F495993
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1893 | 765 | 3786 | 408 |
Family's Representative Sequence
| Representative Sequence | 3300003771|Ga0055526_1007031|Ga0055526_10070316 |
| Length | 482 |
| Sequence | MNRRVAVTGMAGISPLGNDWASVRERLGQYRNAVVHMEEWDNYEGLNTRLGAPAAPFELSDRFNRKTTRSMGRVSLLATRATELALEDAGLLDHPLLKSGDMGVAFGSSVGSTSAIGDFGRMLEERSTKGLNATTYIKMMGHTAPVNVGVFFGLTGRVITTSSACTSGSQGIGYAYEAIKTGKQLAMVAGGAEELCPTEAAVFDILFATSVRNDAPETTPRPFDVNRDGLVIGEGAGCLVLEDLEHAEARGATIYAELVGFGTNSDGRHVTQPSADTMRRAMELALQDAGLQPSDIGYINAHGTATAQGDMAESQATHEVFGSNTPISSLKSYMGHTLGACGALEAWISIEMMREGWYAPTINLXQSDPXCAVLDYIAGTGRRIDCDYVMSNNFAFGGINTSLIFKRYGKXXGRADADLAGRCERDDGRQPAALPGLADAGRAGAPWALRARTAPPPVRRRPHPAADGAGTSASRAASAGPA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 2 | 2124908027 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 | Metagenome | Rhizosphere |
| 3 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 4 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 5 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 6 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 7 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 8 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 9 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 10 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 11 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 12 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 13 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 14 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 15 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 16 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 17 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 18 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 19 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 20 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 21 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 22 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 23 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 24 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 25 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 26 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 27 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 28 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 29 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 30 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 31 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 32 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 33 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 34 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 35 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 36 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 37 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 38 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 39 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 40 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 41 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 43 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 45 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 51 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 58 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 60 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 63 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 65 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 66 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 67 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 68 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 69 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 70 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 71 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 72 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 73 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 74 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 75 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 76 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 77 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 79 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 80 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 81 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 82 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 83 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 84 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 85 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 109 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 112 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 113 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 115 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 116 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 117 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 118 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 119 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 120 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 121 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 122 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 123 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 124 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 125 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 126 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 127 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 128 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 129 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 130 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 131 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 132 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 133 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 134 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 135 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 136 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 137 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 138 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 139 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 140 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 141 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 142 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 143 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 144 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 145 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 146 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 147 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 148 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 186 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 191 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 195 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 196 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 197 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 198 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 199 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 200 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 201 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 202 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 203 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 204 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 205 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 206 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 207 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 208 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 209 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 210 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 211 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 212 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 213 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 214 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 215 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 216 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 217 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 218 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 219 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 220 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 221 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 222 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 223 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 224 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 225 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 226 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 227 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 228 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 229 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 230 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 231 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 232 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 233 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 234 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 235 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 236 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 237 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 238 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 239 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 240 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 241 | 3300042000 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 | Metagenome | Rhizosphere |
| 242 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 243 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 244 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 245 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 246 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 247 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 248 | 3300042129 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 | Metagenome | Rhizosphere |
| 249 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 250 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 251 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 252 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 253 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 254 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 255 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 256 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 257 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 258 | 3300042533 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 | Metagenome | Rhizosphere |
| 259 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 260 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 261 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 262 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 263 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 264 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 265 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 266 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 267 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 268 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 269 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 359 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 360 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 361 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 362 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 363 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 364 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 365 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 366 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 367 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 368 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 369 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 370 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 371 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 372 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 373 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 374 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 375 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 376 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 377 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 378 | 3300049130 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 379 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300049513 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control | Metagenome | Rhizosphere |
| 382 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 383 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 384 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 385 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 386 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 387 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 388 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 389 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 390 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 391 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 392 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 393 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 394 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 395 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 396 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 397 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 398 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 399 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 400 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 401 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 402 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 403 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 404 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 405 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 406 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 407 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 408 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 409 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 410 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 411 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 412 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 413 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 414 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 415 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 416 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 418 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 419 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 420 | 3300053126 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere | Metagenome | Endosphere |
| 421 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 422 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 423 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 424 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 425 | 2506520007 | Serratia plymuthica AS9 | Isolate | Rhizosphere |
| 426 | 2506520008 | Serratia plymuthica AS12 | Isolate | Unclassified |
| 427 | 2508501071 | Serratia proteamaculans S4 | Isolate | Rhizosphere |
| 428 | 2510065053 | Pseudomonas sp. MOIL14HWK12:I1 | Isolate | Rhizosphere |
| 429 | 2510065055 | Pseudomonas sp. MOIL14HWK12:I2 | Isolate | Rhizosphere |
| 430 | 2510065058 | Pseudomonas oleovorans MOIL14HWK12 | Isolate | Rhizosphere |
| 431 | 2511231003 | Herbaspirillum sp. CF444 | Isolate | Rhizosphere |
| 432 | 2511231004 | Pseudomonas sp. GM102 | Isolate | Nodule |
| 433 | 2511231006 | Pseudomonas sp. GM17 | Isolate | Nodule |
| 434 | 2511231010 | Pseudomonas sp. GM25 | Isolate | Nodule |
| 435 | 2511231011 | Pseudomonas sp. GM30 | Isolate | Nodule |
| 436 | 2511231012 | Pseudomonas sp. GM33 | Isolate | Nodule |
| 437 | 2511231014 | Pseudomonas sp. GM48 | Isolate | Nodule |
| 438 | 2511231015 | Pseudomonas sp. GM49 | Isolate | Nodule |
| 439 | 2511231016 | Pseudomonas sp. GM50 | Isolate | Nodule |
| 440 | 2511231017 | Pseudomonas sp. GM55 | Isolate | Nodule |
| 441 | 2511231018 | Pseudomonas sp. GM60 | Isolate | Nodule |
| 442 | 2511231019 | Pseudomonas sp. GM67 | Isolate | Nodule |
| 443 | 2511231020 | Pseudomonas sp. GM74 | Isolate | Nodule |
| 444 | 2511231021 | Pseudomonas sp. GM78 | Isolate | Nodule |
| 445 | 2511231022 | Pseudomonas sp. GM79 | Isolate | Nodule |
| 446 | 2511231023 | Pseudomonas sp. GM80 | Isolate | Nodule |
| 447 | 2511231025 | Pantoea sp. YR343 | Isolate | Rhizosphere |
| 448 | 2511231026 | Herbaspirillum sp. YR522 | Isolate | Rhizosphere |
| 449 | 2511231031 | Pseudomonas sp. GM16 | Isolate | Nodule |
| 450 | 2511231035 | Pantoea sp. GM01 | Isolate | Rhizosphere |
| 451 | 2512047018 | Pseudomonas chlororaphis chlororaphis GP72 | Isolate | Rhizosphere |
| 452 | 2521172590 | Herbaspirillum sp. GW103 | Isolate | Rhizosphere |
| 453 | 2524614729 | Arenimonas oryziterrae YC6267, DSM 21050 | Isolate | Rhizosphere |
| 454 | 2537561728 | Pectobacterium wasabiae CFBP 3304 | Isolate | Rhizoplane |
| 455 | 2547132416 | Enterobacter sp. MR1 | Isolate | Rhizoplane |
| 456 | 2548876994 | Herbaspirillum lusitanum P6-12 | Isolate | Nodule |
