
45 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
46 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
47 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
48 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
49 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
50 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
51 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
52 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
53 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
54 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
55 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
56 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
57 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
58 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
59 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
60 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
61 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
62 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
63 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
64 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
65 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
66 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
67 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
68 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
69 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
70 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
71 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
72 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
73 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
74 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
75 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
76 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
77 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
79 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
80 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
81 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
82 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
83 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
84 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
85 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
86 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
87 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
88 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
89 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
91 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
93 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
94 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
95 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
96 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
97 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
98 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
99 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
100 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
101 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
102 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
103 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
104 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
105 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
106 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
107 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
108 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
109 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
110 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
111 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
112 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
113 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
114 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
115 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
116 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
117 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
118 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
119 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
120 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
121 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
122 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
123 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
124 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
125 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
126 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
127 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
128 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
129 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
130 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
131 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
132 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
133 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
134 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
135 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
136 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
137 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
138 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
139 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
140 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
141 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
142 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
143 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
144 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
145 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
146 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
147 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
148 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
186 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
187 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
188 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
189 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
190 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
191 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
195 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
196 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
197 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
198 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
199 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
200 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
201 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
202 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
203 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
204 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
205 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
206 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
207 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
208 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
209 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
210 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
211 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
212 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
213 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
214 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
215 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
216 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
217 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
218 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
219 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
220 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
221 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
222 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
223 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
224 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
225 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
226 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
227 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
228 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
229 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
230 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
231 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
232 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
233 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
234 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
235 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
236 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
237 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
238 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
239 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
240 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
241 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
242 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
243 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
244 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
245 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
246 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
247 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
248 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
249 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
250 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
251 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
252 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
253 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
254 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
255 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
256 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
257 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
258 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
259 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
260 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
261 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
262 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
263 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
264 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
265 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
266 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
267 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
268 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
269 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
270 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
271 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
272 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
273 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
274 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
275 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
276 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
277 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
278 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
279 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
280 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
281 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
282 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
283 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
284 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
285 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
286 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
287 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
288 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
289 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
290 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
291 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
292 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
293 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
294 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
295 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
296 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
297 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
298 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
299 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
300 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
301 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
302 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
303 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
304 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
305 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
306 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
307 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
308 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
309 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
310 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
311 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
312 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
313 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
314 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
315 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
316 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
317 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
318 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
319 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
320 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
321 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
322 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
323 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
324 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
325 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
326 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
327 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
328 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
329 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
330 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
331 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
332 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
333 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
334 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
335 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
336 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
337 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
338 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
339 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
340 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
341 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
342 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
343 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
344 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
345 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
346 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
347 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
348 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
349 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
350 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
351 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
352 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
353 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
354 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
355 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
356 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
357 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
358 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
359 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
360 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
361 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
362 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
363 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
364 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
365 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
366 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
367 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
368 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
369 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
370 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
371 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
372 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
373 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
374 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
375 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
376 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
377 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
378 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
379 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
380 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
381 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
382 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
383 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
384 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
385 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
386 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
387 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
388 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
389 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
390 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
391 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
392 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
393 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
394 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
395 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
396 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
397 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
398 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
399 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
400 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
401 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
402 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
403 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
404 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
405 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
406 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
407 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
408 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
409 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
410 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
411 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
412 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
413 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
414 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
415 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
416 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
417 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
418 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
419 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
420 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
421 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
422 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
423 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
424 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
425 2506520007 Serratia plymuthica AS9 Isolate Rhizosphere
426 2506520008 Serratia plymuthica AS12 Isolate Unclassified
427 2508501071 Serratia proteamaculans S4 Isolate Rhizosphere
428 2510065053 Pseudomonas sp. MOIL14HWK12:I1 Isolate Rhizosphere
429 2510065055 Pseudomonas sp. MOIL14HWK12:I2 Isolate Rhizosphere
430 2510065058 Pseudomonas oleovorans MOIL14HWK12 Isolate Rhizosphere
431 2511231003 Herbaspirillum sp. CF444 Isolate Rhizosphere
432 2511231004 Pseudomonas sp. GM102 Isolate Nodule
433 2511231006 Pseudomonas sp. GM17 Isolate Nodule
434 2511231010 Pseudomonas sp. GM25 Isolate Nodule
435 2511231011 Pseudomonas sp. GM30 Isolate Nodule
436 2511231012 Pseudomonas sp. GM33 Isolate Nodule
437 2511231014 Pseudomonas sp. GM48 Isolate Nodule
438 2511231015 Pseudomonas sp. GM49 Isolate Nodule
439 2511231016 Pseudomonas sp. GM50 Isolate Nodule
440 2511231017 Pseudomonas sp. GM55 Isolate Nodule
441 2511231018 Pseudomonas sp. GM60 Isolate Nodule
442 2511231019 Pseudomonas sp. GM67 Isolate Nodule
443 2511231020 Pseudomonas sp. GM74 Isolate Nodule
444 2511231021 Pseudomonas sp. GM78 Isolate Nodule
445 2511231022 Pseudomonas sp. GM79 Isolate Nodule
446 2511231023 Pseudomonas sp. GM80 Isolate Nodule
447 2511231025 Pantoea sp. YR343 Isolate Rhizosphere
448 2511231026 Herbaspirillum sp. YR522 Isolate Rhizosphere
449 2511231031 Pseudomonas sp. GM16 Isolate Nodule
450 2511231035 Pantoea sp. GM01 Isolate Rhizosphere
451 2512047018 Pseudomonas chlororaphis chlororaphis GP72 Isolate Rhizosphere
452 2521172590 Herbaspirillum sp. GW103 Isolate Rhizosphere
453 2524614729 Arenimonas oryziterrae YC6267, DSM 21050 Isolate Rhizosphere
454 2537561728 Pectobacterium wasabiae CFBP 3304 Isolate Rhizoplane
455 2547132416 Enterobacter sp. MR1 Isolate Rhizoplane
456 2548876994 Herbaspirillum lusitanum P6-12 Isolate Nodule
457 2551306416 Herbaspirillum seropedicae Os34 Isolate Unclassified
458 2554235231 Pseudomonas putida MTCC 5279 Isolate Unclassified
459 2554235341 Pseudomonas protegens CHA0 Isolate Rhizosphere
460 2582580891 Pseudomonas chlororaphis YL-1 Isolate Unclassified
461 2585427591 Rahnella aquatilis OV744 Isolate Rhizosphere
462 2585427592 Rahnella aquatilis OV588 Isolate Rhizosphere
463 2597489887 Pseudomonas chlororaphis aureofaciens 30-84 Isolate Rhizosphere
464 2597489888 Pseudomonas fluorescens SS101 Isolate Rhizosphere
465 2597489889 Pseudomonas synxantha BG33R Isolate Rhizosphere
466 2599185155 Pseudomonas sp. NFACC10-1 Isolate Rhizoplane
467 2599185160 Pseudomonas sp. NFPP25 Isolate Rhizoplane
468 2599185161 Pseudomonas sp. NFPP09 Isolate Rhizoplane
469 2599185162 Pseudomonas sp. NFPP10 Isolate Rhizoplane
470 2599185163 Pseudomonas sp. NFPP12 Isolate Rhizoplane
471 2599185164 Pseudomonas sp. NFPP13 Isolate Rhizoplane
472 2599185165 Pseudomonas sp. NFPP18 Isolate Rhizoplane
473 2599185166 Pseudomonas sp. NFPP08 Isolate Rhizoplane
474 2599185167 Pseudomonas sp. NFPP28 Isolate Rhizoplane
475 2599185168 Pseudomonas sp. NFPP05 Isolate Rhizoplane
476 2599185169 Klebsiella quasipneumoniae NFPP35 Isolate Rhizoplane
477 2599185179 Pseudomonas sp. NFR09 Isolate Rhizoplane
478 2599185181 Pseudomonas sp. NFPP17 Isolate Rhizoplane
479 2599185182 Pseudomonas sp. NFPP19 Isolate Rhizoplane
480 2599185185 Pseudomonas sp. NFPP07 Isolate Rhizoplane
481 2599185186 Pseudomonas sp. NFPP15 Isolate Rhizoplane
482 2599185189 Pseudomonas sp. NFPP02 Isolate Rhizoplane
483 2599185190 Pseudomonas sp. NFPP04 Isolate Rhizoplane
484 2599185191 Pseudomonas sp. NFPP24 Isolate Rhizoplane
485 2599185257 Pseudomonas sp. NFACC41-3 Isolate Rhizoplane
486 2599185288 Pseudomonas sp. NFACC25 Isolate Rhizoplane
487 2599185290 Pseudomonas sp. NFPP11 Isolate Rhizoplane
488 2599185299 Pantoea ananatis NFR11 Isolate Rhizoplane
489 2599185303 Pseudomonas sp. NFACC42-2 Isolate Rhizoplane
490 2599185356 Pseudomonas sp. NFPP14 Isolate Rhizoplane
491 2600254931 Pseudomonas sp. NFIX28 Isolate Rhizoplane
492 2600255254 Klebsiella quasipneumoniae NFIX15 Isolate Rhizoplane
493 2600255255 Klebsiella quasipneumoniae NFIX23 Isolate Rhizoplane
494 2600255256 Enterobacter sp. NFIX08 Isolate Rhizoplane
495 2600255257 Enterobacter sp. NFIX03 Isolate Rhizoplane
496 2600255280 Klebsiella quasipneumoniae NFIX42 Isolate Rhizoplane
497 2600255281 Klebsiella quasipneumoniae NFIX43 Isolate Rhizoplane
498 2600255287 Klebsiella quasipneumoniae NFIX11 Isolate Rhizoplane
499 2600255288 Klebsiella quasipneumoniae NFIX14 Isolate Rhizoplane
500 2600255289 Klebsiella quasipneumoniae NFIX16 Isolate Rhizoplane
501 2600255290 Klebsiella quasipneumoniae NFIX17 Isolate Rhizoplane
502 2600255291 Klebsiella quasipneumoniae NFIX19 Isolate Rhizoplane
503 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
504 2600255296 Pseudomonas sp. NFR02 Isolate Rhizoplane
505 2600255298 Klebsiella quasipneumoniae NFIX21 Isolate Rhizoplane
506 2600255299 Klebsiella quasipneumoniae NFIX22 Isolate Rhizoplane
507 2600255300 Klebsiella quasipneumoniae NFIX30 Isolate Rhizoplane
508 2600255301 Klebsiella quasipneumoniae NFIX33 Isolate Rhizoplane
509 2600255302 Klebsiella quasipneumoniae NFIX35 Isolate Rhizoplane
510 2600255303 Klebsiella quasipneumoniae NFIX36 Isolate Rhizoplane
511 2600255304 Klebsiella quasipneumoniae NFIX37 Isolate Rhizoplane
512 2600255305 Klebsiella quasipneumoniae NFIX41 Isolate Rhizoplane
513 2600255306 Klebsiella quasipneumoniae NFIX44 Isolate Rhizoplane
514 2600255307 Klebsiella quasipneumoniae NFIX56 Isolate Rhizoplane
515 2600255309 Klebsiella sp. NFIX53 Isolate Rhizoplane
516 2600255310 Enterobacter sp. NFIX06 Isolate Rhizoplane
517 2600255311 Enterobacter sp. NFIX04 Isolate Rhizoplane
518 2600255313 Pseudomonas sp. NFPP16 Isolate Rhizoplane
519 2600255318 Pseudomonas putida NFIX47 Isolate Rhizoplane
520 2600255389 Pseudomonas sp. NFPP33 Isolate Rhizoplane
521 2600255392 Klebsiella quasipneumoniae NFIX54 Isolate Rhizoplane
522 2602042046 Enterobacter sp. NFIX09 Isolate Rhizoplane
523 2602042047 Enterobacter sp. NFIX59 Isolate Rhizoplane
524 2602042052 Klebsiella quasipneumoniae NFIX18 Isolate Rhizoplane
525 2602042053 Klebsiella quasipneumoniae NFIX12 Isolate Rhizoplane
526 2602042066 Enterobacter sp. NFIX45 Isolate Rhizoplane
527 2602042067 Enterobacter sp. NFIX58 Isolate Rhizoplane
528 2602042103 Klebsiella quasipneumoniae NFIX29 Isolate Rhizoplane
529 2602042104 Klebsiella quasipneumoniae NFIX26 Isolate Rhizoplane
530 2602042105 Klebsiella quasipneumoniae NFIX25 Isolate Rhizoplane
531 2602042106 Klebsiella quasipneumoniae NFIX13 Isolate Rhizoplane
532 2602042109 Klebsiella aerogenes NFIX39 Isolate Rhizoplane
533 2602042110 Klebsiella quasipneumoniae NFIX40 Isolate Rhizoplane
534 2602042111 Klebsiella quasipneumoniae NFIX20 Isolate Rhizoplane
535 2603880178 Klebsiella quasipneumoniae NFIX34 Isolate Rhizoplane
536 2603880184 Klebsiella quasipneumoniae NFIX27 Isolate Rhizoplane
537 2603880185 Pseudomonas sp. NFIX46 Isolate Rhizoplane
538 2603880199 Pseudomonas sp. NFIX49 Isolate Rhizoplane
539 2603880202 Klebsiella quasipneumoniae NFIX38 Isolate Rhizoplane
540 2603880211 Klebsiella quasipneumoniae NFIX24 Isolate Rhizoplane
541 2608642108 Pantoea agglomerans NFPP29 Isolate Rhizoplane
542 2619619299 Pseudomonas veronii R4 Genome sequencing Isolate Unclassified
543 2623620443 Pseudomonas sp. DR 5-09 Isolate Unclassified
544 2627854209 Arenimonas oryziterrae YC6267, DSM 21050 Isolate Rhizosphere
545 2643221554 Duganella sp. Root1480D1 Isolate Unclassified
546 2643221565 Pseudomonas sp. Root562 Isolate Unclassified
547 2643221571 Pseudomonas sp. Root569 Isolate Unclassified
548 2643221589 Pseudomonas sp. Root68 Isolate Unclassified
549 2643221602 Pseudomonas sp. Root71 Isolate Unclassified
550 2643221609 Acidovorax sp. Root217 Isolate Unclassified
551 2643221611 Acidovorax sp. Root219 Isolate Unclassified
552 2643221633 Pseudomonas sp. Root329 Isolate Unclassified
553 2643221645 Massilia sp. Root351 Isolate Unclassified
554 2643221713 Pseudomonas sp. Root9 Isolate Unclassified
555 2648501693 Pantoea ananatis B1-9 Isolate Rhizosphere
556 2654587920 Serratia plymuthica HRO-C48 Isolate Rhizosphere
557 2667528171 Pseudomonas sp. NFPP22 Isolate Rhizoplane
558 2667528172 Enterobacteriaceae bacterium NFIX31 Isolate Rhizoplane
559 2667528173 Rahnella sp. NFIX50 Isolate Rhizoplane
560 2671180115 Cedecea sp. NFIX57 Isolate Rhizoplane
561 2671180172 Pseudomonas sp. NFIX51 Isolate Rhizoplane
562 2675903046 Klebsiella quasipneumoniae NFIX52 Isolate Rhizoplane
563 2675903420 Pseudomonas fluorescens Ps006 Isolate Unclassified
564 2681812866 Enterobacter asburiae NFIX55 Isolate Rhizoplane
565 2681812869 Enterobacter ludwigii NFPP41 Isolate Rhizoplane
566 2687453601 Serratia plymuthica 3Rp8 Isolate Unclassified
567 2711768156 Atlantibacter hermannii DDE1 Isolate Unclassified
568 2713897148 Pseudomonas fluorescens SF39a Isolate Rhizosphere
569 2713897149 Pseudomonas fluorescens SF4c Isolate Rhizosphere
570 2718217725 Pseudomonas fluorescens CREA-C16 Isolate Rhizosphere
571 2721755523 Delftia sp. HK171 Isolate Unclassified
572 2721755607 Pseudomonas fluorescens Pt14 Isolate Rhizosphere
573 2738541265 Pseudomonas sp. GV077 Isolate Unclassified
574 2738541276 Cellvibrio sp. YR554 Isolate Unclassified
575 2738541282 Pseudomonas sp. GV058 Isolate Unclassified
576 2738541294 Pseudomonas sp. GV087 Isolate Unclassified
577 2738541303 Pseudomonas sp. GV105 Isolate Unclassified
578 2738541309 Pseudomonas sp. GV047 Isolate Unclassified
579 2738543004 Pseudomonas sp. GV085 Isolate Unclassified
580 2738543015 Pseudomonas sp. GV041 Isolate Unclassified
581 2738543020 Pseudomonas sp. GV054 Isolate Unclassified
582 2738543021 Pseudomonas sp. GV071 Isolate Unclassified
583 2738543025 Pseudomonas sp. GV091 Isolate Unclassified
584 2740891818 Desulfofaba hansenii DSM 12642 Isolate Unclassified
585 2740892503 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
586 2751185917 Enterobacter sp. HK169 Isolate Unclassified
587 2765235842 Enterobacter ludwigii AA4 Isolate Unclassified
588 2773857670 Pseudomonas sp. 478 Isolate Unclassified
589 2773857672 Pseudomonas sp. 1766 Isolate Unclassified
590 2773857673 Pseudomonas sp. 443 Isolate Unclassified
591 2775506706 Enterobacter asburiae 1216 Isolate Unclassified
592 2784132063 Pseudomonas sp. 424 Isolate Unclassified
593 2784132072 Pseudomonas sp. 460 Isolate Unclassified
594 2791354903 Mangrovibacter phragmitis MP23 Isolate Unclassified
595 2808606373 Pseudomonas sp. SLBN-2 Isolate Unclassified
596 2808606377 Pseudomonas sp. SJZ083 Isolate Rhizosphere
597 2808606379 Pseudomonas sp. SJZ079 Isolate Rhizosphere
598 2808606381 Pseudomonas sp. SJZ077 Isolate Rhizosphere
599 2808606382 Pseudomonas sp. SJZ080 Isolate Rhizosphere
600 2808606385 Pseudomonas sp. SJZ103 Isolate Rhizosphere
601 2808606388 Pseudomonas sp. SJZ094 Isolate Rhizosphere
602 2808606414 Pantoea sp. SJZ147 Isolate Rhizosphere
603 2808606445 Pseudomonas sp. SJZ131 Isolate Rhizosphere
604 2811994881 Pseudomonas sp. SLBN-26 Isolate Unclassified
605 2811995292 Kosakonia oryzae Ola 51 Isolate Unclassified
606 2814123068 Kosakonia radicincitans GXGL-4A Isolate Rhizosphere
607 2816332133 Acidovorax radicis 2721A Isolate Unclassified
608 2816332298 Pseudomonas veronii R02 Isolate Rhizosphere
609 2818991436 Collimonas arenae 515 Isolate Unclassified
610 2818991445 Herbaspirillum hiltneri 3195 Isolate Unclassified
611 2818991456 Pseudomonas koreensis 3286 Isolate Rhizosphere
612 2818991464 Pseudomonas protegens 3295 Isolate Rhizosphere
613 2821118458 Enterobacter asburiae 609 Isolate Unclassified
614 2823373977 Enterobacter ludwigii NCR3 Isolate Rhizosphere
615 2823421272 Pseudomonas mendocina S5.2 Isolate Rhizoplane
616 2826581358 Pseudomonas viridiflava CDRTc14 Isolate Unclassified
617 2834028612 Pseudomonas fluorescens 513 Isolate Unclassified
618 2839094727 Herbaspirillum robiniae HZ10 Isolate Nodule
619 2842711865 Duganella sp. R-73148 Isolate Unclassified
620 2842805378 Pseudomonas sp. R-72599 Isolate Unclassified
621 2842815866 Pseudomonas sp. R-72210 Isolate Unclassified
622 2842826826 Pseudomonas sp. R-72172 Isolate Unclassified
623 2842832357 Pseudomonas sp. R-72164 Isolate Unclassified
624 2842837860 Pseudomonas sp. R-72102 Isolate Unclassified
625 2842843487 Pseudomonas sp. R-72074 Isolate Unclassified
626 2842849001 Pseudomonas sp. R-72008 Isolate Unclassified
627 2844528606 Pantoea sp. R-72498 v. 2 Isolate Unclassified
628 2844665904 Pseudomonas protegens H1F10C Isolate Unclassified
629 2846037992 Chromobacterium alticapitis MWU14-2602 Isolate Rhizosphere
630 2847797336 Pantoea ananatis NN08200 Isolate Unclassified
631 2852612431 Pseudomonas sp. SJZ073 Isolate Rhizosphere
632 2852657418 Pseudomonas sp. JAI115 Isolate Rhizosphere
633 2852667396 Pseudomonas sp. JAI120 Isolate Rhizosphere
634 2854601825 Dickeya dianthicola SS70 Isolate Stem Tuber
635 2855195626 Pectobacterium atrosepticum SS26 Isolate Stem Tuber
636 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
637 2857553236 Duganella sp. R-74557 Isolate Unclassified
638 2857558681 Duganella sp. R-74565 Isolate Unclassified
639 2857564685 Duganella sp. R-74599 Isolate Unclassified
640 2858466076 Pectobacterium polaris SS28 Isolate Stem Tuber
641 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
642 2860867994 Pseudomonas sp. R1-43-08 Isolate Rhizosphere
643 2865014394 Pantoea sp. R-71966 Isolate Unclassified
644 2869551831 Serratia inhibens PRI-2C Isolate Rhizosphere
645 2871272651 Pectobacterium carotovorum SS96 Isolate Stem Tuber
646 2871282230 Pectobacterium parmentieri SS90 Isolate Stem Tuber
647 2876601092 Pantoea endophytica 596 Isolate Unclassified
648 2878029506 Pseudomonas fluorescens DR397 Isolate Rhizosphere
649 2880230671 Pseudomonas fluorescens LBUM677 Isolate Unclassified
650 2881609920 Pantoea sp. ARC607 Isolate Rhizosphere
651 2883354860 Hypericibacter adhaerens R5959 Isolate Rhizosphere
652 2884086401 Kluyvera sp. PO2S7 Isolate Rhizosphere
653 2884338543 Luteibacter pinisoli MAH-14 Isolate Rhizosphere
654 2884811622 Herbaspirillum sp. 3C11 Isolate Unclassified
655 2884836552 Herbaspirillum sp. 3R-11 Isolate Unclassified
656 2884852848 Herbaspirillum sp. 3R11 Isolate Unclassified
657 2885080285 Janthinobacterium sp. AD80 Isolate Rhizosphere
658 2888366609 Serratia sp. NGAS9 Isolate Rhizosphere
659 2888373701 Serratia rhizosphaerae KUDC3025 Isolate Rhizosphere
660 2891670763 Buttiauxella sp. B2 Isolate Rhizosphere
661 2894510363 Methylomonas sp. Kb3 Isolate Unclassified
662 2896154374 Herbaspirillum sp. 3R-3a1 Isolate Nodule
663 2900051742 Pectobacterium zantedeschiae 2M Isolate Stem Tuber
664 2904424332 Duganella sp. 1411 Isolate Rhizosphere
665 2904439833 Herbaspirillum sp. 1589 Isolate Rhizosphere
666 2904474040 Rahnella aquatilis 4485 Isolate Rhizosphere
667 2904504865 Serratia marcescens 1822 Isolate Unclassified
668 2904518522 Pseudomonas fluorescens 4488 Isolate Rhizosphere
669 2904530477 Herbaspirillum huttiense 611 Isolate Unclassified
670 2904550169 Stutzerimonas stutzeri 1099 Isolate Rhizosphere
671 2904584206 Herbaspirillum sp. 1050 Isolate Unclassified
672 2904589729 Herbaspirillum sp. 1130 Isolate Unclassified
673 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
674 2908446538 Pseudomonas sp. R76 Isolate Rhizosphere
675 2917070673 Pseudomonas protegens CHA0 Isolate Rhizosphere
676 2917832318 Pseudomonas rhizoryzae RY24 Isolate Unclassified
677 2919063839 Pseudomonas pharyngis 1098 Isolate Rhizosphere
678 2919079590 Herbaspirillum sp. 1173 Isolate Unclassified
679 2919125081 Pseudomonas psychrotolerans 1545 Isolate Rhizosphere
680 2919150387 Rahnella aceris 1817 Isolate Unclassified
681 2919155634 Pseudomonas fulva 1992 Isolate Unclassified
682 2919385768 Pseudomonas sp. 2957 Isolate Unclassified
683 2919456309 Pseudomonas sp. 3296 Isolate Rhizosphere
684 2919476304 Duganella sp. 3397 Isolate Unclassified
685 2919487758 Pseudomonas koreensis 3441 Isolate Unclassified
686 2919493220 Aeromonas salmonicida salmonicida 3466 Isolate Unclassified
687 2919497567 Shewanella putrefaciens 3469 Isolate Unclassified
688 2919501602 Pseudomonas alcaliphila 3512 Isolate Unclassified
689 2919543075 Aeromonas salmonicida masoucida 4076 Isolate Unclassified
690 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
691 2923153595 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
692 2923510766 Herbaspirillum rubrisubalbicans SLBN-127 Isolate Rhizosphere
693 2923519811 Pseudomonas otitidis SLBN-103 Isolate Rhizosphere
694 2926063275 Pseudomonas sp. 3400 Isolate Unclassified
695 2927143783 Rahnella sp. 2050 Isolate Unclassified
696 2927833300 Enterobacter sp. SLBN-59 Isolate Rhizosphere
697 2928130867 Herbaspirillum seropedicae 1977 Isolate Unclassified
698 2929189879 Pseudomonas sp. R-71842 Hybrid assembly Isolate Unclassified
699 2931390751 Pseudomonas sp. DR208 Isolate Rhizosphere
700 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
701 2935353572 Pseudomonas protegens TECH19 Isolate Unclassified
702 2937539931 Pantoea sp. LS15 Isolate Unclassified
703 2939568625 Lelliottia sp. 489 Isolate Rhizosphere
704 2939602548 Pantoea dispersa 1175 Isolate Rhizosphere
705 2939607340 Leclercia sp. 1548 Isolate Rhizosphere
706 2939636861 Pseudomonas sp. 2725 Isolate Rhizosphere
707 2939642701 Lelliottia nimipressuralis 2756 Isolate Rhizosphere
708 2941471342 Luteibacter sp. 621 Isolate Unclassified
709 2945874760 Phytobacter diazotrophicus UAEU22 Isolate Rhizosphere
710 2945928738 Pseudomonas cedrina W1I11 Isolate Rhizosphere
711 2945951305 Pantoea agglomerans W2I1 Isolate Rhizosphere
712 2945961074 Pseudomonas sp. W2I6 Isolate Rhizosphere
713 2946006987 Pseudomonas sp. W3I7 Isolate Rhizosphere
714 2946027586 Pseudomonas sp. W4I3 Isolate Rhizosphere
715 2947233263 Pseudomonas synxantha W2I4 Isolate Rhizosphere
716 2969304461 Pseudomonas sp. R84 Isolate Rhizosphere
717 2974289157 Pseudomonas fluorescens SORGH_AS 191 Isolate Unclassified
718 2974310843 Enterobacter sp. SORGH_AS 287 Isolate Unclassified
719 2978975091 Pantoea anthophila SORGH_AS 797 Isolate Unclassified
720 2984286254 Pseudomonas chlororaphis aurantiaca JD37 Isolate Rhizosphere
721 2984494565 Pantoea ananatis SORGH_AS197 Isolate Aerial Root
722 2984499530 Pseudomonas sp. SORGH_AS199 Isolate Aerial Root
723 2984504281 Pseudomonas psychrotolerans SORGH_AS201 Isolate Aerial Root
724 2990261002 Pantoea ananatis SORGH_AS213 Isolate Aerial Root
725 2998139840 Pseudomonas iranensis SWRI54 Isolate Rhizosphere
726 3007252601 Pseudomonas punonensis D1-6 Isolate Unclassified
727 3007315729 Pseudomonas argentinensis SA190 Isolate Unclassified
728 3007395558 Pseudomonas chlororaphis PCL1601 Isolate Rhizosphere
729 3007419365 Pseudomonas vanderleydeniana RW8P3 Isolate Unclassified
730 3007511990 Pseudomonas fluorescens G20-18 Isolate Rhizosphere
731 3007614139 Pseudomonas sp. PB106 Isolate Unclassified
732 3007619802 Pseudomonas sp. PB120 Isolate Unclassified
733 3007718800 Pseudomonas fluorescens BW11P2 Isolate Rhizosphere
734 3007855910 Pseudomonas khorasanensis SWRI153 Isolate Rhizosphere
735 3007861166 Pseudomonas hamedanensis SWRI65 Isolate Rhizosphere
736 637000220 Pseudomonas protegens Pf-5 Isolate Rhizoplane
737 640753048 Serratia proteamaculans 568 Isolate Endosphere
738 8001522603 Methylomicrobium sp. RS1 Isolate Unclassified
739 8015687852 Pseudomonas chlororaphis aurantiaca RP4 Isolate Rhizosphere
740 8016733728 Pantoea sp. SORGH_AS 659 Isolate Unclassified
741 8018221730 Enterobacter sp. CM29 Isolate Unclassified
742 8018405270 Enterobacter sp. 198 Isolate Rhizosphere
743 8019499862 Kluyvera sp. 1366 Isolate Rhizosphere
744 8019769354 Pseudomonas sp. MSSRFD41 Isolate Rhizosphere
745 8029995093 Pseudomonas atacamensis SM1 Isolate Rhizosphere
746 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere
747 8054285046 Pseudomonas petroselini MAFF 311096 Isolate Nodule
748 8054347763 Pseudomonas carnis NWU Be30 Isolate Unclassified
749 8054503363 Pseudomonas sivasensis BsEB-1 Isolate Unclassified
750 8054844752 Dryocola boscaweniae H18W14 Isolate Rhizosphere
751 8054849141 Dryocola clanedunensis H11S18 Isolate Rhizosphere
752 8055087960 Silvania hatchlandensis H19S6 Isolate Rhizosphere
753 8055092621 Silvania confinis H4N4 Isolate Rhizosphere
754 8055097453 Leclercia tamurae H6W5 Isolate Rhizosphere
755 8055770955 Pseudomonas chlororaphis qlu-1 Isolate Rhizosphere
756 8055817908 Pseudomonas pergaminensis 1008 Isolate Rhizosphere
757 8056125926 Pseudomonas azerbaijanorientalis SWRI123 Isolate Rhizosphere
758 8056131705 Pseudomonas asgharzadehiana SWRI132 Isolate Rhizosphere
759 8056148874 Pseudomonas khavaziana SWRI124 Isolate Rhizosphere
760 8056161164 Pseudomonas azadiae SWRI103 Isolate Rhizosphere
761 8056166840 Pseudomonas triticicola SWRI88 Isolate Rhizosphere
762 8056177738 Pseudomonas azerbaijanoccidentalis SWRI74 Isolate Rhizosphere
763 8056569372 Pseudomonas serboccidentalis IT-P374 Isolate Rhizosphere
764 8057304971 Scandinavium manionii H17S15 Isolate Rhizosphere
765 8057798959 Pseudomonas piscis BW16M1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 81.93
Metatranscriptomes 0.05
Isolates 18.01

Biome Distribution

Category Percentage (%)
Aerial Root 0.21
Bulb 0
Endosphere 9.56
Nodule 2.32
Rhizoplane 5.71
Rhizosphere 65.35
Stem 0
Stem Tuber 0.32
Unclassified 0.05

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0055526_1007031 3300003771 Bacteria 5957
2 MRS2a_Contig_66 2124908027 Bacteria 22945
3 SwRhRL2b_contig_111498 2162886007 Bacteria 5326
4 SwRhRL2b_contig_3150169 2162886007 Bacteria 9422
5 SwRhRL2b_contig_677248 2162886007 Bacteria 190393
6 JGI24736J21556_1001491 3300001904 Bacteria 4281
7 JGI25162J39368_1000002 3300002737 Bacteria 663004
8 JGI25162J39368_1000140 3300002737 Bacteria 78251
9 JGI25162J39368_1000181 3300002737 Bacteria 67817
10 JGI25154J39366_1000156 3300002738 Bacteria 52857
11 JGI25154J39366_1000230 3300002738 Bacteria 37506
12 JGI25154J39366_1001243 3300002738 Bacteria 9588
13 JGI25157J39369_1000127 3300002741 Bacteria 65070
14 JGI25157J39369_1000241 3300002741 Bacteria 41722
15 JGI25163J39215_1000166 3300002771 Bacteria 25833
16 JGI25163J39215_1000195 3300002771 Bacteria 23525
17 JGI25163J39215_1000805 3300002771 Bacteria 7547
18 JGI25163J39215_1001748 3300002771 Bacteria 3035
19 JGI25164J39214_1000066 3300002772 Bacteria 106367
20 JGI25164J39214_1000110 3300002772 Bacteria 78251
21 JGI25164J39214_1000146 3300002772 Bacteria 67817
22 JGI25152J39213_1000052 3300002773 Bacteria 77690
23 JGI25150J39212_1000260 3300002774 Bacteria 28066
24 JGI25150J39212_1000643 3300002774 Bacteria 13163
25 JGI25159J45721_1010505 3300002987 Bacteria 2351
26 JGI25165J46597_1000001 3300003214 Bacteria 1111887
27 JGI25165J46597_1000228 3300003214 Bacteria 78251
28 JGI25165J46597_1000267 3300003214 Bacteria 67817
29 JGI25153J46596_10018456 3300003215 Bacteria 2709
30 JGI25153J46596_10020340 3300003215 Bacteria 2512
31 rootH1_10077162 3300003316 Bacteria 4103
32 rootH2_10034969 3300003320 Bacteria 27348
33 rootL2_10018704 3300003322 Bacteria 6623
34 rootH1_10009899 3300003323 Bacteria 26612
35 rootH1_10025721 3300003323 Bacteria 8664
36 JGI25160J50197_1011257 3300003354 Bacteria 3180
37 JGI25161J50226_1000052 3300003374 Bacteria 107273
38 JGI25161J50226_1005753 3300003374 Bacteria 2351
39 Ga0055538_1000001 3300003751 Bacteria 1111887
40 Ga0055538_1000003 3300003751 Bacteria 663004
41 Ga0055538_1000037 3300003751 Bacteria 190238
42 Ga0055538_1000057 3300003751 Bacteria 112934
43 Ga0055539_1000001 3300003752 Bacteria 1111887
44 Ga0055539_1000003 3300003752 Bacteria 663004
45 Ga0055539_1000048 3300003752 Bacteria 190238
46 Ga0055539_1000088 3300003752 Bacteria 112934
47 Ga0055539_1000405 3300003752 Bacteria 16592
48 Ga0055533_1000003 3300003756 Bacteria 1111887
49 Ga0055533_1000005 3300003756 Bacteria 663004
50 Ga0055533_1000024 3300003756 Bacteria 338067
51 Ga0055533_1000059 3300003756 Bacteria 190238
52 Ga0055533_1000096 3300003756 Bacteria 112934
53 Ga0055532_1000015 3300003758 Bacteria 340197
54 Ga0055532_1000105 3300003758 Bacteria 91428
55 Ga0055525_1000005 3300003759 Bacteria 663004
56 Ga0055525_1000057 3300003759 Bacteria 211185
57 Ga0055525_1000087 3300003759 Bacteria 149803
58 Ga0055525_1000128 3300003759 Bacteria 113553
59 Ga0055525_1000129 3300003759 Bacteria 112934
60 Ga0055525_1000778 3300003759 Bacteria 10266
61 Ga0055535_1005791 3300003761 Bacteria 2631
62 Ga0055526_1000066 3300003771 Bacteria 101329
63 Ga0055526_1000100 3300003771 Bacteria 76578
64 Ga0055537_1001797 3300003773 Bacteria 7805
65 Ga0055524_1000383 3300003775 Bacteria 38438
66 Ga0055524_1001387 3300003775 Bacteria 13982
67 Ga0055536_1000392 3300003781 Bacteria 31780
68 Ga0055536_1000624 3300003781 Bacteria 24057
69 Ga0055530_10000050 3300003791 Bacteria 105620
70 Ga0055530_10000333 3300003791 Bacteria 42485
71 Ga0055530_10001393 3300003791 Bacteria 17867
72 Ga0055530_10006688 3300003791 Bacteria 5068
73 Ga0055530_10020690 3300003791 Bacteria 1958
74 Ga0055540_1000279 3300003792 Bacteria 45880
75 Ga0055540_1001037 3300003792 Bacteria 17785
76 Ga0055531_10000321 3300003794 Bacteria 47157
77 Ga0055531_10000334 3300003794 Bacteria 46520
78 Ga0055541_1000001 3300003841 Bacteria 1111887
79 Ga0055541_1000003 3300003841 Bacteria 663004
80 Ga0055541_1000035 3300003841 Bacteria 190238
81 Ga0055541_1000059 3300003841 Bacteria 112934
82 Ga0058692_1000467 3300003856 Bacteria 18185
83 Ga0058692_1000511 3300003856 Bacteria 17175
84 Ga0058692_1000526 3300003856 Bacteria 16625
85 Ga0058692_1000596 3300003856 Bacteria 15201
86 Ga0058692_1005707 3300003856 Bacteria 3516
87 Ga0055543_1000038 3300004625 Bacteria 124032
88 Ga0065165_1000117 3300005262 Bacteria 134716
89 Ga0065714_10002942 3300005288 Bacteria 12490
90 Ga0065714_10066785 3300005288 Bacteria 6305
91 Ga0065714_10118969 3300005288 Bacteria 1366
92 Ga0065704_10000264 3300005289 Bacteria 45979
93 Ga0065704_10005832 3300005289 Bacteria 4106
94 Ga0065704_10070138 3300005289 Bacteria 546071
95 Ga0065704_10070840 3300005289 Bacteria 15542
96 Ga0065704_10117084 3300005289 Bacteria 1836
97 Ga0065712_10002256 3300005290 Bacteria 8682
98 Ga0065707_10004433 3300005295 Bacteria 4276
99 Ga0070658_10051357 3300005327 Bacteria 3342
100 Ga0070690_100009303 3300005330 Bacteria 5689
101 Ga0070670_100002353 3300005331 Bacteria 15579
102 Ga0068869_100004475 3300005334 Bacteria 8689
103 Ga0068869_100259175 3300005334 Bacteria 1392
104 Ga0070666_10129865 3300005335 Bacteria 1750
105 Ga0070660_100061895 3300005339 Bacteria 2906
106 Ga0070661_100000078 3300005344 Bacteria 77449
107 Ga0070669_100000221 3300005353 Bacteria 47408
108 Ga0070669_100001965 3300005353 Bacteria 14852
109 Ga0070673_100002270 3300005364 Bacteria 11654
110 Ga0070673_100206336 3300005364 Bacteria 1695
111 Ga0070688_100140697 3300005365 Bacteria 1639
112 Ga0070659_100009757 3300005366 Bacteria 7057
113 Ga0070659_100022514 3300005366 Bacteria 4812
114 Ga0070714_100002975 3300005435 Bacteria 12559
115 Ga0070711_100039163 3300005439 Bacteria 3191
116 Ga0070705_100051014 3300005440 Bacteria 2410
117 Ga0070708_100046554 3300005445 Bacteria 3827
118 Ga0070662_100000095 3300005457 Bacteria 48526
119 Ga0070706_100206242 3300005467 Bacteria 1836
120 Ga0070707_100068328 3300005468 Bacteria 3420
121 Ga0068853_100000089 3300005539 Bacteria 62291
122 Ga0068853_100135139 3300005539 Bacteria 2210
123 Ga0070696_100059361 3300005546 Bacteria 2673
124 Ga0070665_100000117 3300005548 Bacteria 149831
125 Ga0070665_100302846 3300005548 Bacteria 1601
126 Ga0068855_100002195 3300005563 Bacteria 24130
127 Ga0068855_100066169 3300005563 Bacteria 4213
128 Ga0070664_100000391 3300005564 Bacteria 32645
129 Ga0070664_100014872 3300005564 Bacteria 6350
130 Ga0070664_100119058 3300005564 Bacteria 2310
131 Ga0068857_100000006 3300005577 Bacteria 168660
132 Ga0068857_100001885 3300005577 Bacteria 16897
133 Ga0068857_100369670 3300005577 Bacteria 1330
134 Ga0068854_100005598 3300005578 Bacteria 7938
135 Ga0068856_100005894 3300005614 Bacteria 12076
136 Ga0068861_100005127 3300005719 Bacteria 8834
137 Ga0068851_10000024 3300005834 Bacteria 125917
138 Ga0068851_10001161 3300005834 Bacteria 11427
139 Ga0068863_100104359 3300005841 Bacteria 2696
140 Ga0068860_100032190 3300005843 Bacteria 5040
141 Ga0068860_100225729 3300005843 Bacteria 1819
142 Ga0068862_100142116 3300005844 Bacteria 2131
143 Ga0081455_10000094 3300005937 Bacteria 96637
144 Ga0081538_10002691 3300005981 Bacteria 17084
145 Ga0075364_10000923 3300006051 Bacteria 15523
146 Ga0075364_10008290 3300006051 Bacteria 6207
147 Ga0075364_10044409 3300006051 Bacteria 2890
148 Ga0075364_10074101 3300006051 Bacteria 2244
149 Ga0075432_10033245 3300006058 Bacteria 1788
150 Ga0070712_100074217 3300006175 Bacteria 2443
151 Ga0097621_100023910 3300006237 Bacteria 4763
152 Ga0068871_100012427 3300006358 Bacteria 6275
153 Ga0075431_100041519 3300006847 Bacteria 4742
154 Ga0075431_100110820 3300006847 Bacteria 2832
155 Ga0075431_100269780 3300006847 Bacteria 1725
156 Ga0075433_10002631 3300006852 Bacteria 13709
157 Ga0075433_10025385 3300006852 Bacteria 5009
158 Ga0075434_100025667 3300006871 Bacteria 5766
159 Ga0075434_100069988 3300006871 Bacteria 3499
160 Ga0075429_100095061 3300006880 Bacteria 2599
161 Ga0079104_1000078 3300006946 Bacteria 141909
162 Ga0079104_1000130 3300006946 Bacteria 107410
163 Ga0079104_1000296 3300006946 Bacteria 63123
164 Ga0079104_1000398 3300006946 Bacteria 50358
165 Ga0079104_1000527 3300006946 Bacteria 40639
166 Ga0079104_1000564 3300006946 Bacteria 37815
167 Ga0079104_1001042 3300006946 Bacteria 21182
168 Ga0079104_1001578 3300006946 Bacteria 14902
169 Ga0079104_1001940 3300006946 Bacteria 12304
170 Ga0079104_1019295 3300006946 Bacteria 1909
171 Ga0075435_100003659 3300007076 Bacteria 10469
172 Ga0075435_100065755 3300007076 Bacteria 2948
173 Ga0075435_100098519 3300007076 Bacteria 2420
174 Ga0105251_10000113 3300009011 Bacteria 80570
175 Ga0105251_10000361 3300009011 Bacteria 44718
176 Ga0105251_10000488 3300009011 Bacteria 37538
177 Ga0105251_10001520 3300009011 Bacteria 19928
178 Ga0105251_10001591 3300009011 Bacteria 19391
179 Ga0105251_10002600 3300009011 Bacteria 13964
180 Ga0105251_10003514 3300009011 Bacteria 11319
181 Ga0105251_10003914 3300009011 Bacteria 10579
182 Ga0105251_10006822 3300009011 Bacteria 7185
183 Ga0105251_10016397 3300009011 Bacteria 4004
184 Ga0105251_10047549 3300009011 Bacteria 2061
185 Ga0105251_10057511 3300009011 Bacteria 1837
186 Ga0105244_10000021 3300009036 Bacteria 238820
187 Ga0105244_10000034 3300009036 Bacteria 168462
188 Ga0105244_10000557 3300009036 Bacteria 33275
189 Ga0105244_10000982 3300009036 Bacteria 23922
190 Ga0105244_10002091 3300009036 Bacteria 15355
191 Ga0105244_10002327 3300009036 Bacteria 14438
192 Ga0105244_10002351 3300009036 Bacteria 14360
193 Ga0105244_10003420 3300009036 Bacteria 11312
194 Ga0105244_10003749 3300009036 Bacteria 10736
195 Ga0105244_10003972 3300009036 Bacteria 10370
196 Ga0105244_10004754 3300009036 Bacteria 9248
197 Ga0105244_10010109 3300009036 Bacteria 5745
198 Ga0105244_10011859 3300009036 Bacteria 5194
199 Ga0105244_10037378 3300009036 Bacteria 2539
200 Ga0105244_10044227 3300009036 Bacteria 2295
201 Ga0105244_10073766 3300009036 Bacteria 1698
202 Ga0105250_10000004 3300009092 Bacteria 438653
203 Ga0105250_10000189 3300009092 Bacteria 52791
204 Ga0105250_10000211 3300009092 Bacteria 48658
205 Ga0105250_10000447 3300009092 Bacteria 29734
206 Ga0105250_10001416 3300009092 Bacteria 12955
207 Ga0105250_10001514 3300009092 Bacteria 12544
208 Ga0105250_10004436 3300009092 Bacteria 6462
209 Ga0105250_10005745 3300009092 Bacteria 5526
210 Ga0105250_10009521 3300009092 Bacteria 4087
211 Ga0105240_10004079 3300009093 Bacteria 22469
212 Ga0105240_10046807 3300009093 Bacteria 5477
213 Ga0105240_10047323 3300009093 Bacteria 5443
214 Ga0105240_10122372 3300009093 Bacteria 3131
215 Ga0111539_10050989 3300009094 Bacteria 4930
216 Ga0111539_10452857 3300009094 Bacteria 1494
217 Ga0105245_10162449 3300009098 Bacteria 2121
218 Ga0114129_10002450 3300009147 Bacteria 25774
219 Ga0114129_10011473 3300009147 Bacteria 12618
220 Ga0114129_10044965 3300009147 Bacteria 6210
221 Ga0114129_10062432 3300009147 Bacteria 5205
222 Ga0114129_10075748 3300009147 Unclassified 4685
223 Ga0105243_10000595 3300009148 Bacteria 36195
224 Ga0105243_10000918 3300009148 Bacteria 27604
225 Ga0105243_10013794 3300009148 Bacteria 6115
226 Ga0105243_10039308 3300009148 Bacteria 3687
227 Ga0105243_10061309 3300009148 Bacteria 3008
228 Ga0105243_10111717 3300009148 Bacteria 2288
229 Ga0105241_10000004 3300009174 Bacteria 803007
230 Ga0105241_10002206 3300009174 Bacteria 14650
231 Ga0105242_10000136 3300009176 Bacteria 53348
232 Ga0105242_10012557 3300009176 Bacteria 6522
233 Ga0105248_10012631 3300009177 Bacteria 9319
234 Ga0105248_10034319 3300009177 Bacteria 5671
235 Ga0105248_10165972 3300009177 Bacteria 2489
236 Ga0105237_10000939 3300009545 Bacteria 39181
237 Ga0105237_10013428 3300009545 Bacteria 8589
238 Ga0105237_10029202 3300009545 Bacteria 5609
239 Ga0105238_10000006 3300009551 Bacteria 346249
240 Ga0105238_10021866 3300009551 Bacteria 6515
241 Ga0105239_10030781 3300010375 Bacteria 5903
242 Ga0105239_10325231 3300010375 Bacteria 1734
243 Ga0105239_10426401 3300010375 Bacteria 1503
244 Ga0105246_10000042 3300011119 Bacteria 48091
245 Ga0105246_10003799 3300011119 Bacteria 9151
246 Ga0105246_10010036 3300011119 Bacteria 5843
247 Ga0105246_10179365 3300011119 Bacteria 1629
248 Ga0157373_10001463 3300013100 Bacteria 18045
249 Ga0157373_10002210 3300013100 Bacteria 14730
250 Ga0157373_10021939 3300013100 Bacteria 4633
251 Ga0157373_10030530 3300013100 Bacteria 3879
252 Ga0157373_10067906 3300013100 Bacteria 2521
253 Ga0157371_10000811 3300013102 Bacteria 35895
254 Ga0157371_10001070 3300013102 Bacteria 29890
255 Ga0157371_10001080 3300013102 Bacteria 29511
256 Ga0157371_10002984 3300013102 Bacteria 15714
257 Ga0157371_10005453 3300013102 Bacteria 10723
258 Ga0157371_10005644 3300013102 Bacteria 10505
259 Ga0157371_10025390 3300013102 Bacteria 4318
260 Ga0157371_10025844 3300013102 Bacteria 4273
261 Ga0157371_10096412 3300013102 Bacteria 2096
262 Ga0157370_10000150 3300013104 Bacteria 85732
263 Ga0157370_10000655 3300013104 Bacteria 43089
264 Ga0157370_10001869 3300013104 Bacteria 25963
265 Ga0157370_10002081 3300013104 Bacteria 24497
266 Ga0157370_10003150 3300013104 Bacteria 19544
267 Ga0157370_10024113 3300013104 Bacteria 6031
268 Ga0157370_10034674 3300013104 Bacteria 4910
269 Ga0157370_10047672 3300013104 Bacteria 4107
270 Ga0157370_10074019 3300013104 Bacteria 3213
271 Ga0157369_10000080 3300013105 Bacteria 133011
272 Ga0157369_10001555 3300013105 Bacteria 28080
273 Ga0157369_10010831 3300013105 Bacteria 10386
274 Ga0157369_10022077 3300013105 Bacteria 7112
275 Ga0157369_10027225 3300013105 Bacteria 6339
276 Ga0157369_10027876 3300013105 Bacteria 6257
277 Ga0157369_10059033 3300013105 Bacteria 4138
278 Ga0157378_10004257 3300013297 Bacteria 12614
279 Ga0163162_10000737 3300013306 Bacteria 30385
280 Ga0163162_10028226 3300013306 Bacteria 5551
281 Ga0163162_10111392 3300013306 Bacteria 2834
282 Ga0163162_10120879 3300013306 Bacteria 2723
283 Ga0163162_10313256 3300013306 Bacteria 1702
284 Ga0157372_10001529 3300013307 Bacteria 25153
285 Ga0157372_10005514 3300013307 Bacteria 13454
286 Ga0157372_10009617 3300013307 Bacteria 10275
287 Ga0157372_10038144 3300013307 Bacteria 5302
288 Ga0157375_10001875 3300013308 Bacteria 18102
289 Ga0157375_10172300 3300013308 Bacteria 2312
290 Ga0157375_10259389 3300013308 Bacteria 1900
291 Ga0182008_10000203 3300014497 Bacteria 46755
292 Ga0182008_10001562 3300014497 Bacteria 15234
293 Ga0182008_10002570 3300014497 Bacteria 11290
294 Ga0182008_10003277 3300014497 Bacteria 9848
295 Ga0182008_10009036 3300014497 Bacteria 5397
296 Ga0182008_10048080 3300014497 Bacteria 2119
297 Ga0182008_10061975 3300014497 Bacteria 1844
298 Ga0157379_10000183 3300014968 Bacteria 47695
299 Ga0157376_10026443 3300014969 Bacteria 4587
300 Ga0182006_1000002 3300015261 Bacteria 887990
301 Ga0182006_1000009 3300015261 Bacteria 438243
302 Ga0182006_1000021 3300015261 Bacteria 280808
303 Ga0182006_1000380 3300015261 Bacteria 36760
304 Ga0182006_1001000 3300015261 Bacteria 18502
305 Ga0182006_1004320 3300015261 Bacteria 7033
306 Ga0182006_1004510 3300015261 Bacteria 6855
307 Ga0182006_1006485 3300015261 Bacteria 5436
308 Ga0182006_1008456 3300015261 Bacteria 4662
309 Ga0182006_1008677 3300015261 Bacteria 4600
310 Ga0182006_1011832 3300015261 Bacteria 3825
311 Ga0182006_1022085 3300015261 Bacteria 2648
312 Ga0182006_1030459 3300015261 Bacteria 2181
313 Ga0182005_1000013 3300015265 Bacteria 396391
314 Ga0182005_1000070 3300015265 Bacteria 85687
315 Ga0182005_1000227 3300015265 Bacteria 37208
316 Ga0182005_1004756 3300015265 Bacteria 4331
317 Ga0182005_1012826 3300015265 Bacteria 2362
318 Ga0182005_1014570 3300015265 Bacteria 2199
319 Ga0163161_10000107 3300017792 Bacteria 78998
320 Ga0163161_10000719 3300017792 Bacteria 26142
321 Ga0163161_10005392 3300017792 Bacteria 8885
322 Ga0163161_10018069 3300017792 Bacteria 4943
323 Ga0163161_10026492 3300017792 Bacteria 4106
324 Ga0163161_10040439 3300017792 Bacteria 3349
325 Ga0163161_10096785 3300017792 Bacteria 2191
326 Ga0213872_10000840 3300021361 Bacteria 22228
327 Ga0213876_10000660 3300021384 Bacteria 24722
328 Ga0213876_10013285 3300021384 Bacteria 4376
329 Ga0209435_100021 3300025206 Bacteria 223961
330 Ga0209435_100318 3300025206 Bacteria 11585
331 Ga0209760_100005 3300025207 Bacteria 238315
332 Ga0209760_100037 3300025207 Bacteria 129761
333 Ga0209760_100128 3300025207 Bacteria 50562
334 Ga0209436_100063 3300025208 Bacteria 56237
335 Ga0209436_100337 3300025208 Bacteria 21289
336 Ga0209784_100001 3300025224 Bacteria 3600592
337 Ga0209784_100004 3300025224 Bacteria 1378156
338 Ga0209784_100009 3300025224 Bacteria 688031
339 Ga0209784_100028 3300025224 Bacteria 357464
340 Ga0209566_100001 3300025225 Bacteria 3600765
341 Ga0209566_100004 3300025225 Bacteria 1531866
342 Ga0209566_100007 3300025225 Bacteria 688031
343 Ga0209566_100028 3300025225 Bacteria 357464
344 Ga0209674_100002 3300025226 Bacteria 3600592
345 Ga0209674_100006 3300025226 Bacteria 1531866
346 Ga0209674_100007 3300025226 Bacteria 1077082
347 Ga0209674_100018 3300025226 Bacteria 688031
348 Ga0209674_100047 3300025226 Bacteria 357464
349 Ga0209672_104838 3300025228 Bacteria 2423
350 Ga0209147_100004 3300025229 Bacteria 1371850
351 Ga0209147_100031 3300025229 Bacteria 357464
352 Ga0209563_100002 3300025230 Bacteria 2045675
353 Ga0209563_100009 3300025230 Bacteria 1378156
354 Ga0209563_100014 3300025230 Bacteria 940582
355 Ga0209563_100020 3300025230 Bacteria 688031
356 Ga0209563_100050 3300025230 Bacteria 357464
357 Ga0209563_100052 3300025230 Bacteria 334307
358 Ga0209563_102415 3300025230 Bacteria 4237
359 Ga0207427_100009 3300025231 Bacteria 663036
360 Ga0207427_100014 3300025231 Bacteria 561361
361 Ga0207427_100016 3300025231 Bacteria 538697
362 Ga0207427_100851 3300025231 Bacteria 13601
363 Ga0209437_100001 3300025233 Bacteria 2045675
364 Ga0209437_100004 3300025233 Bacteria 1378156
365 Ga0209437_100011 3300025233 Bacteria 818520
366 Ga0209437_100016 3300025233 Bacteria 710118
367 Ga0209437_100035 3300025233 Bacteria 481110
368 Ga0209437_100045 3300025233 Bacteria 429809
369 Ga0209437_103337 3300025233 Bacteria 2921
370 Ga0209437_104234 3300025233 Bacteria 2544
371 Ga0209258_100083 3300025242 Bacteria 246008
372 Ga0209258_100150 3300025242 Bacteria 161813
373 Ga0209258_100534 3300025242 Bacteria 36052
374 Ga0207425_1000001 3300025245 Bacteria 2525432
375 Ga0207425_1000048 3300025245 Bacteria 188748
376 Ga0207425_1000484 3300025245 Bacteria 25043
377 Ga0209646_1000010 3300025246 Bacteria 573803
378 Ga0209646_1000020 3300025246 Bacteria 462204
379 Ga0209646_1000074 3300025246 Bacteria 223961
380 Ga0209646_1000094 3300025246 Bacteria 182874
381 Ga0209646_1000183 3300025246 Bacteria 79021
382 Ga0209026_1000009 3300025250 Bacteria 531812
383 Ga0209026_1000058 3300025250 Bacteria 228656
384 Ga0209677_100002 3300025253 Bacteria 2045675
385 Ga0209677_100005 3300025253 Bacteria 1378156
386 Ga0209677_100010 3300025253 Bacteria 688031
387 Ga0209677_100015 3300025253 Bacteria 532137
388 Ga0209677_100029 3300025253 Bacteria 357464
389 Ga0209677_100097 3300025253 Bacteria 97418
390 Ga0209677_101137 3300025253 Bacteria 12430
391 Ga0209759_1000046 3300025256 Bacteria 230149
392 Ga0209759_1000065 3300025256 Bacteria 187612
393 Ga0209759_1000073 3300025256 Bacteria 178048
394 Ga0209129_1000001 3300025258 Bacteria 1452436
395 Ga0209129_1002226 3300025258 Bacteria 9712
396 Ga0209233_1000005 3300025261 Bacteria 1531866
397 Ga0209233_1000019 3300025261 Bacteria 818520
398 Ga0209233_1000036 3300025261 Bacteria 561361
399 Ga0209233_1000634 3300025261 Bacteria 17526
400 Ga0209565_1003393 3300025263 Bacteria 5181
401 Ga0209565_1003550 3300025263 Bacteria 4995
402 Ga0209565_1004335 3300025263 Bacteria 4350
403 Ga0209565_1008440 3300025263 Bacteria 2692
404 Ga0209455_1001956 3300025272 Bacteria 8493
405 Ga0209130_1000059 3300025284 Bacteria 204772
406 Ga0209130_1003699 3300025284 Bacteria 6297
407 Ga0209130_1009134 3300025284 Bacteria 2856
408 Ga0209675_1004660 3300025291 Bacteria 6025
409 Ga0209676_1000025 3300025292 Bacteria 577569
410 Ga0209676_1000026 3300025292 Bacteria 574599
411 Ga0209676_1000032 3300025292 Bacteria 469558
412 Ga0209676_1000318 3300025292 Bacteria 94045
413 Ga0209676_1009868 3300025292 Bacteria 4056
414 Ga0209025_1002077 3300025294 Bacteria 22739
415 Ga0209564_1000009 3300025295 Bacteria 950196
416 Ga0209564_1000045 3300025295 Bacteria 376549
417 Ga0209564_1000219 3300025295 Bacteria 129725
418 Ga0209564_1004579 3300025295 Bacteria 8371
419 Ga0209758_1000166 3300025297 Bacteria 151104
420 Ga0209758_1000489 3300025297 Bacteria 64758
421 Ga0209050_1000025 3300025298 Bacteria 528225
422 Ga0209050_1000058 3300025298 Bacteria 325558
423 Ga0209050_1000331 3300025298 Bacteria 94245
424 Ga0209050_1000398 3300025298 Bacteria 81373
425 Ga0209050_1000520 3300025298 Bacteria 64262
426 Ga0209050_1001196 3300025298 Bacteria 30513
427 Ga0209050_1003847 3300025298 Bacteria 10695
428 Ga0209256_1000350 3300025299 Bacteria 74944
429 Ga0209256_1001089 3300025299 Bacteria 31291
430 Ga0207426_1001606 3300025302 Bacteria 17990
431 Ga0209051_1000026 3300025303 Bacteria 413311
432 Ga0209051_1000299 3300025303 Bacteria 78310
433 Ga0209051_1009700 3300025303 Bacteria 4936
434 Ga0209051_1012533 3300025303 Bacteria 4096
435 Ga0209051_1016351 3300025303 Bacteria 3364
436 Ga0209257_1000003 3300025304 Bacteria 1702593
437 Ga0209257_1000034 3300025304 Bacteria 662719
438 Ga0209257_1001074 3300025304 Bacteria 35989
439 Ga0207697_10015082 3300025315 Bacteria 3197
440 Ga0207696_1000020 3300025711 Bacteria 434998
441 Ga0207696_1000033 3300025711 Bacteria 360689
442 Ga0207696_1000040 3300025711 Bacteria 318695
443 Ga0207696_1000057 3300025711 Bacteria 249404
444 Ga0207696_1000070 3300025711 Bacteria 227242
445 Ga0207696_1000084 3300025711 Bacteria 196086
446 Ga0207696_1000114 3300025711 Bacteria 151422
447 Ga0207696_1000482 3300025711 Bacteria 33749
448 Ga0207696_1000553 3300025711 Bacteria 29996
449 Ga0207696_1000679 3300025711 Bacteria 23720