| 457 | 2551306416 | Herbaspirillum seropedicae Os34 | Isolate | Unclassified |
| 458 | 2554235231 | Pseudomonas putida MTCC 5279 | Isolate | Unclassified |
| 459 | 2554235341 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 460 | 2582580891 | Pseudomonas chlororaphis YL-1 | Isolate | Unclassified |
| 461 | 2585427591 | Rahnella aquatilis OV744 | Isolate | Rhizosphere |
| 462 | 2585427592 | Rahnella aquatilis OV588 | Isolate | Rhizosphere |
| 463 | 2597489887 | Pseudomonas chlororaphis aureofaciens 30-84 | Isolate | Rhizosphere |
| 464 | 2597489888 | Pseudomonas fluorescens SS101 | Isolate | Rhizosphere |
| 465 | 2597489889 | Pseudomonas synxantha BG33R | Isolate | Rhizosphere |
| 466 | 2599185155 | Pseudomonas sp. NFACC10-1 | Isolate | Rhizoplane |
| 467 | 2599185160 | Pseudomonas sp. NFPP25 | Isolate | Rhizoplane |
| 468 | 2599185161 | Pseudomonas sp. NFPP09 | Isolate | Rhizoplane |
| 469 | 2599185162 | Pseudomonas sp. NFPP10 | Isolate | Rhizoplane |
| 470 | 2599185163 | Pseudomonas sp. NFPP12 | Isolate | Rhizoplane |
| 471 | 2599185164 | Pseudomonas sp. NFPP13 | Isolate | Rhizoplane |
| 472 | 2599185165 | Pseudomonas sp. NFPP18 | Isolate | Rhizoplane |
| 473 | 2599185166 | Pseudomonas sp. NFPP08 | Isolate | Rhizoplane |
| 474 | 2599185167 | Pseudomonas sp. NFPP28 | Isolate | Rhizoplane |
| 475 | 2599185168 | Pseudomonas sp. NFPP05 | Isolate | Rhizoplane |
| 476 | 2599185169 | Klebsiella quasipneumoniae NFPP35 | Isolate | Rhizoplane |
| 477 | 2599185179 | Pseudomonas sp. NFR09 | Isolate | Rhizoplane |
| 478 | 2599185181 | Pseudomonas sp. NFPP17 | Isolate | Rhizoplane |
| 479 | 2599185182 | Pseudomonas sp. NFPP19 | Isolate | Rhizoplane |
| 480 | 2599185185 | Pseudomonas sp. NFPP07 | Isolate | Rhizoplane |
| 481 | 2599185186 | Pseudomonas sp. NFPP15 | Isolate | Rhizoplane |
| 482 | 2599185189 | Pseudomonas sp. NFPP02 | Isolate | Rhizoplane |
| 483 | 2599185190 | Pseudomonas sp. NFPP04 | Isolate | Rhizoplane |
| 484 | 2599185191 | Pseudomonas sp. NFPP24 | Isolate | Rhizoplane |
| 485 | 2599185257 | Pseudomonas sp. NFACC41-3 | Isolate | Rhizoplane |
| 486 | 2599185288 | Pseudomonas sp. NFACC25 | Isolate | Rhizoplane |
| 487 | 2599185290 | Pseudomonas sp. NFPP11 | Isolate | Rhizoplane |
| 488 | 2599185299 | Pantoea ananatis NFR11 | Isolate | Rhizoplane |
| 489 | 2599185303 | Pseudomonas sp. NFACC42-2 | Isolate | Rhizoplane |
| 490 | 2599185356 | Pseudomonas sp. NFPP14 | Isolate | Rhizoplane |
| 491 | 2600254931 | Pseudomonas sp. NFIX28 | Isolate | Rhizoplane |
| 492 | 2600255254 | Klebsiella quasipneumoniae NFIX15 | Isolate | Rhizoplane |
| 493 | 2600255255 | Klebsiella quasipneumoniae NFIX23 | Isolate | Rhizoplane |
| 494 | 2600255256 | Enterobacter sp. NFIX08 | Isolate | Rhizoplane |
| 495 | 2600255257 | Enterobacter sp. NFIX03 | Isolate | Rhizoplane |
| 496 | 2600255280 | Klebsiella quasipneumoniae NFIX42 | Isolate | Rhizoplane |
| 497 | 2600255281 | Klebsiella quasipneumoniae NFIX43 | Isolate | Rhizoplane |
| 498 | 2600255287 | Klebsiella quasipneumoniae NFIX11 | Isolate | Rhizoplane |
| 499 | 2600255288 | Klebsiella quasipneumoniae NFIX14 | Isolate | Rhizoplane |
| 500 | 2600255289 | Klebsiella quasipneumoniae NFIX16 | Isolate | Rhizoplane |
| 501 | 2600255290 | Klebsiella quasipneumoniae NFIX17 | Isolate | Rhizoplane |
| 502 | 2600255291 | Klebsiella quasipneumoniae NFIX19 | Isolate | Rhizoplane |
| 503 | 2600255292 | Janthinobacterium lividum NFR18 | Isolate | Rhizoplane |
| 504 | 2600255296 | Pseudomonas sp. NFR02 | Isolate | Rhizoplane |
| 505 | 2600255298 | Klebsiella quasipneumoniae NFIX21 | Isolate | Rhizoplane |
| 506 | 2600255299 | Klebsiella quasipneumoniae NFIX22 | Isolate | Rhizoplane |
| 507 | 2600255300 | Klebsiella quasipneumoniae NFIX30 | Isolate | Rhizoplane |
| 508 | 2600255301 | Klebsiella quasipneumoniae NFIX33 | Isolate | Rhizoplane |
| 509 | 2600255302 | Klebsiella quasipneumoniae NFIX35 | Isolate | Rhizoplane |
| 510 | 2600255303 | Klebsiella quasipneumoniae NFIX36 | Isolate | Rhizoplane |
| 511 | 2600255304 | Klebsiella quasipneumoniae NFIX37 | Isolate | Rhizoplane |
| 512 | 2600255305 | Klebsiella quasipneumoniae NFIX41 | Isolate | Rhizoplane |
| 513 | 2600255306 | Klebsiella quasipneumoniae NFIX44 | Isolate | Rhizoplane |
| 514 | 2600255307 | Klebsiella quasipneumoniae NFIX56 | Isolate | Rhizoplane |
| 515 | 2600255309 | Klebsiella sp. NFIX53 | Isolate | Rhizoplane |
| 516 | 2600255310 | Enterobacter sp. NFIX06 | Isolate | Rhizoplane |
| 517 | 2600255311 | Enterobacter sp. NFIX04 | Isolate | Rhizoplane |
| 518 | 2600255313 | Pseudomonas sp. NFPP16 | Isolate | Rhizoplane |
| 519 | 2600255318 | Pseudomonas putida NFIX47 | Isolate | Rhizoplane |
| 520 | 2600255389 | Pseudomonas sp. NFPP33 | Isolate | Rhizoplane |
| 521 | 2600255392 | Klebsiella quasipneumoniae NFIX54 | Isolate | Rhizoplane |
| 522 | 2602042046 | Enterobacter sp. NFIX09 | Isolate | Rhizoplane |
| 523 | 2602042047 | Enterobacter sp. NFIX59 | Isolate | Rhizoplane |
| 524 | 2602042052 | Klebsiella quasipneumoniae NFIX18 | Isolate | Rhizoplane |
| 525 | 2602042053 | Klebsiella quasipneumoniae NFIX12 | Isolate | Rhizoplane |
| 526 | 2602042066 | Enterobacter sp. NFIX45 | Isolate | Rhizoplane |
| 527 | 2602042067 | Enterobacter sp. NFIX58 | Isolate | Rhizoplane |
| 528 | 2602042103 | Klebsiella quasipneumoniae NFIX29 | Isolate | Rhizoplane |
| 529 | 2602042104 | Klebsiella quasipneumoniae NFIX26 | Isolate | Rhizoplane |
| 530 | 2602042105 | Klebsiella quasipneumoniae NFIX25 | Isolate | Rhizoplane |
| 531 | 2602042106 | Klebsiella quasipneumoniae NFIX13 | Isolate | Rhizoplane |
| 532 | 2602042109 | Klebsiella aerogenes NFIX39 | Isolate | Rhizoplane |
| 533 | 2602042110 | Klebsiella quasipneumoniae NFIX40 | Isolate | Rhizoplane |
| 534 | 2602042111 | Klebsiella quasipneumoniae NFIX20 | Isolate | Rhizoplane |
| 535 | 2603880178 | Klebsiella quasipneumoniae NFIX34 | Isolate | Rhizoplane |
| 536 | 2603880184 | Klebsiella quasipneumoniae NFIX27 | Isolate | Rhizoplane |
| 537 | 2603880185 | Pseudomonas sp. NFIX46 | Isolate | Rhizoplane |
| 538 | 2603880199 | Pseudomonas sp. NFIX49 | Isolate | Rhizoplane |
| 539 | 2603880202 | Klebsiella quasipneumoniae NFIX38 | Isolate | Rhizoplane |
| 540 | 2603880211 | Klebsiella quasipneumoniae NFIX24 | Isolate | Rhizoplane |
| 541 | 2608642108 | Pantoea agglomerans NFPP29 | Isolate | Rhizoplane |
| 542 | 2619619299 | Pseudomonas veronii R4 Genome sequencing | Isolate | Unclassified |
| 543 | 2623620443 | Pseudomonas sp. DR 5-09 | Isolate | Unclassified |
| 544 | 2627854209 | Arenimonas oryziterrae YC6267, DSM 21050 | Isolate | Rhizosphere |
| 545 | 2643221554 | Duganella sp. Root1480D1 | Isolate | Unclassified |
| 546 | 2643221565 | Pseudomonas sp. Root562 | Isolate | Unclassified |
| 547 | 2643221571 | Pseudomonas sp. Root569 | Isolate | Unclassified |
| 548 | 2643221589 | Pseudomonas sp. Root68 | Isolate | Unclassified |
| 549 | 2643221602 | Pseudomonas sp. Root71 | Isolate | Unclassified |
| 550 | 2643221609 | Acidovorax sp. Root217 | Isolate | Unclassified |
| 551 | 2643221611 | Acidovorax sp. Root219 | Isolate | Unclassified |
| 552 | 2643221633 | Pseudomonas sp. Root329 | Isolate | Unclassified |
| 553 | 2643221645 | Massilia sp. Root351 | Isolate | Unclassified |
| 554 | 2643221713 | Pseudomonas sp. Root9 | Isolate | Unclassified |
| 555 | 2648501693 | Pantoea ananatis B1-9 | Isolate | Rhizosphere |
| 556 | 2654587920 | Serratia plymuthica HRO-C48 | Isolate | Rhizosphere |
| 557 | 2667528171 | Pseudomonas sp. NFPP22 | Isolate | Rhizoplane |
| 558 | 2667528172 | Enterobacteriaceae bacterium NFIX31 | Isolate | Rhizoplane |
| 559 | 2667528173 | Rahnella sp. NFIX50 | Isolate | Rhizoplane |
| 560 | 2671180115 | Cedecea sp. NFIX57 | Isolate | Rhizoplane |
| 561 | 2671180172 | Pseudomonas sp. NFIX51 | Isolate | Rhizoplane |
| 562 | 2675903046 | Klebsiella quasipneumoniae NFIX52 | Isolate | Rhizoplane |
| 563 | 2675903420 | Pseudomonas fluorescens Ps006 | Isolate | Unclassified |
| 564 | 2681812866 | Enterobacter asburiae NFIX55 | Isolate | Rhizoplane |
| 565 | 2681812869 | Enterobacter ludwigii NFPP41 | Isolate | Rhizoplane |
| 566 | 2687453601 | Serratia plymuthica 3Rp8 | Isolate | Unclassified |
| 567 | 2711768156 | Atlantibacter hermannii DDE1 | Isolate | Unclassified |
| 568 | 2713897148 | Pseudomonas fluorescens SF39a | Isolate | Rhizosphere |
| 569 | 2713897149 | Pseudomonas fluorescens SF4c | Isolate | Rhizosphere |
| 570 | 2718217725 | Pseudomonas fluorescens CREA-C16 | Isolate | Rhizosphere |
| 571 | 2721755523 | Delftia sp. HK171 | Isolate | Unclassified |
| 572 | 2721755607 | Pseudomonas fluorescens Pt14 | Isolate | Rhizosphere |
| 573 | 2738541265 | Pseudomonas sp. GV077 | Isolate | Unclassified |
| 574 | 2738541276 | Cellvibrio sp. YR554 | Isolate | Unclassified |
| 575 | 2738541282 | Pseudomonas sp. GV058 | Isolate | Unclassified |
| 576 | 2738541294 | Pseudomonas sp. GV087 | Isolate | Unclassified |
| 577 | 2738541303 | Pseudomonas sp. GV105 | Isolate | Unclassified |
| 578 | 2738541309 | Pseudomonas sp. GV047 | Isolate | Unclassified |
| 579 | 2738543004 | Pseudomonas sp. GV085 | Isolate | Unclassified |
| 580 | 2738543015 | Pseudomonas sp. GV041 | Isolate | Unclassified |
| 581 | 2738543020 | Pseudomonas sp. GV054 | Isolate | Unclassified |
| 582 | 2738543021 | Pseudomonas sp. GV071 | Isolate | Unclassified |
| 583 | 2738543025 | Pseudomonas sp. GV091 | Isolate | Unclassified |
| 584 | 2740891818 | Desulfofaba hansenii DSM 12642 | Isolate | Unclassified |
| 585 | 2740892503 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 586 | 2751185917 | Enterobacter sp. HK169 | Isolate | Unclassified |
| 587 | 2765235842 | Enterobacter ludwigii AA4 | Isolate | Unclassified |
| 588 | 2773857670 | Pseudomonas sp. 478 | Isolate | Unclassified |
| 589 | 2773857672 | Pseudomonas sp. 1766 | Isolate | Unclassified |
| 590 | 2773857673 | Pseudomonas sp. 443 | Isolate | Unclassified |
| 591 | 2775506706 | Enterobacter asburiae 1216 | Isolate | Unclassified |
| 592 | 2784132063 | Pseudomonas sp. 424 | Isolate | Unclassified |
| 593 | 2784132072 | Pseudomonas sp. 460 | Isolate | Unclassified |
| 594 | 2791354903 | Mangrovibacter phragmitis MP23 | Isolate | Unclassified |
| 595 | 2808606373 | Pseudomonas sp. SLBN-2 | Isolate | Unclassified |
| 596 | 2808606377 | Pseudomonas sp. SJZ083 | Isolate | Rhizosphere |
| 597 | 2808606379 | Pseudomonas sp. SJZ079 | Isolate | Rhizosphere |
| 598 | 2808606381 | Pseudomonas sp. SJZ077 | Isolate | Rhizosphere |
| 599 | 2808606382 | Pseudomonas sp. SJZ080 | Isolate | Rhizosphere |
| 600 | 2808606385 | Pseudomonas sp. SJZ103 | Isolate | Rhizosphere |
| 601 | 2808606388 | Pseudomonas sp. SJZ094 | Isolate | Rhizosphere |
| 602 | 2808606414 | Pantoea sp. SJZ147 | Isolate | Rhizosphere |
| 603 | 2808606445 | Pseudomonas sp. SJZ131 | Isolate | Rhizosphere |
| 604 | 2811994881 | Pseudomonas sp. SLBN-26 | Isolate | Unclassified |
| 605 | 2811995292 | Kosakonia oryzae Ola 51 | Isolate | Unclassified |
| 606 | 2814123068 | Kosakonia radicincitans GXGL-4A | Isolate | Rhizosphere |
| 607 | 2816332133 | Acidovorax radicis 2721A | Isolate | Unclassified |
| 608 | 2816332298 | Pseudomonas veronii R02 | Isolate | Rhizosphere |
| 609 | 2818991436 | Collimonas arenae 515 | Isolate | Unclassified |
| 610 | 2818991445 | Herbaspirillum hiltneri 3195 | Isolate | Unclassified |
| 611 | 2818991456 | Pseudomonas koreensis 3286 | Isolate | Rhizosphere |
| 612 | 2818991464 | Pseudomonas protegens 3295 | Isolate | Rhizosphere |
| 613 | 2821118458 | Enterobacter asburiae 609 | Isolate | Unclassified |
| 614 | 2823373977 | Enterobacter ludwigii NCR3 | Isolate | Rhizosphere |
| 615 | 2823421272 | Pseudomonas mendocina S5.2 | Isolate | Rhizoplane |
| 616 | 2826581358 | Pseudomonas viridiflava CDRTc14 | Isolate | Unclassified |
| 617 | 2834028612 | Pseudomonas fluorescens 513 | Isolate | Unclassified |
| 618 | 2839094727 | Herbaspirillum robiniae HZ10 | Isolate | Nodule |
| 619 | 2842711865 | Duganella sp. R-73148 | Isolate | Unclassified |
| 620 | 2842805378 | Pseudomonas sp. R-72599 | Isolate | Unclassified |
| 621 | 2842815866 | Pseudomonas sp. R-72210 | Isolate | Unclassified |
| 622 | 2842826826 | Pseudomonas sp. R-72172 | Isolate | Unclassified |
| 623 | 2842832357 | Pseudomonas sp. R-72164 | Isolate | Unclassified |
| 624 | 2842837860 | Pseudomonas sp. R-72102 | Isolate | Unclassified |
| 625 | 2842843487 | Pseudomonas sp. R-72074 | Isolate | Unclassified |
| 626 | 2842849001 | Pseudomonas sp. R-72008 | Isolate | Unclassified |
| 627 | 2844528606 | Pantoea sp. R-72498 v. 2 | Isolate | Unclassified |
| 628 | 2844665904 | Pseudomonas protegens H1F10C | Isolate | Unclassified |
| 629 | 2846037992 | Chromobacterium alticapitis MWU14-2602 | Isolate | Rhizosphere |
| 630 | 2847797336 | Pantoea ananatis NN08200 | Isolate | Unclassified |
| 631 | 2852612431 | Pseudomonas sp. SJZ073 | Isolate | Rhizosphere |
| 632 | 2852657418 | Pseudomonas sp. JAI115 | Isolate | Rhizosphere |
| 633 | 2852667396 | Pseudomonas sp. JAI120 | Isolate | Rhizosphere |
| 634 | 2854601825 | Dickeya dianthicola SS70 | Isolate | Stem Tuber |
| 635 | 2855195626 | Pectobacterium atrosepticum SS26 | Isolate | Stem Tuber |
| 636 | 2857547612 | Janthinobacterium sp. R-74502 | Isolate | Unclassified |
| 637 | 2857553236 | Duganella sp. R-74557 | Isolate | Unclassified |
| 638 | 2857558681 | Duganella sp. R-74565 | Isolate | Unclassified |
| 639 | 2857564685 | Duganella sp. R-74599 | Isolate | Unclassified |
| 640 | 2858466076 | Pectobacterium polaris SS28 | Isolate | Stem Tuber |
| 641 | 2860339153 | Pseudomonas sp. JAI111 | Isolate | Rhizosphere |
| 642 | 2860867994 | Pseudomonas sp. R1-43-08 | Isolate | Rhizosphere |
| 643 | 2865014394 | Pantoea sp. R-71966 | Isolate | Unclassified |
| 644 | 2869551831 | Serratia inhibens PRI-2C | Isolate | Rhizosphere |
| 645 | 2871272651 | Pectobacterium carotovorum SS96 | Isolate | Stem Tuber |
| 646 | 2871282230 | Pectobacterium parmentieri SS90 | Isolate | Stem Tuber |
| 647 | 2876601092 | Pantoea endophytica 596 | Isolate | Unclassified |
| 648 | 2878029506 | Pseudomonas fluorescens DR397 | Isolate | Rhizosphere |
| 649 | 2880230671 | Pseudomonas fluorescens LBUM677 | Isolate | Unclassified |
| 650 | 2881609920 | Pantoea sp. ARC607 | Isolate | Rhizosphere |
| 651 | 2883354860 | Hypericibacter adhaerens R5959 | Isolate | Rhizosphere |
| 652 | 2884086401 | Kluyvera sp. PO2S7 | Isolate | Rhizosphere |
| 653 | 2884338543 | Luteibacter pinisoli MAH-14 | Isolate | Rhizosphere |
| 654 | 2884811622 | Herbaspirillum sp. 3C11 | Isolate | Unclassified |
| 655 | 2884836552 | Herbaspirillum sp. 3R-11 | Isolate | Unclassified |
| 656 | 2884852848 | Herbaspirillum sp. 3R11 | Isolate | Unclassified |
| 657 | 2885080285 | Janthinobacterium sp. AD80 | Isolate | Rhizosphere |
| 658 | 2888366609 | Serratia sp. NGAS9 | Isolate | Rhizosphere |
| 659 | 2888373701 | Serratia rhizosphaerae KUDC3025 | Isolate | Rhizosphere |
| 660 | 2891670763 | Buttiauxella sp. B2 | Isolate | Rhizosphere |
| 661 | 2894510363 | Methylomonas sp. Kb3 | Isolate | Unclassified |
| 662 | 2896154374 | Herbaspirillum sp. 3R-3a1 | Isolate | Nodule |
| 663 | 2900051742 | Pectobacterium zantedeschiae 2M | Isolate | Stem Tuber |
| 664 | 2904424332 | Duganella sp. 1411 | Isolate | Rhizosphere |
| 665 | 2904439833 | Herbaspirillum sp. 1589 | Isolate | Rhizosphere |
| 666 | 2904474040 | Rahnella aquatilis 4485 | Isolate | Rhizosphere |
| 667 | 2904504865 | Serratia marcescens 1822 | Isolate | Unclassified |
| 668 | 2904518522 | Pseudomonas fluorescens 4488 | Isolate | Rhizosphere |
| 669 | 2904530477 | Herbaspirillum huttiense 611 | Isolate | Unclassified |
| 670 | 2904550169 | Stutzerimonas stutzeri 1099 | Isolate | Rhizosphere |
| 671 | 2904584206 | Herbaspirillum sp. 1050 | Isolate | Unclassified |
| 672 | 2904589729 | Herbaspirillum sp. 1130 | Isolate | Unclassified |
| 673 | 2904601388 | Herbaspirillum sp. 1273 | Isolate | Rhizosphere |
| 674 | 2908446538 | Pseudomonas sp. R76 | Isolate | Rhizosphere |
| 675 | 2917070673 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 676 | 2917832318 | Pseudomonas rhizoryzae RY24 | Isolate | Unclassified |
| 677 | 2919063839 | Pseudomonas pharyngis 1098 | Isolate | Rhizosphere |
| 678 | 2919079590 | Herbaspirillum sp. 1173 | Isolate | Unclassified |
| 679 | 2919125081 | Pseudomonas psychrotolerans 1545 | Isolate | Rhizosphere |
| 680 | 2919150387 | Rahnella aceris 1817 | Isolate | Unclassified |
| 681 | 2919155634 | Pseudomonas fulva 1992 | Isolate | Unclassified |
| 682 | 2919385768 | Pseudomonas sp. 2957 | Isolate | Unclassified |
| 683 | 2919456309 | Pseudomonas sp. 3296 | Isolate | Rhizosphere |
| 684 | 2919476304 | Duganella sp. 3397 | Isolate | Unclassified |
| 685 | 2919487758 | Pseudomonas koreensis 3441 | Isolate | Unclassified |
| 686 | 2919493220 | Aeromonas salmonicida salmonicida 3466 | Isolate | Unclassified |
| 687 | 2919497567 | Shewanella putrefaciens 3469 | Isolate | Unclassified |
| 688 | 2919501602 | Pseudomonas alcaliphila 3512 | Isolate | Unclassified |
| 689 | 2919543075 | Aeromonas salmonicida masoucida 4076 | Isolate | Unclassified |
| 690 | 2919704043 | Hydrogenophaga palleronii 4249 | Isolate | Unclassified |
| 691 | 2923153595 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 692 | 2923510766 | Herbaspirillum rubrisubalbicans SLBN-127 | Isolate | Rhizosphere |
| 693 | 2923519811 | Pseudomonas otitidis SLBN-103 | Isolate | Rhizosphere |
| 694 | 2926063275 | Pseudomonas sp. 3400 | Isolate | Unclassified |
| 695 | 2927143783 | Rahnella sp. 2050 | Isolate | Unclassified |
| 696 | 2927833300 | Enterobacter sp. SLBN-59 | Isolate | Rhizosphere |
| 697 | 2928130867 | Herbaspirillum seropedicae 1977 | Isolate | Unclassified |
| 698 | 2929189879 | Pseudomonas sp. R-71842 Hybrid assembly | Isolate | Unclassified |
| 699 | 2931390751 | Pseudomonas sp. DR208 | Isolate | Rhizosphere |
| 700 | 2931396565 | Pseudomonas sp. DR48 | Isolate | Rhizosphere |
| 701 | 2935353572 | Pseudomonas protegens TECH19 | Isolate | Unclassified |
| 702 | 2937539931 | Pantoea sp. LS15 | Isolate | Unclassified |
| 703 | 2939568625 | Lelliottia sp. 489 | Isolate | Rhizosphere |
| 704 | 2939602548 | Pantoea dispersa 1175 | Isolate | Rhizosphere |
| 705 | 2939607340 | Leclercia sp. 1548 | Isolate | Rhizosphere |
| 706 | 2939636861 | Pseudomonas sp. 2725 | Isolate | Rhizosphere |
| 707 | 2939642701 | Lelliottia nimipressuralis 2756 | Isolate | Rhizosphere |
| 708 | 2941471342 | Luteibacter sp. 621 | Isolate | Unclassified |
| 709 | 2945874760 | Phytobacter diazotrophicus UAEU22 | Isolate | Rhizosphere |
| 710 | 2945928738 | Pseudomonas cedrina W1I11 | Isolate | Rhizosphere |
| 711 | 2945951305 | Pantoea agglomerans W2I1 | Isolate | Rhizosphere |
| 712 | 2945961074 | Pseudomonas sp. W2I6 | Isolate | Rhizosphere |
| 713 | 2946006987 | Pseudomonas sp. W3I7 | Isolate | Rhizosphere |
| 714 | 2946027586 | Pseudomonas sp. W4I3 | Isolate | Rhizosphere |
| 715 | 2947233263 | Pseudomonas synxantha W2I4 | Isolate | Rhizosphere |
| 716 | 2969304461 | Pseudomonas sp. R84 | Isolate | Rhizosphere |
| 717 | 2974289157 | Pseudomonas fluorescens SORGH_AS 191 | Isolate | Unclassified |
| 718 | 2974310843 | Enterobacter sp. SORGH_AS 287 | Isolate | Unclassified |
| 719 | 2978975091 | Pantoea anthophila SORGH_AS 797 | Isolate | Unclassified |
| 720 | 2984286254 | Pseudomonas chlororaphis aurantiaca JD37 | Isolate | Rhizosphere |
| 721 | 2984494565 | Pantoea ananatis SORGH_AS197 | Isolate | Aerial Root |
| 722 | 2984499530 | Pseudomonas sp. SORGH_AS199 | Isolate | Aerial Root |
| 723 | 2984504281 | Pseudomonas psychrotolerans SORGH_AS201 | Isolate | Aerial Root |
| 724 | 2990261002 | Pantoea ananatis SORGH_AS213 | Isolate | Aerial Root |
| 725 | 2998139840 | Pseudomonas iranensis SWRI54 | Isolate | Rhizosphere |
| 726 | 3007252601 | Pseudomonas punonensis D1-6 | Isolate | Unclassified |
| 727 | 3007315729 | Pseudomonas argentinensis SA190 | Isolate | Unclassified |
| 728 | 3007395558 | Pseudomonas chlororaphis PCL1601 | Isolate | Rhizosphere |
| 729 | 3007419365 | Pseudomonas vanderleydeniana RW8P3 | Isolate | Unclassified |
| 730 | 3007511990 | Pseudomonas fluorescens G20-18 | Isolate | Rhizosphere |
| 731 | 3007614139 | Pseudomonas sp. PB106 | Isolate | Unclassified |
| 732 | 3007619802 | Pseudomonas sp. PB120 | Isolate | Unclassified |
| 733 | 3007718800 | Pseudomonas fluorescens BW11P2 | Isolate | Rhizosphere |
| 734 | 3007855910 | Pseudomonas khorasanensis SWRI153 | Isolate | Rhizosphere |
| 735 | 3007861166 | Pseudomonas hamedanensis SWRI65 | Isolate | Rhizosphere |
| 736 | 637000220 | Pseudomonas protegens Pf-5 | Isolate | Rhizoplane |
| 737 | 640753048 | Serratia proteamaculans 568 | Isolate | Endosphere |
| 738 | 8001522603 | Methylomicrobium sp. RS1 | Isolate | Unclassified |
| 739 | 8015687852 | Pseudomonas chlororaphis aurantiaca RP4 | Isolate | Rhizosphere |
| 740 | 8016733728 | Pantoea sp. SORGH_AS 659 | Isolate | Unclassified |
| 741 | 8018221730 | Enterobacter sp. CM29 | Isolate | Unclassified |
| 742 | 8018405270 | Enterobacter sp. 198 | Isolate | Rhizosphere |
| 743 | 8019499862 | Kluyvera sp. 1366 | Isolate | Rhizosphere |
| 744 | 8019769354 | Pseudomonas sp. MSSRFD41 | Isolate | Rhizosphere |
| 745 | 8029995093 | Pseudomonas atacamensis SM1 | Isolate | Rhizosphere |
| 746 | 8047673197 | Telluria mixta LMG 11547 | Isolate | Rhizosphere |
| 747 | 8054285046 | Pseudomonas petroselini MAFF 311096 | Isolate | Nodule |
| 748 | 8054347763 | Pseudomonas carnis NWU Be30 | Isolate | Unclassified |
| 749 | 8054503363 | Pseudomonas sivasensis BsEB-1 | Isolate | Unclassified |
| 750 | 8054844752 | Dryocola boscaweniae H18W14 | Isolate | Rhizosphere |
| 751 | 8054849141 | Dryocola clanedunensis H11S18 | Isolate | Rhizosphere |
| 752 | 8055087960 | Silvania hatchlandensis H19S6 | Isolate | Rhizosphere |
| 753 | 8055092621 | Silvania confinis H4N4 | Isolate | Rhizosphere |
| 754 | 8055097453 | Leclercia tamurae H6W5 | Isolate | Rhizosphere |
| 755 | 8055770955 | Pseudomonas chlororaphis qlu-1 | Isolate | Rhizosphere |
| 756 | 8055817908 | Pseudomonas pergaminensis 1008 | Isolate | Rhizosphere |
| 757 | 8056125926 | Pseudomonas azerbaijanorientalis SWRI123 | Isolate | Rhizosphere |
| 758 | 8056131705 | Pseudomonas asgharzadehiana SWRI132 | Isolate | Rhizosphere |
| 759 | 8056148874 | Pseudomonas khavaziana SWRI124 | Isolate | Rhizosphere |
| 760 | 8056161164 | Pseudomonas azadiae SWRI103 | Isolate | Rhizosphere |
| 761 | 8056166840 | Pseudomonas triticicola SWRI88 | Isolate | Rhizosphere |
| 762 | 8056177738 | Pseudomonas azerbaijanoccidentalis SWRI74 | Isolate | Rhizosphere |
| 763 | 8056569372 | Pseudomonas serboccidentalis IT-P374 | Isolate | Rhizosphere |
| 764 | 8057304971 | Scandinavium manionii H17S15 | Isolate | Rhizosphere |
| 765 | 8057798959 | Pseudomonas piscis BW16M1 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 81.93 |
| Metatranscriptomes | 0.05 |
| Isolates | 18.01 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.21 |
| Bulb | 0 |
| Endosphere | 9.56 |
| Nodule | 2.32 |
| Rhizoplane | 5.71 |
| Rhizosphere | 65.35 |
| Stem | 0 |
| Stem Tuber | 0.32 |
| Unclassified | 0.05 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0055526_1007031 | 3300003771 | Bacteria | 5957 |
| 2 | MRS2a_Contig_66 | 2124908027 | Bacteria | 22945 |
| 3 | SwRhRL2b_contig_111498 | 2162886007 | Bacteria | 5326 |
| 4 | SwRhRL2b_contig_3150169 | 2162886007 | Bacteria | 9422 |
| 5 | SwRhRL2b_contig_677248 | 2162886007 | Bacteria | 190393 |
| 6 | JGI24736J21556_1001491 | 3300001904 | Bacteria | 4281 |
| 7 | JGI25162J39368_1000002 | 3300002737 | Bacteria | 663004 |
| 8 | JGI25162J39368_1000140 | 3300002737 | Bacteria | 78251 |
| 9 | JGI25162J39368_1000181 | 3300002737 | Bacteria | 67817 |
| 10 | JGI25154J39366_1000156 | 3300002738 | Bacteria | 52857 |
| 11 | JGI25154J39366_1000230 | 3300002738 | Bacteria | 37506 |
| 12 | JGI25154J39366_1001243 | 3300002738 | Bacteria | 9588 |
| 13 | JGI25157J39369_1000127 | 3300002741 | Bacteria | 65070 |
| 14 | JGI25157J39369_1000241 | 3300002741 | Bacteria | 41722 |
| 15 | JGI25163J39215_1000166 | 3300002771 | Bacteria | 25833 |
| 16 | JGI25163J39215_1000195 | 3300002771 | Bacteria | 23525 |
| 17 | JGI25163J39215_1000805 | 3300002771 | Bacteria | 7547 |
| 18 | JGI25163J39215_1001748 | 3300002771 | Bacteria | 3035 |
| 19 | JGI25164J39214_1000066 | 3300002772 | Bacteria | 106367 |
| 20 | JGI25164J39214_1000110 | 3300002772 | Bacteria | 78251 |
| 21 | JGI25164J39214_1000146 | 3300002772 | Bacteria | 67817 |
| 22 | JGI25152J39213_1000052 | 3300002773 | Bacteria | 77690 |
| 23 | JGI25150J39212_1000260 | 3300002774 | Bacteria | 28066 |
| 24 | JGI25150J39212_1000643 | 3300002774 | Bacteria | 13163 |
| 25 | JGI25159J45721_1010505 | 3300002987 | Bacteria | 2351 |
| 26 | JGI25165J46597_1000001 | 3300003214 | Bacteria | 1111887 |
| 27 | JGI25165J46597_1000228 | 3300003214 | Bacteria | 78251 |
| 28 | JGI25165J46597_1000267 | 3300003214 | Bacteria | 67817 |
| 29 | JGI25153J46596_10018456 | 3300003215 | Bacteria | 2709 |
| 30 | JGI25153J46596_10020340 | 3300003215 | Bacteria | 2512 |
| 31 | rootH1_10077162 | 3300003316 | Bacteria | 4103 |
| 32 | rootH2_10034969 | 3300003320 | Bacteria | 27348 |
| 33 | rootL2_10018704 | 3300003322 | Bacteria | 6623 |
| 34 | rootH1_10009899 | 3300003323 | Bacteria | 26612 |
| 35 | rootH1_10025721 | 3300003323 | Bacteria | 8664 |
| 36 | JGI25160J50197_1011257 | 3300003354 | Bacteria | 3180 |
| 37 | JGI25161J50226_1000052 | 3300003374 | Bacteria | 107273 |
| 38 | JGI25161J50226_1005753 | 3300003374 | Bacteria | 2351 |
| 39 | Ga0055538_1000001 | 3300003751 | Bacteria | 1111887 |
| 40 | Ga0055538_1000003 | 3300003751 | Bacteria | 663004 |
| 41 | Ga0055538_1000037 | 3300003751 | Bacteria | 190238 |
| 42 | Ga0055538_1000057 | 3300003751 | Bacteria | 112934 |
| 43 | Ga0055539_1000001 | 3300003752 | Bacteria | 1111887 |
| 44 | Ga0055539_1000003 | 3300003752 | Bacteria | 663004 |
| 45 | Ga0055539_1000048 | 3300003752 | Bacteria | 190238 |
| 46 | Ga0055539_1000088 | 3300003752 | Bacteria | 112934 |
| 47 | Ga0055539_1000405 | 3300003752 | Bacteria | 16592 |
| 48 | Ga0055533_1000003 | 3300003756 | Bacteria | 1111887 |
| 49 | Ga0055533_1000005 | 3300003756 | Bacteria | 663004 |
| 50 | Ga0055533_1000024 | 3300003756 | Bacteria | 338067 |
| 51 | Ga0055533_1000059 | 3300003756 | Bacteria | 190238 |
| 52 | Ga0055533_1000096 | 3300003756 | Bacteria | 112934 |
| 53 | Ga0055532_1000015 | 3300003758 | Bacteria | 340197 |
| 54 | Ga0055532_1000105 | 3300003758 | Bacteria | 91428 |
| 55 | Ga0055525_1000005 | 3300003759 | Bacteria | 663004 |
| 56 | Ga0055525_1000057 | 3300003759 | Bacteria | 211185 |
| 57 | Ga0055525_1000087 | 3300003759 | Bacteria | 149803 |
| 58 | Ga0055525_1000128 | 3300003759 | Bacteria | 113553 |
| 59 | Ga0055525_1000129 | 3300003759 | Bacteria | 112934 |
| 60 | Ga0055525_1000778 | 3300003759 | Bacteria | 10266 |
| 61 | Ga0055535_1005791 | 3300003761 | Bacteria | 2631 |
| 62 | Ga0055526_1000066 | 3300003771 | Bacteria | 101329 |
| 63 | Ga0055526_1000100 | 3300003771 | Bacteria | 76578 |
| 64 | Ga0055537_1001797 | 3300003773 | Bacteria | 7805 |
| 65 | Ga0055524_1000383 | 3300003775 | Bacteria | 38438 |
| 66 | Ga0055524_1001387 | 3300003775 | Bacteria | 13982 |
| 67 | Ga0055536_1000392 | 3300003781 | Bacteria | 31780 |
| 68 | Ga0055536_1000624 | 3300003781 | Bacteria | 24057 |
| 69 | Ga0055530_10000050 | 3300003791 | Bacteria | 105620 |
| 70 | Ga0055530_10000333 | 3300003791 | Bacteria | 42485 |
| 71 | Ga0055530_10001393 | 3300003791 | Bacteria | 17867 |
| 72 | Ga0055530_10006688 | 3300003791 | Bacteria | 5068 |
| 73 | Ga0055530_10020690 | 3300003791 | Bacteria | 1958 |
| 74 | Ga0055540_1000279 | 3300003792 | Bacteria | 45880 |
| 75 | Ga0055540_1001037 | 3300003792 | Bacteria | 17785 |
| 76 | Ga0055531_10000321 | 3300003794 | Bacteria | 47157 |
| 77 | Ga0055531_10000334 | 3300003794 | Bacteria | 46520 |
| 78 | Ga0055541_1000001 | 3300003841 | Bacteria | 1111887 |
| 79 | Ga0055541_1000003 | 3300003841 | Bacteria | 663004 |
| 80 | Ga0055541_1000035 | 3300003841 | Bacteria | 190238 |
| 81 | Ga0055541_1000059 | 3300003841 | Bacteria | 112934 |
| 82 | Ga0058692_1000467 | 3300003856 | Bacteria | 18185 |
| 83 | Ga0058692_1000511 | 3300003856 | Bacteria | 17175 |
| 84 | Ga0058692_1000526 | 3300003856 | Bacteria | 16625 |
| 85 | Ga0058692_1000596 | 3300003856 | Bacteria | 15201 |
| 86 | Ga0058692_1005707 | 3300003856 | Bacteria | 3516 |
| 87 | Ga0055543_1000038 | 3300004625 | Bacteria | 124032 |
| 88 | Ga0065165_1000117 | 3300005262 | Bacteria | 134716 |
| 89 | Ga0065714_10002942 | 3300005288 | Bacteria | 12490 |
| 90 | Ga0065714_10066785 | 3300005288 | Bacteria | 6305 |
| 91 | Ga0065714_10118969 | 3300005288 | Bacteria | 1366 |
| 92 | Ga0065704_10000264 | 3300005289 | Bacteria | 45979 |
| 93 | Ga0065704_10005832 | 3300005289 | Bacteria | 4106 |
| 94 | Ga0065704_10070138 | 3300005289 | Bacteria | 546071 |
| 95 | Ga0065704_10070840 | 3300005289 | Bacteria | 15542 |
| 96 | Ga0065704_10117084 | 3300005289 | Bacteria | 1836 |
| 97 | Ga0065712_10002256 | 3300005290 | Bacteria | 8682 |
| 98 | Ga0065707_10004433 | 3300005295 | Bacteria | 4276 |
| 99 | Ga0070658_10051357 | 3300005327 | Bacteria | 3342 |
| 100 | Ga0070690_100009303 | 3300005330 | Bacteria | 5689 |
| 101 | Ga0070670_100002353 | 3300005331 | Bacteria | 15579 |
| 102 | Ga0068869_100004475 | 3300005334 | Bacteria | 8689 |
| 103 | Ga0068869_100259175 | 3300005334 | Bacteria | 1392 |
| 104 | Ga0070666_10129865 | 3300005335 | Bacteria | 1750 |
| 105 | Ga0070660_100061895 | 3300005339 | Bacteria | 2906 |
| 106 | Ga0070661_100000078 | 3300005344 | Bacteria | 77449 |
| 107 | Ga0070669_100000221 | 3300005353 | Bacteria | 47408 |
| 108 | Ga0070669_100001965 | 3300005353 | Bacteria | 14852 |
| 109 | Ga0070673_100002270 | 3300005364 | Bacteria | 11654 |
| 110 | Ga0070673_100206336 | 3300005364 | Bacteria | 1695 |
| 111 | Ga0070688_100140697 | 3300005365 | Bacteria | 1639 |
| 112 | Ga0070659_100009757 | 3300005366 | Bacteria | 7057 |
| 113 | Ga0070659_100022514 | 3300005366 | Bacteria | 4812 |
| 114 | Ga0070714_100002975 | 3300005435 | Bacteria | 12559 |
| 115 | Ga0070711_100039163 | 3300005439 | Bacteria | 3191 |
| 116 | Ga0070705_100051014 | 3300005440 | Bacteria | 2410 |
| 117 | Ga0070708_100046554 | 3300005445 | Bacteria | 3827 |
| 118 | Ga0070662_100000095 | 3300005457 | Bacteria | 48526 |
| 119 | Ga0070706_100206242 | 3300005467 | Bacteria | 1836 |
| 120 | Ga0070707_100068328 | 3300005468 | Bacteria | 3420 |
| 121 | Ga0068853_100000089 | 3300005539 | Bacteria | 62291 |
| 122 | Ga0068853_100135139 | 3300005539 | Bacteria | 2210 |
| 123 | Ga0070696_100059361 | 3300005546 | Bacteria | 2673 |
| 124 | Ga0070665_100000117 | 3300005548 | Bacteria | 149831 |
| 125 | Ga0070665_100302846 | 3300005548 | Bacteria | 1601 |
| 126 | Ga0068855_100002195 | 3300005563 | Bacteria | 24130 |
| 127 | Ga0068855_100066169 | 3300005563 | Bacteria | 4213 |
| 128 | Ga0070664_100000391 | 3300005564 | Bacteria | 32645 |
| 129 | Ga0070664_100014872 | 3300005564 | Bacteria | 6350 |
| 130 | Ga0070664_100119058 | 3300005564 | Bacteria | 2310 |
| 131 | Ga0068857_100000006 | 3300005577 | Bacteria | 168660 |
| 132 | Ga0068857_100001885 | 3300005577 | Bacteria | 16897 |
| 133 | Ga0068857_100369670 | 3300005577 | Bacteria | 1330 |
| 134 | Ga0068854_100005598 | 3300005578 | Bacteria | 7938 |
| 135 | Ga0068856_100005894 | 3300005614 | Bacteria | 12076 |
| 136 | Ga0068861_100005127 | 3300005719 | Bacteria | 8834 |
| 137 | Ga0068851_10000024 | 3300005834 | Bacteria | 125917 |
| 138 | Ga0068851_10001161 | 3300005834 | Bacteria | 11427 |
| 139 | Ga0068863_100104359 | 3300005841 | Bacteria | 2696 |
| 140 | Ga0068860_100032190 | 3300005843 | Bacteria | 5040 |
| 141 | Ga0068860_100225729 | 3300005843 | Bacteria | 1819 |
| 142 | Ga0068862_100142116 | 3300005844 | Bacteria | 2131 |
| 143 | Ga0081455_10000094 | 3300005937 | Bacteria | 96637 |
| 144 | Ga0081538_10002691 | 3300005981 | Bacteria | 17084 |
| 145 | Ga0075364_10000923 | 3300006051 | Bacteria | 15523 |
| 146 | Ga0075364_10008290 | 3300006051 | Bacteria | 6207 |
| 147 | Ga0075364_10044409 | 3300006051 | Bacteria | 2890 |
| 148 | Ga0075364_10074101 | 3300006051 | Bacteria | 2244 |
| 149 | Ga0075432_10033245 | 3300006058 | Bacteria | 1788 |
| 150 | Ga0070712_100074217 | 3300006175 | Bacteria | 2443 |
| 151 | Ga0097621_100023910 | 3300006237 | Bacteria | 4763 |
| 152 | Ga0068871_100012427 | 3300006358 | Bacteria | 6275 |
| 153 | Ga0075431_100041519 | 3300006847 | Bacteria | 4742 |
| 154 | Ga0075431_100110820 | 3300006847 | Bacteria | 2832 |
| 155 | Ga0075431_100269780 | 3300006847 | Bacteria | 1725 |
| 156 | Ga0075433_10002631 | 3300006852 | Bacteria | 13709 |
| 157 | Ga0075433_10025385 | 3300006852 | Bacteria | 5009 |
| 158 | Ga0075434_100025667 | 3300006871 | Bacteria | 5766 |
| 159 | Ga0075434_100069988 | 3300006871 | Bacteria | 3499 |
| 160 | Ga0075429_100095061 | 3300006880 | Bacteria | 2599 |
| 161 | Ga0079104_1000078 | 3300006946 | Bacteria | 141909 |
| 162 | Ga0079104_1000130 | 3300006946 | Bacteria | 107410 |
| 163 | Ga0079104_1000296 | 3300006946 | Bacteria | 63123 |
| 164 | Ga0079104_1000398 | 3300006946 | Bacteria | 50358 |
| 165 | Ga0079104_1000527 | 3300006946 | Bacteria | 40639 |
| 166 | Ga0079104_1000564 | 3300006946 | Bacteria | 37815 |
| 167 | Ga0079104_1001042 | 3300006946 | Bacteria | 21182 |
| 168 | Ga0079104_1001578 | 3300006946 | Bacteria | 14902 |
| 169 | Ga0079104_1001940 | 3300006946 | Bacteria | 12304 |
| 170 | Ga0079104_1019295 | 3300006946 | Bacteria | 1909 |
| 171 | Ga0075435_100003659 | 3300007076 | Bacteria | 10469 |
| 172 | Ga0075435_100065755 | 3300007076 | Bacteria | 2948 |
| 173 | Ga0075435_100098519 | 3300007076 | Bacteria | 2420 |
| 174 | Ga0105251_10000113 | 3300009011 | Bacteria | 80570 |
| 175 | Ga0105251_10000361 | 3300009011 | Bacteria | 44718 |
| 176 | Ga0105251_10000488 | 3300009011 | Bacteria | 37538 |
| 177 | Ga0105251_10001520 | 3300009011 | Bacteria | 19928 |
| 178 | Ga0105251_10001591 | 3300009011 | Bacteria | 19391 |
| 179 | Ga0105251_10002600 | 3300009011 | Bacteria | 13964 |
| 180 | Ga0105251_10003514 | 3300009011 | Bacteria | 11319 |
| 181 | Ga0105251_10003914 | 3300009011 | Bacteria | 10579 |
| 182 | Ga0105251_10006822 | 3300009011 | Bacteria | 7185 |
| 183 | Ga0105251_10016397 | 3300009011 | Bacteria | 4004 |
| 184 | Ga0105251_10047549 | 3300009011 | Bacteria | 2061 |
| 185 | Ga0105251_10057511 | 3300009011 | Bacteria | 1837 |
| 186 | Ga0105244_10000021 | 3300009036 | Bacteria | 238820 |
| 187 | Ga0105244_10000034 | 3300009036 | Bacteria | 168462 |
| 188 | Ga0105244_10000557 | 3300009036 | Bacteria | 33275 |