450 Ga0207696_1000885 3300025711 Bacteria 18669
451 Ga0207696_1002459 3300025711 Bacteria 9058
452 Ga0207696_1002728 3300025711 Bacteria 8414
453 Ga0207696_1017321 3300025711 Bacteria 2389
454 Ga0207655_1000014 3300025728 Bacteria 607124
455 Ga0207655_1000040 3300025728 Bacteria 335311
456 Ga0207655_1000043 3300025728 Bacteria 332919
457 Ga0207655_1000046 3300025728 Bacteria 309474
458 Ga0207655_1000082 3300025728 Bacteria 213760
459 Ga0207655_1000326 3300025728 Bacteria 70089
460 Ga0207655_1000405 3300025728 Bacteria 59516
461 Ga0207655_1000683 3300025728 Bacteria 39498
462 Ga0207655_1000935 3300025728 Bacteria 30300
463 Ga0207655_1002391 3300025728 Bacteria 15301
464 Ga0207655_1002944 3300025728 Bacteria 13087
465 Ga0207655_1003197 3300025728 Bacteria 12327
466 Ga0207655_1005952 3300025728 Bacteria 8170
467 Ga0207655_1006383 3300025728 Bacteria 7827
468 Ga0207655_1013293 3300025728 Bacteria 4738
469 Ga0207655_1013387 3300025728 Bacteria 4714
470 Ga0207655_1013571 3300025728 Bacteria 4666
471 Ga0207655_1022358 3300025728 Bacteria 3173
472 Ga0207655_1022931 3300025728 Bacteria 3111
473 Ga0207655_1045584 3300025728 Bacteria 1829
474 Ga0207713_1000001 3300025735 Bacteria 2295391
475 Ga0207713_1000017 3300025735 Bacteria 394495
476 Ga0207713_1000031 3300025735 Bacteria 283971
477 Ga0207713_1000065 3300025735 Bacteria 196128
478 Ga0207713_1000114 3300025735 Bacteria 132170
479 Ga0207713_1000331 3300025735 Bacteria 53100
480 Ga0207713_1000434 3300025735 Bacteria 44039
481 Ga0207713_1000632 3300025735 Bacteria 34264
482 Ga0207713_1001357 3300025735 Bacteria 19946
483 Ga0207713_1001639 3300025735 Bacteria 17443
484 Ga0207713_1002107 3300025735 Bacteria 14839
485 Ga0207713_1019084 3300025735 Bacteria 3369
486 Ga0207713_1019183 3300025735 Bacteria 3357
487 Ga0207713_1021830 3300025735 Bacteria 3059
488 Ga0207692_10100118 3300025898 Bacteria 1589
489 Ga0207710_10000016 3300025900 Bacteria 388568
490 Ga0207647_10000342 3300025904 Bacteria 37701
491 Ga0207705_10144152 3300025909 Bacteria 1781
492 Ga0207684_10117411 3300025910 Bacteria 2280
493 Ga0207654_10000006 3300025911 Bacteria 815027
494 Ga0207654_10011436 3300025911 Bacteria 4529
495 Ga0207695_10002480 3300025913 Bacteria 27184
496 Ga0207695_10003589 3300025913 Bacteria 21707
497 Ga0207695_10006850 3300025913 Bacteria 14669
498 Ga0207695_10074976 3300025913 Bacteria 3443
499 Ga0207671_10000015 3300025914 Bacteria 439607
500 Ga0207671_10016677 3300025914 Bacteria 5701
501 Ga0207663_10044006 3300025916 Bacteria 2738
502 Ga0207657_10007271 3300025919 Bacteria 11373
503 Ga0207657_10103833 3300025919 Bacteria 2356
504 Ga0207649_10000001 3300025920 Bacteria 537851
505 Ga0207649_10002460 3300025920 Bacteria 10368
506 Ga0207681_10000236 3300025923 Bacteria 42706
507 Ga0207681_10047262 3300025923 Bacteria 2898
508 Ga0207694_10000315 3300025924 Bacteria 45522
509 Ga0207694_10246888 3300025924 Bacteria 1460
510 Ga0207650_10000273 3300025925 Bacteria 54321
511 Ga0207650_10000449 3300025925 Bacteria 35040
512 Ga0207659_10048719 3300025926 Bacteria 3003
513 Ga0207664_10005354 3300025929 Bacteria 8765
514 Ga0207690_10004543 3300025932 Bacteria 8195
515 Ga0207690_10005500 3300025932 Bacteria 7473
516 Ga0207690_10014280 3300025932 Bacteria 4795
517 Ga0207706_10000069 3300025933 Bacteria 105541
518 Ga0207706_10000936 3300025933 Bacteria 29850
519 Ga0207686_10006292 3300025934 Bacteria 6386
520 Ga0207709_10000022 3300025935 Bacteria 383573
521 Ga0207709_10000164 3300025935 Bacteria 91154
522 Ga0207709_10000484 3300025935 Bacteria 36264
523 Ga0207709_10000505 3300025935 Bacteria 34640
524 Ga0207709_10027046 3300025935 Bacteria 3300
525 Ga0207709_10038884 3300025935 Bacteria 2837
526 Ga0207709_10068927 3300025935 Bacteria 2237
527 Ga0207709_10155160 3300025935 Bacteria 1590
528 Ga0207691_10118786 3300025940 Bacteria 2345
529 Ga0207711_10021445 3300025941 Bacteria 5397
530 Ga0207711_10107701 3300025941 Bacteria 2475
531 Ga0207679_10000011 3300025945 Bacteria 346112
532 Ga0207679_10001201 3300025945 Bacteria 16463
533 Ga0207679_10044762 3300025945 Bacteria 3196
534 Ga0207679_10116154 3300025945 Bacteria 2121
535 Ga0207667_10000120 3300025949 Bacteria 123800
536 Ga0207667_10004008 3300025949 Bacteria 18098
537 Ga0207667_10015507 3300025949 Bacteria 8648
538 Ga0207651_10001180 3300025960 Bacteria 11721
539 Ga0207640_10012068 3300025981 Bacteria 4912
540 Ga0207640_10045798 3300025981 Bacteria 2811
541 Ga0207639_10001824 3300026041 Bacteria 14346
542 Ga0207678_10166436 3300026067 Bacteria 1882
543 Ga0207708_10124510 3300026075 Bacteria 2011
544 Ga0207702_10000610 3300026078 Bacteria 39489
545 Ga0207674_10000018 3300026116 Bacteria 167809
546 Ga0207674_10012892 3300026116 Bacteria 9328
547 Ga0207674_10173445 3300026116 Bacteria 2109
548 Ga0207675_100005379 3300026118 Bacteria 12284
549 Ga0207683_10137991 3300026121 Bacteria 2196
550 Ga0209281_1000008 3300027111 Bacteria 867470
551 Ga0209281_1000026 3300027111 Bacteria 465877
552 Ga0209281_1000031 3300027111 Bacteria 422772
553 Ga0209281_1000112 3300027111 Bacteria 213847
554 Ga0209281_1000162 3300027111 Bacteria 159535
555 Ga0209281_1000233 3300027111 Bacteria 117525
556 Ga0209281_1000248 3300027111 Bacteria 107418
557 Ga0209281_1000618 3300027111 Bacteria 39906
558 Ga0209281_1000832 3300027111 Bacteria 27672
559 Ga0209281_1000833 3300027111 Bacteria 27672
560 Ga0209281_1003539 3300027111 Bacteria 5102
561 Ga0209281_1004394 3300027111 Bacteria 4232
562 Ga0209281_1008543 3300027111 Bacteria 2477
563 Ga0209281_1012097 3300027111 Bacteria 1907
564 Ga0209371_1000027 3300027312 Bacteria 448853
565 Ga0209371_1000032 3300027312 Bacteria 392355
566 Ga0209371_1000092 3300027312 Bacteria 171648
567 Ga0209371_1000167 3300027312 Bacteria 98922
568 Ga0209371_1000266 3300027312 Bacteria 61272
569 Ga0209371_1000388 3300027312 Bacteria 46275
570 Ga0209371_1001638 3300027312 Bacteria 14415
571 Ga0209371_1017903 3300027312 Bacteria 1819
572 Ga0210002_1007854 3300027617 Bacteria 1620
573 Ga0209983_1000145 3300027665 Bacteria 13043
574 Ga0209974_10022065 3300027876 Bacteria 2108
575 Ga0207428_10036325 3300027907 Bacteria 4019
576 Ga0207428_10172221 3300027907 Bacteria 1639
577 Ga0268266_10000079 3300028379 Bacteria 213545
578 Ga0268266_10013364 3300028379 Bacteria 7073
579 Ga0268266_10065771 3300028379 Bacteria 3134
580 Ga0268266_10214035 3300028379 Bacteria 1768
581 Ga0268266_10240601 3300028379 Bacteria 1670
582 Ga0268265_10251337 3300028380 Bacteria 1566
583 Ga0268264_10100046 3300028381 Bacteria 2518
584 Ga0265334_10000500 3300028573 Bacteria 20148
585 Ga0265334_10005163 3300028573 Bacteria 5722
586 Ga0265334_10036366 3300028573 Bacteria 1945
587 Ga0265336_10000061 3300028666 Bacteria 102829
588 Ga0307517_10023043 3300028786 Bacteria 7766
589 Ga0265338_10003945 3300028800 Bacteria 20449
590 Ga0265324_10001696 3300029957 Bacteria 12114
591 Ga0268256_1000045 3300030500 Bacteria 330053
592 Ga0268256_1000050 3300030500 Bacteria 300675
593 Ga0268256_1000082 3300030500 Bacteria 171648
594 Ga0268256_1000124 3300030500 Bacteria 111181
595 Ga0268256_1000269 3300030500 Bacteria 54055
596 Ga0268256_1000750 3300030500 Bacteria 23747
597 Ga0268256_1001428 3300030500 Bacteria 14415
598 Ga0268256_1019975 3300030500 Bacteria 1819
599 Ga0307511_10002002 3300030521 Bacteria 21396
600 Ga0307511_10094074 3300030521 Bacteria 2011
601 Ga0316178_1026759 3300030735 Bacteria 13206
602 Ga0316181_1059262 3300030744 Bacteria 4477
603 Ga0265328_10003176 3300031239 Bacteria 7295
604 Ga0265327_10001649 3300031251 Bacteria 26951
605 Ga0307513_10002356 3300031456 Bacteria 26271
606 Ga0307513_10021955 3300031456 Bacteria 7521
607 Ga0307513_10109937 3300031456 Bacteria 2752
608 Ga0307509_10130334 3300031507 Bacteria 2471
609 Ga0307408_100000024 3300031548 Bacteria 279725
610 Ga0307408_100000181 3300031548 Bacteria 69832
611 Ga0307408_100000299 3300031548 Bacteria 47931
612 Ga0307408_100000786 3300031548 Bacteria 25524
613 Ga0307408_100024220 3300031548 Bacteria 4142
614 Ga0307408_100060212 3300031548 Bacteria 2767
615 Ga0307408_100063817 3300031548 Bacteria 2696
616 Ga0307514_10000643 3300031649 Bacteria 63638
617 Ga0316575_10000758 3300031665 Bacteria 9722
618 Ga0316576_10009330 3300031727 Bacteria 6323
619 Ga0316576_10011679 3300031727 Bacteria 5767
620 Ga0316578_10038352 3300031728 Bacteria 2763
621 Ga0316578_10064426 3300031728 Bacteria 2163
622 Ga0307516_10003778 3300031730 Bacteria 19239
623 Ga0307413_10063185 3300031824 Bacteria 2294
624 Ga0307410_10023799 3300031852 Bacteria 3816
625 Ga0307406_10000113 3300031901 Bacteria 46753
626 Ga0307412_10039050 3300031911 Bacteria 3062
627 Ga0307412_10121731 3300031911 Bacteria 1879
628 Ga0307409_100008148 3300031995 Bacteria 6332
629 Ga0307409_100065517 3300031995 Bacteria 2859
630 Ga0307409_100193004 3300031995 Bacteria 1815
631 Ga0307416_100001332 3300032002 Bacteria 13308
632 Ga0307416_100115749 3300032002 Bacteria 2375
633 Ga0307416_100125903 3300032002 Bacteria 2295
634 Ga0307411_10015387 3300032005 Bacteria 4295
635 Ga0307411_10018213 3300032005 Bacteria 4023
636 Ga0307411_10023151 3300032005 Bacteria 3673
637 Ga0307510_10001604 3300033180 Bacteria 25008
638 Ga0373943_0066733 3300035170 Bacteria 1813
639 Ga0316574_0000934 3300035398 Bacteria 13033
640 Ga0373935_0069580 3300035692 Bacteria 2267
641 Ga0373937_0023046 3300036401 Bacteria 5602
642 Ga0316584_0059505 3300036712 Bacteria 2861
643 Ga0316584_0207081 3300036712 Bacteria 1445
644 Ga0373925_0062659 3300037068 Bacteria 2797
645 Ga0395899_0004137 3300037312 Bacteria 11407
646 Ga0395899_0014968 3300037312 Bacteria 5916
647 Ga0395899_0067437 3300037312 Bacteria 2625
648 Ga0395900_0013133 3300037418 Bacteria 8463
649 Ga0395900_0092907 3300037418 Bacteria 3100
650 Ga0395900_0130360 3300037418 Bacteria 2577
651 Ga0395900_0168005 3300037418 Bacteria 2234
652 Ga0395898_0043252 3300037466 Bacteria 4439
653 Ga0395898_0140996 3300037466 Bacteria 2307
654 Ga0395898_0199964 3300037466 Bacteria 1908
655 Ga0395905_0024179 3300037471 Bacteria 5734
656 Ga0395905_0046172 3300037471 Bacteria 4084
657 Ga0395905_0119354 3300037471 Bacteria 2478
658 Ga0395905_0119887 3300037471 Bacteria 2472
659 Ga0395905_0156102 3300037471 Bacteria 2146
660 Ga0395901_0000033 3300038443 Bacteria 232357
661 Ga0395901_0004756 3300038443 Bacteria 13701
662 Ga0395901_0014131 3300038443 Bacteria 8128
663 Ga0395901_0049958 3300038443 Bacteria 4346
664 Ga0395901_0115919 3300038443 Bacteria 2814
665 Ga0436365_0743852 3300039437 Bacteria 24807
666 Ga0436361_0475217 3300039447 Bacteria 31445
667 Ga0436361_0941622 3300039447 Bacteria 2080
668 Ga0439438_000001 3300041405 Bacteria 1263568
669 Ga0439438_000579 3300041405 Bacteria 16620
670 Ga0439438_003785 3300041405 Bacteria 5980
671 Ga0439447_000222 3300041407 Bacteria 20061
672 Ga0439447_021038 3300041407 Bacteria 1722
673 Ga0439447_025902 3300041407 Bacteria 1507
674 Ga0439466_0000003 3300041411 Bacteria 486229
675 Ga0439466_0008703 3300041411 Bacteria 3824
676 Ga0439466_0014344 3300041411 Bacteria 2886
677 Ga0439466_0021313 3300041411 Bacteria 2298
678 Ga0451807_1250449 3300041486 Bacteria 1411
679 Ga0451833_0043619 3300041491 Bacteria 2942
680 Ga0451853_3838449 3300041512 Bacteria 5092
681 Ga0439431_0005176 3300041997 Bacteria 2875
682 Ga0439437_001461 3300042000 Bacteria 2484
683 Ga0439448_0000301 3300042005 Bacteria 10911
684 Ga0439448_0037632 3300042005 Bacteria 1555
685 Ga0439432_000409 3300042006 Bacteria 15952
686 Ga0439432_002502 3300042006 Bacteria 6925
687 Ga0439432_003370 3300042006 Bacteria 5928
688 Ga0439432_018396 3300042006 Bacteria 2335
689 Ga0439432_040066 3300042006 Bacteria 1486
690 Ga0439449_0051331 3300042007 Bacteria 1525
691 Ga0439452_000010 3300042010 Bacteria 459139
692 Ga0439452_000039 3300042010 Bacteria 145243
693 Ga0439452_000212 3300042010 Bacteria 41258
694 Ga0439452_000227 3300042010 Bacteria 39915
695 Ga0439452_000231 3300042010 Bacteria 38808
696 Ga0439452_000245 3300042010 Bacteria 37540
697 Ga0439452_000977 3300042010 Bacteria 12830
698 Ga0439452_009132 3300042010 Bacteria 2938
699 Ga0450911_000018 3300042115 Bacteria 104759
700 Ga0450911_000158 3300042115 Bacteria 27057
701 Ga0450911_002722 3300042115 Bacteria 3358
702 Ga0450920_001399 3300042122 Bacteria 3981
703 Ga0450891_002871 3300042129 Bacteria 1703
704 Ga0450902_000315 3300042137 Bacteria 5835
705 Ga0450904_000622 3300042139 Bacteria 6510
706 Ga0450906_002414 3300042145 Bacteria 4084
707 Ga0450907_000206 3300042146 Bacteria 21277
708 Ga0450908_009773 3300042184 Bacteria 1777
709 Ga0450909_002236 3300042185 Bacteria 2733
710 Ga0439434_0000122 3300042435 Bacteria 20574
711 Ga0439464_0000216 3300042439 Bacteria 10381
712 Ga0439464_0002678 3300042439 Bacteria 4416
713 Ga0439464_0006312 3300042439 Bacteria 3084
714 Ga0450893_0002000 3300042532 Bacteria 3178
715 Ga0450901_000195 3300042533 Bacteria 7181
716 Ga0451577_0000137 3300042876 Bacteria 163955
717 Ga0451577_0000162 3300042876 Bacteria 145994
718 Ga0451577_0001379 3300042876 Bacteria 32538
719 Ga0451577_0004703 3300042876 Bacteria 14323
720 Ga0451577_0175850 3300042876 Bacteria 1929
721 Ga0453683_0000766 3300044673 Bacteria 31975
722 Ga0466965_0015129 3300044683 Bacteria 3662
723 Ga0466961_0116641 3300044693 Bacteria 1678
724 Ga0466964_0006082 3300044706 Bacteria 4498
725 Ga0453684_0000014 3300044712 Bacteria 993311
726 Ga0453684_0000377 3300044712 Bacteria 183445
727 Ga0453684_0000384 3300044712 Bacteria 181189
728 Ga0453684_0000524 3300044712 Bacteria 146655
729 Ga0453684_0001213 3300044712 Bacteria 79157
730 Ga0453684_0002367 3300044712 Bacteria 46050
731 Ga0453684_0003729 3300044712 Bacteria 33733
732 Ga0453684_0004733 3300044712 Bacteria 28118
733 Ga0453684_0069376 3300044712 Bacteria 4471
734 Ga0453684_0158496 3300044712 Bacteria 2680
735 Ga0466957_0001593 3300044842 Bacteria 11926
736 Ga0466957_0029147 3300044842 Bacteria 3290
737 Ga0466960_0034067 3300044901 Bacteria 2371
738 Ga0451576_0000033 3300045051 Bacteria 393131
739 Ga0451576_0000169 3300045051 Bacteria 164329
740 Ga0451576_0001166 3300045051 Bacteria 47381
741 Ga0451576_0112608 3300045051 Bacteria 2832
742 Ga0451576_0225830 3300045051 Bacteria 1955
743 Ga0466958_0108320 3300045836 Bacteria 1733
744 Ga0495617_000136 3300046452 Bacteria 48660
745 Ga0495617_003902 3300046452 Bacteria 5494
746 Ga0495617_003925 3300046452 Bacteria 5480
747 Ga0495617_007971 3300046452 Bacteria 3661
748 Ga0495617_009658 3300046452 Bacteria 3309
749 Ga0495617_023089 3300046452 Bacteria 2102
750 Ga0495627_000023 3300046453 Bacteria 251113
751 Ga0495627_000194 3300046453 Bacteria 66597
752 Ga0495627_000700 3300046453 Bacteria 25589
753 Ga0495627_001188 3300046453 Bacteria 16475
754 Ga0495627_003088 3300046453 Bacteria 7560
755 Ga0495627_016887 3300046453 Bacteria 2491
756 Ga0495592_0013806 3300046454 Bacteria 6141
757 Ga0495603_0005812 3300046455 Bacteria 7379
758 Ga0495590_0000003 3300046457 Bacteria 478593
759 Ga0495590_0002491 3300046457 Bacteria 7617
760 Ga0495590_0003931 3300046457 Bacteria 6043
761 Ga0495590_0004480 3300046457 Bacteria 5635
762 Ga0495590_0007145 3300046457 Bacteria 4320
763 Ga0495591_000014 3300046458 Bacteria 254281
764 Ga0495591_000025 3300046458 Bacteria 189897
765 Ga0495591_000029 3300046458 Bacteria 179657
766 Ga0495591_000244 3300046458 Bacteria 52389
767 Ga0495591_000717 3300046458 Bacteria 24075
768 Ga0495591_001158 3300046458 Bacteria 17285
769 Ga0495591_001191 3300046458 Bacteria 16988
770 Ga0495591_001492 3300046458 Bacteria 14436
771 Ga0495591_001672 3300046458 Bacteria 13343
772 Ga0495591_001689 3300046458 Bacteria 13198
773 Ga0495591_006448 3300046458 Bacteria 5188
774 Ga0495591_007569 3300046458 Bacteria 4593
775 Ga0495591_009001 3300046458 Bacteria 4017
776 Ga0495591_009994 3300046458 Bacteria 3719
777 Ga0495591_017937 3300046458 Bacteria 2414
778 Ga0495629_0052049 3300046459 Bacteria 2865
779 Ga0495638_0000091 3300046460 Bacteria 146548
780 Ga0495638_0001218 3300046460 Bacteria 24478
781 Ga0495638_0001551 3300046460 Bacteria 20607
782 Ga0495638_0004653 3300046460 Bacteria 10379
783 Ga0495638_0006661 3300046460 Bacteria 8381
784 Ga0495638_0013609 3300046460 Bacteria 5528
785 Ga0495638_0076050 3300046460 Bacteria 2045
786 Ga0495651_0081988 3300046462 Bacteria 2434
787 Ga0495653_0000549 3300046463 Bacteria 28717
788 Ga0495653_0004499 3300046463 Bacteria 11259
789 Ga0495653_0006284 3300046463 Bacteria 9746
790 Ga0495653_0011868 3300046463 Bacteria 7117
791 Ga0495653_0062377 3300046463 Bacteria 2816
792 Ga0495650_0000032 3300046471 Bacteria 425389
793 Ga0495650_0000097 3300046471 Bacteria 216051
794 Ga0495650_0000103 3300046471 Bacteria 210023
795 Ga0495650_0000386 3300046471 Bacteria 75722
796 Ga0495650_0001058 3300046471 Bacteria 30529
797 Ga0495650_0001865 3300046471 Bacteria 18852
798 Ga0495650_0006713 3300046471 Bacteria 7123
799 Ga0495650_0007354 3300046471 Bacteria 6634
800 Ga0495650_0010356 3300046471 Bacteria 5210
801 Ga0495650_0011972 3300046471 Bacteria 4698
802 Ga0495650_0016850 3300046471 Bacteria 3680
803 Ga0495650_0017796 3300046471 Bacteria 3552
804 Ga0495580_0046926 3300046472 Bacteria 3063
805 Ga0495582_0000880 3300046473 Bacteria 16656
806 Ga0495582_0008606 3300046473 Bacteria 5628
807 Ga0495605_0000095 3300046474 Bacteria 112622
808 Ga0495605_0000237 3300046474 Bacteria 66607
809 Ga0495605_0000246 3300046474 Bacteria 64351
810 Ga0495605_0000251 3300046474 Bacteria 63553
811 Ga0495605_0000311 3300046474 Bacteria 50989
812 Ga0495605_0000328 3300046474 Bacteria 48074
813 Ga0495605_0000673 3300046474 Bacteria 25763
814 Ga0495605_0000878 3300046474 Bacteria 20810
815 Ga0495605_0001867 3300046474 Bacteria 13472
816 Ga0495605_0003763 3300046474 Bacteria 8998
817 Ga0495605_0004933 3300046474 Bacteria 7796
818 Ga0495605_0007006 3300046474 Bacteria 6433
819 Ga0495605_0008057 3300046474 Bacteria 5965
820 Ga0495605_0016771 3300046474 Bacteria 3958
821 Ga0495605_0060012 3300046474 Bacteria 1824
822 Ga0495605_0106440 3300046474 Bacteria 1283
823 Ga0495639_0010865 3300046475 Bacteria 3921
824 Ga0495584_0000695 3300046491 Bacteria 22284
825 Ga0495584_0001738 3300046491 Bacteria 12732
826 Ga0495584_0002471 3300046491 Bacteria 10466
827 Ga0495584_0011709 3300046491 Bacteria 4486
828 Ga0495584_0026343 3300046491 Bacteria 2945
829 Ga0495584_0030102 3300046491 Bacteria 2751
830 Ga0495584_0031955 3300046491 Bacteria 2664
831 Ga0495585_0000005 3300046492 Bacteria 328103
832 Ga0495585_0000279 3300046492 Bacteria 51082
833 Ga0495585_0000790 3300046492 Bacteria 27867
834 Ga0495585_0001195 3300046492 Bacteria 21116
835 Ga0495585_0002554 3300046492 Bacteria 12902
836 Ga0495585_0004763 3300046492 Bacteria 8733
837 Ga0495585_0005582 3300046492 Bacteria 7902
838 Ga0495585_0008791 3300046492 Bacteria 6099
839 Ga0495585_0022472 3300046492 Bacteria 3620
840 Ga0495585_0024974 3300046492 Bacteria 3424
841 Ga0495585_0031614 3300046492 Bacteria 3003
842 Ga0495585_0050086 3300046492 Bacteria 2317
843 Ga0495585_0074612 3300046492 Bacteria 1845
844 Ga0495594_0006507 3300046499 Bacteria 6012
845 Ga0495594_0006764 3300046499 Bacteria 5897
846 Ga0495594_0008636 3300046499 Bacteria 5248
847 Ga0495594_0063337 3300046499 Bacteria 2049
848 Ga0495596_0001177 3300046500 Bacteria 15333
849 Ga0495596_0001477 3300046500 Bacteria 13428
850 Ga0495596_0006433 3300046500 Bacteria 5405
851 Ga0495596_0016068 3300046500 Bacteria 3116
852 Ga0495596_0016079 3300046500 Bacteria 3115
853 Ga0495607_0000181 3300046501 Bacteria 67120
854 Ga0495607_0000347 3300046501 Bacteria 47969
855 Ga0495607_0000552 3300046501 Bacteria 36630
856 Ga0495607_0000776 3300046501 Bacteria 30570
857 Ga0495607_0001128 3300046501 Bacteria 24218
858 Ga0495607_0001875 3300046501 Bacteria 17831
859 Ga0495607_0002014 3300046501 Bacteria 17053
860 Ga0495607_0003010 3300046501 Bacteria 13163
861 Ga0495607_0006297 3300046501 Bacteria 8368
862 Ga0495607_0007143 3300046501 Bacteria 7761
863 Ga0495607_0008065 3300046501 Bacteria 7230
864 Ga0495607_0011290 3300046501 Bacteria 5957
865 Ga0495607_0012842 3300046501 Bacteria 5508
866 Ga0495607_0017978 3300046501 Bacteria 4518
867 Ga0495607_0024174 3300046501 Bacteria 3791
868 Ga0495607_0026649 3300046501 Bacteria 3584
869 Ga0495607_0031719 3300046501 Bacteria 3232
870 Ga0495583_0000015 3300046506 Bacteria 316392
871 Ga0495583_0000060 3300046506 Bacteria 199091
872 Ga0495583_0000062 3300046506 Bacteria 195151
873 Ga0495583_0000155 3300046506 Bacteria 114870
874 Ga0495583_0000197 3300046506 Bacteria 101236
875 Ga0495583_0000756 3300046506 Bacteria 41068
876 Ga0495583_0001189 3300046506 Bacteria 28043
877 Ga0495583_0001231 3300046506 Bacteria 27233
878 Ga0495583_0001514 3300046506 Bacteria 23104
879 Ga0495583_0001852 3300046506 Bacteria 19708
880 Ga0495583_0003070 3300046506 Bacteria 13227
881 Ga0495583_0003993 3300046506 Bacteria 10886
882 Ga0495606_0000068 3300046507 Bacteria 179653
883 Ga0495606_0000141 3300046507 Bacteria 123586
884 Ga0495606_0000177 3300046507 Bacteria 112843
885 Ga0495606_0000214 3300046507 Bacteria 103149
886 Ga0495606_0000266 3300046507 Bacteria 92444
887 Ga0495606_0000371 3300046507 Bacteria 76806
888 Ga0495606_0000461 3300046507 Bacteria 66807
889 Ga0495606_0000696 3300046507 Bacteria 52177
890 Ga0495606_0000843 3300046507 Bacteria 46153
891 Ga0495606_0002268 3300046507 Bacteria 22764
892 Ga0495606_0002328 3300046507 Bacteria 22395
893 Ga0495606_0003165 3300046507 Bacteria 17806
894 Ga0495606_0004642 3300046507 Bacteria 13589
895 Ga0495606_0007052 3300046507 Bacteria 10180
896 Ga0495606_0016853 3300046507 Bacteria 5550
897 Ga0495606_0056002 3300046507 Bacteria 2546
898 Ga0495608_0018979 3300046511 Bacteria 4738
899 Ga0495610_0000003 3300046512 Bacteria 1203910
900 Ga0495610_0001476 3300046512 Bacteria 20720
901 Ga0495610_0003651 3300046512 Bacteria 11843
902 Ga0495610_0009810 3300046512 Bacteria 6008
903 Ga0495610_0010298 3300046512 Bacteria 5821
904 Ga0495610_0014621 3300046512 Bacteria 4602
905 Ga0495610_0015071 3300046512 Bacteria 4509
906 Ga0495610_0025482 3300046512 Bacteria 3173
907 Ga0495616_0000184 3300046513 Bacteria 52694
908 Ga0495616_0001441 3300046513 Bacteria 16553