| 189 | Ga0105244_10000982 | 3300009036 | Bacteria | 23922 |
| 190 | Ga0105244_10002091 | 3300009036 | Bacteria | 15355 |
| 191 | Ga0105244_10002327 | 3300009036 | Bacteria | 14438 |
| 192 | Ga0105244_10002351 | 3300009036 | Bacteria | 14360 |
| 193 | Ga0105244_10003420 | 3300009036 | Bacteria | 11312 |
| 194 | Ga0105244_10003749 | 3300009036 | Bacteria | 10736 |
| 195 | Ga0105244_10003972 | 3300009036 | Bacteria | 10370 |
| 196 | Ga0105244_10004754 | 3300009036 | Bacteria | 9248 |
| 197 | Ga0105244_10010109 | 3300009036 | Bacteria | 5745 |
| 198 | Ga0105244_10011859 | 3300009036 | Bacteria | 5194 |
| 199 | Ga0105244_10037378 | 3300009036 | Bacteria | 2539 |
| 200 | Ga0105244_10044227 | 3300009036 | Bacteria | 2295 |
| 201 | Ga0105244_10073766 | 3300009036 | Bacteria | 1698 |
| 202 | Ga0105250_10000004 | 3300009092 | Bacteria | 438653 |
| 203 | Ga0105250_10000189 | 3300009092 | Bacteria | 52791 |
| 204 | Ga0105250_10000211 | 3300009092 | Bacteria | 48658 |
| 205 | Ga0105250_10000447 | 3300009092 | Bacteria | 29734 |
| 206 | Ga0105250_10001416 | 3300009092 | Bacteria | 12955 |
| 207 | Ga0105250_10001514 | 3300009092 | Bacteria | 12544 |
| 208 | Ga0105250_10004436 | 3300009092 | Bacteria | 6462 |
| 209 | Ga0105250_10005745 | 3300009092 | Bacteria | 5526 |
| 210 | Ga0105250_10009521 | 3300009092 | Bacteria | 4087 |
| 211 | Ga0105240_10004079 | 3300009093 | Bacteria | 22469 |
| 212 | Ga0105240_10046807 | 3300009093 | Bacteria | 5477 |
| 213 | Ga0105240_10047323 | 3300009093 | Bacteria | 5443 |
| 214 | Ga0105240_10122372 | 3300009093 | Bacteria | 3131 |
| 215 | Ga0111539_10050989 | 3300009094 | Bacteria | 4930 |
| 216 | Ga0111539_10452857 | 3300009094 | Bacteria | 1494 |
| 217 | Ga0105245_10162449 | 3300009098 | Bacteria | 2121 |
| 218 | Ga0114129_10002450 | 3300009147 | Bacteria | 25774 |
| 219 | Ga0114129_10011473 | 3300009147 | Bacteria | 12618 |
| 220 | Ga0114129_10044965 | 3300009147 | Bacteria | 6210 |
| 221 | Ga0114129_10062432 | 3300009147 | Bacteria | 5205 |
| 222 | Ga0114129_10075748 | 3300009147 | Unclassified | 4685 |
| 223 | Ga0105243_10000595 | 3300009148 | Bacteria | 36195 |
| 224 | Ga0105243_10000918 | 3300009148 | Bacteria | 27604 |
| 225 | Ga0105243_10013794 | 3300009148 | Bacteria | 6115 |
| 226 | Ga0105243_10039308 | 3300009148 | Bacteria | 3687 |
| 227 | Ga0105243_10061309 | 3300009148 | Bacteria | 3008 |
| 228 | Ga0105243_10111717 | 3300009148 | Bacteria | 2288 |
| 229 | Ga0105241_10000004 | 3300009174 | Bacteria | 803007 |
| 230 | Ga0105241_10002206 | 3300009174 | Bacteria | 14650 |
| 231 | Ga0105242_10000136 | 3300009176 | Bacteria | 53348 |
| 232 | Ga0105242_10012557 | 3300009176 | Bacteria | 6522 |
| 233 | Ga0105248_10012631 | 3300009177 | Bacteria | 9319 |
| 234 | Ga0105248_10034319 | 3300009177 | Bacteria | 5671 |
| 235 | Ga0105248_10165972 | 3300009177 | Bacteria | 2489 |
| 236 | Ga0105237_10000939 | 3300009545 | Bacteria | 39181 |
| 237 | Ga0105237_10013428 | 3300009545 | Bacteria | 8589 |
| 238 | Ga0105237_10029202 | 3300009545 | Bacteria | 5609 |
| 239 | Ga0105238_10000006 | 3300009551 | Bacteria | 346249 |
| 240 | Ga0105238_10021866 | 3300009551 | Bacteria | 6515 |
| 241 | Ga0105239_10030781 | 3300010375 | Bacteria | 5903 |
| 242 | Ga0105239_10325231 | 3300010375 | Bacteria | 1734 |
| 243 | Ga0105239_10426401 | 3300010375 | Bacteria | 1503 |
| 244 | Ga0105246_10000042 | 3300011119 | Bacteria | 48091 |
| 245 | Ga0105246_10003799 | 3300011119 | Bacteria | 9151 |
| 246 | Ga0105246_10010036 | 3300011119 | Bacteria | 5843 |
| 247 | Ga0105246_10179365 | 3300011119 | Bacteria | 1629 |
| 248 | Ga0157373_10001463 | 3300013100 | Bacteria | 18045 |
| 249 | Ga0157373_10002210 | 3300013100 | Bacteria | 14730 |
| 250 | Ga0157373_10021939 | 3300013100 | Bacteria | 4633 |
| 251 | Ga0157373_10030530 | 3300013100 | Bacteria | 3879 |
| 252 | Ga0157373_10067906 | 3300013100 | Bacteria | 2521 |
| 253 | Ga0157371_10000811 | 3300013102 | Bacteria | 35895 |
| 254 | Ga0157371_10001070 | 3300013102 | Bacteria | 29890 |
| 255 | Ga0157371_10001080 | 3300013102 | Bacteria | 29511 |
| 256 | Ga0157371_10002984 | 3300013102 | Bacteria | 15714 |
| 257 | Ga0157371_10005453 | 3300013102 | Bacteria | 10723 |
| 258 | Ga0157371_10005644 | 3300013102 | Bacteria | 10505 |
| 259 | Ga0157371_10025390 | 3300013102 | Bacteria | 4318 |
| 260 | Ga0157371_10025844 | 3300013102 | Bacteria | 4273 |
| 261 | Ga0157371_10096412 | 3300013102 | Bacteria | 2096 |
| 262 | Ga0157370_10000150 | 3300013104 | Bacteria | 85732 |
| 263 | Ga0157370_10000655 | 3300013104 | Bacteria | 43089 |
| 264 | Ga0157370_10001869 | 3300013104 | Bacteria | 25963 |
| 265 | Ga0157370_10002081 | 3300013104 | Bacteria | 24497 |
| 266 | Ga0157370_10003150 | 3300013104 | Bacteria | 19544 |
| 267 | Ga0157370_10024113 | 3300013104 | Bacteria | 6031 |
| 268 | Ga0157370_10034674 | 3300013104 | Bacteria | 4910 |
| 269 | Ga0157370_10047672 | 3300013104 | Bacteria | 4107 |
| 270 | Ga0157370_10074019 | 3300013104 | Bacteria | 3213 |
| 271 | Ga0157369_10000080 | 3300013105 | Bacteria | 133011 |
| 272 | Ga0157369_10001555 | 3300013105 | Bacteria | 28080 |
| 273 | Ga0157369_10010831 | 3300013105 | Bacteria | 10386 |
| 274 | Ga0157369_10022077 | 3300013105 | Bacteria | 7112 |
| 275 | Ga0157369_10027225 | 3300013105 | Bacteria | 6339 |
| 276 | Ga0157369_10027876 | 3300013105 | Bacteria | 6257 |
| 277 | Ga0157369_10059033 | 3300013105 | Bacteria | 4138 |
| 278 | Ga0157378_10004257 | 3300013297 | Bacteria | 12614 |
| 279 | Ga0163162_10000737 | 3300013306 | Bacteria | 30385 |
| 280 | Ga0163162_10028226 | 3300013306 | Bacteria | 5551 |
| 281 | Ga0163162_10111392 | 3300013306 | Bacteria | 2834 |
| 282 | Ga0163162_10120879 | 3300013306 | Bacteria | 2723 |
| 283 | Ga0163162_10313256 | 3300013306 | Bacteria | 1702 |
| 284 | Ga0157372_10001529 | 3300013307 | Bacteria | 25153 |
| 285 | Ga0157372_10005514 | 3300013307 | Bacteria | 13454 |
| 286 | Ga0157372_10009617 | 3300013307 | Bacteria | 10275 |
| 287 | Ga0157372_10038144 | 3300013307 | Bacteria | 5302 |
| 288 | Ga0157375_10001875 | 3300013308 | Bacteria | 18102 |
| 289 | Ga0157375_10172300 | 3300013308 | Bacteria | 2312 |
| 290 | Ga0157375_10259389 | 3300013308 | Bacteria | 1900 |
| 291 | Ga0182008_10000203 | 3300014497 | Bacteria | 46755 |
| 292 | Ga0182008_10001562 | 3300014497 | Bacteria | 15234 |
| 293 | Ga0182008_10002570 | 3300014497 | Bacteria | 11290 |
| 294 | Ga0182008_10003277 | 3300014497 | Bacteria | 9848 |
| 295 | Ga0182008_10009036 | 3300014497 | Bacteria | 5397 |
| 296 | Ga0182008_10048080 | 3300014497 | Bacteria | 2119 |
| 297 | Ga0182008_10061975 | 3300014497 | Bacteria | 1844 |
| 298 | Ga0157379_10000183 | 3300014968 | Bacteria | 47695 |
| 299 | Ga0157376_10026443 | 3300014969 | Bacteria | 4587 |
| 300 | Ga0182006_1000002 | 3300015261 | Bacteria | 887990 |
| 301 | Ga0182006_1000009 | 3300015261 | Bacteria | 438243 |
| 302 | Ga0182006_1000021 | 3300015261 | Bacteria | 280808 |
| 303 | Ga0182006_1000380 | 3300015261 | Bacteria | 36760 |
| 304 | Ga0182006_1001000 | 3300015261 | Bacteria | 18502 |
| 305 | Ga0182006_1004320 | 3300015261 | Bacteria | 7033 |
| 306 | Ga0182006_1004510 | 3300015261 | Bacteria | 6855 |
| 307 | Ga0182006_1006485 | 3300015261 | Bacteria | 5436 |
| 308 | Ga0182006_1008456 | 3300015261 | Bacteria | 4662 |
| 309 | Ga0182006_1008677 | 3300015261 | Bacteria | 4600 |
| 310 | Ga0182006_1011832 | 3300015261 | Bacteria | 3825 |
| 311 | Ga0182006_1022085 | 3300015261 | Bacteria | 2648 |
| 312 | Ga0182006_1030459 | 3300015261 | Bacteria | 2181 |
| 313 | Ga0182005_1000013 | 3300015265 | Bacteria | 396391 |
| 314 | Ga0182005_1000070 | 3300015265 | Bacteria | 85687 |
| 315 | Ga0182005_1000227 | 3300015265 | Bacteria | 37208 |
| 316 | Ga0182005_1004756 | 3300015265 | Bacteria | 4331 |
| 317 | Ga0182005_1012826 | 3300015265 | Bacteria | 2362 |
| 318 | Ga0182005_1014570 | 3300015265 | Bacteria | 2199 |
| 319 | Ga0163161_10000107 | 3300017792 | Bacteria | 78998 |
| 320 | Ga0163161_10000719 | 3300017792 | Bacteria | 26142 |
| 321 | Ga0163161_10005392 | 3300017792 | Bacteria | 8885 |
| 322 | Ga0163161_10018069 | 3300017792 | Bacteria | 4943 |
| 323 | Ga0163161_10026492 | 3300017792 | Bacteria | 4106 |
| 324 | Ga0163161_10040439 | 3300017792 | Bacteria | 3349 |
| 325 | Ga0163161_10096785 | 3300017792 | Bacteria | 2191 |
| 326 | Ga0213872_10000840 | 3300021361 | Bacteria | 22228 |
| 327 | Ga0213876_10000660 | 3300021384 | Bacteria | 24722 |
| 328 | Ga0213876_10013285 | 3300021384 | Bacteria | 4376 |
| 329 | Ga0209435_100021 | 3300025206 | Bacteria | 223961 |
| 330 | Ga0209435_100318 | 3300025206 | Bacteria | 11585 |
| 331 | Ga0209760_100005 | 3300025207 | Bacteria | 238315 |
| 332 | Ga0209760_100037 | 3300025207 | Bacteria | 129761 |
| 333 | Ga0209760_100128 | 3300025207 | Bacteria | 50562 |
| 334 | Ga0209436_100063 | 3300025208 | Bacteria | 56237 |
| 335 | Ga0209436_100337 | 3300025208 | Bacteria | 21289 |
| 336 | Ga0209784_100001 | 3300025224 | Bacteria | 3600592 |
| 337 | Ga0209784_100004 | 3300025224 | Bacteria | 1378156 |
| 338 | Ga0209784_100009 | 3300025224 | Bacteria | 688031 |
| 339 | Ga0209784_100028 | 3300025224 | Bacteria | 357464 |
| 340 | Ga0209566_100001 | 3300025225 | Bacteria | 3600765 |
| 341 | Ga0209566_100004 | 3300025225 | Bacteria | 1531866 |
| 342 | Ga0209566_100007 | 3300025225 | Bacteria | 688031 |
| 343 | Ga0209566_100028 | 3300025225 | Bacteria | 357464 |
| 344 | Ga0209674_100002 | 3300025226 | Bacteria | 3600592 |
| 345 | Ga0209674_100006 | 3300025226 | Bacteria | 1531866 |
| 346 | Ga0209674_100007 | 3300025226 | Bacteria | 1077082 |
| 347 | Ga0209674_100018 | 3300025226 | Bacteria | 688031 |
| 348 | Ga0209674_100047 | 3300025226 | Bacteria | 357464 |
| 349 | Ga0209672_104838 | 3300025228 | Bacteria | 2423 |
| 350 | Ga0209147_100004 | 3300025229 | Bacteria | 1371850 |
| 351 | Ga0209147_100031 | 3300025229 | Bacteria | 357464 |
| 352 | Ga0209563_100002 | 3300025230 | Bacteria | 2045675 |
| 353 | Ga0209563_100009 | 3300025230 | Bacteria | 1378156 |
| 354 | Ga0209563_100014 | 3300025230 | Bacteria | 940582 |
| 355 | Ga0209563_100020 | 3300025230 | Bacteria | 688031 |
| 356 | Ga0209563_100050 | 3300025230 | Bacteria | 357464 |
| 357 | Ga0209563_100052 | 3300025230 | Bacteria | 334307 |
| 358 | Ga0209563_102415 | 3300025230 | Bacteria | 4237 |
| 359 | Ga0207427_100009 | 3300025231 | Bacteria | 663036 |
| 360 | Ga0207427_100014 | 3300025231 | Bacteria | 561361 |
| 361 | Ga0207427_100016 | 3300025231 | Bacteria | 538697 |
| 362 | Ga0207427_100851 | 3300025231 | Bacteria | 13601 |
| 363 | Ga0209437_100001 | 3300025233 | Bacteria | 2045675 |
| 364 | Ga0209437_100004 | 3300025233 | Bacteria | 1378156 |
| 365 | Ga0209437_100011 | 3300025233 | Bacteria | 818520 |
| 366 | Ga0209437_100016 | 3300025233 | Bacteria | 710118 |
| 367 | Ga0209437_100035 | 3300025233 | Bacteria | 481110 |
| 368 | Ga0209437_100045 | 3300025233 | Bacteria | 429809 |
| 369 | Ga0209437_103337 | 3300025233 | Bacteria | 2921 |
| 370 | Ga0209437_104234 | 3300025233 | Bacteria | 2544 |
| 371 | Ga0209258_100083 | 3300025242 | Bacteria | 246008 |
| 372 | Ga0209258_100150 | 3300025242 | Bacteria | 161813 |
| 373 | Ga0209258_100534 | 3300025242 | Bacteria | 36052 |
| 374 | Ga0207425_1000001 | 3300025245 | Bacteria | 2525432 |
| 375 | Ga0207425_1000048 | 3300025245 | Bacteria | 188748 |
| 376 | Ga0207425_1000484 | 3300025245 | Bacteria | 25043 |
| 377 | Ga0209646_1000010 | 3300025246 | Bacteria | 573803 |
| 378 | Ga0209646_1000020 | 3300025246 | Bacteria | 462204 |
| 379 | Ga0209646_1000074 | 3300025246 | Bacteria | 223961 |
| 380 | Ga0209646_1000094 | 3300025246 | Bacteria | 182874 |
| 381 | Ga0209646_1000183 | 3300025246 | Bacteria | 79021 |
| 382 | Ga0209026_1000009 | 3300025250 | Bacteria | 531812 |
| 383 | Ga0209026_1000058 | 3300025250 | Bacteria | 228656 |
| 384 | Ga0209677_100002 | 3300025253 | Bacteria | 2045675 |
| 385 | Ga0209677_100005 | 3300025253 | Bacteria | 1378156 |
| 386 | Ga0209677_100010 | 3300025253 | Bacteria | 688031 |
| 387 | Ga0209677_100015 | 3300025253 | Bacteria | 532137 |
| 388 | Ga0209677_100029 | 3300025253 | Bacteria | 357464 |
| 389 | Ga0209677_100097 | 3300025253 | Bacteria | 97418 |
| 390 | Ga0209677_101137 | 3300025253 | Bacteria | 12430 |
| 391 | Ga0209759_1000046 | 3300025256 | Bacteria | 230149 |
| 392 | Ga0209759_1000065 | 3300025256 | Bacteria | 187612 |
| 393 | Ga0209759_1000073 | 3300025256 | Bacteria | 178048 |
| 394 | Ga0209129_1000001 | 3300025258 | Bacteria | 1452436 |
| 395 | Ga0209129_1002226 | 3300025258 | Bacteria | 9712 |
| 396 | Ga0209233_1000005 | 3300025261 | Bacteria | 1531866 |
| 397 | Ga0209233_1000019 | 3300025261 | Bacteria | 818520 |
| 398 | Ga0209233_1000036 | 3300025261 | Bacteria | 561361 |
| 399 | Ga0209233_1000634 | 3300025261 | Bacteria | 17526 |
| 400 | Ga0209565_1003393 | 3300025263 | Bacteria | 5181 |
| 401 | Ga0209565_1003550 | 3300025263 | Bacteria | 4995 |
| 402 | Ga0209565_1004335 | 3300025263 | Bacteria | 4350 |
| 403 | Ga0209565_1008440 | 3300025263 | Bacteria | 2692 |
| 404 | Ga0209455_1001956 | 3300025272 | Bacteria | 8493 |
| 405 | Ga0209130_1000059 | 3300025284 | Bacteria | 204772 |
| 406 | Ga0209130_1003699 | 3300025284 | Bacteria | 6297 |
| 407 | Ga0209130_1009134 | 3300025284 | Bacteria | 2856 |
| 408 | Ga0209675_1004660 | 3300025291 | Bacteria | 6025 |
| 409 | Ga0209676_1000025 | 3300025292 | Bacteria | 577569 |
| 410 | Ga0209676_1000026 | 3300025292 | Bacteria | 574599 |
| 411 | Ga0209676_1000032 | 3300025292 | Bacteria | 469558 |
| 412 | Ga0209676_1000318 | 3300025292 | Bacteria | 94045 |
| 413 | Ga0209676_1009868 | 3300025292 | Bacteria | 4056 |
| 414 | Ga0209025_1002077 | 3300025294 | Bacteria | 22739 |
| 415 | Ga0209564_1000009 | 3300025295 | Bacteria | 950196 |
| 416 | Ga0209564_1000045 | 3300025295 | Bacteria | 376549 |
| 417 | Ga0209564_1000219 | 3300025295 | Bacteria | 129725 |
| 418 | Ga0209564_1004579 | 3300025295 | Bacteria | 8371 |
| 419 | Ga0209758_1000166 | 3300025297 | Bacteria | 151104 |
| 420 | Ga0209758_1000489 | 3300025297 | Bacteria | 64758 |
| 421 | Ga0209050_1000025 | 3300025298 | Bacteria | 528225 |
| 422 | Ga0209050_1000058 | 3300025298 | Bacteria | 325558 |
| 423 | Ga0209050_1000331 | 3300025298 | Bacteria | 94245 |
| 424 | Ga0209050_1000398 | 3300025298 | Bacteria | 81373 |
| 425 | Ga0209050_1000520 | 3300025298 | Bacteria | 64262 |
| 426 | Ga0209050_1001196 | 3300025298 | Bacteria | 30513 |
| 427 | Ga0209050_1003847 | 3300025298 | Bacteria | 10695 |
| 428 | Ga0209256_1000350 | 3300025299 | Bacteria | 74944 |
| 429 | Ga0209256_1001089 | 3300025299 | Bacteria | 31291 |
| 430 | Ga0207426_1001606 | 3300025302 | Bacteria | 17990 |
| 431 | Ga0209051_1000026 | 3300025303 | Bacteria | 413311 |
| 432 | Ga0209051_1000299 | 3300025303 | Bacteria | 78310 |
| 433 | Ga0209051_1009700 | 3300025303 | Bacteria | 4936 |
| 434 | Ga0209051_1012533 | 3300025303 | Bacteria | 4096 |
| 435 | Ga0209051_1016351 | 3300025303 | Bacteria | 3364 |
| 436 | Ga0209257_1000003 | 3300025304 | Bacteria | 1702593 |
| 437 | Ga0209257_1000034 | 3300025304 | Bacteria | 662719 |
| 438 | Ga0209257_1001074 | 3300025304 | Bacteria | 35989 |
| 439 | Ga0207697_10015082 | 3300025315 | Bacteria | 3197 |
| 440 | Ga0207696_1000020 | 3300025711 | Bacteria | 434998 |
| 441 | Ga0207696_1000033 | 3300025711 | Bacteria | 360689 |
| 442 | Ga0207696_1000040 | 3300025711 | Bacteria | 318695 |
| 443 | Ga0207696_1000057 | 3300025711 | Bacteria | 249404 |
| 444 | Ga0207696_1000070 | 3300025711 | Bacteria | 227242 |
| 445 | Ga0207696_1000084 | 3300025711 | Bacteria | 196086 |
| 446 | Ga0207696_1000114 | 3300025711 | Bacteria | 151422 |
| 447 | Ga0207696_1000482 | 3300025711 | Bacteria | 33749 |
| 448 | Ga0207696_1000553 | 3300025711 | Bacteria | 29996 |
| 449 | Ga0207696_1000679 | 3300025711 | Bacteria | 23720 |
| 450 | Ga0207696_1000885 | 3300025711 | Bacteria | 18669 |
| 451 | Ga0207696_1002459 | 3300025711 | Bacteria | 9058 |
| 452 | Ga0207696_1002728 | 3300025711 | Bacteria | 8414 |
| 453 | Ga0207696_1017321 | 3300025711 | Bacteria | 2389 |
| 454 | Ga0207655_1000014 | 3300025728 | Bacteria | 607124 |
| 455 | Ga0207655_1000040 | 3300025728 | Bacteria | 335311 |
| 456 | Ga0207655_1000043 | 3300025728 | Bacteria | 332919 |
| 457 | Ga0207655_1000046 | 3300025728 | Bacteria | 309474 |
| 458 | Ga0207655_1000082 | 3300025728 | Bacteria | 213760 |
| 459 | Ga0207655_1000326 | 3300025728 | Bacteria | 70089 |
| 460 | Ga0207655_1000405 | 3300025728 | Bacteria | 59516 |
| 461 | Ga0207655_1000683 | 3300025728 | Bacteria | 39498 |
| 462 | Ga0207655_1000935 | 3300025728 | Bacteria | 30300 |
| 463 | Ga0207655_1002391 | 3300025728 | Bacteria | 15301 |
| 464 | Ga0207655_1002944 | 3300025728 | Bacteria | 13087 |
| 465 | Ga0207655_1003197 | 3300025728 | Bacteria | 12327 |
| 466 | Ga0207655_1005952 | 3300025728 | Bacteria | 8170 |
| 467 | Ga0207655_1006383 | 3300025728 | Bacteria | 7827 |
| 468 | Ga0207655_1013293 | 3300025728 | Bacteria | 4738 |
| 469 | Ga0207655_1013387 | 3300025728 | Bacteria | 4714 |
| 470 | Ga0207655_1013571 | 3300025728 | Bacteria | 4666 |
| 471 | Ga0207655_1022358 | 3300025728 | Bacteria | 3173 |
| 472 | Ga0207655_1022931 | 3300025728 | Bacteria | 3111 |
| 473 | Ga0207655_1045584 | 3300025728 | Bacteria | 1829 |
| 474 | Ga0207713_1000001 | 3300025735 | Bacteria | 2295391 |
| 475 | Ga0207713_1000017 | 3300025735 | Bacteria | 394495 |
| 476 | Ga0207713_1000031 | 3300025735 | Bacteria | 283971 |