909 Ga0495616_0004461 3300046513 Bacteria 8812
910 Ga0495616_0005947 3300046513 Bacteria 7441
911 Ga0495616_0008293 3300046513 Bacteria 6167
912 Ga0495616_0009974 3300046513 Bacteria 5521
913 Ga0495616_0014276 3300046513 Bacteria 4452
914 Ga0495616_0017305 3300046513 Bacteria 3977
915 Ga0495616_0019028 3300046513 Bacteria 3754
916 Ga0495616_0038840 3300046513 Bacteria 2441
917 Ga0495618_0011571 3300046514 Bacteria 5354
918 Ga0495618_0102076 3300046514 Bacteria 1836
919 Ga0495620_0000042 3300046515 Bacteria 112107
920 Ga0495620_0000456 3300046515 Bacteria 26967
921 Ga0495620_0001496 3300046515 Bacteria 13914
922 Ga0495620_0002041 3300046515 Bacteria 11774
923 Ga0495620_0004368 3300046515 Bacteria 7982
924 Ga0495620_0006298 3300046515 Bacteria 6528
925 Ga0495620_0045501 3300046515 Bacteria 1899
926 Ga0495628_0070535 3300046516 Bacteria 2725
927 Ga0495630_0025997 3300046517 Bacteria 4332
928 Ga0495630_0129753 3300046517 Bacteria 1914
929 Ga0495631_0000722 3300046518 Bacteria 21214
930 Ga0495631_0000794 3300046518 Bacteria 20159
931 Ga0495631_0004320 3300046518 Bacteria 7580
932 Ga0495631_0004837 3300046518 Bacteria 7100
933 Ga0495631_0026043 3300046518 Bacteria 2689
934 Ga0495631_0062453 3300046518 Bacteria 1614
935 Ga0495632_0000573 3300046519 Bacteria 34214
936 Ga0495632_0001250 3300046519 Bacteria 21567
937 Ga0495632_0001313 3300046519 Bacteria 21015
938 Ga0495632_0001532 3300046519 Bacteria 19084
939 Ga0495632_0009908 3300046519 Bacteria 5695
940 Ga0495632_0025653 3300046519 Bacteria 3114
941 Ga0495632_0057255 3300046519 Bacteria 1903
942 Ga0495637_0000020 3300046520 Bacteria 181611
943 Ga0495637_0000087 3300046520 Bacteria 72113
944 Ga0495637_0000260 3300046520 Bacteria 41743
945 Ga0495637_0000848 3300046520 Bacteria 20166
946 Ga0495637_0002194 3300046520 Bacteria 10915
947 Ga0495637_0002273 3300046520 Bacteria 10654
948 Ga0495637_0002495 3300046520 Bacteria 10154
949 Ga0495637_0005014 3300046520 Bacteria 6809
950 Ga0495637_0010737 3300046520 Bacteria 4417
951 Ga0495637_0045902 3300046520 Bacteria 1850
952 Ga0495643_0000179 3300046522 Bacteria 100406
953 Ga0495643_0000287 3300046522 Bacteria 72080
954 Ga0495643_0000411 3300046522 Bacteria 56229
955 Ga0495643_0000585 3300046522 Bacteria 44407
956 Ga0495643_0001628 3300046522 Bacteria 19819
957 Ga0495643_0002022 3300046522 Bacteria 16910
958 Ga0495643_0011258 3300046522 Bacteria 5460
959 Ga0495643_0015794 3300046522 Bacteria 4451
960 Ga0495643_0055851 3300046522 Bacteria 2109
961 Ga0495644_0000218 3300046523 Bacteria 27012
962 Ga0495644_0000952 3300046523 Bacteria 11967
963 Ga0495644_0002342 3300046523 Bacteria 7553
964 Ga0495644_0003908 3300046523 Bacteria 5868
965 Ga0495644_0005160 3300046523 Bacteria 5112
966 Ga0495644_0014154 3300046523 Bacteria 3056
967 Ga0495644_0015839 3300046523 Bacteria 2888
968 Ga0495644_0020449 3300046523 Bacteria 2526
969 Ga0495644_0028708 3300046523 Bacteria 2104
970 Ga0495644_0032761 3300046523 Bacteria 1963
971 Ga0495648_0000058 3300046524 Bacteria 156717
972 Ga0495648_0000076 3300046524 Bacteria 129413
973 Ga0495648_0000299 3300046524 Bacteria 55022
974 Ga0495648_0001064 3300046524 Bacteria 27859
975 Ga0495648_0002580 3300046524 Bacteria 16591
976 Ga0495648_0009200 3300046524 Bacteria 7686
977 Ga0495648_0010573 3300046524 Bacteria 7017
978 Ga0495648_0012123 3300046524 Bacteria 6453
979 Ga0495648_0016557 3300046524 Bacteria 5310
980 Ga0495648_0023158 3300046524 Bacteria 4260
981 Ga0495648_0032542 3300046524 Bacteria 3419
982 Ga0495648_0042121 3300046524 Bacteria 2875
983 Ga0495648_0046654 3300046524 Bacteria 2683
984 Ga0495648_0111533 3300046524 Bacteria 1487
985 Ga0495666_0000514 3300046526 Bacteria 17215
986 Ga0495666_0007844 3300046526 Bacteria 5345
987 Ga0495666_0039645 3300046526 Bacteria 2286
988 Ga0495666_0043376 3300046526 Bacteria 2173
989 Ga0495642_0000088 3300046528 Bacteria 53831
990 Ga0495642_0000223 3300046528 Bacteria 32585
991 Ga0495642_0000463 3300046528 Bacteria 21321
992 Ga0495642_0006585 3300046528 Bacteria 4457
993 Ga0495642_0038639 3300046528 Bacteria 1934
994 Ga0495652_0038065 3300046529 Bacteria 4169
995 Ga0495652_0131616 3300046529 Bacteria 1980
996 Ga0495654_0000019 3300046530 Bacteria 289483
997 Ga0495654_0000074 3300046530 Bacteria 114325
998 Ga0495654_0000451 3300046530 Bacteria 34657
999 Ga0495654_0000985 3300046530 Bacteria 20933
1000 Ga0495654_0001089 3300046530 Bacteria 19727
1001 Ga0495654_0001254 3300046530 Bacteria 17873
1002 Ga0495654_0001271 3300046530 Bacteria 17708
1003 Ga0495654_0004701 3300046530 Bacteria 8045
1004 Ga0495654_0006622 3300046530 Bacteria 6559
1005 Ga0495654_0011325 3300046530 Bacteria 4831
1006 Ga0495654_0017372 3300046530 Bacteria 3784
1007 Ga0495654_0018225 3300046530 Bacteria 3682
1008 Ga0495654_0054647 3300046530 Bacteria 1936
1009 Ga0495640_0065769 3300046533 Bacteria 2447
1010 Ga0495586_0031574 3300046535 Bacteria 2838
1011 Ga0495587_0065213 3300046536 Bacteria 2127
1012 Ga0495609_0000039 3300046538 Bacteria 179384
1013 Ga0495609_0000053 3300046538 Bacteria 149126
1014 Ga0495609_0000102 3300046538 Bacteria 100762
1015 Ga0495609_0000685 3300046538 Bacteria 26127
1016 Ga0495609_0001189 3300046538 Bacteria 17916
1017 Ga0495609_0003042 3300046538 Bacteria 9863
1018 Ga0495609_0029907 3300046538 Bacteria 2478
1019 Ga0495597_0000153 3300046542 Bacteria 61233
1020 Ga0495597_0000186 3300046542 Bacteria 55973
1021 Ga0495597_0000209 3300046542 Bacteria 53295
1022 Ga0495597_0000242 3300046542 Bacteria 49561
1023 Ga0495597_0000537 3300046542 Bacteria 31420
1024 Ga0495597_0000808 3300046542 Bacteria 24718
1025 Ga0495597_0002455 3300046542 Bacteria 11727
1026 Ga0495597_0033447 3300046542 Bacteria 2328
1027 Ga0495597_0035248 3300046542 Bacteria 2257
1028 Ga0495597_0062226 3300046542 Bacteria 1624
1029 Ga0495597_0074476 3300046542 Bacteria 1458
1030 Ga0495645_0009101 3300046543 Bacteria 6939
1031 Ga0495645_0031956 3300046543 Bacteria 3838
1032 Ga0495645_0159292 3300046543 Bacteria 1562
1033 Ga0495622_0000054 3300046557 Bacteria 102782
1034 Ga0495622_0000468 3300046557 Bacteria 25821
1035 Ga0495622_0000584 3300046557 Bacteria 21528
1036 Ga0495622_0002858 3300046557 Bacteria 8240
1037 Ga0495622_0009925 3300046557 Bacteria 4404
1038 Ga0495633_0000119 3300046558 Bacteria 106455
1039 Ga0495633_0000249 3300046558 Bacteria 64232
1040 Ga0495633_0000366 3300046558 Bacteria 48617
1041 Ga0495633_0001297 3300046558 Bacteria 19748
1042 Ga0495633_0002317 3300046558 Bacteria 13558
1043 Ga0495633_0004532 3300046558 Bacteria 8775
1044 Ga0495633_0009262 3300046558 Bacteria 5455
1045 Ga0495633_0011956 3300046558 Bacteria 4642
1046 Ga0495633_0025940 3300046558 Bacteria 2881
1047 Ga0495633_0075050 3300046558 Bacteria 1575
1048 Ga0495667_0055871 3300046559 Bacteria 2596
1049 Ga0495667_0114760 3300046559 Bacteria 1740
1050 Ga0495656_0030753 3300046615 Bacteria 2172
1051 Ga0495668_0000337 3300046616 Bacteria 63494
1052 Ga0495668_0000466 3300046616 Bacteria 51377
1053 Ga0495668_0000866 3300046616 Bacteria 34104
1054 Ga0495668_0015652 3300046616 Bacteria 4424
1055 Ga0495668_0024652 3300046616 Bacteria 3421
1056 Ga0495668_0080776 3300046616 Bacteria 1784
1057 Ga0495634_0001452 3300046642 Bacteria 21049
1058 Ga0495634_0040408 3300046642 Bacteria 3173
1059 Ga0495611_0000386 3300046648 Bacteria 28151
1060 Ga0495611_0000546 3300046648 Bacteria 22058
1061 Ga0495611_0002380 3300046648 Bacteria 8661
1062 Ga0495611_0004289 3300046648 Bacteria 6194
1063 Ga0495611_0005319 3300046648 Bacteria 5510
1064 Ga0495611_0023655 3300046648 Bacteria 2667
1065 Ga0495611_0096133 3300046648 Bacteria 1371
1066 Ga0495625_0000086 3300046660 Bacteria 151735
1067 Ga0495625_0000132 3300046660 Bacteria 115728
1068 Ga0495625_0000139 3300046660 Bacteria 112271
1069 Ga0495625_0001396 3300046660 Bacteria 29588
1070 Ga0495625_0002129 3300046660 Bacteria 22079
1071 Ga0495625_0002623 3300046660 Bacteria 19215
1072 Ga0495625_0003090 3300046660 Bacteria 17005
1073 Ga0495625_0003498 3300046660 Bacteria 15570
1074 Ga0495625_0003977 3300046660 Bacteria 14173
1075 Ga0495625_0010314 3300046660 Bacteria 7744
1076 Ga0495625_0010440 3300046660 Bacteria 7684
1077 Ga0495625_0013007 3300046660 Bacteria 6712
1078 Ga0495625_0028160 3300046660 Bacteria 4217
1079 Ga0495625_0048669 3300046660 Bacteria 3051
1080 Ga0495625_0072932 3300046660 Bacteria 2407
1081 Ga0495635_0010447 3300046663 Bacteria 6494
1082 Ga0495635_0066463 3300046663 Bacteria 2473
1083 Ga0495659_0000684 3300046664 Bacteria 12267
1084 Ga0495659_0001118 3300046664 Bacteria 9335
1085 Ga0495661_0000048 3300046665 Bacteria 144678
1086 Ga0495661_0000058 3300046665 Bacteria 133316
1087 Ga0495661_0000094 3300046665 Bacteria 109394
1088 Ga0495661_0000131 3300046665 Bacteria 90795
1089 Ga0495661_0000171 3300046665 Bacteria 76610
1090 Ga0495661_0001840 3300046665 Bacteria 16963
1091 Ga0495661_0002376 3300046665 Bacteria 14528
1092 Ga0495661_0008362 3300046665 Bacteria 7160
1093 Ga0495661_0011367 3300046665 Bacteria 6041
1094 Ga0495661_0017452 3300046665 Bacteria 4740
1095 Ga0495661_0022149 3300046665 Bacteria 4135
1096 Ga0495661_0027405 3300046665 Bacteria 3658
1097 Ga0495661_0035739 3300046665 Bacteria 3115
1098 Ga0495661_0036819 3300046665 Bacteria 3059
1099 Ga0495661_0039514 3300046665 Bacteria 2932
1100 Ga0495661_0072285 3300046665 Bacteria 2012
1101 Ga0495661_0077161 3300046665 Bacteria 1931
1102 Ga0495588_0000110 3300046674 Bacteria 142825
1103 Ga0495588_0004605 3300046674 Bacteria 6091
1104 Ga0495588_0026084 3300046674 Bacteria 2915
1105 Ga0495599_0000399 3300046678 Bacteria 24819
1106 Ga0495599_0004483 3300046678 Bacteria 8274
1107 Ga0495623_0005943 3300046679 Bacteria 7955
1108 Ga0495623_0006642 3300046679 Bacteria 7530
1109 Ga0495623_0066232 3300046679 Bacteria 2257
1110 Ga0495646_0000446 3300046680 Bacteria 21847
1111 Ga0495646_0024671 3300046680 Bacteria 3786
1112 Ga0495669_0000041 3300046684 Bacteria 88966
1113 Ga0495669_0026695 3300046684 Bacteria 2524
1114 Ga0495669_0080805 3300046684 Bacteria 1491
1115 Ga0495613_0092878 3300046689 Bacteria 2184
1116 Ga0495624_0001848 3300046690 Bacteria 16142
1117 Ga0495670_0000302 3300046691 Bacteria 23271
1118 Ga0495670_0002252 3300046691 Bacteria 9516
1119 Ga0495670_0005988 3300046691 Bacteria 5954
1120 Ga0495670_0006106 3300046691 Bacteria 5910
1121 Ga0495670_0007946 3300046691 Bacteria 5213
1122 Ga0495670_0011561 3300046691 Bacteria 4342
1123 Ga0495671_0000157 3300046692 Bacteria 59803
1124 Ga0495671_0000582 3300046692 Bacteria 27065
1125 Ga0495671_0000796 3300046692 Bacteria 22620
1126 Ga0495671_0001635 3300046692 Bacteria 14701
1127 Ga0495671_0003155 3300046692 Bacteria 10243
1128 Ga0495671_0005078 3300046692 Bacteria 7745
1129 Ga0495671_0008993 3300046692 Bacteria 5604
1130 Ga0495671_0012930 3300046692 Bacteria 4542
1131 Ga0495671_0017322 3300046692 Bacteria 3835
1132 Ga0495671_0032264 3300046692 Bacteria 2674
1133 Ga0495649_0000049 3300046694 Bacteria 113865
1134 Ga0495649_0000510 3300046694 Bacteria 33248
1135 Ga0495649_0000847 3300046694 Bacteria 24572
1136 Ga0495649_0000965 3300046694 Bacteria 22681
1137 Ga0495649_0003527 3300046694 Bacteria 10516
1138 Ga0495649_0003587 3300046694 Bacteria 10407
1139 Ga0495649_0005204 3300046694 Bacteria 8330
1140 Ga0495649_0010593 3300046694 Bacteria 5434
1141 Ga0495649_0013796 3300046694 Bacteria 4651
1142 Ga0495649_0036011 3300046694 Bacteria 2720
1143 Ga0495649_0066360 3300046694 Bacteria 1936
1144 Ga0495649_0088894 3300046694 Bacteria 1647
1145 Ga0495649_0120197 3300046694 Bacteria 1389
1146 Ga0495589_0000006 3300046794 Bacteria 303635
1147 Ga0495589_0000019 3300046794 Bacteria 200814
1148 Ga0495589_0000445 3300046794 Bacteria 30407
1149 Ga0495589_0000647 3300046794 Bacteria 22840
1150 Ga0495589_0000866 3300046794 Bacteria 18894
1151 Ga0495589_0001426 3300046794 Bacteria 13815
1152 Ga0495589_0002079 3300046794 Bacteria 11326
1153 Ga0495589_0003754 3300046794 Bacteria 8174
1154 Ga0495589_0011721 3300046794 Bacteria 4550
1155 Ga0495589_0017134 3300046794 Bacteria 3720
1156 Ga0495589_0024381 3300046794 Bacteria 3074
1157 Ga0495589_0050380 3300046794 Bacteria 2060
1158 Ga0495600_0002038 3300046809 Bacteria 11377
1159 Ga0495600_0100251 3300046809 Bacteria 1888
1160 Ga0495660_0000021 3300046810 Bacteria 293250
1161 Ga0495660_0000056 3300046810 Bacteria 134518
1162 Ga0495660_0000168 3300046810 Bacteria 71020
1163 Ga0495660_0000245 3300046810 Bacteria 53011
1164 Ga0495660_0000608 3300046810 Bacteria 28251
1165 Ga0495660_0005539 3300046810 Bacteria 7557
1166 Ga0495660_0007449 3300046810 Bacteria 6426
1167 Ga0495660_0009308 3300046810 Bacteria 5728
1168 Ga0495660_0015517 3300046810 Bacteria 4399
1169 Ga0495660_0016457 3300046810 Bacteria 4263
1170 Ga0495660_0022873 3300046810 Bacteria 3566
1171 Ga0495660_0073548 3300046810 Bacteria 1807
1172 Ga0495581_0014620 3300047315 Bacteria 4550
1173 Ga0495604_0014483 3300047317 Bacteria 6290
1174 Ga0495604_0050582 3300047317 Bacteria 3226
1175 Ga0495604_0101791 3300047317 Bacteria 2109
1176 Ga0495636_0001360 3300047318 Bacteria 9262
1177 Ga0495636_0001666 3300047318 Bacteria 8465
1178 Ga0495636_0008015 3300047318 Bacteria 4166
1179 Ga0495636_0014610 3300047318 Bacteria 3123
1180 Ga0495674_0002066 3300047319 Bacteria 19692
1181 Ga0495674_0085409 3300047319 Bacteria 2703
1182 Ga0495672_0000002 3300047320 Bacteria 740116
1183 Ga0495672_0000012 3300047320 Bacteria 519975
1184 Ga0495672_0000020 3300047320 Bacteria 432845
1185 Ga0495672_0000263 3300047320 Bacteria 72879
1186 Ga0495672_0001472 3300047320 Bacteria 23111
1187 Ga0495672_0002315 3300047320 Bacteria 17677
1188 Ga0495672_0002439 3300047320 Bacteria 17116
1189 Ga0495672_0003847 3300047320 Bacteria 12624
1190 Ga0495672_0007415 3300047320 Bacteria 8252
1191 Ga0495672_0010293 3300047320 Bacteria 6681
1192 Ga0495672_0031579 3300047320 Bacteria 3305
1193 Ga0495672_0058653 3300047320 Bacteria 2230
1194 Ga0495672_0070641 3300047320 Bacteria 1977
1195 Ga0495676_0000022 3300047321 Bacteria 163719
1196 Ga0495676_0004002 3300047321 Bacteria 13417
1197 Ga0495680_0037898 3300047322 Bacteria 3858
1198 Ga0495680_0091818 3300047322 Bacteria 2275
1199 Ga0495680_0103548 3300047322 Bacteria 2118
1200 Ga0495680_0115054 3300047322 Bacteria 1990
1201 Ga0495680_0124245 3300047322 Bacteria 1902
1202 Ga0495683_0000030 3300047323 Bacteria 150551
1203 Ga0495683_0000520 3300047323 Bacteria 29465
1204 Ga0495683_0000927 3300047323 Bacteria 20673
1205 Ga0495683_0003113 3300047323 Bacteria 9722
1206 Ga0495683_0011966 3300047323 Bacteria 4559
1207 Ga0495683_0019467 3300047323 Bacteria 3502
1208 Ga0495683_0020424 3300047323 Bacteria 3416
1209 Ga0495683_0024380 3300047323 Bacteria 3105
1210 Ga0495683_0048266 3300047323 Bacteria 2134
1211 Ga0495687_000059 3300047443 Bacteria 179357
1212 Ga0495687_000296 3300047443 Bacteria 65626
1213 Ga0495687_001460 3300047443 Bacteria 21684
1214 Ga0495687_001591 3300047443 Bacteria 20510
1215 Ga0495687_001767 3300047443 Bacteria 19104
1216 Ga0495675_0074373 3300047444 Bacteria 2141
1217 Ga0495677_0000006 3300047445 Bacteria 199230
1218 Ga0495677_0000590 3300047445 Bacteria 14890
1219 Ga0495677_0002558 3300047445 Bacteria 7116
1220 Ga0495677_0003280 3300047445 Bacteria 6308
1221 Ga0495677_0010069 3300047445 Bacteria 3478
1222 Ga0495677_0025054 3300047445 Bacteria 2164
1223 Ga0495677_0050358 3300047445 Bacteria 1532
1224 Ga0495679_000020 3300047446 Bacteria 228413
1225 Ga0495679_000218 3300047446 Bacteria 48725
1226 Ga0495679_000494 3300047446 Bacteria 28041
1227 Ga0495679_001364 3300047446 Bacteria 14041
1228 Ga0495679_002504 3300047446 Bacteria 9297
1229 Ga0495679_002509 3300047446 Bacteria 9269
1230 Ga0495679_002913 3300047446 Bacteria 8470
1231 Ga0495679_003549 3300047446 Bacteria 7455
1232 Ga0495685_000416 3300047447 Bacteria 13459
1233 Ga0495685_003595 3300047447 Bacteria 4958
1234 Ga0495673_0000006 3300047469 Bacteria 908691
1235 Ga0495673_0000024 3300047469 Bacteria 521349
1236 Ga0495673_0000079 3300047469 Bacteria 202569
1237 Ga0495673_0000544 3300047469 Bacteria 38535
1238 Ga0495673_0001080 3300047469 Bacteria 23910
1239 Ga0495673_0001326 3300047469 Bacteria 20085
1240 Ga0495673_0002964 3300047469 Bacteria 11442
1241 Ga0495673_0003791 3300047469 Bacteria 9778
1242 Ga0495673_0004931 3300047469 Bacteria 8211
1243 Ga0495673_0009417 3300047469 Bacteria 5407
1244 Ga0495673_0011178 3300047469 Bacteria 4844
1245 Ga0495673_0019270 3300047469 Bacteria 3420
1246 Ga0495673_0024681 3300047469 Bacteria 2898
1247 Ga0495681_0000351 3300047470 Bacteria 36044
1248 Ga0495681_0000411 3300047470 Bacteria 33097
1249 Ga0495681_0000534 3300047470 Bacteria 29137
1250 Ga0495681_0001568 3300047470 Bacteria 17031
1251 Ga0495681_0001787 3300047470 Bacteria 15838
1252 Ga0495681_0003728 3300047470 Bacteria 10556
1253 Ga0495681_0010655 3300047470 Bacteria 5552
1254 Ga0495681_0019212 3300047470 Bacteria 3738
1255 Ga0495681_0025685 3300047470 Bacteria 3078
1256 Ga0495681_0057034 3300047470 Bacteria 1815
1257 Ga0495681_0095140 3300047470 Bacteria 1309
1258 Ga0495686_0000017 3300047472 Bacteria 435554
1259 Ga0495686_0001364 3300047472 Bacteria 27253
1260 Ga0495686_0003766 3300047472 Bacteria 12894
1261 Ga0495686_0014853 3300047472 Bacteria 5346
1262 Ga0495686_0015703 3300047472 Bacteria 5159
1263 Ga0495686_0061115 3300047472 Bacteria 2340
1264 Ga0495593_0014612 3300047673 Bacteria 4460
1265 Ga0495593_0044222 3300047673 Bacteria 2382
1266 Ga0495602_0040199 3300048088 Bacteria 4293
1267 Ga0495614_0005763 3300048089 Bacteria 5578
1268 Ga0495626_0000039 3300048091 Bacteria 175454
1269 Ga0495626_0000103 3300048091 Bacteria 110163
1270 Ga0495626_0000391 3300048091 Bacteria 45354
1271 Ga0495626_0000494 3300048091 Bacteria 39727
1272 Ga0495626_0000562 3300048091 Bacteria 36865
1273 Ga0495626_0000711 3300048091 Bacteria 31405
1274 Ga0495626_0002239 3300048091 Bacteria 13862
1275 Ga0495626_0005483 3300048091 Bacteria 7394
1276 Ga0495626_0029382 3300048091 Bacteria 2660
1277 Ga0495626_0035165 3300048091 Bacteria 2391
1278 Ga0495626_0039518 3300048091 Bacteria 2232
1279 Ga0495626_0042079 3300048091 Bacteria 2147
1280 Ga0496101_0000671 3300048904 Bacteria 20633
1281 Ga0496102_0001161 3300048905 Bacteria 24071
1282 Ga0496102_0008716 3300048905 Bacteria 8705
1283 Ga0496102_0077507 3300048905 Bacteria 3059
1284 Ga0496103_0000631 3300048906 Bacteria 26992
1285 Ga0496103_0005456 3300048906 Bacteria 7603
1286 Ga0496103_0128194 3300048906 Bacteria 1619
1287 Ga0496104_0000119 3300048907 Bacteria 74104
1288 Ga0496104_0002141 3300048907 Bacteria 17139
1289 Ga0496104_0004930 3300048907 Bacteria 11644
1290 Ga0496105_0006486 3300048908 Bacteria 8997
1291 Ga0496105_0022243 3300048908 Bacteria 5135
1292 Ga0496105_0035265 3300048908 Bacteria 4117
1293 Ga0496105_0106492 3300048908 Bacteria 2314
1294 Ga0496105_0120651 3300048908 Bacteria 2162
1295 Ga0496106_0100961 3300048909 Bacteria 2238
1296 Ga0496110_0035108 3300048913 Bacteria 4348
1297 Ga0496114_0113188 3300048917 Bacteria 2326
1298 Ga0496115_0012877 3300048918 Bacteria 6307
1299 Ga0496116_0000031 3300048919 Bacteria 420043
1300 Ga0496116_0000320 3300048919 Bacteria 78683
1301 Ga0496116_0000376 3300048919 Bacteria 66696
1302 Ga0496116_0000623 3300048919 Bacteria 46579
1303 Ga0496116_0003799 3300048919 Bacteria 14764
1304 Ga0496116_0005272 3300048919 Bacteria 12065
1305 Ga0496116_0005434 3300048919 Bacteria 11810
1306 Ga0496116_0005510 3300048919 Bacteria 11700
1307 Ga0496116_0011980 3300048919 Bacteria 7122
1308 Ga0496116_0017900 3300048919 Bacteria 5480
1309 Ga0496116_0043099 3300048919 Bacteria 3077
1310 Ga0496116_0060937 3300048919 Bacteria 2445
1311 Ga0496117_0000001 3300048920 Bacteria 2526244
1312 Ga0496117_0000004 3300048920 Bacteria 877131
1313 Ga0496117_0000298 3300048920 Bacteria 87318
1314 Ga0496117_0000486 3300048920 Bacteria 65652
1315 Ga0496117_0001035 3300048920 Bacteria 42455
1316 Ga0496117_0001085 3300048920 Bacteria 41180
1317 Ga0496117_0001205 3300048920 Bacteria 38844
1318 Ga0496117_0003937 3300048920 Bacteria 16804
1319 Ga0496117_0005845 3300048920 Bacteria 12736
1320 Ga0496117_0010248 3300048920 Bacteria 8586
1321 Ga0496117_0011377 3300048920 Bacteria 7975
1322 Ga0496117_0011922 3300048920 Bacteria 7727
1323 Ga0496117_0016158 3300048920 Bacteria 6312
1324 Ga0496117_0016430 3300048920 Bacteria 6247
1325 Ga0496117_0020422 3300048920 Bacteria 5399
1326 Ga0496117_0029491 3300048920 Bacteria 4228
1327 Ga0496117_0033375 3300048920 Bacteria 3893
1328 Ga0496117_0034171 3300048920 Bacteria 3835
1329 Ga0496117_0041020 3300048920 Bacteria 3396
1330 Ga0496117_0067256 3300048920 Bacteria 2426
1331 Ga0496118_0000072 3300048921 Bacteria 201387
1332 Ga0496118_0000078 3300048921 Bacteria 190946
1333 Ga0496118_0000323 3300048921 Bacteria 82847
1334 Ga0496118_0000805 3300048921 Bacteria 50087
1335 Ga0496118_0001319 3300048921 Bacteria 37658
1336 Ga0496118_0002349 3300048921 Bacteria 25650
1337 Ga0496118_0002434 3300048921 Bacteria 25050
1338 Ga0496118_0003571 3300048921 Bacteria 19383
1339 Ga0496118_0003732 3300048921 Bacteria 18850
1340 Ga0496118_0004028 3300048921 Bacteria 17860
1341 Ga0496118_0004806 3300048921 Bacteria 15762
1342 Ga0496118_0010083 3300048921 Bacteria 9399
1343 Ga0496118_0019204 3300048921 Bacteria 6117
1344 Ga0496118_0024222 3300048921 Bacteria 5248
1345 Ga0496118_0044124 3300048921 Bacteria 3494
1346 Ga0496118_0108077 3300048921 Bacteria 1855
1347 Ga0496118_0108324 3300048921 Bacteria 1852
1348 Ga0496118_0128321 3300048921 Bacteria 1634
1349 Ga0496119_0000080 3300048922 Bacteria 139962
1350 Ga0496119_0000082 3300048922 Bacteria 138565
1351 Ga0496119_0000188 3300048922 Bacteria 87312
1352 Ga0496119_0000741 3300048922 Bacteria 43950
1353 Ga0496119_0001826 3300048922 Bacteria 24657
1354 Ga0496119_0002279 3300048922 Bacteria 21256
1355 Ga0496119_0003650 3300048922 Bacteria 15798
1356 Ga0496119_0005070 3300048922 Bacteria 12787
1357 Ga0496119_0010220 3300048922 Bacteria 7919
1358 Ga0496119_0019431 3300048922 Bacteria 5005
1359 Ga0496119_0024522 3300048922 Bacteria 4240
1360 Ga0496119_0037150 3300048922 Bacteria 3168
1361 Ga0496119_0037522 3300048922 Bacteria 3146
1362 Ga0496119_0043055 3300048922 Bacteria 2857
1363 Ga0496120_0000062 3300048923 Bacteria 172365