| 477 | Ga0207713_1000065 | 3300025735 | Bacteria | 196128 |
| 478 | Ga0207713_1000114 | 3300025735 | Bacteria | 132170 |
| 479 | Ga0207713_1000331 | 3300025735 | Bacteria | 53100 |
| 480 | Ga0207713_1000434 | 3300025735 | Bacteria | 44039 |
| 481 | Ga0207713_1000632 | 3300025735 | Bacteria | 34264 |
| 482 | Ga0207713_1001357 | 3300025735 | Bacteria | 19946 |
| 483 | Ga0207713_1001639 | 3300025735 | Bacteria | 17443 |
| 484 | Ga0207713_1002107 | 3300025735 | Bacteria | 14839 |
| 485 | Ga0207713_1019084 | 3300025735 | Bacteria | 3369 |
| 486 | Ga0207713_1019183 | 3300025735 | Bacteria | 3357 |
| 487 | Ga0207713_1021830 | 3300025735 | Bacteria | 3059 |
| 488 | Ga0207692_10100118 | 3300025898 | Bacteria | 1589 |
| 489 | Ga0207710_10000016 | 3300025900 | Bacteria | 388568 |
| 490 | Ga0207647_10000342 | 3300025904 | Bacteria | 37701 |
| 491 | Ga0207705_10144152 | 3300025909 | Bacteria | 1781 |
| 492 | Ga0207684_10117411 | 3300025910 | Bacteria | 2280 |
| 493 | Ga0207654_10000006 | 3300025911 | Bacteria | 815027 |
| 494 | Ga0207654_10011436 | 3300025911 | Bacteria | 4529 |
| 495 | Ga0207695_10002480 | 3300025913 | Bacteria | 27184 |
| 496 | Ga0207695_10003589 | 3300025913 | Bacteria | 21707 |
| 497 | Ga0207695_10006850 | 3300025913 | Bacteria | 14669 |
| 498 | Ga0207695_10074976 | 3300025913 | Bacteria | 3443 |
| 499 | Ga0207671_10000015 | 3300025914 | Bacteria | 439607 |
| 500 | Ga0207671_10016677 | 3300025914 | Bacteria | 5701 |
| 501 | Ga0207663_10044006 | 3300025916 | Bacteria | 2738 |
| 502 | Ga0207657_10007271 | 3300025919 | Bacteria | 11373 |
| 503 | Ga0207657_10103833 | 3300025919 | Bacteria | 2356 |
| 504 | Ga0207649_10000001 | 3300025920 | Bacteria | 537851 |
| 505 | Ga0207649_10002460 | 3300025920 | Bacteria | 10368 |
| 506 | Ga0207681_10000236 | 3300025923 | Bacteria | 42706 |
| 507 | Ga0207681_10047262 | 3300025923 | Bacteria | 2898 |
| 508 | Ga0207694_10000315 | 3300025924 | Bacteria | 45522 |
| 509 | Ga0207694_10246888 | 3300025924 | Bacteria | 1460 |
| 510 | Ga0207650_10000273 | 3300025925 | Bacteria | 54321 |
| 511 | Ga0207650_10000449 | 3300025925 | Bacteria | 35040 |
| 512 | Ga0207659_10048719 | 3300025926 | Bacteria | 3003 |
| 513 | Ga0207664_10005354 | 3300025929 | Bacteria | 8765 |
| 514 | Ga0207690_10004543 | 3300025932 | Bacteria | 8195 |
| 515 | Ga0207690_10005500 | 3300025932 | Bacteria | 7473 |
| 516 | Ga0207690_10014280 | 3300025932 | Bacteria | 4795 |
| 517 | Ga0207706_10000069 | 3300025933 | Bacteria | 105541 |
| 518 | Ga0207706_10000936 | 3300025933 | Bacteria | 29850 |
| 519 | Ga0207686_10006292 | 3300025934 | Bacteria | 6386 |
| 520 | Ga0207709_10000022 | 3300025935 | Bacteria | 383573 |
| 521 | Ga0207709_10000164 | 3300025935 | Bacteria | 91154 |
| 522 | Ga0207709_10000484 | 3300025935 | Bacteria | 36264 |
| 523 | Ga0207709_10000505 | 3300025935 | Bacteria | 34640 |
| 524 | Ga0207709_10027046 | 3300025935 | Bacteria | 3300 |
| 525 | Ga0207709_10038884 | 3300025935 | Bacteria | 2837 |
| 526 | Ga0207709_10068927 | 3300025935 | Bacteria | 2237 |
| 527 | Ga0207709_10155160 | 3300025935 | Bacteria | 1590 |
| 528 | Ga0207691_10118786 | 3300025940 | Bacteria | 2345 |
| 529 | Ga0207711_10021445 | 3300025941 | Bacteria | 5397 |
| 530 | Ga0207711_10107701 | 3300025941 | Bacteria | 2475 |
| 531 | Ga0207679_10000011 | 3300025945 | Bacteria | 346112 |
| 532 | Ga0207679_10001201 | 3300025945 | Bacteria | 16463 |
| 533 | Ga0207679_10044762 | 3300025945 | Bacteria | 3196 |
| 534 | Ga0207679_10116154 | 3300025945 | Bacteria | 2121 |
| 535 | Ga0207667_10000120 | 3300025949 | Bacteria | 123800 |
| 536 | Ga0207667_10004008 | 3300025949 | Bacteria | 18098 |
| 537 | Ga0207667_10015507 | 3300025949 | Bacteria | 8648 |
| 538 | Ga0207651_10001180 | 3300025960 | Bacteria | 11721 |
| 539 | Ga0207640_10012068 | 3300025981 | Bacteria | 4912 |
| 540 | Ga0207640_10045798 | 3300025981 | Bacteria | 2811 |
| 541 | Ga0207639_10001824 | 3300026041 | Bacteria | 14346 |
| 542 | Ga0207678_10166436 | 3300026067 | Bacteria | 1882 |
| 543 | Ga0207708_10124510 | 3300026075 | Bacteria | 2011 |
| 544 | Ga0207702_10000610 | 3300026078 | Bacteria | 39489 |
| 545 | Ga0207674_10000018 | 3300026116 | Bacteria | 167809 |
| 546 | Ga0207674_10012892 | 3300026116 | Bacteria | 9328 |
| 547 | Ga0207674_10173445 | 3300026116 | Bacteria | 2109 |
| 548 | Ga0207675_100005379 | 3300026118 | Bacteria | 12284 |
| 549 | Ga0207683_10137991 | 3300026121 | Bacteria | 2196 |
| 550 | Ga0209281_1000008 | 3300027111 | Bacteria | 867470 |
| 551 | Ga0209281_1000026 | 3300027111 | Bacteria | 465877 |
| 552 | Ga0209281_1000031 | 3300027111 | Bacteria | 422772 |
| 553 | Ga0209281_1000112 | 3300027111 | Bacteria | 213847 |
| 554 | Ga0209281_1000162 | 3300027111 | Bacteria | 159535 |
| 555 | Ga0209281_1000233 | 3300027111 | Bacteria | 117525 |
| 556 | Ga0209281_1000248 | 3300027111 | Bacteria | 107418 |
| 557 | Ga0209281_1000618 | 3300027111 | Bacteria | 39906 |
| 558 | Ga0209281_1000832 | 3300027111 | Bacteria | 27672 |
| 559 | Ga0209281_1000833 | 3300027111 | Bacteria | 27672 |
| 560 | Ga0209281_1003539 | 3300027111 | Bacteria | 5102 |
| 561 | Ga0209281_1004394 | 3300027111 | Bacteria | 4232 |
| 562 | Ga0209281_1008543 | 3300027111 | Bacteria | 2477 |
| 563 | Ga0209281_1012097 | 3300027111 | Bacteria | 1907 |
| 564 | Ga0209371_1000027 | 3300027312 | Bacteria | 448853 |
| 565 | Ga0209371_1000032 | 3300027312 | Bacteria | 392355 |
| 566 | Ga0209371_1000092 | 3300027312 | Bacteria | 171648 |
| 567 | Ga0209371_1000167 | 3300027312 | Bacteria | 98922 |
| 568 | Ga0209371_1000266 | 3300027312 | Bacteria | 61272 |
| 569 | Ga0209371_1000388 | 3300027312 | Bacteria | 46275 |
| 570 | Ga0209371_1001638 | 3300027312 | Bacteria | 14415 |
| 571 | Ga0209371_1017903 | 3300027312 | Bacteria | 1819 |
| 572 | Ga0210002_1007854 | 3300027617 | Bacteria | 1620 |
| 573 | Ga0209983_1000145 | 3300027665 | Bacteria | 13043 |
| 574 | Ga0209974_10022065 | 3300027876 | Bacteria | 2108 |
| 575 | Ga0207428_10036325 | 3300027907 | Bacteria | 4019 |
| 576 | Ga0207428_10172221 | 3300027907 | Bacteria | 1639 |
| 577 | Ga0268266_10000079 | 3300028379 | Bacteria | 213545 |
| 578 | Ga0268266_10013364 | 3300028379 | Bacteria | 7073 |
| 579 | Ga0268266_10065771 | 3300028379 | Bacteria | 3134 |
| 580 | Ga0268266_10214035 | 3300028379 | Bacteria | 1768 |
| 581 | Ga0268266_10240601 | 3300028379 | Bacteria | 1670 |
| 582 | Ga0268265_10251337 | 3300028380 | Bacteria | 1566 |
| 583 | Ga0268264_10100046 | 3300028381 | Bacteria | 2518 |
| 584 | Ga0265334_10000500 | 3300028573 | Bacteria | 20148 |
| 585 | Ga0265334_10005163 | 3300028573 | Bacteria | 5722 |
| 586 | Ga0265334_10036366 | 3300028573 | Bacteria | 1945 |
| 587 | Ga0265336_10000061 | 3300028666 | Bacteria | 102829 |
| 588 | Ga0307517_10023043 | 3300028786 | Bacteria | 7766 |
| 589 | Ga0265338_10003945 | 3300028800 | Bacteria | 20449 |
| 590 | Ga0265324_10001696 | 3300029957 | Bacteria | 12114 |
| 591 | Ga0268256_1000045 | 3300030500 | Bacteria | 330053 |
| 592 | Ga0268256_1000050 | 3300030500 | Bacteria | 300675 |
| 593 | Ga0268256_1000082 | 3300030500 | Bacteria | 171648 |
| 594 | Ga0268256_1000124 | 3300030500 | Bacteria | 111181 |
| 595 | Ga0268256_1000269 | 3300030500 | Bacteria | 54055 |
| 596 | Ga0268256_1000750 | 3300030500 | Bacteria | 23747 |
| 597 | Ga0268256_1001428 | 3300030500 | Bacteria | 14415 |
| 598 | Ga0268256_1019975 | 3300030500 | Bacteria | 1819 |
| 599 | Ga0307511_10002002 | 3300030521 | Bacteria | 21396 |
| 600 | Ga0307511_10094074 | 3300030521 | Bacteria | 2011 |
| 601 | Ga0316178_1026759 | 3300030735 | Bacteria | 13206 |
| 602 | Ga0316181_1059262 | 3300030744 | Bacteria | 4477 |
| 603 | Ga0265328_10003176 | 3300031239 | Bacteria | 7295 |
| 604 | Ga0265327_10001649 | 3300031251 | Bacteria | 26951 |
| 605 | Ga0307513_10002356 | 3300031456 | Bacteria | 26271 |
| 606 | Ga0307513_10021955 | 3300031456 | Bacteria | 7521 |
| 607 | Ga0307513_10109937 | 3300031456 | Bacteria | 2752 |
| 608 | Ga0307509_10130334 | 3300031507 | Bacteria | 2471 |
| 609 | Ga0307408_100000024 | 3300031548 | Bacteria | 279725 |
| 610 | Ga0307408_100000181 | 3300031548 | Bacteria | 69832 |
| 611 | Ga0307408_100000299 | 3300031548 | Bacteria | 47931 |
| 612 | Ga0307408_100000786 | 3300031548 | Bacteria | 25524 |
| 613 | Ga0307408_100024220 | 3300031548 | Bacteria | 4142 |
| 614 | Ga0307408_100060212 | 3300031548 | Bacteria | 2767 |
| 615 | Ga0307408_100063817 | 3300031548 | Bacteria | 2696 |
| 616 | Ga0307514_10000643 | 3300031649 | Bacteria | 63638 |
| 617 | Ga0316575_10000758 | 3300031665 | Bacteria | 9722 |
| 618 | Ga0316576_10009330 | 3300031727 | Bacteria | 6323 |
| 619 | Ga0316576_10011679 | 3300031727 | Bacteria | 5767 |
| 620 | Ga0316578_10038352 | 3300031728 | Bacteria | 2763 |
| 621 | Ga0316578_10064426 | 3300031728 | Bacteria | 2163 |
| 622 | Ga0307516_10003778 | 3300031730 | Bacteria | 19239 |
| 623 | Ga0307413_10063185 | 3300031824 | Bacteria | 2294 |
| 624 | Ga0307410_10023799 | 3300031852 | Bacteria | 3816 |
| 625 | Ga0307406_10000113 | 3300031901 | Bacteria | 46753 |
| 626 | Ga0307412_10039050 | 3300031911 | Bacteria | 3062 |
| 627 | Ga0307412_10121731 | 3300031911 | Bacteria | 1879 |
| 628 | Ga0307409_100008148 | 3300031995 | Bacteria | 6332 |
| 629 | Ga0307409_100065517 | 3300031995 | Bacteria | 2859 |
| 630 | Ga0307409_100193004 | 3300031995 | Bacteria | 1815 |
| 631 | Ga0307416_100001332 | 3300032002 | Bacteria | 13308 |
| 632 | Ga0307416_100115749 | 3300032002 | Bacteria | 2375 |
| 633 | Ga0307416_100125903 | 3300032002 | Bacteria | 2295 |
| 634 | Ga0307411_10015387 | 3300032005 | Bacteria | 4295 |
| 635 | Ga0307411_10018213 | 3300032005 | Bacteria | 4023 |
| 636 | Ga0307411_10023151 | 3300032005 | Bacteria | 3673 |
| 637 | Ga0307510_10001604 | 3300033180 | Bacteria | 25008 |
| 638 | Ga0373943_0066733 | 3300035170 | Bacteria | 1813 |
| 639 | Ga0316574_0000934 | 3300035398 | Bacteria | 13033 |
| 640 | Ga0373935_0069580 | 3300035692 | Bacteria | 2267 |
| 641 | Ga0373937_0023046 | 3300036401 | Bacteria | 5602 |
| 642 | Ga0316584_0059505 | 3300036712 | Bacteria | 2861 |
| 643 | Ga0316584_0207081 | 3300036712 | Bacteria | 1445 |
| 644 | Ga0373925_0062659 | 3300037068 | Bacteria | 2797 |
| 645 | Ga0395899_0004137 | 3300037312 | Bacteria | 11407 |
| 646 | Ga0395899_0014968 | 3300037312 | Bacteria | 5916 |
| 647 | Ga0395899_0067437 | 3300037312 | Bacteria | 2625 |
| 648 | Ga0395900_0013133 | 3300037418 | Bacteria | 8463 |
| 649 | Ga0395900_0092907 | 3300037418 | Bacteria | 3100 |
| 650 | Ga0395900_0130360 | 3300037418 | Bacteria | 2577 |
| 651 | Ga0395900_0168005 | 3300037418 | Bacteria | 2234 |
| 652 | Ga0395898_0043252 | 3300037466 | Bacteria | 4439 |
| 653 | Ga0395898_0140996 | 3300037466 | Bacteria | 2307 |
| 654 | Ga0395898_0199964 | 3300037466 | Bacteria | 1908 |
| 655 | Ga0395905_0024179 | 3300037471 | Bacteria | 5734 |
| 656 | Ga0395905_0046172 | 3300037471 | Bacteria | 4084 |
| 657 | Ga0395905_0119354 | 3300037471 | Bacteria | 2478 |
| 658 | Ga0395905_0119887 | 3300037471 | Bacteria | 2472 |
| 659 | Ga0395905_0156102 | 3300037471 | Bacteria | 2146 |
| 660 | Ga0395901_0000033 | 3300038443 | Bacteria | 232357 |
| 661 | Ga0395901_0004756 | 3300038443 | Bacteria | 13701 |
| 662 | Ga0395901_0014131 | 3300038443 | Bacteria | 8128 |
| 663 | Ga0395901_0049958 | 3300038443 | Bacteria | 4346 |
| 664 | Ga0395901_0115919 | 3300038443 | Bacteria | 2814 |
| 665 | Ga0436365_0743852 | 3300039437 | Bacteria | 24807 |
| 666 | Ga0436361_0475217 | 3300039447 | Bacteria | 31445 |
| 667 | Ga0436361_0941622 | 3300039447 | Bacteria | 2080 |
| 668 | Ga0439438_000001 | 3300041405 | Bacteria | 1263568 |
| 669 | Ga0439438_000579 | 3300041405 | Bacteria | 16620 |
| 670 | Ga0439438_003785 | 3300041405 | Bacteria | 5980 |
| 671 | Ga0439447_000222 | 3300041407 | Bacteria | 20061 |
| 672 | Ga0439447_021038 | 3300041407 | Bacteria | 1722 |
| 673 | Ga0439447_025902 | 3300041407 | Bacteria | 1507 |
| 674 | Ga0439466_0000003 | 3300041411 | Bacteria | 486229 |
| 675 | Ga0439466_0008703 | 3300041411 | Bacteria | 3824 |
| 676 | Ga0439466_0014344 | 3300041411 | Bacteria | 2886 |
| 677 | Ga0439466_0021313 | 3300041411 | Bacteria | 2298 |
| 678 | Ga0451807_1250449 | 3300041486 | Bacteria | 1411 |
| 679 | Ga0451833_0043619 | 3300041491 | Bacteria | 2942 |
| 680 | Ga0451853_3838449 | 3300041512 | Bacteria | 5092 |
| 681 | Ga0439431_0005176 | 3300041997 | Bacteria | 2875 |
| 682 | Ga0439437_001461 | 3300042000 | Bacteria | 2484 |
| 683 | Ga0439448_0000301 | 3300042005 | Bacteria | 10911 |
| 684 | Ga0439448_0037632 | 3300042005 | Bacteria | 1555 |
| 685 | Ga0439432_000409 | 3300042006 | Bacteria | 15952 |
| 686 | Ga0439432_002502 | 3300042006 | Bacteria | 6925 |
| 687 | Ga0439432_003370 | 3300042006 | Bacteria | 5928 |
| 688 | Ga0439432_018396 | 3300042006 | Bacteria | 2335 |
| 689 | Ga0439432_040066 | 3300042006 | Bacteria | 1486 |
| 690 | Ga0439449_0051331 | 3300042007 | Bacteria | 1525 |
| 691 | Ga0439452_000010 | 3300042010 | Bacteria | 459139 |
| 692 | Ga0439452_000039 | 3300042010 | Bacteria | 145243 |
| 693 | Ga0439452_000212 | 3300042010 | Bacteria | 41258 |
| 694 | Ga0439452_000227 | 3300042010 | Bacteria | 39915 |
| 695 | Ga0439452_000231 | 3300042010 | Bacteria | 38808 |
| 696 | Ga0439452_000245 | 3300042010 | Bacteria | 37540 |
| 697 | Ga0439452_000977 | 3300042010 | Bacteria | 12830 |
| 698 | Ga0439452_009132 | 3300042010 | Bacteria | 2938 |
| 699 | Ga0450911_000018 | 3300042115 | Bacteria | 104759 |
| 700 | Ga0450911_000158 | 3300042115 | Bacteria | 27057 |
| 701 | Ga0450911_002722 | 3300042115 | Bacteria | 3358 |
| 702 | Ga0450920_001399 | 3300042122 | Bacteria | 3981 |
| 703 | Ga0450891_002871 | 3300042129 | Bacteria | 1703 |
| 704 | Ga0450902_000315 | 3300042137 | Bacteria | 5835 |
| 705 | Ga0450904_000622 | 3300042139 | Bacteria | 6510 |
| 706 | Ga0450906_002414 | 3300042145 | Bacteria | 4084 |
| 707 | Ga0450907_000206 | 3300042146 | Bacteria | 21277 |
| 708 | Ga0450908_009773 | 3300042184 | Bacteria | 1777 |
| 709 | Ga0450909_002236 | 3300042185 | Bacteria | 2733 |
| 710 | Ga0439434_0000122 | 3300042435 | Bacteria | 20574 |
| 711 | Ga0439464_0000216 | 3300042439 | Bacteria | 10381 |
| 712 | Ga0439464_0002678 | 3300042439 | Bacteria | 4416 |
| 713 | Ga0439464_0006312 | 3300042439 | Bacteria | 3084 |
| 714 | Ga0450893_0002000 | 3300042532 | Bacteria | 3178 |
| 715 | Ga0450901_000195 | 3300042533 | Bacteria | 7181 |
| 716 | Ga0451577_0000137 | 3300042876 | Bacteria | 163955 |
| 717 | Ga0451577_0000162 | 3300042876 | Bacteria | 145994 |
| 718 | Ga0451577_0001379 | 3300042876 | Bacteria | 32538 |
| 719 | Ga0451577_0004703 | 3300042876 | Bacteria | 14323 |
| 720 | Ga0451577_0175850 | 3300042876 | Bacteria | 1929 |
| 721 | Ga0453683_0000766 | 3300044673 | Bacteria | 31975 |
| 722 | Ga0466965_0015129 | 3300044683 | Bacteria | 3662 |
| 723 | Ga0466961_0116641 | 3300044693 | Bacteria | 1678 |
| 724 | Ga0466964_0006082 | 3300044706 | Bacteria | 4498 |
| 725 | Ga0453684_0000014 | 3300044712 | Bacteria | 993311 |
| 726 | Ga0453684_0000377 | 3300044712 | Bacteria | 183445 |
| 727 | Ga0453684_0000384 | 3300044712 | Bacteria | 181189 |
| 728 | Ga0453684_0000524 | 3300044712 | Bacteria | 146655 |
| 729 | Ga0453684_0001213 | 3300044712 | Bacteria | 79157 |
| 730 | Ga0453684_0002367 | 3300044712 | Bacteria | 46050 |
| 731 | Ga0453684_0003729 | 3300044712 | Bacteria | 33733 |
| 732 | Ga0453684_0004733 | 3300044712 | Bacteria | 28118 |
| 733 | Ga0453684_0069376 | 3300044712 | Bacteria | 4471 |
| 734 | Ga0453684_0158496 | 3300044712 | Bacteria | 2680 |
| 735 | Ga0466957_0001593 | 3300044842 | Bacteria | 11926 |
| 736 | Ga0466957_0029147 | 3300044842 | Bacteria | 3290 |
| 737 | Ga0466960_0034067 | 3300044901 | Bacteria | 2371 |
| 738 | Ga0451576_0000033 | 3300045051 | Bacteria | 393131 |
| 739 | Ga0451576_0000169 | 3300045051 | Bacteria | 164329 |
| 740 | Ga0451576_0001166 | 3300045051 | Bacteria | 47381 |
| 741 | Ga0451576_0112608 | 3300045051 | Bacteria | 2832 |
| 742 | Ga0451576_0225830 | 3300045051 | Bacteria | 1955 |
| 743 | Ga0466958_0108320 | 3300045836 | Bacteria | 1733 |
| 744 | Ga0495617_000136 | 3300046452 | Bacteria | 48660 |
| 745 | Ga0495617_003902 | 3300046452 | Bacteria | 5494 |
| 746 | Ga0495617_003925 | 3300046452 | Bacteria | 5480 |
| 747 | Ga0495617_007971 | 3300046452 | Bacteria | 3661 |
| 748 | Ga0495617_009658 | 3300046452 | Bacteria | 3309 |
| 749 | Ga0495617_023089 | 3300046452 | Bacteria | 2102 |
| 750 | Ga0495627_000023 | 3300046453 | Bacteria | 251113 |
| 751 | Ga0495627_000194 | 3300046453 | Bacteria | 66597 |
| 752 | Ga0495627_000700 | 3300046453 | Bacteria | 25589 |
| 753 | Ga0495627_001188 | 3300046453 | Bacteria | 16475 |
| 754 | Ga0495627_003088 | 3300046453 | Bacteria | 7560 |
| 755 | Ga0495627_016887 | 3300046453 | Bacteria | 2491 |
| 756 | Ga0495592_0013806 | 3300046454 | Bacteria | 6141 |
| 757 | Ga0495603_0005812 | 3300046455 | Bacteria | 7379 |
| 758 | Ga0495590_0000003 | 3300046457 | Bacteria | 478593 |
| 759 | Ga0495590_0002491 | 3300046457 | Bacteria | 7617 |
| 760 | Ga0495590_0003931 | 3300046457 | Bacteria | 6043 |
| 761 | Ga0495590_0004480 | 3300046457 | Bacteria | 5635 |
| 762 | Ga0495590_0007145 | 3300046457 | Bacteria | 4320 |
| 763 | Ga0495591_000014 | 3300046458 | Bacteria | 254281 |
| 764 | Ga0495591_000025 | 3300046458 | Bacteria | 189897 |
| 765 | Ga0495591_000029 | 3300046458 | Bacteria | 179657 |