1364 Ga0496120_0000075 3300048923 Bacteria 163540
1365 Ga0496120_0000252 3300048923 Bacteria 89838
1366 Ga0496120_0000302 3300048923 Bacteria 82387
1367 Ga0496120_0000389 3300048923 Bacteria 70922
1368 Ga0496120_0000873 3300048923 Bacteria 42650
1369 Ga0496120_0001166 3300048923 Bacteria 33619
1370 Ga0496120_0001718 3300048923 Bacteria 24948
1371 Ga0496120_0001877 3300048923 Bacteria 23391
1372 Ga0496120_0001913 3300048923 Bacteria 22983
1373 Ga0496120_0002608 3300048923 Bacteria 17868
1374 Ga0496120_0003866 3300048923 Bacteria 13143
1375 Ga0496120_0013125 3300048923 Bacteria 5597
1376 Ga0496120_0019805 3300048923 Bacteria 4292
1377 Ga0496121_0000047 3300048924 Bacteria 335768
1378 Ga0496121_0000372 3300048924 Bacteria 92348
1379 Ga0496121_0001119 3300048924 Bacteria 47137
1380 Ga0496121_0001155 3300048924 Bacteria 46296
1381 Ga0496121_0001222 3300048924 Bacteria 44730
1382 Ga0496121_0001386 3300048924 Bacteria 41013
1383 Ga0496121_0002320 3300048924 Bacteria 29478
1384 Ga0496121_0003763 3300048924 Bacteria 21231
1385 Ga0496121_0004640 3300048924 Bacteria 18268
1386 Ga0496121_0007722 3300048924 Bacteria 12904
1387 Ga0496121_0011325 3300048924 Bacteria 9924
1388 Ga0496121_0018539 3300048924 Bacteria 7011
1389 Ga0496121_0020831 3300048924 Bacteria 6461
1390 Ga0496121_0022151 3300048924 Bacteria 6180
1391 Ga0496121_0029481 3300048924 Bacteria 5073
1392 Ga0496122_0000108 3300048925 Bacteria 191029
1393 Ga0496122_0000571 3300048925 Bacteria 75468
1394 Ga0496122_0000887 3300048925 Bacteria 55765
1395 Ga0496122_0001367 3300048925 Bacteria 39674
1396 Ga0496122_0002008 3300048925 Bacteria 30259
1397 Ga0496122_0002062 3300048925 Bacteria 29793
1398 Ga0496122_0004208 3300048925 Bacteria 18095
1399 Ga0496122_0005674 3300048925 Bacteria 14730
1400 Ga0496122_0023966 3300048925 Bacteria 5357
1401 Ga0496122_0031823 3300048925 Bacteria 4378
1402 Ga0496122_0037693 3300048925 Bacteria 3886
1403 Ga0496122_0040628 3300048925 Bacteria 3692
1404 Ga0496122_0045803 3300048925 Bacteria 3394
1405 Ga0496123_0000065 3300048926 Bacteria 211758
1406 Ga0496123_0000180 3300048926 Bacteria 127726
1407 Ga0496123_0000430 3300048926 Bacteria 75549
1408 Ga0496123_0000508 3300048926 Bacteria 67759
1409 Ga0496123_0000605 3300048926 Bacteria 60923
1410 Ga0496123_0001152 3300048926 Bacteria 39412
1411 Ga0496123_0002413 3300048926 Bacteria 23311
1412 Ga0496123_0002626 3300048926 Bacteria 21790
1413 Ga0496123_0003036 3300048926 Bacteria 19348
1414 Ga0496123_0007845 3300048926 Bacteria 9928
1415 Ga0496123_0027357 3300048926 Bacteria 4249
1416 Ga0496123_0031828 3300048926 Bacteria 3829
1417 Ga0496123_0036535 3300048926 Bacteria 3482
1418 Ga0496123_0037297 3300048926 Bacteria 3433
1419 Ga0496123_0039355 3300048926 Bacteria 3308
1420 Ga0496123_0040890 3300048926 Bacteria 3221
1421 Ga0496124_0000053 3300048927 Bacteria 252285
1422 Ga0496124_0000120 3300048927 Bacteria 163899
1423 Ga0496124_0000147 3300048927 Bacteria 145724
1424 Ga0496124_0000474 3300048927 Bacteria 69115
1425 Ga0496124_0001035 3300048927 Bacteria 43988
1426 Ga0496124_0001108 3300048927 Bacteria 42354
1427 Ga0496124_0001901 3300048927 Bacteria 28695
1428 Ga0496124_0002123 3300048927 Bacteria 26679
1429 Ga0496124_0003341 3300048927 Bacteria 19748
1430 Ga0496124_0003710 3300048927 Bacteria 18436
1431 Ga0496124_0003980 3300048927 Bacteria 17612
1432 Ga0496124_0004161 3300048927 Bacteria 17075
1433 Ga0496124_0004499 3300048927 Bacteria 16259
1434 Ga0496124_0007018 3300048927 Bacteria 12070
1435 Ga0496124_0013002 3300048927 Bacteria 8159
1436 Ga0496124_0014377 3300048927 Bacteria 7652
1437 Ga0496124_0025110 3300048927 Bacteria 5403
1438 Ga0496124_0027366 3300048927 Bacteria 5119
1439 Ga0496124_0034290 3300048927 Bacteria 4456
1440 Ga0496124_0041873 3300048927 Bacteria 3947
1441 Ga0496124_0061209 3300048927 Bacteria 3156
1442 Ga0496124_0110635 3300048927 Bacteria 2211
1443 Ga0496124_0120650 3300048927 Bacteria 2095
1444 Ga0496124_0190440 3300048927 Bacteria 1570
1445 Ga0496125_0000799 3300048928 Bacteria 51395
1446 Ga0496125_0001606 3300048928 Bacteria 31934
1447 Ga0496125_0001971 3300048928 Bacteria 27913
1448 Ga0496125_0003554 3300048928 Bacteria 18777
1449 Ga0496125_0006712 3300048928 Bacteria 12375
1450 Ga0496125_0007902 3300048928 Bacteria 11232
1451 Ga0496125_0009754 3300048928 Bacteria 9800
1452 Ga0496125_0015469 3300048928 Bacteria 7376
1453 Ga0496125_0016979 3300048928 Bacteria 6959
1454 Ga0496125_0053126 3300048928 Bacteria 3325
1455 Ga0496125_0086737 3300048928 Bacteria 2366
1456 Ga0496126_0000387 3300048929 Bacteria 91081
1457 Ga0496126_0000759 3300048929 Bacteria 58398
1458 Ga0496126_0001894 3300048929 Bacteria 30181
1459 Ga0496126_0007665 3300048929 Bacteria 11782
1460 Ga0496126_0024453 3300048929 Bacteria 5832
1461 Ga0496126_0061634 3300048929 Bacteria 3369
1462 Ga0496126_0065253 3300048929 Bacteria 3258
1463 Ga0496126_0120013 3300048929 Bacteria 2281
1464 Ga0496126_0150556 3300048929 Bacteria 1994
1465 Ga0501310_000600 3300049130 Bacteria 3168
1466 Ga0495678_000006 3300049459 Bacteria 463690
1467 Ga0495678_000017 3300049459 Bacteria 282592
1468 Ga0495678_000104 3300049459 Bacteria 103726
1469 Ga0495678_000283 3300049459 Bacteria 55712
1470 Ga0495678_000326 3300049459 Bacteria 50497
1471 Ga0495678_000365 3300049459 Bacteria 46300
1472 Ga0495678_000693 3300049459 Bacteria 30734
1473 Ga0495678_001927 3300049459 Bacteria 15036
1474 Ga0495678_002423 3300049459 Bacteria 12682
1475 Ga0495678_003240 3300049459 Bacteria 10196
1476 Ga0495678_011539 3300049459 Bacteria 4224
1477 Ga0495678_014280 3300049459 Bacteria 3698
1478 Ga0495678_019135 3300049459 Bacteria 3062
1479 Ga0495682_0000015 3300049460 Bacteria 235048
1480 Ga0495682_0000182 3300049460 Bacteria 51816
1481 Ga0495682_0000188 3300049460 Bacteria 50664
1482 Ga0495682_0000659 3300049460 Bacteria 22954
1483 Ga0495682_0001301 3300049460 Bacteria 13876
1484 Ga0495682_0008465 3300049460 Bacteria 4051
1485 Ga0495682_0046868 3300049460 Bacteria 1577
1486 Ga0501290_003355 3300049513 Bacteria 2026
1487 Ga0501033_0131466 3300049570 Bacteria 1813
1488 Ga0501034_0000022 3300049571 Bacteria 264441
1489 Ga0501039_0103735 3300049575 Bacteria 2220
1490 Ga0501040_0031538 3300049576 Bacteria 3583
1491 Ga0501041_0173745 3300049577 Bacteria 1348
1492 Ga0501047_0157899 3300049581 Bacteria 2140
1493 Ga0501047_0158279 3300049581 Bacteria 2137
1494 Ga0501067_0006864 3300049583 Bacteria 6316
1495 Ga0501068_0071169 3300049584 Bacteria 2123
1496 Ga0501070_0017528 3300049586 Bacteria 6013
1497 Ga0501073_0101121 3300049589 Bacteria 2001
1498 Ga0501075_0003850 3300049591 Bacteria 10103
1499 Ga0501076_0140215 3300049592 Bacteria 1964
1500 Ga0501198_000057 3300049649 Bacteria 32474
1501 Ga0501222_000017 3300049662 Bacteria 75770
1502 Ga0501079_0194910 3300049741 Bacteria 1582
1503 Ga0501080_0085223 3300049742 Bacteria 2936
1504 Ga0501080_0135208 3300049742 Bacteria 2282
1505 Ga0501080_0360148 3300049742 Bacteria 1312
1506 Ga0501081_0004297 3300049743 Bacteria 9128
1507 Ga0501083_0041654 3300049744 Bacteria 3114
1508 Ga0501269_000017 3300049766 Bacteria 57974
1509 Ga0501279_004689 3300049775 Bacteria 1795
1510 Ga0501035_0028900 3300049822 Bacteria 5059
1511 Ga0501044_0000065 3300049823 Bacteria 130072
1512 Ga0501044_0071447 3300049823 Bacteria 3529
1513 Ga0501045_0102316 3300049824 Bacteria 2121
1514 Ga0501226_000002 3300049853 Bacteria 426935
1515 nmdc:mga03683_19835_c1 3300050489 Bacteria 2571
1516 nmdc:mga03n38_55249_c1 3300050490 Bacteria 1788
1517 nmdc:mga00v17_36076_c1 3300050491 Bacteria 2945
1518 nmdc:mga00v17_71435_c1 3300050491 Bacteria 2151
1519 nmdc:mga00v17_97385_c1 3300050491 Bacteria 1854
1520 nmdc:mga05p37_135694_c1 3300050507 Bacteria 3018
1521 nmdc:mga05p37_267918_c1 3300050507 Bacteria 2042
1522 nmdc:mga05p37_29695_c1 3300050507 Bacteria 6671
1523 nmdc:mga05p37_50989_c1 3300050507 Bacteria 5089
1524 nmdc:mga05p37_53352_c1 3300050507 Bacteria 4972
1525 nmdc:mga0qj67_199974_c1 3300050509 Bacteria 1624
1526 nmdc:mga06r32_37200_c1 3300050510 Bacteria 4604
1527 nmdc:mga08y16_23075_c1 3300050511 Bacteria 6570
1528 nmdc:mga0n895_155737_c1 3300050512 Bacteria 2315
1529 nmdc:mga0n895_185107_c1 3300050512 Bacteria 2114
1530 nmdc:mga0n895_2762_c1 3300050512 Bacteria 13867
1531 nmdc:mga0rr50_137777_c1 3300050513 Bacteria 1961
1532 nmdc:mga0rr50_300850_c1 3300050513 Bacteria 1342
1533 nmdc:mga0rr50_48426_c1 3300050513 Bacteria 3141
1534 nmdc:mga0a205_135148_c1 3300050515 Bacteria 2366
1535 nmdc:mga0a205_188559_c1 3300050515 Bacteria 1955
1536 nmdc:mga0a205_29557_c1 3300050515 Bacteria 5245
1537 nmdc:mga0a205_320295_c1 3300050515 Bacteria 1422
1538 nmdc:mga0a205_3269_c1 3300050515 Bacteria 14415
1539 nmdc:mga0a205_56645_c1 3300050515 Bacteria 3784
1540 Ga0495601_0019691 3300053077 Bacteria 4118
1541 Ga0500635_0000026 3300053080 Bacteria 104983
1542 Ga0500593_000035 3300053117 Bacteria 48133
1543 Ga0500595_002138 3300053119 Bacteria 10061
1544 Ga0500621_000001 3300053126 Bacteria 1049698
1545 Ga0500637_0005602 3300053178 Bacteria 6103
1546 Ga0501084_0036114 3300054114 Bacteria 4129
1547 Ga0501084_0256612 3300054114 Bacteria 1476
1548 Ga0501082_0003999 3300060353 Bacteria 12869
1549 Ga0501082_0042873 3300060353 Bacteria 3900
1550 Ga0501082_0063221 3300060353 Bacteria 3187
1551 Ga0530510_0095888 3300061734 Bacteria 2167
1552 Ga0530510_0129518 3300061734 Bacteria 1856
1553 2506576871 2506520007 Bacteria 5442880
1554 2506582009 2506520008 Bacteria 5443009
1555 2508850838 2508501071 Bacteria 5454741
1556 2510284326 2510065053 Bacteria 5005518
1557 2510292985 2510065055 Bacteria 5037935
1558 2510312491 2510065058 Bacteria 5005894
1559 2511249807 2511231003 Bacteria 5606035
1560 2511254732 2511231004 Bacteria 6669789
1561 2511265543 2511231006 Bacteria 6794709
1562 2511288797 2511231010 Bacteria 6373152
1563 2511297336 2511231011 Bacteria 6149768
1564 2511301703 2511231012 Bacteria 6738011
1565 2511316727 2511231014 Bacteria 6462302
1566 2511319870 2511231015 Bacteria 6598026
1567 2511326036 2511231016 Bacteria 6704427
1568 2511330998 2511231017 Bacteria 6503007
1569 2511336333 2511231018 Bacteria 6436256
1570 2511344322 2511231019 Bacteria 6520662
1571 2511349103 2511231020 Bacteria 6115223
1572 2511355980 2511231021 Bacteria 7302637
1573 2511360664 2511231022 Bacteria 6719296
1574 2511366635 2511231023 Bacteria 6808468
1575 2511378561 2511231025 Bacteria 5324661
1576 2511383819 2511231026 Bacteria 5225445
1577 2511411304 2511231031 Bacteria 6558529
1578 2511434064 2511231035 Bacteria 5341610
1579 2512325944 2512047018 Bacteria 6663241
1580 2521559631 2521172590 Bacteria 5047645
1581 2525557851 2524614729 Bacteria 3091755
1582 2538428561 2537561728 Bacteria 5149301
1583 2548648152 2547132416 Bacteria 4633861
1584 2550696104 2548876994 Bacteria 4904866
1585 2553006337 2551306416 Bacteria 6152985
1586 2555245734 2554235231 Bacteria 5215788
1587 2555667407 2554235341 Bacteria 6867980
1588 2583789815 2582580891 Bacteria 6800976
1589 2585829815 2585427591 Bacteria 5482980
1590 2585833522 2585427592 Bacteria 5370892
1591 2597855651 2597489887 Bacteria 6666321
1592 2597861652 2597489888 Bacteria 6179543
1593 2597867377 2597489889 Bacteria 6297495
1594 2599327433 2599185155 Bacteria 5827168
1595 2599356630 2599185160 Bacteria 6844013
1596 2599363340 2599185161 Bacteria 6960462
1597 2599369708 2599185162 Bacteria 6957254
1598 2599376449 2599185163 Bacteria 6995158
1599 2599381735 2599185164 Bacteria 6841688
1600 2599388121 2599185165 Bacteria 6843250
1601 2599395355 2599185166 Bacteria 6959206
1602 2599398861 2599185167 Bacteria 6353609
1603 2599407120 2599185168 Bacteria 6997636
1604 2599411756 2599185169 Bacteria 5441380
1605 2599450916 2599185179 Bacteria 6611171
1606 2599463463 2599185181 Bacteria 6844519
1607 2599469187 2599185182 Bacteria 6883168
1608 2599485553 2599185185 Bacteria 6652270
1609 2599492480 2599185186 Bacteria 6831633
1610 2599506418 2599185189 Bacteria 5862825
1611 2599514138 2599185190 Bacteria 6285678
1612 2599518739 2599185191 Bacteria 6297582
1613 2599806682 2599185257 Bacteria 6492581
1614 2599882654 2599185288 Bacteria 6666191
1615 2599893527 2599185290 Bacteria 6289611
1616 2599928045 2599185299 Bacteria 4854625
1617 2599950769 2599185303 Bacteria 6512725
1618 2600216092 2599185356 Bacteria 6843884
1619 2600364894 2600254931 Bacteria 6734225
1620 2601524571 2600255254 Bacteria 5281859
1621 2601529725 2600255255 Bacteria 5282785
1622 2601534625 2600255256 Bacteria 5597742
1623 2601539210 2600255257 Bacteria 5597196
1624 2601616559 2600255280 Bacteria 5292309
1625 2601621281 2600255281 Bacteria 5288753
1626 2601645132 2600255287 Bacteria 5210468
1627 2601649678 2600255288 Bacteria 5282738
1628 2601654605 2600255289 Bacteria 5281907
1629 2601660121 2600255290 Bacteria 5282218
1630 2601664373 2600255291 Bacteria 5217298
1631 2601667293 2600255292 Bacteria 6300551
1632 2601692337 2600255296 Bacteria 5784754
1633 2601698094 2600255298 Bacteria 5215185
1634 2601702462 2600255299 Bacteria 5218662
1635 2601707349 2600255300 Bacteria 5287774
1636 2601712370 2600255301 Bacteria 5280532
1637 2601717866 2600255302 Bacteria 5288235
1638 2601722965 2600255303 Bacteria 5219315
1639 2601727794 2600255304 Bacteria 5283973
1640 2601732811 2600255305 Bacteria 5282329
1641 2601737420 2600255306 Bacteria 5281613
1642 2601741839 2600255307 Bacteria 5439064
1643 2601752737 2600255309 Bacteria 5431045
1644 2601757559 2600255310 Bacteria 5600903
1645 2601763918 2600255311 Bacteria 5598766
1646 2601776259 2600255313 Bacteria 6842543
1647 2601797823 2600255318 Bacteria 6383414
1648 2602008632 2600255389 Bacteria 5275336
1649 2602019691 2600255392 Bacteria 5437392
1650 2603640265 2602042046 Bacteria 5483348
1651 2603645947 2602042047 Bacteria 4697674
1652 2603662537 2602042052 Bacteria 5215873
1653 2603667433 2602042053 Bacteria 5214361
1654 2603701833 2602042066 Bacteria 4423871
1655 2603706458 2602042067 Bacteria 4863713
1656 2603840220 2602042103 Bacteria 5284714
1657 2603845297 2602042104 Bacteria 5281639
1658 2603850370 2602042105 Bacteria 5282303
1659 2603855438 2602042106 Bacteria 5282744
1660 2603868299 2602042109 Bacteria 5152801
1661 2603873114 2602042110 Bacteria 5283285
1662 2603878244 2602042111 Bacteria 5212080
1663 2606050199 2603880178 Bacteria 5283018
1664 2606071861 2603880184 Bacteria 5217896
1665 2606076694 2603880185 Bacteria 6379190
1666 2606128892 2603880199 Bacteria 6377649
1667 2606147882 2603880202 Bacteria 5284684
1668 2606178183 2603880211 Bacteria 5284226
1669 2608668994 2608642108 Bacteria 4104624
1670 2621302188 2619619299 Bacteria 6649820
1671 2624478212 2623620443 Bacteria 6427864
1672 2630650182 2627854209 Bacteria 3093011
1673 2643791609 2643221554 Bacteria 6603920
1674 2643840980 2643221565 Bacteria 6216018
1675 2643872629 2643221571 Bacteria 6228673
1676 2643954911 2643221589 Bacteria 6250934
1677 2644024551 2643221602 Bacteria 6249926
1678 2644060851 2643221609 Bacteria 6756331
1679 2644074530 2643221611 Bacteria 6820941
1680 2644186112 2643221633 Bacteria 6733554
1681 2644252445 2643221645 Bacteria 7207331
1682 2644619638 2643221713 Bacteria 6554480
1683 2650896933 2648501693 Bacteria 5069560
1684 2656279243 2654587920 Bacteria 5475511
1685 2671099980 2667528171 Bacteria 6900659
1686 2671105339 2667528172 Bacteria 5170840
1687 2671107457 2667528173 Bacteria 5375747
1688 2671586449 2671180115 Bacteria 5353919
1689 2671772333 2671180172 Bacteria 6495783
1690 2676408836 2675903046 Bacteria 5451247
1691 2677898964 2675903420 Bacteria 6247433
1692 2681998867 2681812866 Bacteria 4552357
1693 2682009716 2681812869 Bacteria 5014465
1694 2689443270 2687453601 Bacteria 5546041
1695 2712472076 2711768156 Bacteria 4471618
1696 2715749197 2713897148 Bacteria 5883533
1697 2715755467 2713897149 Bacteria 6506249
1698 2718632149 2718217725 Bacteria 5758958
1699 2722884172 2721755523 Bacteria 6430384
1700 2723246550 2721755607 Bacteria 5841722
1701 2738674077 2738541265 Bacteria 6594665
1702 2738714086 2738541276 Bacteria 4690596
1703 2738752470 2738541282 Bacteria 6593925
1704 2738807917 2738541294 Bacteria 6925949
1705 2738861511 2738541303 Bacteria 6591772
1706 2738895277 2738541309 Bacteria 6926455
1707 2739198017 2738543004 Bacteria 6381073
1708 2739260307 2738543015 Bacteria 6750701
1709 2739288602 2738543020 Bacteria 5718238
1710 2739293914 2738543021 Bacteria 5718241
1711 2739311270 2738543025 Bacteria 6600348
1712 2740995155 2740891818 Bacteria 6711283
1713 2743735068 2740892503 Bacteria 6855563
1714 2753857964 2751185917 Bacteria 4551186
1715 2765591130 2765235842 Bacteria 4799256
1716 2774119571 2773857670 Bacteria 6407454
1717 2774131506 2773857672 Bacteria 4993178
1718 2774134727 2773857673 Bacteria 6513460
1719 2775542817 2775506706 Bacteria 4873073
1720 2784261057 2784132063 Bacteria 6262788
1721 2784315982 2784132072 Bacteria 6596533
1722 2791922865 2791354903 Bacteria 4937680
1723 2808905445 2808606373 Bacteria 4423627
1724 2808932167 2808606377 Bacteria 6646337
1725 2808939695 2808606379 Bacteria 5022697
1726 2808954232 2808606381 Bacteria 6646461
1727 2808955859 2808606382 Bacteria 6841132
1728 2808976670 2808606385 Bacteria 6711065
1729 2808991892 2808606388 Bacteria 6706662
1730 2809124181 2808606414 Bacteria 4917181
1731 2809217967 2808606445 Bacteria 6057339
1732 2812370168 2811994881 Bacteria 6298475
1733 2813726510 2811995292 Bacteria 5303342
1734 2814693884 2814123068 Bacteria 5687681
1735 2816476018 2816332133 Bacteria 7249298
1736 2817488402 2816332298 Bacteria 6852809
1737 2819541021 2818991436 Bacteria 5376622
1738 2819592228 2818991445 Bacteria 4955017
1739 2819657221 2818991456 Bacteria 6123676
1740 2819705204 2818991464 Bacteria 6907494
1741 2821122417 2821118458 Bacteria 4714306
1742 2823378106 2823373977 Bacteria 4779415
1743 2823425513 2823421272 Bacteria 5372474
1744 2826586887 2826581358 Bacteria 5963467
1745 2834032221 2834028612 Bacteria 6354979
1746 2839098070 2839094727 Bacteria 5534556
1747 2842714483 2842711865 Bacteria 7155354
1748 2842807122 2842805378 Bacteria 5385175
1749 2842816704 2842815866 Bacteria 5947510
1750 2842832075 2842826826 Bacteria 5974129
1751 2842834149 2842832357 Bacteria 5959113
1752 2842838625 2842837860 Bacteria 6066181
1753 2842846374 2842843487 Bacteria 6004777
1754 2842852247 2842849001 Bacteria 5924277
1755 2844530455 2844528606 Bacteria 4733806
1756 2844667887 2844665904 Bacteria 6817974
1757 2846041917 2846037992 Bacteria 4526407
1758 2847801382 2847797336 Bacteria 5176640
1759 2852617066 2852612431 Bacteria 6885235
1760 2852660462 2852657418 Bacteria 6472974
1761 2852671945 2852667396 Bacteria 6885555
1762 2854603544 2854601825 Bacteria 4797592
1763 2855199489 2855195626 Bacteria 4927512
1764 2857552516 2857547612 Bacteria 6179999
1765 2857553516 2857553236 Bacteria 6166726
1766 2857561589 2857558681 Bacteria 6617694
1767 2857565152 2857564685 Bacteria 6290584
1768 2858470370 2858466076 Bacteria 4722413
1769 2860343652 2860339153 Bacteria 6846989
1770 2860868426 2860867994 Bacteria 5645326
1771 2865015603 2865014394 Bacteria 4764573
1772 2869552676 2869551831 Bacteria 5474685
1773 2871274681 2871272651 Bacteria 5042015
1774 2871284339 2871282230 Bacteria 4917173
1775 2876602015 2876601092 Bacteria 5114497
1776 2878030155 2878029506 Bacteria 6418441
1777 2880231102 2880230671 Bacteria 6140320
1778 2881612359 2881609920 Bacteria 4405319
1779 2883357789 2883354860 Bacteria 5865246
1780 2884089542 2884086401 Bacteria 5005459
1781 2884341550 2884338543 Bacteria 4610696
1782 2884816675 2884811622 Bacteria 5552861
1783 2884840345 2884836552 Bacteria 5219991
1784 2884855601 2884852848 Bacteria 5221161
1785 2885081624 2885080285 Bacteria 6355622
1786 2888371068 2888366609 Bacteria 5155009
1787 2888374850 2888373701 Bacteria 5098052
1788 2891672624 2891670763 Bacteria 4967099
1789 2894513814 2894510363 Bacteria 5121143
1790 2896157473 2896154374 Bacteria 5221518
1791 2900054867 2900051742 Bacteria 4985156
1792 2904426461 2904424332 Bacteria 7633521
1793 2904443255 2904439833 Bacteria 5931679
1794 2904476405 2904474040 Bacteria 5504324
1795 2904506839 2904504865 Bacteria 5152820
1796 2904519561 2904518522 Bacteria 6068986
1797 2904532964 2904530477 Bacteria 5876334
1798 2904552169 2904550169 Bacteria 6221258
1799 2904585516 2904584206 Bacteria 6028872
1800 2904593865 2904589729 Bacteria 6113573
1801 2904603984 2904601388 Bacteria 5884906
1802 2908447019 2908446538 Bacteria 6829095
1803 2917071158 2917070673 Bacteria 6868303
1804 2917836390 2917832318 Bacteria 5346010
1805 2919066163 2919063839 Bacteria 6302690
1806 2919081781 2919079590 Bacteria 5946433
1807 2919127477 2919125081 Bacteria 5385106
1808 2919152574 2919150387 Bacteria 5500879
1809 2919155799 2919155634 Bacteria 4860545
1810 2919389787 2919385768 Bacteria 5897293
1811 2919459975 2919456309 Bacteria 6586567
1812 2919481394 2919476304 Bacteria 5888696
1813 2919488714 2919487758 Bacteria 5929766
1814 2919493773 2919493220 Bacteria 4598500
1815 2919500915 2919497567 Bacteria 4408621
1816 2919502248 2919501602 Bacteria 5286340
1817 2919545657 2919543075 Bacteria 4728703
1818 2919708489 2919704043 Bacteria 5560311
1819 2923154063 2923153595 Bacteria 6870622
1820 2923513407 2923510766 Bacteria 5926163
1821 2923524259 2923519811 Bacteria 6298479
1822 2926063921 2926063275 Bacteria 5285848
1823 2927145243 2927143783 Bacteria 5504251
1824 2927836566 2927833300 Bacteria 4923934
1825 2928134053 2928130867 Bacteria 5467269
1826 2929190291 2929189879 Bacteria 5930554
1827 2931391370 2931390751 Bacteria 6273349
1828 2931398829 2931396565 Bacteria 7251677
1829 2935358986 2935353572 Unclassified 6955622
1830 2937540137 2937539931 Bacteria 4639830
1831 2939572156 2939568625 Bacteria 4542555
1832 2939602563 2939602548 Bacteria 4950493
1833 2939611490 2939607340 Bacteria 4719256
1834 2939641103 2939636861 Bacteria 6297853
1835 2939646468 2939642701 Bacteria 4475280
1836 2941472993 2941471342 Bacteria 5018624
1837 2945876184 2945874760 Bacteria 5527237
1838 2945930176 2945928738 Bacteria 6053221
1839 2945953496 2945951305 Bacteria 4918162
1840 2945967580 2945961074 Bacteria 7342064
1841 2946012523 2946006987 Bacteria 6705746
1842 2946028634 2946027586 Bacteria 6049274
1843 2947235161 2947233263 Bacteria 6439278
1844 2969304948 2969304461 Bacteria 6601805
1845 2974293360 2974289157 Bacteria 6080362
1846 2974314638 2974310843 Bacteria 4947816
1847 2978975988 2978975091 Bacteria 4704313
1848 2984291996 2984286254 Bacteria 6702062
1849 2984498214 2984494565 Bacteria 5000175
1850 2984500685 2984499530 Bacteria 5020881
1851 2984507208 2984504281 Bacteria 5262371
1852 2990265534 2990261002 Bacteria 4919493
1853 2998140451 2998139840 Bacteria 6073514
1854 3007255357 3007252601 Bacteria 4559114
1855 3007315837 3007315729 Bacteria 5076637
1856 3007399614 3007395558 Bacteria 6755444
1857 3007420013 3007419365 Bacteria 7026924
1858 3007517896 3007511990 Bacteria 6481491
1859 3007618665 3007614139 Bacteria 6053559
1860 3007624999 3007619802 Bacteria 6411688
1861 3007721212 3007718800 Bacteria 5971527
1862 3007859691 3007855910 Bacteria 5637581
1863 3007864336 3007861166 Bacteria 6045338
1864 637317804 637000220 Bacteria 7074893
1865 640936423 640753048 Bacteria 5495657
1866 8001522612 8001522603 Bacteria 4726425
1867 8015688312 8015687852 Bacteria 6613826
1868 8016736393 8016733728 Bacteria 5274317
1869 8018223139 8018221730 Bacteria 4616064
1870 8018408855 8018405270 Bacteria 4978981
1871 8019503064 8019499862 Bacteria 5169538
1872 8019770298 8019769354 Bacteria 6924660
1873 8030000287 8029995093 Bacteria 5990776
1874 8047673315 8047673197 Bacteria 7395230
1875 8054291514 8054285046 Bacteria 6919322
1876 8054350140 8054347763 Bacteria 5901107
1877 8054503957 8054503363 Bacteria 6101651
1878 8054846290 8054844752 Bacteria 4450330
1879 8054850416 8054849141 Bacteria 5232694
1880 8055092398 8055087960 Bacteria 4784273
1881 8055093595 8055092621 Bacteria 4873875
1882 8055097674 8055097453 Bacteria 4865496
1883 8055771409 8055770955 Bacteria 6827675
1884 8055818353 8055817908 Bacteria 6609162
1885 8056126464 8056125926 Bacteria 6228218
1886 8056132327 8056131705 Bacteria 6107031
1887 8056152467 8056148874 Bacteria 6479865
1888 8056164333 8056161164 Bacteria 6106669
1889 8056170600 8056166840 Bacteria 5820959
1890 8056183052 8056177738 Bacteria 6748268
1891 8056572310 8056569372 Bacteria 5997322
1892 8057307969 8057304971 Bacteria 4649742
1893 8057802700 8057798959 Bacteria 6713499
1894 Ga0055526_1007031
1895 MRS2a_Contig_66
1896 SwRhRL2b_contig_111498
1897 SwRhRL2b_contig_3150169
1898 SwRhRL2b_contig_677248
1899 JGI24736J21556_1001491
1900 JGI25162J39368_1000002
1901 JGI25162J39368_1000140
1902 JGI25162J39368_1000181
1903 JGI25154J39366_1000156
1904 JGI25154J39366_1000230
1905 JGI25154J39366_1001243
1906 JGI25157J39369_1000127
1907 JGI25157J39369_1000241
1908 JGI25163J39215_1000166
1909 JGI25163J39215_1000195
1910 JGI25163J39215_1000805
1911 JGI25163J39215_1001748
1912 JGI25164J39214_1000066
1913 JGI25164J39214_1000110
1914 JGI25164J39214_1000146
1915 JGI25152J39213_1000052
1916 JGI25150J39212_1000260
1917 JGI25150J39212_1000643
1918 JGI25159J45721_1010505
1919 JGI25165J46597_1000001
1920 JGI25165J46597_1000228
1921 JGI25165J46597_1000267
1922 JGI25153J46596_10018456
1923 JGI25153J46596_10020340
1924 rootH1_10077162
1925 rootH2_10034969
1926 rootL2_10018704
1927 rootH1_10009899
1928 rootH1_10025721
1929 JGI25160J50197_1011257
1930 JGI25161J50226_1000052
1931 JGI25161J50226_1005753
1932 Ga0055538_1000001
1933 Ga0055538_1000003
1934 Ga0055538_1000037
1935 Ga0055538_1000057
1936 Ga0055539_1000001
1937 Ga0055539_1000003
1938 Ga0055539_1000048
1939 Ga0055539_1000088
1940 Ga0055539_1000405
1941 Ga0055533_1000003
1942 Ga0055533_1000005
1943 Ga0055533_1000024
1944 Ga0055533_1000059
1945 Ga0055533_1000096
1946 Ga0055532_1000015
1947 Ga0055532_1000105
1948 Ga0055525_1000005
1949 Ga0055525_1000057
1950 Ga0055525_1000087
1951 Ga0055525_1000128
1952 Ga0055525_1000129
1953 Ga0055525_1000778
1954 Ga0055535_1005791
1955 Ga0055526_1000066
1956 Ga0055526_1000100
1957 Ga0055537_1001797
1958 Ga0055524_1000383
1959 Ga0055524_1001387
1960 Ga0055536_1000392
1961 Ga0055536_1000624
1962 Ga0055530_10000050
1963 Ga0055530_10000333
1964 Ga0055530_10001393
1965 Ga0055530_10006688
1966 Ga0055530_10020690
1967 Ga0055540_1000279
1968 Ga0055540_1001037
1969 Ga0055531_10000321
1970 Ga0055531_10000334
1971 Ga0055541_1000001
1972 Ga0055541_1000003
1973 Ga0055541_1000035
1974 Ga0055541_1000059
1975 Ga0058692_1000467
1976 Ga0058692_1000511
1977 Ga0058692_1000526
1978 Ga0058692_1000596
1979 Ga0058692_1005707
1980 Ga0055543_1000038
1981 Ga0065165_1000117
1982 Ga0065714_10002942
1983 Ga0065714_10066785
1984 Ga0065714_10118969
1985 Ga0065704_10000264
1986 Ga0065704_10005832
1987 Ga0065704_10070138
1988 Ga0065704_10070840
1989 Ga0065704_10117084
1990 Ga0065712_10002256
1991 Ga0065707_10004433
1992 Ga0070658_10051357
1993 Ga0070690_100009303
1994 Ga0070670_100002353
1995 Ga0068869_100004475
1996 Ga0068869_100259175
1997 Ga0070666_10129865
1998 Ga0070660_100061895
1999 Ga0070661_100000078
2000 Ga0070669_100000221
2001 Ga0070669_100001965
2002 Ga0070673_100002270
2003 Ga0070673_100206336
2004 Ga0070688_100140697
2005 Ga0070659_100009757
2006 Ga0070659_100022514
2007 Ga0070714_100002975
2008 Ga0070711_100039163
2009 Ga0070705_100051014
2010 Ga0070708_100046554
2011 Ga0070662_100000095
2012 Ga0070706_100206242
2013 Ga0070707_100068328
2014 Ga0068853_100000089
2015 Ga0068853_100135139
2016 Ga0070696_100059361
2017 Ga0070665_100000117
2018 Ga0070665_100302846
2019 Ga0068855_100002195
2020 Ga0068855_100066169
2021 Ga0070664_100000391
2022 Ga0070664_100014872
2023 Ga0070664_100119058
2024 Ga0068857_100000006
2025 Ga0068857_100001885
2026 Ga0068857_100369670
2027 Ga0068854_100005598
2028 Ga0068856_100005894
2029 Ga0068861_100005127
2030 Ga0068851_10000024
2031 Ga0068851_10001161
2032 Ga0068863_100104359
2033 Ga0068860_100032190
2034 Ga0068860_100225729
2035 Ga0068862_100142116
2036 Ga0081455_10000094
2037 Ga0081538_10002691
2038 Ga0075364_10000923
2039 Ga0075364_10008290
2040 Ga0075364_10044409
2041 Ga0075364_10074101
2042 Ga0075432_10033245
2043 Ga0070712_100074217
2044 Ga0097621_100023910
2045 Ga0068871_100012427
2046 Ga0075431_100041519
2047 Ga0075431_100110820
2048 Ga0075431_100269780
2049 Ga0075433_10002631
2050 Ga0075433_10025385
2051 Ga0075434_100025667
2052 Ga0075434_100069988
2053 Ga0075429_100095061
2054 Ga0079104_1000078
2055 Ga0079104_1000130
2056 Ga0079104_1000296
2057 Ga0079104_1000398
2058 Ga0079104_1000527
2059 Ga0079104_1000564
2060 Ga0079104_1001042
2061 Ga0079104_1001578
2062 Ga0079104_1001940
2063 Ga0079104_1019295
2064 Ga0075435_100003659
2065 Ga0075435_100065755
2066 Ga0075435_100098519
2067 Ga0105251_10000113
2068 Ga0105251_10000361
2069 Ga0105251_10000488
2070 Ga0105251_10001520
2071 Ga0105251_10001591
2072 Ga0105251_10002600
2073 Ga0105251_10003514
2074 Ga0105251_10003914
2075 Ga0105251_10006822
2076 Ga0105251_10016397
2077 Ga0105251_10047549
2078 Ga0105251_10057511
2079 Ga0105244_10000021
2080 Ga0105244_10000034
2081 Ga0105244_10000557
2082 Ga0105244_10000982
2083 Ga0105244_10002091
2084 Ga0105244_10002327
2085 Ga0105244_10002351
2086 Ga0105244_10003420
2087 Ga0105244_10003749
2088 Ga0105244_10003972
2089 Ga0105244_10004754
2090 Ga0105244_10010109
2091 Ga0105244_10011859
2092 Ga0105244_10037378
2093 Ga0105244_10044227
2094 Ga0105244_10073766
2095 Ga0105250_10000004
2096 Ga0105250_10000189
2097 Ga0105250_10000211
2098 Ga0105250_10000447
2099 Ga0105250_10001416
2100 Ga0105250_10001514
2101 Ga0105250_10004436
2102 Ga0105250_10005745
2103 Ga0105250_10009521
2104 Ga0105240_10004079
2105 Ga0105240_10046807
2106 Ga0105240_10047323
2107 Ga0105240_10122372
2108 Ga0111539_10050989
2109 Ga0111539_10452857
2110 Ga0105245_10162449
2111 Ga0114129_10002450
2112 Ga0114129_10011473
2113 Ga0114129_10044965
2114 Ga0114129_10062432
2115 Ga0114129_10075748
2116 Ga0105243_10000595
2117 Ga0105243_10000918
2118 Ga0105243_10013794
2119 Ga0105243_10039308
2120 Ga0105243_10061309
2121 Ga0105243_10111717
2122 Ga0105241_10000004
2123 Ga0105241_10002206
2124 Ga0105242_10000136
2125 Ga0105242_10012557
2126 Ga0105248_10012631
2127 Ga0105248_10034319
2128 Ga0105248_10165972
2129 Ga0105237_10000939
2130 Ga0105237_10013428
2131 Ga0105237_10029202
2132 Ga0105238_10000006
2133 Ga0105238_10021866
2134 Ga0105239_10030781
2135 Ga0105239_10325231
2136 Ga0105239_10426401
2137 Ga0105246_10000042
2138 Ga0105246_10003799
2139 Ga0105246_10010036
2140 Ga0105246_10179365
2141 Ga0157373_10001463
2142 Ga0157373_10002210
2143 Ga0157373_10021939
2144 Ga0157373_10030530
2145 Ga0157373_10067906
2146 Ga0157371_10000811
2147 Ga0157371_10001070
2148 Ga0157371_10001080
2149 Ga0157371_10002984
2150 Ga0157371_10005453
2151 Ga0157371_10005644
2152 Ga0157371_10025390
2153 Ga0157371_10025844
2154 Ga0157371_10096412
2155 Ga0157370_10000150
2156 Ga0157370_10000655
2157 Ga0157370_10001869
2158 Ga0157370_10002081
2159 Ga0157370_10003150
2160 Ga0157370_10024113
2161 Ga0157370_10034674
2162 Ga0157370_10047672
2163 Ga0157370_10074019
2164 Ga0157369_10000080
2165 Ga0157369_10001555
2166 Ga0157369_10010831
2167 Ga0157369_10022077
2168 Ga0157369_10027225
2169 Ga0157369_10027876
2170 Ga0157369_10059033
2171 Ga0157378_10004257
2172 Ga0163162_10000737
2173 Ga0163162_10028226
2174 Ga0163162_10111392
2175 Ga0163162_10120879
2176 Ga0163162_10313256
2177 Ga0157372_10001529
2178 Ga0157372_10005514
2179 Ga0157372_10009617
2180 Ga0157372_10038144
2181 Ga0157375_10001875
2182 Ga0157375_10172300
2183 Ga0157375_10259389
2184 Ga0182008_10000203
2185 Ga0182008_10001562
2186 Ga0182008_10002570
2187 Ga0182008_10003277
2188 Ga0182008_10009036
2189 Ga0182008_10048080
2190 Ga0182008_10061975
2191 Ga0157379_10000183
2192 Ga0157376_10026443
2193 Ga0182006_1000002
2194 Ga0182006_1000009
2195 Ga0182006_1000021
2196 Ga0182006_1000380
2197 Ga0182006_1001000
2198 Ga0182006_1004320
2199 Ga0182006_1004510
2200 Ga0182006_1006485
2201 Ga0182006_1008456
2202 Ga0182006_1008677
2203 Ga0182006_1011832
2204 Ga0182006_1022085
2205 Ga0182006_1030459
2206 Ga0182005_1000013
2207 Ga0182005_1000070
2208 Ga0182005_1000227
2209 Ga0182005_1004756
2210 Ga0182005_1012826
2211 Ga0182005_1014570
2212 Ga0163161_10000107
2213 Ga0163161_10000719
2214 Ga0163161_10005392
2215 Ga0163161_10018069
2216 Ga0163161_10026492
2217 Ga0163161_10040439
2218 Ga0163161_10096785
2219 Ga0213872_10000840
2220 Ga0213876_10000660
2221 Ga0213876_10013285
2222 Ga0209435_100021
2223 Ga0209435_100318
2224 Ga0209760_100005
2225 Ga0209760_100037
2226 Ga0209760_100128
2227 Ga0209436_100063
2228 Ga0209436_100337
2229 Ga0209784_100001
2230 Ga0209784_100004
2231 Ga0209784_100009
2232 Ga0209784_100028
2233 Ga0209566_100001
2234 Ga0209566_100004
2235 Ga0209566_100007
2236 Ga0209566_100028
2237 Ga0209674_100002
2238 Ga0209674_100006
2239 Ga0209674_100007
2240 Ga0209674_100018
2241 Ga0209674_100047
2242 Ga0209672_104838
2243 Ga0209147_100004
2244 Ga0209147_100031
2245 Ga0209563_100002
2246 Ga0209563_100009
2247 Ga0209563_100014
2248 Ga0209563_100020
2249 Ga0209563_100050
2250 Ga0209563_100052
2251 Ga0209563_102415
2252 Ga0207427_100009
2253 Ga0207427_100014
2254 Ga0207427_100016
2255 Ga0207427_100851
2256 Ga0209437_100001
2257 Ga0209437_100004
2258 Ga0209437_100011
2259 Ga0209437_100016
2260 Ga0209437_100035
2261 Ga0209437_100045
2262 Ga0209437_103337
2263 Ga0209437_104234
2264 Ga0209258_100083
2265 Ga0209258_100150
2266 Ga0209258_100534
2267 Ga0207425_1000001
2268 Ga0207425_1000048
2269 Ga0207425_1000484
2270 Ga0209646_1000010
2271 Ga0209646_1000020
2272 Ga0209646_1000074
2273 Ga0209646_1000094
2274 Ga0209646_1000183
2275 Ga0209026_1000009
2276 Ga0209026_1000058
2277 Ga0209677_100002
2278 Ga0209677_100005
2279 Ga0209677_100010
2280 Ga0209677_100015
2281 Ga0209677_100029
2282 Ga0209677_100097
2283 Ga0209677_101137
2284 Ga0209759_1000046
2285 Ga0209759_1000065
2286 Ga0209759_1000073
2287 Ga0209129_1000001
2288 Ga0209129_1002226
2289 Ga0209233_1000005
2290 Ga0209233_1000019
2291 Ga0209233_1000036
2292 Ga0209233_1000634
2293 Ga0209565_1003393
2294 Ga0209565_1003550
2295 Ga0209565_1004335
2296 Ga0209565_1008440
2297 Ga0209455_1001956
2298 Ga0209130_1000059
2299 Ga0209130_1003699
2300 Ga0209130_1009134
2301 Ga0209675_1004660
2302 Ga0209676_1000025
2303 Ga0209676_1000026
2304 Ga0209676_1000032
2305 Ga0209676_1000318
2306 Ga0209676_1009868
2307 Ga0209025_1002077
2308 Ga0209564_1000009
2309 Ga0209564_1000045
2310 Ga0209564_1000219
2311 Ga0209564_1004579
2312 Ga0209758_1000166
2313 Ga0209758_1000489
2314 Ga0209050_1000025
2315 Ga0209050_1000058
2316 Ga0209050_1000331
2317 Ga0209050_1000398
2318 Ga0209050_1000520
2319 Ga0209050_1001196
2320 Ga0209050_1003847
2321 Ga0209256_1000350
2322 Ga0209256_1001089
2323 Ga0207426_1001606
2324 Ga0209051_1000026
2325 Ga0209051_1000299
2326 Ga0209051_1009700
2327 Ga0209051_1012533
2328 Ga0209051_1016351
2329 Ga0209257_1000003
2330 Ga0209257_1000034
2331 Ga0209257_1001074
2332 Ga0207697_10015082
2333 Ga0207696_1000020
2334 Ga0207696_1000033
2335 Ga0207696_1000040
2336 Ga0207696_1000057
2337 Ga0207696_1000070
2338 Ga0207696_1000084
2339 Ga0207696_1000114
2340 Ga0207696_1000482
2341 Ga0207696_1000553
2342 Ga0207696_1000679
2343 Ga0207696_1000885
2344 Ga0207696_1002459
2345 Ga0207696_1002728
2346 Ga0207696_1017321
2347 Ga0207655_1000014
2348 Ga0207655_1000040
2349 Ga0207655_1000043
2350 Ga0207655_1000046
2351 Ga0207655_1000082
2352 Ga0207655_1000326
2353 Ga0207655_1000405
2354 Ga0207655_1000683
2355 Ga0207655_1000935
2356 Ga0207655_1002391
2357 Ga0207655_1002944
2358 Ga0207655_1003197
2359 Ga0207655_1005952
2360 Ga0207655_1006383
2361 Ga0207655_1013293
2362 Ga0207655_1013387
2363 Ga0207655_1013571
2364 Ga0207655_1022358
2365 Ga0207655_1022931
2366 Ga0207655_1045584
2367 Ga0207713_1000001
2368 Ga0207713_1000017
2369 Ga0207713_1000031
2370 Ga0207713_1000065
2371 Ga0207713_1000114
2372 Ga0207713_1000331
2373 Ga0207713_1000434
2374 Ga0207713_1000632
2375 Ga0207713_1001357
2376 Ga0207713_1001639
2377 Ga0207713_1002107
2378 Ga0207713_1019084
2379 Ga0207713_1019183
2380 Ga0207713_1021830
2381 Ga0207692_10100118
2382 Ga0207710_10000016
2383 Ga0207647_10000342
2384 Ga0207705_10144152
2385 Ga0207684_10117411
2386 Ga0207654_10000006
2387 Ga0207654_10011436
2388 Ga0207695_10002480
2389 Ga0207695_10003589
2390 Ga0207695_10006850
2391 Ga0207695_10074976
2392 Ga0207671_10000015
2393 Ga0207671_10016677
2394 Ga0207663_10044006
2395 Ga0207657_10007271
2396 Ga0207657_10103833
2397 Ga0207649_10000001
2398 Ga0207649_10002460
2399 Ga0207681_10000236
2400 Ga0207681_10047262
2401 Ga0207694_10000315
2402 Ga0207694_10246888
2403 Ga0207650_10000273
2404 Ga0207650_10000449
2405 Ga0207659_10048719
2406 Ga0207664_10005354
2407 Ga0207690_10004543
2408 Ga0207690_10005500
2409 Ga0207690_10014280
2410 Ga0207706_10000069
2411 Ga0207706_10000936
2412 Ga0207686_10006292
2413 Ga0207709_10000022
2414 Ga0207709_10000164
2415 Ga0207709_10000484
2416 Ga0207709_10000505
2417 Ga0207709_10027046
2418 Ga0207709_10038884
2419 Ga0207709_10068927
2420 Ga0207709_10155160
2421 Ga0207691_10118786
2422 Ga0207711_10021445
2423 Ga0207711_10107701
2424 Ga0207679_10000011
2425 Ga0207679_10001201
2426 Ga0207679_10044762
2427 Ga0207679_10116154
2428 Ga0207667_10000120
2429 Ga0207667_10004008
2430 Ga0207667_10015507
2431 Ga0207651_10001180
2432 Ga0207640_10012068
2433 Ga0207640_10045798
2434 Ga0207639_10001824
2435 Ga0207678_10166436
2436 Ga0207708_10124510
2437 Ga0207702_10000610
2438 Ga0207674_10000018
2439 Ga0207674_10012892
2440 Ga0207674_10173445
2441 Ga0207675_100005379
2442 Ga0207683_10137991
2443 Ga0209281_1000008
2444 Ga0209281_1000026
2445 Ga0209281_1000031
2446 Ga0209281_1000112
2447 Ga0209281_1000162
2448 Ga0209281_1000233
2449 Ga0209281_1000248
2450 Ga0209281_1000618
2451 Ga0209281_1000832
2452 Ga0209281_1000833
2453 Ga0209281_1003539
2454 Ga0209281_1004394
2455 Ga0209281_1008543
2456 Ga0209281_1012097
2457 Ga0209371_1000027
2458 Ga0209371_1000032
2459 Ga0209371_1000092
2460 Ga0209371_1000167
2461 Ga0209371_1000266
2462 Ga0209371_1000388
2463 Ga0209371_1001638
2464 Ga0209371_1017903
2465 Ga0210002_1007854
2466 Ga0209983_1000145
2467 Ga0209974_10022065
2468 Ga0207428_10036325
2469 Ga0207428_10172221
2470 Ga0268266_10000079
2471 Ga0268266_10013364
2472 Ga0268266_10065771
2473 Ga0268266_10214035
2474 Ga0268266_10240601
2475 Ga0268265_10251337
2476 Ga0268264_10100046
2477 Ga0265334_10000500
2478 Ga0265334_10005163
2479 Ga0265334_10036366
2480 Ga0265336_10000061
2481 Ga0307517_10023043
2482 Ga0265338_10003945
2483 Ga0265324_10001696
2484 Ga0268256_1000045
2485 Ga0268256_1000050
2486 Ga0268256_1000082
2487 Ga0268256_1000124
2488 Ga0268256_1000269
2489 Ga0268256_1000750
2490 Ga0268256_1001428
2491 Ga0268256_1019975
2492 Ga0307511_10002002
2493 Ga0307511_10094074
2494 Ga0316178_1026759
2495 Ga0316181_1059262
2496 Ga0265328_10003176
2497 Ga0265327_10001649
2498 Ga0307513_10002356
2499 Ga0307513_10021955
2500 Ga0307513_10109937
2501 Ga0307509_10130334
2502 Ga0307408_100000024
2503 Ga0307408_100000181
2504 Ga0307408_100000299
2505 Ga0307408_100000786
2506 Ga0307408_100024220
2507 Ga0307408_100060212
2508 Ga0307408_100063817
2509 Ga0307514_10000643
2510 Ga0316575_10000758
2511 Ga0316576_10009330
2512 Ga0316576_10011679
2513 Ga0316578_10038352
2514 Ga0316578_10064426
2515 Ga0307516_10003778
2516 Ga0307413_10063185
2517 Ga0307410_10023799
2518 Ga0307406_10000113
2519 Ga0307412_10039050
2520 Ga0307412_10121731
2521 Ga0307409_100008148
2522 Ga0307409_100065517
2523 Ga0307409_100193004
2524 Ga0307416_100001332
2525 Ga0307416_100115749
2526 Ga0307416_100125903
2527 Ga0307411_10015387
2528 Ga0307411_10018213
2529 Ga0307411_10023151
2530 Ga0307510_10001604
2531 Ga0373943_0066733
2532 Ga0316574_0000934
2533 Ga0373935_0069580
2534 Ga0373937_0023046
2535 Ga0316584_0059505
2536 Ga0316584_0207081
2537 Ga0373925_0062659
2538 Ga0395899_0004137
2539 Ga0395899_0014968
2540 Ga0395899_0067437
2541 Ga0395900_0013133
2542 Ga0395900_0092907
2543 Ga0395900_0130360
2544 Ga0395900_0168005
2545 Ga0395898_0043252
2546 Ga0395898_0140996
2547 Ga0395898_0199964
2548 Ga0395905_0024179
2549 Ga0395905_0046172
2550 Ga0395905_0119354
2551 Ga0395905_0119887
2552 Ga0395905_0156102
2553 Ga0395901_0000033
2554 Ga0395901_0004756
2555 Ga0395901_0014131
2556 Ga0395901_0049958
2557 Ga0395901_0115919
2558 Ga0436365_0743852
2559 Ga0436361_0475217
2560 Ga0436361_0941622
2561 Ga0439438_000001
2562 Ga0439438_000579
2563 Ga0439438_003785
2564 Ga0439447_000222
2565 Ga0439447_021038
2566 Ga0439447_025902
2567 Ga0439466_0000003
2568 Ga0439466_0008703
2569 Ga0439466_0014344
2570 Ga0439466_0021313
2571 Ga0451807_1250449
2572 Ga0451833_0043619
2573 Ga0451853_3838449
2574 Ga0439431_0005176
2575 Ga0439437_001461
2576 Ga0439448_0000301
2577 Ga0439448_0037632
2578 Ga0439432_000409
2579 Ga0439432_002502
2580 Ga0439432_003370
2581 Ga0439432_018396
2582 Ga0439432_040066
2583 Ga0439449_0051331
2584 Ga0439452_000010
2585 Ga0439452_000039
2586 Ga0439452_000212
2587 Ga0439452_000227
2588 Ga0439452_000231
2589 Ga0439452_000245
2590 Ga0439452_000977
2591 Ga0439452_009132
2592 Ga0450911_000018
2593 Ga0450911_000158
2594 Ga0450911_002722
2595 Ga0450920_001399
2596 Ga0450891_002871
2597 Ga0450902_000315
2598 Ga0450904_000622
2599 Ga0450906_002414
2600 Ga0450907_000206
2601 Ga0450908_009773
2602 Ga0450909_002236
2603 Ga0439434_0000122
2604 Ga0439464_0000216
2605 Ga0439464_0002678
2606 Ga0439464_0006312
2607 Ga0450893_0002000
2608 Ga0450901_000195
2609 Ga0451577_0000137
2610 Ga0451577_0000162
2611 Ga0451577_0001379
2612 Ga0451577_0004703
2613 Ga0451577_0175850
2614 Ga0453683_0000766
2615 Ga0466965_0015129
2616 Ga0466961_0116641
2617 Ga0466964_0006082
2618 Ga0453684_0000014
2619 Ga0453684_0000377
2620 Ga0453684_0000384
2621 Ga0453684_0000524
2622 Ga0453684_0001213
2623 Ga0453684_0002367
2624 Ga0453684_0003729
2625 Ga0453684_0004733
2626 Ga0453684_0069376
2627 Ga0453684_0158496
2628 Ga0466957_0001593
2629 Ga0466957_0029147
2630 Ga0466960_0034067
2631 Ga0451576_0000033
2632 Ga0451576_0000169
2633 Ga0451576_0001166
2634 Ga0451576_0112608
2635 Ga0451576_0225830
2636 Ga0466958_0108320
2637 Ga0495617_000136
2638 Ga0495617_003902
2639 Ga0495617_003925
2640 Ga0495617_007971
2641 Ga0495617_009658
2642 Ga0495617_023089
2643 Ga0495627_000023
2644 Ga0495627_000194
2645 Ga0495627_000700
2646 Ga0495627_001188
2647 Ga0495627_003088
2648 Ga0495627_016887
2649 Ga0495592_0013806
2650 Ga0495603_0005812
2651 Ga0495590_0000003
2652 Ga0495590_0002491
2653 Ga0495590_0003931
2654 Ga0495590_0004480
2655 Ga0495590_0007145
2656 Ga0495591_000014
2657 Ga0495591_000025
2658 Ga0495591_000029
2659 Ga0495591_000244
2660 Ga0495591_000717
2661 Ga0495591_001158
2662 Ga0495591_001191
2663 Ga0495591_001492
2664 Ga0495591_001672
2665 Ga0495591_001689
2666 Ga0495591_006448
2667 Ga0495591_007569
2668 Ga0495591_009001
2669 Ga0495591_009994
2670 Ga0495591_017937
2671 Ga0495629_0052049
2672 Ga0495638_0000091
2673 Ga0495638_0001218
2674 Ga0495638_0001551
2675 Ga0495638_0004653
2676 Ga0495638_0006661
2677 Ga0495638_0013609
2678 Ga0495638_0076050
2679 Ga0495651_0081988
2680 Ga0495653_0000549
2681 Ga0495653_0004499
2682 Ga0495653_0006284
2683 Ga0495653_0011868
2684 Ga0495653_0062377
2685 Ga0495650_0000032
2686 Ga0495650_0000097
2687 Ga0495650_0000103
2688 Ga0495650_0000386
2689 Ga0495650_0001058
2690 Ga0495650_0001865
2691 Ga0495650_0006713
2692 Ga0495650_0007354
2693 Ga0495650_0010356
2694 Ga0495650_0011972
2695 Ga0495650_0016850
2696 Ga0495650_0017796
2697 Ga0495580_0046926
2698 Ga0495582_0000880
2699 Ga0495582_0008606
2700 Ga0495605_0000095
2701 Ga0495605_0000237
2702 Ga0495605_0000246
2703 Ga0495605_0000251
2704 Ga0495605_0000311
2705 Ga0495605_0000328
2706 Ga0495605_0000673
2707 Ga0495605_0000878
2708 Ga0495605_0001867
2709 Ga0495605_0003763
2710 Ga0495605_0004933
2711 Ga0495605_0007006
2712 Ga0495605_0008057
2713 Ga0495605_0016771
2714 Ga0495605_0060012
2715 Ga0495605_0106440
2716 Ga0495639_0010865
2717 Ga0495584_0000695
2718 Ga0495584_0001738
2719 Ga0495584_0002471
2720 Ga0495584_0011709
2721 Ga0495584_0026343
2722 Ga0495584_0030102
2723 Ga0495584_0031955
2724 Ga0495585_0000005
2725 Ga0495585_0000279
2726 Ga0495585_0000790
2727 Ga0495585_0001195
2728 Ga0495585_0002554
2729 Ga0495585_0004763
2730 Ga0495585_0005582