| 766 | Ga0495591_000244 | 3300046458 | Bacteria | 52389 |
| 767 | Ga0495591_000717 | 3300046458 | Bacteria | 24075 |
| 768 | Ga0495591_001158 | 3300046458 | Bacteria | 17285 |
| 769 | Ga0495591_001191 | 3300046458 | Bacteria | 16988 |
| 770 | Ga0495591_001492 | 3300046458 | Bacteria | 14436 |
| 771 | Ga0495591_001672 | 3300046458 | Bacteria | 13343 |
| 772 | Ga0495591_001689 | 3300046458 | Bacteria | 13198 |
| 773 | Ga0495591_006448 | 3300046458 | Bacteria | 5188 |
| 774 | Ga0495591_007569 | 3300046458 | Bacteria | 4593 |
| 775 | Ga0495591_009001 | 3300046458 | Bacteria | 4017 |
| 776 | Ga0495591_009994 | 3300046458 | Bacteria | 3719 |
| 777 | Ga0495591_017937 | 3300046458 | Bacteria | 2414 |
| 778 | Ga0495629_0052049 | 3300046459 | Bacteria | 2865 |
| 779 | Ga0495638_0000091 | 3300046460 | Bacteria | 146548 |
| 780 | Ga0495638_0001218 | 3300046460 | Bacteria | 24478 |
| 781 | Ga0495638_0001551 | 3300046460 | Bacteria | 20607 |
| 782 | Ga0495638_0004653 | 3300046460 | Bacteria | 10379 |
| 783 | Ga0495638_0006661 | 3300046460 | Bacteria | 8381 |
| 784 | Ga0495638_0013609 | 3300046460 | Bacteria | 5528 |
| 785 | Ga0495638_0076050 | 3300046460 | Bacteria | 2045 |
| 786 | Ga0495651_0081988 | 3300046462 | Bacteria | 2434 |
| 787 | Ga0495653_0000549 | 3300046463 | Bacteria | 28717 |
| 788 | Ga0495653_0004499 | 3300046463 | Bacteria | 11259 |
| 789 | Ga0495653_0006284 | 3300046463 | Bacteria | 9746 |
| 790 | Ga0495653_0011868 | 3300046463 | Bacteria | 7117 |
| 791 | Ga0495653_0062377 | 3300046463 | Bacteria | 2816 |
| 792 | Ga0495650_0000032 | 3300046471 | Bacteria | 425389 |
| 793 | Ga0495650_0000097 | 3300046471 | Bacteria | 216051 |
| 794 | Ga0495650_0000103 | 3300046471 | Bacteria | 210023 |
| 795 | Ga0495650_0000386 | 3300046471 | Bacteria | 75722 |
| 796 | Ga0495650_0001058 | 3300046471 | Bacteria | 30529 |
| 797 | Ga0495650_0001865 | 3300046471 | Bacteria | 18852 |
| 798 | Ga0495650_0006713 | 3300046471 | Bacteria | 7123 |
| 799 | Ga0495650_0007354 | 3300046471 | Bacteria | 6634 |
| 800 | Ga0495650_0010356 | 3300046471 | Bacteria | 5210 |
| 801 | Ga0495650_0011972 | 3300046471 | Bacteria | 4698 |
| 802 | Ga0495650_0016850 | 3300046471 | Bacteria | 3680 |
| 803 | Ga0495650_0017796 | 3300046471 | Bacteria | 3552 |
| 804 | Ga0495580_0046926 | 3300046472 | Bacteria | 3063 |
| 805 | Ga0495582_0000880 | 3300046473 | Bacteria | 16656 |
| 806 | Ga0495582_0008606 | 3300046473 | Bacteria | 5628 |
| 807 | Ga0495605_0000095 | 3300046474 | Bacteria | 112622 |
| 808 | Ga0495605_0000237 | 3300046474 | Bacteria | 66607 |
| 809 | Ga0495605_0000246 | 3300046474 | Bacteria | 64351 |
| 810 | Ga0495605_0000251 | 3300046474 | Bacteria | 63553 |
| 811 | Ga0495605_0000311 | 3300046474 | Bacteria | 50989 |
| 812 | Ga0495605_0000328 | 3300046474 | Bacteria | 48074 |
| 813 | Ga0495605_0000673 | 3300046474 | Bacteria | 25763 |
| 814 | Ga0495605_0000878 | 3300046474 | Bacteria | 20810 |
| 815 | Ga0495605_0001867 | 3300046474 | Bacteria | 13472 |
| 816 | Ga0495605_0003763 | 3300046474 | Bacteria | 8998 |
| 817 | Ga0495605_0004933 | 3300046474 | Bacteria | 7796 |
| 818 | Ga0495605_0007006 | 3300046474 | Bacteria | 6433 |
| 819 | Ga0495605_0008057 | 3300046474 | Bacteria | 5965 |
| 820 | Ga0495605_0016771 | 3300046474 | Bacteria | 3958 |
| 821 | Ga0495605_0060012 | 3300046474 | Bacteria | 1824 |
| 822 | Ga0495605_0106440 | 3300046474 | Bacteria | 1283 |
| 823 | Ga0495639_0010865 | 3300046475 | Bacteria | 3921 |
| 824 | Ga0495584_0000695 | 3300046491 | Bacteria | 22284 |
| 825 | Ga0495584_0001738 | 3300046491 | Bacteria | 12732 |
| 826 | Ga0495584_0002471 | 3300046491 | Bacteria | 10466 |
| 827 | Ga0495584_0011709 | 3300046491 | Bacteria | 4486 |
| 828 | Ga0495584_0026343 | 3300046491 | Bacteria | 2945 |
| 829 | Ga0495584_0030102 | 3300046491 | Bacteria | 2751 |
| 830 | Ga0495584_0031955 | 3300046491 | Bacteria | 2664 |
| 831 | Ga0495585_0000005 | 3300046492 | Bacteria | 328103 |
| 832 | Ga0495585_0000279 | 3300046492 | Bacteria | 51082 |
| 833 | Ga0495585_0000790 | 3300046492 | Bacteria | 27867 |
| 834 | Ga0495585_0001195 | 3300046492 | Bacteria | 21116 |
| 835 | Ga0495585_0002554 | 3300046492 | Bacteria | 12902 |
| 836 | Ga0495585_0004763 | 3300046492 | Bacteria | 8733 |
| 837 | Ga0495585_0005582 | 3300046492 | Bacteria | 7902 |
| 838 | Ga0495585_0008791 | 3300046492 | Bacteria | 6099 |
| 839 | Ga0495585_0022472 | 3300046492 | Bacteria | 3620 |
| 840 | Ga0495585_0024974 | 3300046492 | Bacteria | 3424 |
| 841 | Ga0495585_0031614 | 3300046492 | Bacteria | 3003 |
| 842 | Ga0495585_0050086 | 3300046492 | Bacteria | 2317 |
| 843 | Ga0495585_0074612 | 3300046492 | Bacteria | 1845 |
| 844 | Ga0495594_0006507 | 3300046499 | Bacteria | 6012 |
| 845 | Ga0495594_0006764 | 3300046499 | Bacteria | 5897 |
| 846 | Ga0495594_0008636 | 3300046499 | Bacteria | 5248 |
| 847 | Ga0495594_0063337 | 3300046499 | Bacteria | 2049 |
| 848 | Ga0495596_0001177 | 3300046500 | Bacteria | 15333 |
| 849 | Ga0495596_0001477 | 3300046500 | Bacteria | 13428 |
| 850 | Ga0495596_0006433 | 3300046500 | Bacteria | 5405 |
| 851 | Ga0495596_0016068 | 3300046500 | Bacteria | 3116 |
| 852 | Ga0495596_0016079 | 3300046500 | Bacteria | 3115 |
| 853 | Ga0495607_0000181 | 3300046501 | Bacteria | 67120 |
| 854 | Ga0495607_0000347 | 3300046501 | Bacteria | 47969 |
| 855 | Ga0495607_0000552 | 3300046501 | Bacteria | 36630 |
| 856 | Ga0495607_0000776 | 3300046501 | Bacteria | 30570 |
| 857 | Ga0495607_0001128 | 3300046501 | Bacteria | 24218 |
| 858 | Ga0495607_0001875 | 3300046501 | Bacteria | 17831 |
| 859 | Ga0495607_0002014 | 3300046501 | Bacteria | 17053 |
| 860 | Ga0495607_0003010 | 3300046501 | Bacteria | 13163 |
| 861 | Ga0495607_0006297 | 3300046501 | Bacteria | 8368 |
| 862 | Ga0495607_0007143 | 3300046501 | Bacteria | 7761 |
| 863 | Ga0495607_0008065 | 3300046501 | Bacteria | 7230 |
| 864 | Ga0495607_0011290 | 3300046501 | Bacteria | 5957 |
| 865 | Ga0495607_0012842 | 3300046501 | Bacteria | 5508 |
| 866 | Ga0495607_0017978 | 3300046501 | Bacteria | 4518 |
| 867 | Ga0495607_0024174 | 3300046501 | Bacteria | 3791 |
| 868 | Ga0495607_0026649 | 3300046501 | Bacteria | 3584 |
| 869 | Ga0495607_0031719 | 3300046501 | Bacteria | 3232 |
| 870 | Ga0495583_0000015 | 3300046506 | Bacteria | 316392 |
| 871 | Ga0495583_0000060 | 3300046506 | Bacteria | 199091 |
| 872 | Ga0495583_0000062 | 3300046506 | Bacteria | 195151 |
| 873 | Ga0495583_0000155 | 3300046506 | Bacteria | 114870 |
| 874 | Ga0495583_0000197 | 3300046506 | Bacteria | 101236 |
| 875 | Ga0495583_0000756 | 3300046506 | Bacteria | 41068 |
| 876 | Ga0495583_0001189 | 3300046506 | Bacteria | 28043 |
| 877 | Ga0495583_0001231 | 3300046506 | Bacteria | 27233 |
| 878 | Ga0495583_0001514 | 3300046506 | Bacteria | 23104 |
| 879 | Ga0495583_0001852 | 3300046506 | Bacteria | 19708 |
| 880 | Ga0495583_0003070 | 3300046506 | Bacteria | 13227 |
| 881 | Ga0495583_0003993 | 3300046506 | Bacteria | 10886 |
| 882 | Ga0495606_0000068 | 3300046507 | Bacteria | 179653 |
| 883 | Ga0495606_0000141 | 3300046507 | Bacteria | 123586 |
| 884 | Ga0495606_0000177 | 3300046507 | Bacteria | 112843 |
| 885 | Ga0495606_0000214 | 3300046507 | Bacteria | 103149 |
| 886 | Ga0495606_0000266 | 3300046507 | Bacteria | 92444 |
| 887 | Ga0495606_0000371 | 3300046507 | Bacteria | 76806 |
| 888 | Ga0495606_0000461 | 3300046507 | Bacteria | 66807 |
| 889 | Ga0495606_0000696 | 3300046507 | Bacteria | 52177 |
| 890 | Ga0495606_0000843 | 3300046507 | Bacteria | 46153 |
| 891 | Ga0495606_0002268 | 3300046507 | Bacteria | 22764 |
| 892 | Ga0495606_0002328 | 3300046507 | Bacteria | 22395 |
| 893 | Ga0495606_0003165 | 3300046507 | Bacteria | 17806 |
| 894 | Ga0495606_0004642 | 3300046507 | Bacteria | 13589 |
| 895 | Ga0495606_0007052 | 3300046507 | Bacteria | 10180 |
| 896 | Ga0495606_0016853 | 3300046507 | Bacteria | 5550 |
| 897 | Ga0495606_0056002 | 3300046507 | Bacteria | 2546 |
| 898 | Ga0495608_0018979 | 3300046511 | Bacteria | 4738 |
| 899 | Ga0495610_0000003 | 3300046512 | Bacteria | 1203910 |
| 900 | Ga0495610_0001476 | 3300046512 | Bacteria | 20720 |
| 901 | Ga0495610_0003651 | 3300046512 | Bacteria | 11843 |
| 902 | Ga0495610_0009810 | 3300046512 | Bacteria | 6008 |
| 903 | Ga0495610_0010298 | 3300046512 | Bacteria | 5821 |
| 904 | Ga0495610_0014621 | 3300046512 | Bacteria | 4602 |
| 905 | Ga0495610_0015071 | 3300046512 | Bacteria | 4509 |
| 906 | Ga0495610_0025482 | 3300046512 | Bacteria | 3173 |
| 907 | Ga0495616_0000184 | 3300046513 | Bacteria | 52694 |
| 908 | Ga0495616_0001441 | 3300046513 | Bacteria | 16553 |
| 909 | Ga0495616_0004461 | 3300046513 | Bacteria | 8812 |
| 910 | Ga0495616_0005947 | 3300046513 | Bacteria | 7441 |
| 911 | Ga0495616_0008293 | 3300046513 | Bacteria | 6167 |
| 912 | Ga0495616_0009974 | 3300046513 | Bacteria | 5521 |
| 913 | Ga0495616_0014276 | 3300046513 | Bacteria | 4452 |
| 914 | Ga0495616_0017305 | 3300046513 | Bacteria | 3977 |
| 915 | Ga0495616_0019028 | 3300046513 | Bacteria | 3754 |
| 916 | Ga0495616_0038840 | 3300046513 | Bacteria | 2441 |
| 917 | Ga0495618_0011571 | 3300046514 | Bacteria | 5354 |
| 918 | Ga0495618_0102076 | 3300046514 | Bacteria | 1836 |
| 919 | Ga0495620_0000042 | 3300046515 | Bacteria | 112107 |
| 920 | Ga0495620_0000456 | 3300046515 | Bacteria | 26967 |
| 921 | Ga0495620_0001496 | 3300046515 | Bacteria | 13914 |
| 922 | Ga0495620_0002041 | 3300046515 | Bacteria | 11774 |
| 923 | Ga0495620_0004368 | 3300046515 | Bacteria | 7982 |
| 924 | Ga0495620_0006298 | 3300046515 | Bacteria | 6528 |
| 925 | Ga0495620_0045501 | 3300046515 | Bacteria | 1899 |
| 926 | Ga0495628_0070535 | 3300046516 | Bacteria | 2725 |
| 927 | Ga0495630_0025997 | 3300046517 | Bacteria | 4332 |
| 928 | Ga0495630_0129753 | 3300046517 | Bacteria | 1914 |
| 929 | Ga0495631_0000722 | 3300046518 | Bacteria | 21214 |
| 930 | Ga0495631_0000794 | 3300046518 | Bacteria | 20159 |
| 931 | Ga0495631_0004320 | 3300046518 | Bacteria | 7580 |
| 932 | Ga0495631_0004837 | 3300046518 | Bacteria | 7100 |
| 933 | Ga0495631_0026043 | 3300046518 | Bacteria | 2689 |
| 934 | Ga0495631_0062453 | 3300046518 | Bacteria | 1614 |
| 935 | Ga0495632_0000573 | 3300046519 | Bacteria | 34214 |
| 936 | Ga0495632_0001250 | 3300046519 | Bacteria | 21567 |
| 937 | Ga0495632_0001313 | 3300046519 | Bacteria | 21015 |
| 938 | Ga0495632_0001532 | 3300046519 | Bacteria | 19084 |
| 939 | Ga0495632_0009908 | 3300046519 | Bacteria | 5695 |
| 940 | Ga0495632_0025653 | 3300046519 | Bacteria | 3114 |
| 941 | Ga0495632_0057255 | 3300046519 | Bacteria | 1903 |
| 942 | Ga0495637_0000020 | 3300046520 | Bacteria | 181611 |
| 943 | Ga0495637_0000087 | 3300046520 | Bacteria | 72113 |
| 944 | Ga0495637_0000260 | 3300046520 | Bacteria | 41743 |
| 945 | Ga0495637_0000848 | 3300046520 | Bacteria | 20166 |
| 946 | Ga0495637_0002194 | 3300046520 | Bacteria | 10915 |
| 947 | Ga0495637_0002273 | 3300046520 | Bacteria | 10654 |
| 948 | Ga0495637_0002495 | 3300046520 | Bacteria | 10154 |
| 949 | Ga0495637_0005014 | 3300046520 | Bacteria | 6809 |
| 950 | Ga0495637_0010737 | 3300046520 | Bacteria | 4417 |
| 951 | Ga0495637_0045902 | 3300046520 | Bacteria | 1850 |
| 952 | Ga0495643_0000179 | 3300046522 | Bacteria | 100406 |
| 953 | Ga0495643_0000287 | 3300046522 | Bacteria | 72080 |
| 954 | Ga0495643_0000411 | 3300046522 | Bacteria | 56229 |
| 955 | Ga0495643_0000585 | 3300046522 | Bacteria | 44407 |
| 956 | Ga0495643_0001628 | 3300046522 | Bacteria | 19819 |
| 957 | Ga0495643_0002022 | 3300046522 | Bacteria | 16910 |
| 958 | Ga0495643_0011258 | 3300046522 | Bacteria | 5460 |
| 959 | Ga0495643_0015794 | 3300046522 | Bacteria | 4451 |
| 960 | Ga0495643_0055851 | 3300046522 | Bacteria | 2109 |
| 961 | Ga0495644_0000218 | 3300046523 | Bacteria | 27012 |
| 962 | Ga0495644_0000952 | 3300046523 | Bacteria | 11967 |
| 963 | Ga0495644_0002342 | 3300046523 | Bacteria | 7553 |
| 964 | Ga0495644_0003908 | 3300046523 | Bacteria | 5868 |
| 965 | Ga0495644_0005160 | 3300046523 | Bacteria | 5112 |
| 966 | Ga0495644_0014154 | 3300046523 | Bacteria | 3056 |
| 967 | Ga0495644_0015839 | 3300046523 | Bacteria | 2888 |
| 968 | Ga0495644_0020449 | 3300046523 | Bacteria | 2526 |
| 969 | Ga0495644_0028708 | 3300046523 | Bacteria | 2104 |
| 970 | Ga0495644_0032761 | 3300046523 | Bacteria | 1963 |
| 971 | Ga0495648_0000058 | 3300046524 | Bacteria | 156717 |
| 972 | Ga0495648_0000076 | 3300046524 | Bacteria | 129413 |
| 973 | Ga0495648_0000299 | 3300046524 | Bacteria | 55022 |
| 974 | Ga0495648_0001064 | 3300046524 | Bacteria | 27859 |
| 975 | Ga0495648_0002580 | 3300046524 | Bacteria | 16591 |
| 976 | Ga0495648_0009200 | 3300046524 | Bacteria | 7686 |
| 977 | Ga0495648_0010573 | 3300046524 | Bacteria | 7017 |
| 978 | Ga0495648_0012123 | 3300046524 | Bacteria | 6453 |
| 979 | Ga0495648_0016557 | 3300046524 | Bacteria | 5310 |
| 980 | Ga0495648_0023158 | 3300046524 | Bacteria | 4260 |
| 981 | Ga0495648_0032542 | 3300046524 | Bacteria | 3419 |
| 982 | Ga0495648_0042121 | 3300046524 | Bacteria | 2875 |
| 983 | Ga0495648_0046654 | 3300046524 | Bacteria | 2683 |
| 984 | Ga0495648_0111533 | 3300046524 | Bacteria | 1487 |
| 985 | Ga0495666_0000514 | 3300046526 | Bacteria | 17215 |
| 986 | Ga0495666_0007844 | 3300046526 | Bacteria | 5345 |
| 987 | Ga0495666_0039645 | 3300046526 | Bacteria | 2286 |
| 988 | Ga0495666_0043376 | 3300046526 | Bacteria | 2173 |
| 989 | Ga0495642_0000088 | 3300046528 | Bacteria | 53831 |
| 990 | Ga0495642_0000223 | 3300046528 | Bacteria | 32585 |
| 991 | Ga0495642_0000463 | 3300046528 | Bacteria | 21321 |
| 992 | Ga0495642_0006585 | 3300046528 | Bacteria | 4457 |
| 993 | Ga0495642_0038639 | 3300046528 | Bacteria | 1934 |
| 994 | Ga0495652_0038065 | 3300046529 | Bacteria | 4169 |
| 995 | Ga0495652_0131616 | 3300046529 | Bacteria | 1980 |
| 996 | Ga0495654_0000019 | 3300046530 | Bacteria | 289483 |
| 997 | Ga0495654_0000074 | 3300046530 | Bacteria | 114325 |
| 998 | Ga0495654_0000451 | 3300046530 | Bacteria | 34657 |
| 999 | Ga0495654_0000985 | 3300046530 | Bacteria | 20933 |
| 1000 | Ga0495654_0001089 | 3300046530 | Bacteria | 19727 |
| 1001 | Ga0495654_0001254 | 3300046530 | Bacteria | 17873 |
| 1002 | Ga0495654_0001271 | 3300046530 | Bacteria | 17708 |
| 1003 | Ga0495654_0004701 | 3300046530 | Bacteria | 8045 |
| 1004 | Ga0495654_0006622 | 3300046530 | Bacteria | 6559 |
| 1005 | Ga0495654_0011325 | 3300046530 | Bacteria | 4831 |
| 1006 | Ga0495654_0017372 | 3300046530 | Bacteria | 3784 |
| 1007 | Ga0495654_0018225 | 3300046530 | Bacteria | 3682 |
| 1008 | Ga0495654_0054647 | 3300046530 | Bacteria | 1936 |
| 1009 | Ga0495640_0065769 | 3300046533 | Bacteria | 2447 |
| 1010 | Ga0495586_0031574 | 3300046535 | Bacteria | 2838 |
| 1011 | Ga0495587_0065213 | 3300046536 | Bacteria | 2127 |
| 1012 | Ga0495609_0000039 | 3300046538 | Bacteria | 179384 |
| 1013 | Ga0495609_0000053 | 3300046538 | Bacteria | 149126 |
| 1014 | Ga0495609_0000102 | 3300046538 | Bacteria | 100762 |
| 1015 | Ga0495609_0000685 | 3300046538 | Bacteria | 26127 |
| 1016 | Ga0495609_0001189 | 3300046538 | Bacteria | 17916 |
| 1017 | Ga0495609_0003042 | 3300046538 | Bacteria | 9863 |
| 1018 | Ga0495609_0029907 | 3300046538 | Bacteria | 2478 |
| 1019 | Ga0495597_0000153 | 3300046542 | Bacteria | 61233 |
| 1020 | Ga0495597_0000186 | 3300046542 | Bacteria | 55973 |
| 1021 | Ga0495597_0000209 | 3300046542 | Bacteria | 53295 |
| 1022 | Ga0495597_0000242 | 3300046542 | Bacteria | 49561 |
| 1023 | Ga0495597_0000537 | 3300046542 | Bacteria | 31420 |
| 1024 | Ga0495597_0000808 | 3300046542 | Bacteria | 24718 |
| 1025 | Ga0495597_0002455 | 3300046542 | Bacteria | 11727 |
| 1026 | Ga0495597_0033447 | 3300046542 | Bacteria | 2328 |
| 1027 | Ga0495597_0035248 | 3300046542 | Bacteria | 2257 |
| 1028 | Ga0495597_0062226 | 3300046542 | Bacteria | 1624 |
| 1029 | Ga0495597_0074476 | 3300046542 | Bacteria | 1458 |
| 1030 | Ga0495645_0009101 | 3300046543 | Bacteria | 6939 |
| 1031 | Ga0495645_0031956 | 3300046543 | Bacteria | 3838 |
| 1032 | Ga0495645_0159292 | 3300046543 | Bacteria | 1562 |
| 1033 | Ga0495622_0000054 | 3300046557 | Bacteria | 102782 |
| 1034 | Ga0495622_0000468 | 3300046557 | Bacteria | 25821 |
| 1035 | Ga0495622_0000584 | 3300046557 | Bacteria | 21528 |
| 1036 | Ga0495622_0002858 | 3300046557 | Bacteria | 8240 |
| 1037 | Ga0495622_0009925 | 3300046557 | Bacteria | 4404 |
| 1038 | Ga0495633_0000119 | 3300046558 | Bacteria | 106455 |
| 1039 | Ga0495633_0000249 | 3300046558 | Bacteria | 64232 |
| 1040 | Ga0495633_0000366 | 3300046558 | Bacteria | 48617 |
| 1041 | Ga0495633_0001297 | 3300046558 | Bacteria | 19748 |
| 1042 | Ga0495633_0002317 | 3300046558 | Bacteria | 13558 |
| 1043 | Ga0495633_0004532 | 3300046558 | Bacteria | 8775 |
| 1044 | Ga0495633_0009262 | 3300046558 | Bacteria | 5455 |
| 1045 | Ga0495633_0011956 | 3300046558 | Bacteria | 4642 |
| 1046 | Ga0495633_0025940 | 3300046558 | Bacteria | 2881 |
| 1047 | Ga0495633_0075050 | 3300046558 | Bacteria | 1575 |
| 1048 | Ga0495667_0055871 | 3300046559 | Bacteria | 2596 |
| 1049 | Ga0495667_0114760 | 3300046559 | Bacteria | 1740 |
| 1050 | Ga0495656_0030753 | 3300046615 | Bacteria | 2172 |
| 1051 | Ga0495668_0000337 | 3300046616 | Bacteria | 63494 |
| 1052 | Ga0495668_0000466 | 3300046616 | Bacteria | 51377 |
| 1053 | Ga0495668_0000866 | 3300046616 | Bacteria | 34104 |
| 1054 | Ga0495668_0015652 | 3300046616 | Bacteria | 4424 |
| 1055 | Ga0495668_0024652 | 3300046616 | Bacteria | 3421 |