2731 Ga0495585_0008791
2732 Ga0495585_0022472
2733 Ga0495585_0024974
2734 Ga0495585_0031614
2735 Ga0495585_0050086
2736 Ga0495585_0074612
2737 Ga0495594_0006507
2738 Ga0495594_0006764
2739 Ga0495594_0008636
2740 Ga0495594_0063337
2741 Ga0495596_0001177
2742 Ga0495596_0001477
2743 Ga0495596_0006433
2744 Ga0495596_0016068
2745 Ga0495596_0016079
2746 Ga0495607_0000181
2747 Ga0495607_0000347
2748 Ga0495607_0000552
2749 Ga0495607_0000776
2750 Ga0495607_0001128
2751 Ga0495607_0001875
2752 Ga0495607_0002014
2753 Ga0495607_0003010
2754 Ga0495607_0006297
2755 Ga0495607_0007143
2756 Ga0495607_0008065
2757 Ga0495607_0011290
2758 Ga0495607_0012842
2759 Ga0495607_0017978
2760 Ga0495607_0024174
2761 Ga0495607_0026649
2762 Ga0495607_0031719
2763 Ga0495583_0000015
2764 Ga0495583_0000060
2765 Ga0495583_0000062
2766 Ga0495583_0000155
2767 Ga0495583_0000197
2768 Ga0495583_0000756
2769 Ga0495583_0001189
2770 Ga0495583_0001231
2771 Ga0495583_0001514
2772 Ga0495583_0001852
2773 Ga0495583_0003070
2774 Ga0495583_0003993
2775 Ga0495606_0000068
2776 Ga0495606_0000141
2777 Ga0495606_0000177
2778 Ga0495606_0000214
2779 Ga0495606_0000266
2780 Ga0495606_0000371
2781 Ga0495606_0000461
2782 Ga0495606_0000696
2783 Ga0495606_0000843
2784 Ga0495606_0002268
2785 Ga0495606_0002328
2786 Ga0495606_0003165
2787 Ga0495606_0004642
2788 Ga0495606_0007052
2789 Ga0495606_0016853
2790 Ga0495606_0056002
2791 Ga0495608_0018979
2792 Ga0495610_0000003
2793 Ga0495610_0001476
2794 Ga0495610_0003651
2795 Ga0495610_0009810
2796 Ga0495610_0010298
2797 Ga0495610_0014621
2798 Ga0495610_0015071
2799 Ga0495610_0025482
2800 Ga0495616_0000184
2801 Ga0495616_0001441
2802 Ga0495616_0004461
2803 Ga0495616_0005947
2804 Ga0495616_0008293
2805 Ga0495616_0009974
2806 Ga0495616_0014276
2807 Ga0495616_0017305
2808 Ga0495616_0019028
2809 Ga0495616_0038840
2810 Ga0495618_0011571
2811 Ga0495618_0102076
2812 Ga0495620_0000042
2813 Ga0495620_0000456
2814 Ga0495620_0001496
2815 Ga0495620_0002041
2816 Ga0495620_0004368
2817 Ga0495620_0006298
2818 Ga0495620_0045501
2819 Ga0495628_0070535
2820 Ga0495630_0025997
2821 Ga0495630_0129753
2822 Ga0495631_0000722
2823 Ga0495631_0000794
2824 Ga0495631_0004320
2825 Ga0495631_0004837
2826 Ga0495631_0026043
2827 Ga0495631_0062453
2828 Ga0495632_0000573
2829 Ga0495632_0001250
2830 Ga0495632_0001313
2831 Ga0495632_0001532
2832 Ga0495632_0009908
2833 Ga0495632_0025653
2834 Ga0495632_0057255
2835 Ga0495637_0000020
2836 Ga0495637_0000087
2837 Ga0495637_0000260
2838 Ga0495637_0000848
2839 Ga0495637_0002194
2840 Ga0495637_0002273
2841 Ga0495637_0002495
2842 Ga0495637_0005014
2843 Ga0495637_0010737
2844 Ga0495637_0045902
2845 Ga0495643_0000179
2846 Ga0495643_0000287
2847 Ga0495643_0000411
2848 Ga0495643_0000585
2849 Ga0495643_0001628
2850 Ga0495643_0002022
2851 Ga0495643_0011258
2852 Ga0495643_0015794
2853 Ga0495643_0055851
2854 Ga0495644_0000218
2855 Ga0495644_0000952
2856 Ga0495644_0002342
2857 Ga0495644_0003908
2858 Ga0495644_0005160
2859 Ga0495644_0014154
2860 Ga0495644_0015839
2861 Ga0495644_0020449
2862 Ga0495644_0028708
2863 Ga0495644_0032761
2864 Ga0495648_0000058
2865 Ga0495648_0000076
2866 Ga0495648_0000299
2867 Ga0495648_0001064
2868 Ga0495648_0002580
2869 Ga0495648_0009200
2870 Ga0495648_0010573
2871 Ga0495648_0012123
2872 Ga0495648_0016557
2873 Ga0495648_0023158
2874 Ga0495648_0032542
2875 Ga0495648_0042121
2876 Ga0495648_0046654
2877 Ga0495648_0111533
2878 Ga0495666_0000514
2879 Ga0495666_0007844
2880 Ga0495666_0039645
2881 Ga0495666_0043376
2882 Ga0495642_0000088
2883 Ga0495642_0000223
2884 Ga0495642_0000463
2885 Ga0495642_0006585
2886 Ga0495642_0038639
2887 Ga0495652_0038065
2888 Ga0495652_0131616
2889 Ga0495654_0000019
2890 Ga0495654_0000074
2891 Ga0495654_0000451
2892 Ga0495654_0000985
2893 Ga0495654_0001089
2894 Ga0495654_0001254
2895 Ga0495654_0001271
2896 Ga0495654_0004701
2897 Ga0495654_0006622
2898 Ga0495654_0011325
2899 Ga0495654_0017372
2900 Ga0495654_0018225
2901 Ga0495654_0054647
2902 Ga0495640_0065769
2903 Ga0495586_0031574
2904 Ga0495587_0065213
2905 Ga0495609_0000039
2906 Ga0495609_0000053
2907 Ga0495609_0000102
2908 Ga0495609_0000685
2909 Ga0495609_0001189
2910 Ga0495609_0003042
2911 Ga0495609_0029907
2912 Ga0495597_0000153
2913 Ga0495597_0000186
2914 Ga0495597_0000209
2915 Ga0495597_0000242
2916 Ga0495597_0000537
2917 Ga0495597_0000808
2918 Ga0495597_0002455
2919 Ga0495597_0033447
2920 Ga0495597_0035248
2921 Ga0495597_0062226
2922 Ga0495597_0074476
2923 Ga0495645_0009101
2924 Ga0495645_0031956
2925 Ga0495645_0159292
2926 Ga0495622_0000054
2927 Ga0495622_0000468
2928 Ga0495622_0000584
2929 Ga0495622_0002858
2930 Ga0495622_0009925
2931 Ga0495633_0000119
2932 Ga0495633_0000249
2933 Ga0495633_0000366
2934 Ga0495633_0001297
2935 Ga0495633_0002317
2936 Ga0495633_0004532
2937 Ga0495633_0009262
2938 Ga0495633_0011956
2939 Ga0495633_0025940
2940 Ga0495633_0075050
2941 Ga0495667_0055871
2942 Ga0495667_0114760
2943 Ga0495656_0030753
2944 Ga0495668_0000337
2945 Ga0495668_0000466
2946 Ga0495668_0000866
2947 Ga0495668_0015652
2948 Ga0495668_0024652
2949 Ga0495668_0080776
2950 Ga0495634_0001452
2951 Ga0495634_0040408
2952 Ga0495611_0000386
2953 Ga0495611_0000546
2954 Ga0495611_0002380
2955 Ga0495611_0004289
2956 Ga0495611_0005319
2957 Ga0495611_0023655
2958 Ga0495611_0096133
2959 Ga0495625_0000086
2960 Ga0495625_0000132
2961 Ga0495625_0000139
2962 Ga0495625_0001396
2963 Ga0495625_0002129
2964 Ga0495625_0002623
2965 Ga0495625_0003090
2966 Ga0495625_0003498
2967 Ga0495625_0003977
2968 Ga0495625_0010314
2969 Ga0495625_0010440
2970 Ga0495625_0013007
2971 Ga0495625_0028160
2972 Ga0495625_0048669
2973 Ga0495625_0072932
2974 Ga0495635_0010447
2975 Ga0495635_0066463
2976 Ga0495659_0000684
2977 Ga0495659_0001118
2978 Ga0495661_0000048
2979 Ga0495661_0000058
2980 Ga0495661_0000094
2981 Ga0495661_0000131
2982 Ga0495661_0000171
2983 Ga0495661_0001840
2984 Ga0495661_0002376
2985 Ga0495661_0008362
2986 Ga0495661_0011367
2987 Ga0495661_0017452
2988 Ga0495661_0022149
2989 Ga0495661_0027405
2990 Ga0495661_0035739
2991 Ga0495661_0036819
2992 Ga0495661_0039514
2993 Ga0495661_0072285
2994 Ga0495661_0077161
2995 Ga0495588_0000110
2996 Ga0495588_0004605
2997 Ga0495588_0026084
2998 Ga0495599_0000399
2999 Ga0495599_0004483
3000 Ga0495623_0005943
3001 Ga0495623_0006642
3002 Ga0495623_0066232
3003 Ga0495646_0000446
3004 Ga0495646_0024671
3005 Ga0495669_0000041
3006 Ga0495669_0026695
3007 Ga0495669_0080805
3008 Ga0495613_0092878
3009 Ga0495624_0001848
3010 Ga0495670_0000302
3011 Ga0495670_0002252
3012 Ga0495670_0005988
3013 Ga0495670_0006106
3014 Ga0495670_0007946
3015 Ga0495670_0011561
3016 Ga0495671_0000157
3017 Ga0495671_0000582
3018 Ga0495671_0000796
3019 Ga0495671_0001635
3020 Ga0495671_0003155
3021 Ga0495671_0005078
3022 Ga0495671_0008993
3023 Ga0495671_0012930
3024 Ga0495671_0017322
3025 Ga0495671_0032264
3026 Ga0495649_0000049
3027 Ga0495649_0000510
3028 Ga0495649_0000847
3029 Ga0495649_0000965
3030 Ga0495649_0003527
3031 Ga0495649_0003587
3032 Ga0495649_0005204
3033 Ga0495649_0010593
3034 Ga0495649_0013796
3035 Ga0495649_0036011
3036 Ga0495649_0066360
3037 Ga0495649_0088894
3038 Ga0495649_0120197
3039 Ga0495589_0000006
3040 Ga0495589_0000019
3041 Ga0495589_0000445
3042 Ga0495589_0000647
3043 Ga0495589_0000866
3044 Ga0495589_0001426
3045 Ga0495589_0002079
3046 Ga0495589_0003754
3047 Ga0495589_0011721
3048 Ga0495589_0017134
3049 Ga0495589_0024381
3050 Ga0495589_0050380
3051 Ga0495600_0002038
3052 Ga0495600_0100251
3053 Ga0495660_0000021
3054 Ga0495660_0000056
3055 Ga0495660_0000168
3056 Ga0495660_0000245
3057 Ga0495660_0000608
3058 Ga0495660_0005539
3059 Ga0495660_0007449
3060 Ga0495660_0009308
3061 Ga0495660_0015517
3062 Ga0495660_0016457
3063 Ga0495660_0022873
3064 Ga0495660_0073548
3065 Ga0495581_0014620
3066 Ga0495604_0014483
3067 Ga0495604_0050582
3068 Ga0495604_0101791
3069 Ga0495636_0001360
3070 Ga0495636_0001666
3071 Ga0495636_0008015
3072 Ga0495636_0014610
3073 Ga0495674_0002066
3074 Ga0495674_0085409
3075 Ga0495672_0000002
3076 Ga0495672_0000012
3077 Ga0495672_0000020
3078 Ga0495672_0000263
3079 Ga0495672_0001472
3080 Ga0495672_0002315
3081 Ga0495672_0002439
3082 Ga0495672_0003847
3083 Ga0495672_0007415
3084 Ga0495672_0010293
3085 Ga0495672_0031579
3086 Ga0495672_0058653
3087 Ga0495672_0070641
3088 Ga0495676_0000022
3089 Ga0495676_0004002
3090 Ga0495680_0037898
3091 Ga0495680_0091818
3092 Ga0495680_0103548
3093 Ga0495680_0115054
3094 Ga0495680_0124245
3095 Ga0495683_0000030
3096 Ga0495683_0000520
3097 Ga0495683_0000927
3098 Ga0495683_0003113
3099 Ga0495683_0011966
3100 Ga0495683_0019467
3101 Ga0495683_0020424
3102 Ga0495683_0024380
3103 Ga0495683_0048266
3104 Ga0495687_000059
3105 Ga0495687_000296
3106 Ga0495687_001460
3107 Ga0495687_001591
3108 Ga0495687_001767
3109 Ga0495675_0074373
3110 Ga0495677_0000006
3111 Ga0495677_0000590
3112 Ga0495677_0002558
3113 Ga0495677_0003280
3114 Ga0495677_0010069
3115 Ga0495677_0025054
3116 Ga0495677_0050358
3117 Ga0495679_000020
3118 Ga0495679_000218
3119 Ga0495679_000494
3120 Ga0495679_001364
3121 Ga0495679_002504
3122 Ga0495679_002509
3123 Ga0495679_002913
3124 Ga0495679_003549
3125 Ga0495685_000416
3126 Ga0495685_003595
3127 Ga0495673_0000006
3128 Ga0495673_0000024
3129 Ga0495673_0000079
3130 Ga0495673_0000544
3131 Ga0495673_0001080
3132 Ga0495673_0001326
3133 Ga0495673_0002964
3134 Ga0495673_0003791
3135 Ga0495673_0004931
3136 Ga0495673_0009417
3137 Ga0495673_0011178
3138 Ga0495673_0019270
3139 Ga0495673_0024681
3140 Ga0495681_0000351
3141 Ga0495681_0000411
3142 Ga0495681_0000534
3143 Ga0495681_0001568
3144 Ga0495681_0001787
3145 Ga0495681_0003728
3146 Ga0495681_0010655
3147 Ga0495681_0019212
3148 Ga0495681_0025685
3149 Ga0495681_0057034
3150 Ga0495681_0095140
3151 Ga0495686_0000017
3152 Ga0495686_0001364
3153 Ga0495686_0003766
3154 Ga0495686_0014853
3155 Ga0495686_0015703
3156 Ga0495686_0061115
3157 Ga0495593_0014612
3158 Ga0495593_0044222
3159 Ga0495602_0040199
3160 Ga0495614_0005763
3161 Ga0495626_0000039
3162 Ga0495626_0000103
3163 Ga0495626_0000391
3164 Ga0495626_0000494
3165 Ga0495626_0000562
3166 Ga0495626_0000711
3167 Ga0495626_0002239
3168 Ga0495626_0005483
3169 Ga0495626_0029382
3170 Ga0495626_0035165
3171 Ga0495626_0039518
3172 Ga0495626_0042079
3173 Ga0496101_0000671
3174 Ga0496102_0001161
3175 Ga0496102_0008716
3176 Ga0496102_0077507
3177 Ga0496103_0000631
3178 Ga0496103_0005456
3179 Ga0496103_0128194
3180 Ga0496104_0000119
3181 Ga0496104_0002141
3182 Ga0496104_0004930
3183 Ga0496105_0006486
3184 Ga0496105_0022243
3185 Ga0496105_0035265
3186 Ga0496105_0106492
3187 Ga0496105_0120651
3188 Ga0496106_0100961
3189 Ga0496110_0035108
3190 Ga0496114_0113188
3191 Ga0496115_0012877
3192 Ga0496116_0000031
3193 Ga0496116_0000320
3194 Ga0496116_0000376
3195 Ga0496116_0000623
3196 Ga0496116_0003799
3197 Ga0496116_0005272
3198 Ga0496116_0005434
3199 Ga0496116_0005510
3200 Ga0496116_0011980
3201 Ga0496116_0017900
3202 Ga0496116_0043099
3203 Ga0496116_0060937
3204 Ga0496117_0000001
3205 Ga0496117_0000004
3206 Ga0496117_0000298
3207 Ga0496117_0000486
3208 Ga0496117_0001035
3209 Ga0496117_0001085
3210 Ga0496117_0001205
3211 Ga0496117_0003937
3212 Ga0496117_0005845
3213 Ga0496117_0010248
3214 Ga0496117_0011377
3215 Ga0496117_0011922
3216 Ga0496117_0016158
3217 Ga0496117_0016430
3218 Ga0496117_0020422
3219 Ga0496117_0029491
3220 Ga0496117_0033375
3221 Ga0496117_0034171
3222 Ga0496117_0041020
3223 Ga0496117_0067256
3224 Ga0496118_0000072
3225 Ga0496118_0000078
3226 Ga0496118_0000323
3227 Ga0496118_0000805
3228 Ga0496118_0001319
3229 Ga0496118_0002349
3230 Ga0496118_0002434
3231 Ga0496118_0003571
3232 Ga0496118_0003732
3233 Ga0496118_0004028
3234 Ga0496118_0004806
3235 Ga0496118_0010083
3236 Ga0496118_0019204
3237 Ga0496118_0024222
3238 Ga0496118_0044124
3239 Ga0496118_0108077
3240 Ga0496118_0108324
3241 Ga0496118_0128321
3242 Ga0496119_0000080
3243 Ga0496119_0000082
3244 Ga0496119_0000188
3245 Ga0496119_0000741
3246 Ga0496119_0001826
3247 Ga0496119_0002279
3248 Ga0496119_0003650
3249 Ga0496119_0005070
3250 Ga0496119_0010220
3251 Ga0496119_0019431
3252 Ga0496119_0024522
3253 Ga0496119_0037150
3254 Ga0496119_0037522
3255 Ga0496119_0043055
3256 Ga0496120_0000062
3257 Ga0496120_0000075
3258 Ga0496120_0000252
3259 Ga0496120_0000302
3260 Ga0496120_0000389
3261 Ga0496120_0000873
3262 Ga0496120_0001166
3263 Ga0496120_0001718
3264 Ga0496120_0001877
3265 Ga0496120_0001913
3266 Ga0496120_0002608
3267 Ga0496120_0003866
3268 Ga0496120_0013125
3269 Ga0496120_0019805
3270 Ga0496121_0000047
3271 Ga0496121_0000372
3272 Ga0496121_0001119
3273 Ga0496121_0001155
3274 Ga0496121_0001222
3275 Ga0496121_0001386
3276 Ga0496121_0002320
3277 Ga0496121_0003763
3278 Ga0496121_0004640
3279 Ga0496121_0007722
3280 Ga0496121_0011325
3281 Ga0496121_0018539
3282 Ga0496121_0020831
3283 Ga0496121_0022151
3284 Ga0496121_0029481
3285 Ga0496122_0000108
3286 Ga0496122_0000571
3287 Ga0496122_0000887
3288 Ga0496122_0001367
3289 Ga0496122_0002008
3290 Ga0496122_0002062
3291 Ga0496122_0004208
3292 Ga0496122_0005674
3293 Ga0496122_0023966
3294 Ga0496122_0031823
3295 Ga0496122_0037693
3296 Ga0496122_0040628
3297 Ga0496122_0045803
3298 Ga0496123_0000065
3299 Ga0496123_0000180
3300 Ga0496123_0000430
3301 Ga0496123_0000508
3302 Ga0496123_0000605
3303 Ga0496123_0001152
3304 Ga0496123_0002413
3305 Ga0496123_0002626
3306 Ga0496123_0003036
3307 Ga0496123_0007845
3308 Ga0496123_0027357
3309 Ga0496123_0031828
3310 Ga0496123_0036535
3311 Ga0496123_0037297
3312 Ga0496123_0039355
3313 Ga0496123_0040890
3314 Ga0496124_0000053
3315 Ga0496124_0000120
3316 Ga0496124_0000147
3317 Ga0496124_0000474
3318 Ga0496124_0001035
3319 Ga0496124_0001108
3320 Ga0496124_0001901
3321 Ga0496124_0002123
3322 Ga0496124_0003341
3323 Ga0496124_0003710
3324 Ga0496124_0003980
3325 Ga0496124_0004161
3326 Ga0496124_0004499
3327 Ga0496124_0007018
3328 Ga0496124_0013002
3329 Ga0496124_0014377
3330 Ga0496124_0025110
3331 Ga0496124_0027366
3332 Ga0496124_0034290
3333 Ga0496124_0041873
3334 Ga0496124_0061209
3335 Ga0496124_0110635
3336 Ga0496124_0120650
3337 Ga0496124_0190440
3338 Ga0496125_0000799
3339 Ga0496125_0001606
3340 Ga0496125_0001971
3341 Ga0496125_0003554
3342 Ga0496125_0006712
3343 Ga0496125_0007902
3344 Ga0496125_0009754
3345 Ga0496125_0015469
3346 Ga0496125_0016979
3347 Ga0496125_0053126
3348 Ga0496125_0086737
3349 Ga0496126_0000387
3350 Ga0496126_0000759
3351 Ga0496126_0001894
3352 Ga0496126_0007665
3353 Ga0496126_0024453
3354 Ga0496126_0061634
3355 Ga0496126_0065253
3356 Ga0496126_0120013
3357 Ga0496126_0150556
3358 Ga0501310_000600
3359 Ga0495678_000006
3360 Ga0495678_000017
3361 Ga0495678_000104
3362 Ga0495678_000283
3363 Ga0495678_000326
3364 Ga0495678_000365
3365 Ga0495678_000693
3366 Ga0495678_001927
3367 Ga0495678_002423
3368 Ga0495678_003240
3369 Ga0495678_011539
3370 Ga0495678_014280
3371 Ga0495678_019135
3372 Ga0495682_0000015
3373 Ga0495682_0000182
3374 Ga0495682_0000188
3375 Ga0495682_0000659
3376 Ga0495682_0001301
3377 Ga0495682_0008465
3378 Ga0495682_0046868
3379 Ga0501290_003355
3380 Ga0501033_0131466
3381 Ga0501034_0000022
3382 Ga0501039_0103735
3383 Ga0501040_0031538
3384 Ga0501041_0173745
3385 Ga0501047_0157899
3386 Ga0501047_0158279
3387 Ga0501067_0006864
3388 Ga0501068_0071169
3389 Ga0501070_0017528
3390 Ga0501073_0101121
3391 Ga0501075_0003850
3392 Ga0501076_0140215
3393 Ga0501198_000057
3394 Ga0501222_000017
3395 Ga0501079_0194910
3396 Ga0501080_0085223
3397 Ga0501080_0135208
3398 Ga0501080_0360148
3399 Ga0501081_0004297
3400 Ga0501083_0041654
3401 Ga0501269_000017
3402 Ga0501279_004689
3403 Ga0501035_0028900
3404 Ga0501044_0000065
3405 Ga0501044_0071447
3406 Ga0501045_0102316
3407 Ga0501226_000002
3408 nmdc:mga03683_19835_c1
3409 nmdc:mga03n38_55249_c1
3410 nmdc:mga00v17_36076_c1
3411 nmdc:mga00v17_71435_c1
3412 nmdc:mga00v17_97385_c1
3413 nmdc:mga05p37_135694_c1
3414 nmdc:mga05p37_267918_c1
3415 nmdc:mga05p37_29695_c1
3416 nmdc:mga05p37_50989_c1
3417 nmdc:mga05p37_53352_c1
3418 nmdc:mga0qj67_199974_c1
3419 nmdc:mga06r32_37200_c1
3420 nmdc:mga08y16_23075_c1
3421 nmdc:mga0n895_155737_c1
3422 nmdc:mga0n895_185107_c1
3423 nmdc:mga0n895_2762_c1
3424 nmdc:mga0rr50_137777_c1
3425 nmdc:mga0rr50_300850_c1
3426 nmdc:mga0rr50_48426_c1
3427 nmdc:mga0a205_135148_c1
3428 nmdc:mga0a205_188559_c1
3429 nmdc:mga0a205_29557_c1
3430 nmdc:mga0a205_320295_c1
3431 nmdc:mga0a205_3269_c1
3432 nmdc:mga0a205_56645_c1
3433 Ga0495601_0019691
3434 Ga0500635_0000026
3435 Ga0500593_000035
3436 Ga0500595_002138
3437 Ga0500621_000001
3438 Ga0500637_0005602
3439 Ga0501084_0036114
3440 Ga0501084_0256612
3441 Ga0501082_0003999
3442 Ga0501082_0042873
3443 Ga0501082_0063221
3444 Ga0530510_0095888
3445 Ga0530510_0129518
3446 2506576871
3447 2506582009
3448 2508850838
3449 2510284326
3450 2510292985
3451 2510312491
3452 2511249807
3453 2511254732
3454 2511265543
3455 2511288797
3456 2511297336
3457 2511301703
3458 2511316727
3459 2511319870
3460 2511326036
3461 2511330998
3462 2511336333
3463 2511344322
3464 2511349103
3465 2511355980
3466 2511360664
3467 2511366635
3468 2511378561
3469 2511383819
3470 2511411304
3471 2511434064
3472 2512325944
3473 2521559631
3474 2525557851
3475 2538428561
3476 2548648152
3477 2550696104
3478 2553006337
3479 2555245734
3480 2555667407
3481 2583789815
3482 2585829815
3483 2585833522
3484 2597855651
3485 2597861652
3486 2597867377
3487 2599327433
3488 2599356630
3489 2599363340
3490 2599369708
3491 2599376449
3492 2599381735
3493 2599388121
3494 2599395355
3495 2599398861
3496 2599407120
3497 2599411756
3498 2599450916
3499 2599463463
3500 2599469187
3501 2599485553
3502 2599492480
3503 2599506418
3504 2599514138
3505 2599518739
3506 2599806682
3507 2599882654
3508 2599893527
3509 2599928045
3510 2599950769
3511 2600216092
3512 2600364894
3513 2601524571
3514 2601529725
3515 2601534625
3516 2601539210
3517 2601616559
3518 2601621281
3519 2601645132
3520 2601649678
3521 2601654605
3522 2601660121
3523 2601664373
3524 2601667293
3525 2601692337
3526 2601698094
3527 2601702462
3528 2601707349
3529 2601712370
3530 2601717866
3531 2601722965
3532 2601727794
3533 2601732811
3534 2601737420
3535 2601741839
3536 2601752737
3537 2601757559
3538 2601763918
3539 2601776259
3540 2601797823
3541 2602008632
3542 2602019691
3543 2603640265
3544 2603645947
3545 2603662537
3546 2603667433
3547 2603701833
3548 2603706458
3549 2603840220
3550 2603845297
3551 2603850370
3552 2603855438
3553 2603868299
3554 2603873114
3555 2603878244
3556 2606050199
3557 2606071861
3558 2606076694
3559 2606128892
3560 2606147882
3561 2606178183
3562 2608668994
3563 2621302188
3564 2624478212
3565 2630650182
3566 2643791609
3567 2643840980
3568 2643872629
3569 2643954911
3570 2644024551
3571 2644060851
3572 2644074530
3573 2644186112
3574 2644252445
3575 2644619638
3576 2650896933
3577 2656279243
3578 2671099980
3579 2671105339
3580 2671107457
3581 2671586449
3582 2671772333
3583 2676408836
3584 2677898964
3585 2681998867
3586 2682009716
3587 2689443270
3588 2712472076
3589 2715749197
3590 2715755467
3591 2718632149
3592 2722884172
3593 2723246550
3594 2738674077
3595 2738714086
3596 2738752470
3597 2738807917
3598 2738861511
3599 2738895277
3600 2739198017
3601 2739260307
3602 2739288602
3603 2739293914
3604 2739311270
3605 2740995155
3606 2743735068
3607 2753857964
3608 2765591130
3609 2774119571
3610 2774131506
3611 2774134727
3612 2775542817
3613 2784261057
3614 2784315982
3615 2791922865
3616 2808905445
3617 2808932167
3618 2808939695
3619 2808954232
3620 2808955859
3621 2808976670
3622 2808991892
3623 2809124181
3624 2809217967
3625 2812370168
3626 2813726510
3627 2814693884
3628 2816476018
3629 2817488402
3630 2819541021
3631 2819592228
3632 2819657221
3633 2819705204
3634 2821122417
3635 2823378106
3636 2823425513
3637 2826586887
3638 2834032221
3639 2839098070
3640 2842714483
3641 2842807122
3642 2842816704
3643 2842832075
3644 2842834149
3645 2842838625
3646 2842846374
3647 2842852247
3648 2844530455
3649 2844667887
3650 2846041917
3651 2847801382
3652 2852617066
3653 2852660462
3654 2852671945
3655 2854603544
3656 2855199489
3657 2857552516
3658 2857553516
3659 2857561589
3660 2857565152
3661 2858470370
3662 2860343652
3663 2860868426
3664 2865015603
3665 2869552676
3666 2871274681
3667 2871284339
3668 2876602015
3669 2878030155
3670 2880231102
3671 2881612359
3672 2883357789
3673 2884089542
3674 2884341550
3675 2884816675
3676 2884840345
3677 2884855601
3678 2885081624
3679 2888371068
3680 2888374850
3681 2891672624
3682 2894513814
3683 2896157473
3684 2900054867
3685 2904426461
3686 2904443255
3687 2904476405
3688 2904506839
3689 2904519561
3690 2904532964
3691 2904552169
3692 2904585516
3693 2904593865
3694 2904603984
3695 2908447019
3696 2917071158
3697 2917836390
3698 2919066163
3699 2919081781
3700 2919127477
3701 2919152574
3702 2919155799
3703 2919389787
3704 2919459975
3705 2919481394
3706 2919488714
3707 2919493773
3708 2919500915
3709 2919502248
3710 2919545657
3711 2919708489
3712 2923154063
3713 2923513407
3714 2923524259
3715 2926063921
3716 2927145243
3717 2927836566
3718 2928134053
3719 2929190291
3720 2931391370
3721 2931398829
3722 2935358986
3723 2937540137
3724 2939572156
3725 2939602563
3726 2939611490
3727 2939641103
3728 2939646468
3729 2941472993
3730 2945876184
3731 2945930176
3732 2945953496
3733 2945967580
3734 2946012523
3735 2946028634
3736 2947235161
3737 2969304948
3738 2974293360
3739 2974314638
3740 2978975988
3741 2984291996
3742 2984498214
3743 2984500685
3744 2984507208
3745 2990265534
3746 2998140451
3747 3007255357
3748 3007315837
3749 3007399614
3750 3007420013
3751 3007517896
3752 3007618665
3753 3007624999
3754 3007721212
3755 3007859691
3756 3007864336
3757 637317804
3758 640936423
3759 8001522612
3760 8015688312
3761 8016736393
3762 8018223139
3763 8018408855
3764 8019503064
3765 8019770298
3766 8030000287
3767 8047673315
3768 8054291514
3769 8054350140
3770 8054503957
3771 8054846290
3772 8054850416
3773 8055092398
3774 8055093595
3775 8055097674
3776 8055771409
3777 8055818353
3778 8056126464
3779 8056132327
3780 8056152467
3781 8056164333
3782 8056170600
3783 8056183052
3784 8056572310
3785 8057307969
3786 8057802700