| 1056 | Ga0495668_0080776 | 3300046616 | Bacteria | 1784 |
| 1057 | Ga0495634_0001452 | 3300046642 | Bacteria | 21049 |
| 1058 | Ga0495634_0040408 | 3300046642 | Bacteria | 3173 |
| 1059 | Ga0495611_0000386 | 3300046648 | Bacteria | 28151 |
| 1060 | Ga0495611_0000546 | 3300046648 | Bacteria | 22058 |
| 1061 | Ga0495611_0002380 | 3300046648 | Bacteria | 8661 |
| 1062 | Ga0495611_0004289 | 3300046648 | Bacteria | 6194 |
| 1063 | Ga0495611_0005319 | 3300046648 | Bacteria | 5510 |
| 1064 | Ga0495611_0023655 | 3300046648 | Bacteria | 2667 |
| 1065 | Ga0495611_0096133 | 3300046648 | Bacteria | 1371 |
| 1066 | Ga0495625_0000086 | 3300046660 | Bacteria | 151735 |
| 1067 | Ga0495625_0000132 | 3300046660 | Bacteria | 115728 |
| 1068 | Ga0495625_0000139 | 3300046660 | Bacteria | 112271 |
| 1069 | Ga0495625_0001396 | 3300046660 | Bacteria | 29588 |
| 1070 | Ga0495625_0002129 | 3300046660 | Bacteria | 22079 |
| 1071 | Ga0495625_0002623 | 3300046660 | Bacteria | 19215 |
| 1072 | Ga0495625_0003090 | 3300046660 | Bacteria | 17005 |
| 1073 | Ga0495625_0003498 | 3300046660 | Bacteria | 15570 |
| 1074 | Ga0495625_0003977 | 3300046660 | Bacteria | 14173 |
| 1075 | Ga0495625_0010314 | 3300046660 | Bacteria | 7744 |
| 1076 | Ga0495625_0010440 | 3300046660 | Bacteria | 7684 |
| 1077 | Ga0495625_0013007 | 3300046660 | Bacteria | 6712 |
| 1078 | Ga0495625_0028160 | 3300046660 | Bacteria | 4217 |
| 1079 | Ga0495625_0048669 | 3300046660 | Bacteria | 3051 |
| 1080 | Ga0495625_0072932 | 3300046660 | Bacteria | 2407 |
| 1081 | Ga0495635_0010447 | 3300046663 | Bacteria | 6494 |
| 1082 | Ga0495635_0066463 | 3300046663 | Bacteria | 2473 |
| 1083 | Ga0495659_0000684 | 3300046664 | Bacteria | 12267 |
| 1084 | Ga0495659_0001118 | 3300046664 | Bacteria | 9335 |
| 1085 | Ga0495661_0000048 | 3300046665 | Bacteria | 144678 |
| 1086 | Ga0495661_0000058 | 3300046665 | Bacteria | 133316 |
| 1087 | Ga0495661_0000094 | 3300046665 | Bacteria | 109394 |
| 1088 | Ga0495661_0000131 | 3300046665 | Bacteria | 90795 |
| 1089 | Ga0495661_0000171 | 3300046665 | Bacteria | 76610 |
| 1090 | Ga0495661_0001840 | 3300046665 | Bacteria | 16963 |
| 1091 | Ga0495661_0002376 | 3300046665 | Bacteria | 14528 |
| 1092 | Ga0495661_0008362 | 3300046665 | Bacteria | 7160 |
| 1093 | Ga0495661_0011367 | 3300046665 | Bacteria | 6041 |
| 1094 | Ga0495661_0017452 | 3300046665 | Bacteria | 4740 |
| 1095 | Ga0495661_0022149 | 3300046665 | Bacteria | 4135 |
| 1096 | Ga0495661_0027405 | 3300046665 | Bacteria | 3658 |
| 1097 | Ga0495661_0035739 | 3300046665 | Bacteria | 3115 |
| 1098 | Ga0495661_0036819 | 3300046665 | Bacteria | 3059 |
| 1099 | Ga0495661_0039514 | 3300046665 | Bacteria | 2932 |
| 1100 | Ga0495661_0072285 | 3300046665 | Bacteria | 2012 |
| 1101 | Ga0495661_0077161 | 3300046665 | Bacteria | 1931 |
| 1102 | Ga0495588_0000110 | 3300046674 | Bacteria | 142825 |
| 1103 | Ga0495588_0004605 | 3300046674 | Bacteria | 6091 |
| 1104 | Ga0495588_0026084 | 3300046674 | Bacteria | 2915 |
| 1105 | Ga0495599_0000399 | 3300046678 | Bacteria | 24819 |
| 1106 | Ga0495599_0004483 | 3300046678 | Bacteria | 8274 |
| 1107 | Ga0495623_0005943 | 3300046679 | Bacteria | 7955 |
| 1108 | Ga0495623_0006642 | 3300046679 | Bacteria | 7530 |
| 1109 | Ga0495623_0066232 | 3300046679 | Bacteria | 2257 |
| 1110 | Ga0495646_0000446 | 3300046680 | Bacteria | 21847 |
| 1111 | Ga0495646_0024671 | 3300046680 | Bacteria | 3786 |
| 1112 | Ga0495669_0000041 | 3300046684 | Bacteria | 88966 |
| 1113 | Ga0495669_0026695 | 3300046684 | Bacteria | 2524 |
| 1114 | Ga0495669_0080805 | 3300046684 | Bacteria | 1491 |
| 1115 | Ga0495613_0092878 | 3300046689 | Bacteria | 2184 |
| 1116 | Ga0495624_0001848 | 3300046690 | Bacteria | 16142 |
| 1117 | Ga0495670_0000302 | 3300046691 | Bacteria | 23271 |
| 1118 | Ga0495670_0002252 | 3300046691 | Bacteria | 9516 |
| 1119 | Ga0495670_0005988 | 3300046691 | Bacteria | 5954 |
| 1120 | Ga0495670_0006106 | 3300046691 | Bacteria | 5910 |
| 1121 | Ga0495670_0007946 | 3300046691 | Bacteria | 5213 |
| 1122 | Ga0495670_0011561 | 3300046691 | Bacteria | 4342 |
| 1123 | Ga0495671_0000157 | 3300046692 | Bacteria | 59803 |
| 1124 | Ga0495671_0000582 | 3300046692 | Bacteria | 27065 |
| 1125 | Ga0495671_0000796 | 3300046692 | Bacteria | 22620 |
| 1126 | Ga0495671_0001635 | 3300046692 | Bacteria | 14701 |
| 1127 | Ga0495671_0003155 | 3300046692 | Bacteria | 10243 |
| 1128 | Ga0495671_0005078 | 3300046692 | Bacteria | 7745 |
| 1129 | Ga0495671_0008993 | 3300046692 | Bacteria | 5604 |
| 1130 | Ga0495671_0012930 | 3300046692 | Bacteria | 4542 |
| 1131 | Ga0495671_0017322 | 3300046692 | Bacteria | 3835 |
| 1132 | Ga0495671_0032264 | 3300046692 | Bacteria | 2674 |
| 1133 | Ga0495649_0000049 | 3300046694 | Bacteria | 113865 |
| 1134 | Ga0495649_0000510 | 3300046694 | Bacteria | 33248 |
| 1135 | Ga0495649_0000847 | 3300046694 | Bacteria | 24572 |
| 1136 | Ga0495649_0000965 | 3300046694 | Bacteria | 22681 |
| 1137 | Ga0495649_0003527 | 3300046694 | Bacteria | 10516 |
| 1138 | Ga0495649_0003587 | 3300046694 | Bacteria | 10407 |
| 1139 | Ga0495649_0005204 | 3300046694 | Bacteria | 8330 |
| 1140 | Ga0495649_0010593 | 3300046694 | Bacteria | 5434 |
| 1141 | Ga0495649_0013796 | 3300046694 | Bacteria | 4651 |
| 1142 | Ga0495649_0036011 | 3300046694 | Bacteria | 2720 |
| 1143 | Ga0495649_0066360 | 3300046694 | Bacteria | 1936 |
| 1144 | Ga0495649_0088894 | 3300046694 | Bacteria | 1647 |
| 1145 | Ga0495649_0120197 | 3300046694 | Bacteria | 1389 |
| 1146 | Ga0495589_0000006 | 3300046794 | Bacteria | 303635 |
| 1147 | Ga0495589_0000019 | 3300046794 | Bacteria | 200814 |
| 1148 | Ga0495589_0000445 | 3300046794 | Bacteria | 30407 |
| 1149 | Ga0495589_0000647 | 3300046794 | Bacteria | 22840 |
| 1150 | Ga0495589_0000866 | 3300046794 | Bacteria | 18894 |
| 1151 | Ga0495589_0001426 | 3300046794 | Bacteria | 13815 |
| 1152 | Ga0495589_0002079 | 3300046794 | Bacteria | 11326 |
| 1153 | Ga0495589_0003754 | 3300046794 | Bacteria | 8174 |
| 1154 | Ga0495589_0011721 | 3300046794 | Bacteria | 4550 |
| 1155 | Ga0495589_0017134 | 3300046794 | Bacteria | 3720 |
| 1156 | Ga0495589_0024381 | 3300046794 | Bacteria | 3074 |
| 1157 | Ga0495589_0050380 | 3300046794 | Bacteria | 2060 |
| 1158 | Ga0495600_0002038 | 3300046809 | Bacteria | 11377 |
| 1159 | Ga0495600_0100251 | 3300046809 | Bacteria | 1888 |
| 1160 | Ga0495660_0000021 | 3300046810 | Bacteria | 293250 |
| 1161 | Ga0495660_0000056 | 3300046810 | Bacteria | 134518 |
| 1162 | Ga0495660_0000168 | 3300046810 | Bacteria | 71020 |
| 1163 | Ga0495660_0000245 | 3300046810 | Bacteria | 53011 |
| 1164 | Ga0495660_0000608 | 3300046810 | Bacteria | 28251 |
| 1165 | Ga0495660_0005539 | 3300046810 | Bacteria | 7557 |
| 1166 | Ga0495660_0007449 | 3300046810 | Bacteria | 6426 |
| 1167 | Ga0495660_0009308 | 3300046810 | Bacteria | 5728 |
| 1168 | Ga0495660_0015517 | 3300046810 | Bacteria | 4399 |
| 1169 | Ga0495660_0016457 | 3300046810 | Bacteria | 4263 |
| 1170 | Ga0495660_0022873 | 3300046810 | Bacteria | 3566 |
| 1171 | Ga0495660_0073548 | 3300046810 | Bacteria | 1807 |
| 1172 | Ga0495581_0014620 | 3300047315 | Bacteria | 4550 |
| 1173 | Ga0495604_0014483 | 3300047317 | Bacteria | 6290 |
| 1174 | Ga0495604_0050582 | 3300047317 | Bacteria | 3226 |
| 1175 | Ga0495604_0101791 | 3300047317 | Bacteria | 2109 |
| 1176 | Ga0495636_0001360 | 3300047318 | Bacteria | 9262 |
| 1177 | Ga0495636_0001666 | 3300047318 | Bacteria | 8465 |
| 1178 | Ga0495636_0008015 | 3300047318 | Bacteria | 4166 |
| 1179 | Ga0495636_0014610 | 3300047318 | Bacteria | 3123 |
| 1180 | Ga0495674_0002066 | 3300047319 | Bacteria | 19692 |
| 1181 | Ga0495674_0085409 | 3300047319 | Bacteria | 2703 |
| 1182 | Ga0495672_0000002 | 3300047320 | Bacteria | 740116 |
| 1183 | Ga0495672_0000012 | 3300047320 | Bacteria | 519975 |
| 1184 | Ga0495672_0000020 | 3300047320 | Bacteria | 432845 |
| 1185 | Ga0495672_0000263 | 3300047320 | Bacteria | 72879 |
| 1186 | Ga0495672_0001472 | 3300047320 | Bacteria | 23111 |
| 1187 | Ga0495672_0002315 | 3300047320 | Bacteria | 17677 |
| 1188 | Ga0495672_0002439 | 3300047320 | Bacteria | 17116 |
| 1189 | Ga0495672_0003847 | 3300047320 | Bacteria | 12624 |
| 1190 | Ga0495672_0007415 | 3300047320 | Bacteria | 8252 |
| 1191 | Ga0495672_0010293 | 3300047320 | Bacteria | 6681 |
| 1192 | Ga0495672_0031579 | 3300047320 | Bacteria | 3305 |
| 1193 | Ga0495672_0058653 | 3300047320 | Bacteria | 2230 |
| 1194 | Ga0495672_0070641 | 3300047320 | Bacteria | 1977 |
| 1195 | Ga0495676_0000022 | 3300047321 | Bacteria | 163719 |
| 1196 | Ga0495676_0004002 | 3300047321 | Bacteria | 13417 |
| 1197 | Ga0495680_0037898 | 3300047322 | Bacteria | 3858 |
| 1198 | Ga0495680_0091818 | 3300047322 | Bacteria | 2275 |
| 1199 | Ga0495680_0103548 | 3300047322 | Bacteria | 2118 |
| 1200 | Ga0495680_0115054 | 3300047322 | Bacteria | 1990 |
| 1201 | Ga0495680_0124245 | 3300047322 | Bacteria | 1902 |
| 1202 | Ga0495683_0000030 | 3300047323 | Bacteria | 150551 |
| 1203 | Ga0495683_0000520 | 3300047323 | Bacteria | 29465 |
| 1204 | Ga0495683_0000927 | 3300047323 | Bacteria | 20673 |
| 1205 | Ga0495683_0003113 | 3300047323 | Bacteria | 9722 |
| 1206 | Ga0495683_0011966 | 3300047323 | Bacteria | 4559 |
| 1207 | Ga0495683_0019467 | 3300047323 | Bacteria | 3502 |
| 1208 | Ga0495683_0020424 | 3300047323 | Bacteria | 3416 |
| 1209 | Ga0495683_0024380 | 3300047323 | Bacteria | 3105 |
| 1210 | Ga0495683_0048266 | 3300047323 | Bacteria | 2134 |
| 1211 | Ga0495687_000059 | 3300047443 | Bacteria | 179357 |
| 1212 | Ga0495687_000296 | 3300047443 | Bacteria | 65626 |
| 1213 | Ga0495687_001460 | 3300047443 | Bacteria | 21684 |
| 1214 | Ga0495687_001591 | 3300047443 | Bacteria | 20510 |
| 1215 | Ga0495687_001767 | 3300047443 | Bacteria | 19104 |
| 1216 | Ga0495675_0074373 | 3300047444 | Bacteria | 2141 |
| 1217 | Ga0495677_0000006 | 3300047445 | Bacteria | 199230 |
| 1218 | Ga0495677_0000590 | 3300047445 | Bacteria | 14890 |
| 1219 | Ga0495677_0002558 | 3300047445 | Bacteria | 7116 |
| 1220 | Ga0495677_0003280 | 3300047445 | Bacteria | 6308 |
| 1221 | Ga0495677_0010069 | 3300047445 | Bacteria | 3478 |
| 1222 | Ga0495677_0025054 | 3300047445 | Bacteria | 2164 |
| 1223 | Ga0495677_0050358 | 3300047445 | Bacteria | 1532 |
| 1224 | Ga0495679_000020 | 3300047446 | Bacteria | 228413 |
| 1225 | Ga0495679_000218 | 3300047446 | Bacteria | 48725 |
| 1226 | Ga0495679_000494 | 3300047446 | Bacteria | 28041 |
| 1227 | Ga0495679_001364 | 3300047446 | Bacteria | 14041 |
| 1228 | Ga0495679_002504 | 3300047446 | Bacteria | 9297 |
| 1229 | Ga0495679_002509 | 3300047446 | Bacteria | 9269 |
| 1230 | Ga0495679_002913 | 3300047446 | Bacteria | 8470 |
| 1231 | Ga0495679_003549 | 3300047446 | Bacteria | 7455 |
| 1232 | Ga0495685_000416 | 3300047447 | Bacteria | 13459 |
| 1233 | Ga0495685_003595 | 3300047447 | Bacteria | 4958 |
| 1234 | Ga0495673_0000006 | 3300047469 | Bacteria | 908691 |
| 1235 | Ga0495673_0000024 | 3300047469 | Bacteria | 521349 |
| 1236 | Ga0495673_0000079 | 3300047469 | Bacteria | 202569 |
| 1237 | Ga0495673_0000544 | 3300047469 | Bacteria | 38535 |
| 1238 | Ga0495673_0001080 | 3300047469 | Bacteria | 23910 |
| 1239 | Ga0495673_0001326 | 3300047469 | Bacteria | 20085 |
| 1240 | Ga0495673_0002964 | 3300047469 | Bacteria | 11442 |
| 1241 | Ga0495673_0003791 | 3300047469 | Bacteria | 9778 |
| 1242 | Ga0495673_0004931 | 3300047469 | Bacteria | 8211 |
| 1243 | Ga0495673_0009417 | 3300047469 | Bacteria | 5407 |
| 1244 | Ga0495673_0011178 | 3300047469 | Bacteria | 4844 |
| 1245 | Ga0495673_0019270 | 3300047469 | Bacteria | 3420 |
| 1246 | Ga0495673_0024681 | 3300047469 | Bacteria | 2898 |
| 1247 | Ga0495681_0000351 | 3300047470 | Bacteria | 36044 |
| 1248 | Ga0495681_0000411 | 3300047470 | Bacteria | 33097 |
| 1249 | Ga0495681_0000534 | 3300047470 | Bacteria | 29137 |
| 1250 | Ga0495681_0001568 | 3300047470 | Bacteria | 17031 |
| 1251 | Ga0495681_0001787 | 3300047470 | Bacteria | 15838 |
| 1252 | Ga0495681_0003728 | 3300047470 | Bacteria | 10556 |
| 1253 | Ga0495681_0010655 | 3300047470 | Bacteria | 5552 |
| 1254 | Ga0495681_0019212 | 3300047470 | Bacteria | 3738 |
| 1255 | Ga0495681_0025685 | 3300047470 | Bacteria | 3078 |
| 1256 | Ga0495681_0057034 | 3300047470 | Bacteria | 1815 |
| 1257 | Ga0495681_0095140 | 3300047470 | Bacteria | 1309 |
| 1258 | Ga0495686_0000017 | 3300047472 | Bacteria | 435554 |
| 1259 | Ga0495686_0001364 | 3300047472 | Bacteria | 27253 |
| 1260 | Ga0495686_0003766 | 3300047472 | Bacteria | 12894 |
| 1261 | Ga0495686_0014853 | 3300047472 | Bacteria | 5346 |
| 1262 | Ga0495686_0015703 | 3300047472 | Bacteria | 5159 |
| 1263 | Ga0495686_0061115 | 3300047472 | Bacteria | 2340 |
| 1264 | Ga0495593_0014612 | 3300047673 | Bacteria | 4460 |
| 1265 | Ga0495593_0044222 | 3300047673 | Bacteria | 2382 |
| 1266 | Ga0495602_0040199 | 3300048088 | Bacteria | 4293 |
| 1267 | Ga0495614_0005763 | 3300048089 | Bacteria | 5578 |
| 1268 | Ga0495626_0000039 | 3300048091 | Bacteria | 175454 |
| 1269 | Ga0495626_0000103 | 3300048091 | Bacteria | 110163 |
| 1270 | Ga0495626_0000391 | 3300048091 | Bacteria | 45354 |
| 1271 | Ga0495626_0000494 | 3300048091 | Bacteria | 39727 |
| 1272 | Ga0495626_0000562 | 3300048091 | Bacteria | 36865 |
| 1273 | Ga0495626_0000711 | 3300048091 | Bacteria | 31405 |
| 1274 | Ga0495626_0002239 | 3300048091 | Bacteria | 13862 |
| 1275 | Ga0495626_0005483 | 3300048091 | Bacteria | 7394 |
| 1276 | Ga0495626_0029382 | 3300048091 | Bacteria | 2660 |
| 1277 | Ga0495626_0035165 | 3300048091 | Bacteria | 2391 |
| 1278 | Ga0495626_0039518 | 3300048091 | Bacteria | 2232 |
| 1279 | Ga0495626_0042079 | 3300048091 | Bacteria | 2147 |
| 1280 | Ga0496101_0000671 | 3300048904 | Bacteria | 20633 |
| 1281 | Ga0496102_0001161 | 3300048905 | Bacteria | 24071 |
| 1282 | Ga0496102_0008716 | 3300048905 | Bacteria | 8705 |
| 1283 | Ga0496102_0077507 | 3300048905 | Bacteria | 3059 |
| 1284 | Ga0496103_0000631 | 3300048906 | Bacteria | 26992 |
| 1285 | Ga0496103_0005456 | 3300048906 | Bacteria | 7603 |
| 1286 | Ga0496103_0128194 | 3300048906 | Bacteria | 1619 |
| 1287 | Ga0496104_0000119 | 3300048907 | Bacteria | 74104 |
| 1288 | Ga0496104_0002141 | 3300048907 | Bacteria | 17139 |
| 1289 | Ga0496104_0004930 | 3300048907 | Bacteria | 11644 |
| 1290 | Ga0496105_0006486 | 3300048908 | Bacteria | 8997 |
| 1291 | Ga0496105_0022243 | 3300048908 | Bacteria | 5135 |
| 1292 | Ga0496105_0035265 | 3300048908 | Bacteria | 4117 |
| 1293 | Ga0496105_0106492 | 3300048908 | Bacteria | 2314 |
| 1294 | Ga0496105_0120651 | 3300048908 | Bacteria | 2162 |
| 1295 | Ga0496106_0100961 | 3300048909 | Bacteria | 2238 |
| 1296 | Ga0496110_0035108 | 3300048913 | Bacteria | 4348 |
| 1297 | Ga0496114_0113188 | 3300048917 | Bacteria | 2326 |
| 1298 | Ga0496115_0012877 | 3300048918 | Bacteria | 6307 |
| 1299 | Ga0496116_0000031 | 3300048919 | Bacteria | 420043 |
| 1300 | Ga0496116_0000320 | 3300048919 | Bacteria | 78683 |
| 1301 | Ga0496116_0000376 | 3300048919 | Bacteria | 66696 |
| 1302 | Ga0496116_0000623 | 3300048919 | Bacteria | 46579 |
| 1303 | Ga0496116_0003799 | 3300048919 | Bacteria | 14764 |
| 1304 | Ga0496116_0005272 | 3300048919 | Bacteria | 12065 |
| 1305 | Ga0496116_0005434 | 3300048919 | Bacteria | 11810 |
| 1306 | Ga0496116_0005510 | 3300048919 | Bacteria | 11700 |
| 1307 | Ga0496116_0011980 | 3300048919 | Bacteria | 7122 |
| 1308 | Ga0496116_0017900 | 3300048919 | Bacteria | 5480 |
| 1309 | Ga0496116_0043099 | 3300048919 | Bacteria | 3077 |
| 1310 | Ga0496116_0060937 | 3300048919 | Bacteria | 2445 |
| 1311 | Ga0496117_0000001 | 3300048920 | Bacteria | 2526244 |
| 1312 | Ga0496117_0000004 | 3300048920 | Bacteria | 877131 |
| 1313 | Ga0496117_0000298 | 3300048920 | Bacteria | 87318 |
| 1314 | Ga0496117_0000486 | 3300048920 | Bacteria | 65652 |
| 1315 | Ga0496117_0001035 | 3300048920 | Bacteria | 42455 |
| 1316 | Ga0496117_0001085 | 3300048920 | Bacteria | 41180 |
| 1317 | Ga0496117_0001205 | 3300048920 | Bacteria | 38844 |
| 1318 | Ga0496117_0003937 | 3300048920 | Bacteria | 16804 |
| 1319 | Ga0496117_0005845 | 3300048920 | Bacteria | 12736 |
| 1320 | Ga0496117_0010248 | 3300048920 | Bacteria | 8586 |
| 1321 | Ga0496117_0011377 | 3300048920 | Bacteria | 7975 |
| 1322 | Ga0496117_0011922 | 3300048920 | Bacteria | 7727 |
| 1323 | Ga0496117_0016158 | 3300048920 | Bacteria | 6312 |
| 1324 | Ga0496117_0016430 | 3300048920 | Bacteria | 6247 |
| 1325 | Ga0496117_0020422 | 3300048920 | Bacteria | 5399 |
| 1326 | Ga0496117_0029491 | 3300048920 | Bacteria | 4228 |
| 1327 | Ga0496117_0033375 | 3300048920 | Bacteria | 3893 |
| 1328 | Ga0496117_0034171 | 3300048920 | Bacteria | 3835 |
| 1329 | Ga0496117_0041020 | 3300048920 | Bacteria | 3396 |
| 1330 | Ga0496117_0067256 | 3300048920 | Bacteria | 2426 |
| 1331 | Ga0496118_0000072 | 3300048921 | Bacteria | 201387 |
| 1332 | Ga0496118_0000078 | 3300048921 | Bacteria | 190946 |
| 1333 | Ga0496118_0000323 | 3300048921 | Bacteria | 82847 |
| 1334 | Ga0496118_0000805 | 3300048921 | Bacteria | 50087 |
| 1335 | Ga0496118_0001319 | 3300048921 | Bacteria | 37658 |
| 1336 | Ga0496118_0002349 | 3300048921 | Bacteria | 25650 |
| 1337 | Ga0496118_0002434 | 3300048921 | Bacteria | 25050 |
| 1338 | Ga0496118_0003571 | 3300048921 | Bacteria | 19383 |
| 1339 | Ga0496118_0003732 | 3300048921 | Bacteria | 18850 |
| 1340 | Ga0496118_0004028 | 3300048921 | Bacteria | 17860 |
| 1341 | Ga0496118_0004806 | 3300048921 | Bacteria | 15762 |