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02801

Ketoacyl-synt_C

Beta-ketoacyl synthase, C-terminal domain

255

365

0.96

PF00109

ketoacyl-synt

Beta-ketoacyl synthase, N-terminal domain

2

247

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ewg-assembly1.cif.gz_B crystal structure of a beta-ketoacyl synthase from burkholderia phymatum stm815 0.994 1 407
4ewg-assembly1.cif.gz_B crystal structure of a beta-ketoacyl synthase from burkholderia phymatum stm815 0.9915 1 407
7f27-assembly1.cif.gz_B crystal structure of polyketide ketosynthase 0.9906 1 407
7f27-assembly2.cif.gz_C crystal structure of polyketide ketosynthase 0.9897 1 407
7f27-assembly1.cif.gz_B crystal structure of polyketide ketosynthase 0.9882 1 407
ID Description Score Start End Superfamily
4ewgB02 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9947 260 407 3.40.47.10
4ewgB01 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9897 5 258 3.40.47.10
4ewgB01 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.982 5 258 3.40.47.10
4ewgB02 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9815 260 407 3.40.47.10
af_P9WQD9_267_416_3.40.47.10 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9594 258 406 3.40.47.10
ID Description Score Start End GO Terms
AF-A0A522KQA2-F1-model_v4 deleted 0.9973 1 354
AF-Q6LL26-F1-model_v4 Beta-ketoacyl-ACP synthase 0.9962 1 406 GO:0004315
GO:0005829
GO:0006633
AF-A0A855F2L9-F1-model_v4 Beta-ketoacyl-ACP synthase II 0.9953 2 407 GO:0004315
GO:0005829
GO:0006633
AF-A0A2X2G657-F1-model_v4 deleted 0.9951 2 407
AF-A0A658FYS2-F1-model_v4 deleted 0.994 1 232

Map