| 1342 | Ga0496118_0010083 | 3300048921 | Bacteria | 9399 |
| 1343 | Ga0496118_0019204 | 3300048921 | Bacteria | 6117 |
| 1344 | Ga0496118_0024222 | 3300048921 | Bacteria | 5248 |
| 1345 | Ga0496118_0044124 | 3300048921 | Bacteria | 3494 |
| 1346 | Ga0496118_0108077 | 3300048921 | Bacteria | 1855 |
| 1347 | Ga0496118_0108324 | 3300048921 | Bacteria | 1852 |
| 1348 | Ga0496118_0128321 | 3300048921 | Bacteria | 1634 |
| 1349 | Ga0496119_0000080 | 3300048922 | Bacteria | 139962 |
| 1350 | Ga0496119_0000082 | 3300048922 | Bacteria | 138565 |
| 1351 | Ga0496119_0000188 | 3300048922 | Bacteria | 87312 |
| 1352 | Ga0496119_0000741 | 3300048922 | Bacteria | 43950 |
| 1353 | Ga0496119_0001826 | 3300048922 | Bacteria | 24657 |
| 1354 | Ga0496119_0002279 | 3300048922 | Bacteria | 21256 |
| 1355 | Ga0496119_0003650 | 3300048922 | Bacteria | 15798 |
| 1356 | Ga0496119_0005070 | 3300048922 | Bacteria | 12787 |
| 1357 | Ga0496119_0010220 | 3300048922 | Bacteria | 7919 |
| 1358 | Ga0496119_0019431 | 3300048922 | Bacteria | 5005 |
| 1359 | Ga0496119_0024522 | 3300048922 | Bacteria | 4240 |
| 1360 | Ga0496119_0037150 | 3300048922 | Bacteria | 3168 |
| 1361 | Ga0496119_0037522 | 3300048922 | Bacteria | 3146 |
| 1362 | Ga0496119_0043055 | 3300048922 | Bacteria | 2857 |
| 1363 | Ga0496120_0000062 | 3300048923 | Bacteria | 172365 |
| 1364 | Ga0496120_0000075 | 3300048923 | Bacteria | 163540 |
| 1365 | Ga0496120_0000252 | 3300048923 | Bacteria | 89838 |
| 1366 | Ga0496120_0000302 | 3300048923 | Bacteria | 82387 |
| 1367 | Ga0496120_0000389 | 3300048923 | Bacteria | 70922 |
| 1368 | Ga0496120_0000873 | 3300048923 | Bacteria | 42650 |
| 1369 | Ga0496120_0001166 | 3300048923 | Bacteria | 33619 |
| 1370 | Ga0496120_0001718 | 3300048923 | Bacteria | 24948 |
| 1371 | Ga0496120_0001877 | 3300048923 | Bacteria | 23391 |
| 1372 | Ga0496120_0001913 | 3300048923 | Bacteria | 22983 |
| 1373 | Ga0496120_0002608 | 3300048923 | Bacteria | 17868 |
| 1374 | Ga0496120_0003866 | 3300048923 | Bacteria | 13143 |
| 1375 | Ga0496120_0013125 | 3300048923 | Bacteria | 5597 |
| 1376 | Ga0496120_0019805 | 3300048923 | Bacteria | 4292 |
| 1377 | Ga0496121_0000047 | 3300048924 | Bacteria | 335768 |
| 1378 | Ga0496121_0000372 | 3300048924 | Bacteria | 92348 |
| 1379 | Ga0496121_0001119 | 3300048924 | Bacteria | 47137 |
| 1380 | Ga0496121_0001155 | 3300048924 | Bacteria | 46296 |
| 1381 | Ga0496121_0001222 | 3300048924 | Bacteria | 44730 |
| 1382 | Ga0496121_0001386 | 3300048924 | Bacteria | 41013 |
| 1383 | Ga0496121_0002320 | 3300048924 | Bacteria | 29478 |
| 1384 | Ga0496121_0003763 | 3300048924 | Bacteria | 21231 |
| 1385 | Ga0496121_0004640 | 3300048924 | Bacteria | 18268 |
| 1386 | Ga0496121_0007722 | 3300048924 | Bacteria | 12904 |
| 1387 | Ga0496121_0011325 | 3300048924 | Bacteria | 9924 |
| 1388 | Ga0496121_0018539 | 3300048924 | Bacteria | 7011 |
| 1389 | Ga0496121_0020831 | 3300048924 | Bacteria | 6461 |
| 1390 | Ga0496121_0022151 | 3300048924 | Bacteria | 6180 |
| 1391 | Ga0496121_0029481 | 3300048924 | Bacteria | 5073 |
| 1392 | Ga0496122_0000108 | 3300048925 | Bacteria | 191029 |
| 1393 | Ga0496122_0000571 | 3300048925 | Bacteria | 75468 |
| 1394 | Ga0496122_0000887 | 3300048925 | Bacteria | 55765 |
| 1395 | Ga0496122_0001367 | 3300048925 | Bacteria | 39674 |
| 1396 | Ga0496122_0002008 | 3300048925 | Bacteria | 30259 |
| 1397 | Ga0496122_0002062 | 3300048925 | Bacteria | 29793 |
| 1398 | Ga0496122_0004208 | 3300048925 | Bacteria | 18095 |
| 1399 | Ga0496122_0005674 | 3300048925 | Bacteria | 14730 |
| 1400 | Ga0496122_0023966 | 3300048925 | Bacteria | 5357 |
| 1401 | Ga0496122_0031823 | 3300048925 | Bacteria | 4378 |
| 1402 | Ga0496122_0037693 | 3300048925 | Bacteria | 3886 |
| 1403 | Ga0496122_0040628 | 3300048925 | Bacteria | 3692 |
| 1404 | Ga0496122_0045803 | 3300048925 | Bacteria | 3394 |
| 1405 | Ga0496123_0000065 | 3300048926 | Bacteria | 211758 |
| 1406 | Ga0496123_0000180 | 3300048926 | Bacteria | 127726 |
| 1407 | Ga0496123_0000430 | 3300048926 | Bacteria | 75549 |
| 1408 | Ga0496123_0000508 | 3300048926 | Bacteria | 67759 |
| 1409 | Ga0496123_0000605 | 3300048926 | Bacteria | 60923 |
| 1410 | Ga0496123_0001152 | 3300048926 | Bacteria | 39412 |
| 1411 | Ga0496123_0002413 | 3300048926 | Bacteria | 23311 |
| 1412 | Ga0496123_0002626 | 3300048926 | Bacteria | 21790 |
| 1413 | Ga0496123_0003036 | 3300048926 | Bacteria | 19348 |
| 1414 | Ga0496123_0007845 | 3300048926 | Bacteria | 9928 |
| 1415 | Ga0496123_0027357 | 3300048926 | Bacteria | 4249 |
| 1416 | Ga0496123_0031828 | 3300048926 | Bacteria | 3829 |
| 1417 | Ga0496123_0036535 | 3300048926 | Bacteria | 3482 |
| 1418 | Ga0496123_0037297 | 3300048926 | Bacteria | 3433 |
| 1419 | Ga0496123_0039355 | 3300048926 | Bacteria | 3308 |
| 1420 | Ga0496123_0040890 | 3300048926 | Bacteria | 3221 |
| 1421 | Ga0496124_0000053 | 3300048927 | Bacteria | 252285 |
| 1422 | Ga0496124_0000120 | 3300048927 | Bacteria | 163899 |
| 1423 | Ga0496124_0000147 | 3300048927 | Bacteria | 145724 |
| 1424 | Ga0496124_0000474 | 3300048927 | Bacteria | 69115 |
| 1425 | Ga0496124_0001035 | 3300048927 | Bacteria | 43988 |
| 1426 | Ga0496124_0001108 | 3300048927 | Bacteria | 42354 |
| 1427 | Ga0496124_0001901 | 3300048927 | Bacteria | 28695 |
| 1428 | Ga0496124_0002123 | 3300048927 | Bacteria | 26679 |
| 1429 | Ga0496124_0003341 | 3300048927 | Bacteria | 19748 |
| 1430 | Ga0496124_0003710 | 3300048927 | Bacteria | 18436 |
| 1431 | Ga0496124_0003980 | 3300048927 | Bacteria | 17612 |
| 1432 | Ga0496124_0004161 | 3300048927 | Bacteria | 17075 |
| 1433 | Ga0496124_0004499 | 3300048927 | Bacteria | 16259 |
| 1434 | Ga0496124_0007018 | 3300048927 | Bacteria | 12070 |
| 1435 | Ga0496124_0013002 | 3300048927 | Bacteria | 8159 |
| 1436 | Ga0496124_0014377 | 3300048927 | Bacteria | 7652 |
| 1437 | Ga0496124_0025110 | 3300048927 | Bacteria | 5403 |
| 1438 | Ga0496124_0027366 | 3300048927 | Bacteria | 5119 |
| 1439 | Ga0496124_0034290 | 3300048927 | Bacteria | 4456 |
| 1440 | Ga0496124_0041873 | 3300048927 | Bacteria | 3947 |
| 1441 | Ga0496124_0061209 | 3300048927 | Bacteria | 3156 |
| 1442 | Ga0496124_0110635 | 3300048927 | Bacteria | 2211 |
| 1443 | Ga0496124_0120650 | 3300048927 | Bacteria | 2095 |
| 1444 | Ga0496124_0190440 | 3300048927 | Bacteria | 1570 |
| 1445 | Ga0496125_0000799 | 3300048928 | Bacteria | 51395 |
| 1446 | Ga0496125_0001606 | 3300048928 | Bacteria | 31934 |
| 1447 | Ga0496125_0001971 | 3300048928 | Bacteria | 27913 |
| 1448 | Ga0496125_0003554 | 3300048928 | Bacteria | 18777 |
| 1449 | Ga0496125_0006712 | 3300048928 | Bacteria | 12375 |
| 1450 | Ga0496125_0007902 | 3300048928 | Bacteria | 11232 |
| 1451 | Ga0496125_0009754 | 3300048928 | Bacteria | 9800 |
| 1452 | Ga0496125_0015469 | 3300048928 | Bacteria | 7376 |
| 1453 | Ga0496125_0016979 | 3300048928 | Bacteria | 6959 |
| 1454 | Ga0496125_0053126 | 3300048928 | Bacteria | 3325 |
| 1455 | Ga0496125_0086737 | 3300048928 | Bacteria | 2366 |
| 1456 | Ga0496126_0000387 | 3300048929 | Bacteria | 91081 |
| 1457 | Ga0496126_0000759 | 3300048929 | Bacteria | 58398 |
| 1458 | Ga0496126_0001894 | 3300048929 | Bacteria | 30181 |
| 1459 | Ga0496126_0007665 | 3300048929 | Bacteria | 11782 |
| 1460 | Ga0496126_0024453 | 3300048929 | Bacteria | 5832 |
| 1461 | Ga0496126_0061634 | 3300048929 | Bacteria | 3369 |
| 1462 | Ga0496126_0065253 | 3300048929 | Bacteria | 3258 |
| 1463 | Ga0496126_0120013 | 3300048929 | Bacteria | 2281 |
| 1464 | Ga0496126_0150556 | 3300048929 | Bacteria | 1994 |
| 1465 | Ga0501310_000600 | 3300049130 | Bacteria | 3168 |
| 1466 | Ga0495678_000006 | 3300049459 | Bacteria | 463690 |
| 1467 | Ga0495678_000017 | 3300049459 | Bacteria | 282592 |
| 1468 | Ga0495678_000104 | 3300049459 | Bacteria | 103726 |
| 1469 | Ga0495678_000283 | 3300049459 | Bacteria | 55712 |
| 1470 | Ga0495678_000326 | 3300049459 | Bacteria | 50497 |
| 1471 | Ga0495678_000365 | 3300049459 | Bacteria | 46300 |
| 1472 | Ga0495678_000693 | 3300049459 | Bacteria | 30734 |
| 1473 | Ga0495678_001927 | 3300049459 | Bacteria | 15036 |
| 1474 | Ga0495678_002423 | 3300049459 | Bacteria | 12682 |
| 1475 | Ga0495678_003240 | 3300049459 | Bacteria | 10196 |
| 1476 | Ga0495678_011539 | 3300049459 | Bacteria | 4224 |
| 1477 | Ga0495678_014280 | 3300049459 | Bacteria | 3698 |
| 1478 | Ga0495678_019135 | 3300049459 | Bacteria | 3062 |
| 1479 | Ga0495682_0000015 | 3300049460 | Bacteria | 235048 |
| 1480 | Ga0495682_0000182 | 3300049460 | Bacteria | 51816 |
| 1481 | Ga0495682_0000188 | 3300049460 | Bacteria | 50664 |
| 1482 | Ga0495682_0000659 | 3300049460 | Bacteria | 22954 |
| 1483 | Ga0495682_0001301 | 3300049460 | Bacteria | 13876 |
| 1484 | Ga0495682_0008465 | 3300049460 | Bacteria | 4051 |
| 1485 | Ga0495682_0046868 | 3300049460 | Bacteria | 1577 |
| 1486 | Ga0501290_003355 | 3300049513 | Bacteria | 2026 |
| 1487 | Ga0501033_0131466 | 3300049570 | Bacteria | 1813 |
| 1488 | Ga0501034_0000022 | 3300049571 | Bacteria | 264441 |
| 1489 | Ga0501039_0103735 | 3300049575 | Bacteria | 2220 |
| 1490 | Ga0501040_0031538 | 3300049576 | Bacteria | 3583 |
| 1491 | Ga0501041_0173745 | 3300049577 | Bacteria | 1348 |
| 1492 | Ga0501047_0157899 | 3300049581 | Bacteria | 2140 |
| 1493 | Ga0501047_0158279 | 3300049581 | Bacteria | 2137 |
| 1494 | Ga0501067_0006864 | 3300049583 | Bacteria | 6316 |
| 1495 | Ga0501068_0071169 | 3300049584 | Bacteria | 2123 |
| 1496 | Ga0501070_0017528 | 3300049586 | Bacteria | 6013 |
| 1497 | Ga0501073_0101121 | 3300049589 | Bacteria | 2001 |
| 1498 | Ga0501075_0003850 | 3300049591 | Bacteria | 10103 |
| 1499 | Ga0501076_0140215 | 3300049592 | Bacteria | 1964 |
| 1500 | Ga0501198_000057 | 3300049649 | Bacteria | 32474 |
| 1501 | Ga0501222_000017 | 3300049662 | Bacteria | 75770 |
| 1502 | Ga0501079_0194910 | 3300049741 | Bacteria | 1582 |
| 1503 | Ga0501080_0085223 | 3300049742 | Bacteria | 2936 |
| 1504 | Ga0501080_0135208 | 3300049742 | Bacteria | 2282 |
| 1505 | Ga0501080_0360148 | 3300049742 | Bacteria | 1312 |
| 1506 | Ga0501081_0004297 | 3300049743 | Bacteria | 9128 |
| 1507 | Ga0501083_0041654 | 3300049744 | Bacteria | 3114 |
| 1508 | Ga0501269_000017 | 3300049766 | Bacteria | 57974 |
| 1509 | Ga0501279_004689 | 3300049775 | Bacteria | 1795 |
| 1510 | Ga0501035_0028900 | 3300049822 | Bacteria | 5059 |
| 1511 | Ga0501044_0000065 | 3300049823 | Bacteria | 130072 |
| 1512 | Ga0501044_0071447 | 3300049823 | Bacteria | 3529 |
| 1513 | Ga0501045_0102316 | 3300049824 | Bacteria | 2121 |
| 1514 | Ga0501226_000002 | 3300049853 | Bacteria | 426935 |
| 1515 | nmdc:mga03683_19835_c1 | 3300050489 | Bacteria | 2571 |
| 1516 | nmdc:mga03n38_55249_c1 | 3300050490 | Bacteria | 1788 |
| 1517 | nmdc:mga00v17_36076_c1 | 3300050491 | Bacteria | 2945 |
| 1518 | nmdc:mga00v17_71435_c1 | 3300050491 | Bacteria | 2151 |
| 1519 | nmdc:mga00v17_97385_c1 | 3300050491 | Bacteria | 1854 |
| 1520 | nmdc:mga05p37_135694_c1 | 3300050507 | Bacteria | 3018 |
| 1521 | nmdc:mga05p37_267918_c1 | 3300050507 | Bacteria | 2042 |
| 1522 | nmdc:mga05p37_29695_c1 | 3300050507 | Bacteria | 6671 |
| 1523 | nmdc:mga05p37_50989_c1 | 3300050507 | Bacteria | 5089 |
| 1524 | nmdc:mga05p37_53352_c1 | 3300050507 | Bacteria | 4972 |
| 1525 | nmdc:mga0qj67_199974_c1 | 3300050509 | Bacteria | 1624 |
| 1526 | nmdc:mga06r32_37200_c1 | 3300050510 | Bacteria | 4604 |
| 1527 | nmdc:mga08y16_23075_c1 | 3300050511 | Bacteria | 6570 |
| 1528 | nmdc:mga0n895_155737_c1 | 3300050512 | Bacteria | 2315 |
| 1529 | nmdc:mga0n895_185107_c1 | 3300050512 | Bacteria | 2114 |
| 1530 | nmdc:mga0n895_2762_c1 | 3300050512 | Bacteria | 13867 |
| 1531 | nmdc:mga0rr50_137777_c1 | 3300050513 | Bacteria | 1961 |
| 1532 | nmdc:mga0rr50_300850_c1 | 3300050513 | Bacteria | 1342 |
| 1533 | nmdc:mga0rr50_48426_c1 | 3300050513 | Bacteria | 3141 |
| 1534 | nmdc:mga0a205_135148_c1 | 3300050515 | Bacteria | 2366 |
| 1535 | nmdc:mga0a205_188559_c1 | 3300050515 | Bacteria | 1955 |
| 1536 | nmdc:mga0a205_29557_c1 | 3300050515 | Bacteria | 5245 |
| 1537 | nmdc:mga0a205_320295_c1 | 3300050515 | Bacteria | 1422 |
| 1538 | nmdc:mga0a205_3269_c1 | 3300050515 | Bacteria | 14415 |
| 1539 | nmdc:mga0a205_56645_c1 | 3300050515 | Bacteria | 3784 |
| 1540 | Ga0495601_0019691 | 3300053077 | Bacteria | 4118 |
| 1541 | Ga0500635_0000026 | 3300053080 | Bacteria | 104983 |
| 1542 | Ga0500593_000035 | 3300053117 | Bacteria | 48133 |
| 1543 | Ga0500595_002138 | 3300053119 | Bacteria | 10061 |
| 1544 | Ga0500621_000001 | 3300053126 | Bacteria | 1049698 |
| 1545 | Ga0500637_0005602 | 3300053178 | Bacteria | 6103 |
| 1546 | Ga0501084_0036114 | 3300054114 | Bacteria | 4129 |
| 1547 | Ga0501084_0256612 | 3300054114 | Bacteria | 1476 |
| 1548 | Ga0501082_0003999 | 3300060353 | Bacteria | 12869 |
| 1549 | Ga0501082_0042873 | 3300060353 | Bacteria | 3900 |
| 1550 | Ga0501082_0063221 | 3300060353 | Bacteria | 3187 |
| 1551 | Ga0530510_0095888 | 3300061734 | Bacteria | 2167 |
| 1552 | Ga0530510_0129518 | 3300061734 | Bacteria | 1856 |
| 1553 | 2506576871 | 2506520007 | Bacteria | 5442880 |
| 1554 | 2506582009 | 2506520008 | Bacteria | 5443009 |
| 1555 | 2508850838 | 2508501071 | Bacteria | 5454741 |
| 1556 | 2510284326 | 2510065053 | Bacteria | 5005518 |
| 1557 | 2510292985 | 2510065055 | Bacteria | 5037935 |
| 1558 | 2510312491 | 2510065058 | Bacteria | 5005894 |
| 1559 | 2511249807 | 2511231003 | Bacteria | 5606035 |
| 1560 | 2511254732 | 2511231004 | Bacteria | 6669789 |
| 1561 | 2511265543 | 2511231006 | Bacteria | 6794709 |
| 1562 | 2511288797 | 2511231010 | Bacteria | 6373152 |
| 1563 | 2511297336 | 2511231011 | Bacteria | 6149768 |
| 1564 | 2511301703 | 2511231012 | Bacteria | 6738011 |
| 1565 | 2511316727 | 2511231014 | Bacteria | 6462302 |
| 1566 | 2511319870 | 2511231015 | Bacteria | 6598026 |
| 1567 | 2511326036 | 2511231016 | Bacteria | 6704427 |
| 1568 | 2511330998 | 2511231017 | Bacteria | 6503007 |
| 1569 | 2511336333 | 2511231018 | Bacteria | 6436256 |
| 1570 | 2511344322 | 2511231019 | Bacteria | 6520662 |
| 1571 | 2511349103 | 2511231020 | Bacteria | 6115223 |
| 1572 | 2511355980 | 2511231021 | Bacteria | 7302637 |
| 1573 | 2511360664 | 2511231022 | Bacteria | 6719296 |
| 1574 | 2511366635 | 2511231023 | Bacteria | 6808468 |
| 1575 | 2511378561 | 2511231025 | Bacteria | 5324661 |
| 1576 | 2511383819 | 2511231026 | Bacteria | 5225445 |
| 1577 | 2511411304 | 2511231031 | Bacteria | 6558529 |
| 1578 | 2511434064 | 2511231035 | Bacteria | 5341610 |
| 1579 | 2512325944 | 2512047018 | Bacteria | 6663241 |
| 1580 | 2521559631 | 2521172590 | Bacteria | 5047645 |
| 1581 | 2525557851 | 2524614729 | Bacteria | 3091755 |
| 1582 | 2538428561 | 2537561728 | Bacteria | 5149301 |
| 1583 | 2548648152 | 2547132416 | Bacteria | 4633861 |
| 1584 | 2550696104 | 2548876994 | Bacteria | 4904866 |
| 1585 | 2553006337 | 2551306416 | Bacteria | 6152985 |
| 1586 | 2555245734 | 2554235231 | Bacteria | 5215788 |
| 1587 | 2555667407 | 2554235341 | Bacteria | 6867980 |
| 1588 | 2583789815 | 2582580891 | Bacteria | 6800976 |
| 1589 | 2585829815 | 2585427591 | Bacteria | 5482980 |
| 1590 | 2585833522 | 2585427592 | Bacteria | 5370892 |
| 1591 | 2597855651 | 2597489887 | Bacteria | 6666321 |
| 1592 | 2597861652 | 2597489888 | Bacteria | 6179543 |
| 1593 | 2597867377 | 2597489889 | Bacteria | 6297495 |
| 1594 | 2599327433 | 2599185155 | Bacteria | 5827168 |
| 1595 | 2599356630 | 2599185160 | Bacteria | 6844013 |
| 1596 | 2599363340 | 2599185161 | Bacteria | 6960462 |
| 1597 | 2599369708 | 2599185162 | Bacteria | 6957254 |
| 1598 | 2599376449 | 2599185163 | Bacteria | 6995158 |
| 1599 | 2599381735 | 2599185164 | Bacteria | 6841688 |
| 1600 | 2599388121 | 2599185165 | Bacteria | 6843250 |
| 1601 | 2599395355 | 2599185166 | Bacteria | 6959206 |
| 1602 | 2599398861 | 2599185167 | Bacteria | 6353609 |
| 1603 | 2599407120 | 2599185168 | Bacteria | 6997636 |
| 1604 | 2599411756 | 2599185169 | Bacteria | 5441380 |
| 1605 | 2599450916 | 2599185179 | Bacteria | 6611171 |
| 1606 | 2599463463 | 2599185181 | Bacteria | 6844519 |
| 1607 | 2599469187 | 2599185182 | Bacteria | 6883168 |
| 1608 | 2599485553 | 2599185185 | Bacteria | 6652270 |
| 1609 | 2599492480 | 2599185186 | Bacteria | 6831633 |
| 1610 | 2599506418 | 2599185189 | Bacteria | 5862825 |
| 1611 | 2599514138 | 2599185190 | Bacteria | 6285678 |
| 1612 | 2599518739 | 2599185191 | Bacteria | 6297582 |
| 1613 | 2599806682 | 2599185257 | Bacteria | 6492581 |
| 1614 | 2599882654 | 2599185288 | Bacteria | 6666191 |
| 1615 | 2599893527 | 2599185290 | Bacteria | 6289611 |
| 1616 | 2599928045 | 2599185299 | Bacteria | 4854625 |
| 1617 | 2599950769 | 2599185303 | Bacteria | 6512725 |
| 1618 | 2600216092 | 2599185356 | Bacteria | 6843884 |
| 1619 | 2600364894 | 2600254931 | Bacteria | 6734225 |
| 1620 | 2601524571 | 2600255254 | Bacteria | 5281859 |
| 1621 | 2601529725 | 2600255255 | Bacteria | 5282785 |
| 1622 | 2601534625 | 2600255256 | Bacteria | 5597742 |
| 1623 | 2601539210 | 2600255257 | Bacteria | 5597196 |
| 1624 | 2601616559 | 2600255280 | Bacteria | 5292309 |
| 1625 | 2601621281 | 2600255281 | Bacteria | 5288753 |
| 1626 | 2601645132 | 2600255287 | Bacteria | 5210468 |
| 1627 | 2601649678 | 2600255288 | Bacteria | 5282738 |
| 1628 | 2601654605 | 2600255289 | Bacteria | 5281907 |
| 1629 | 2601660121 | 2600255290 | Bacteria | 5282218 |
| 1630 | 2601664373 | 2600255291 | Bacteria | 5217298 |
| 1631 | 2601667293 | 2600255292 | Bacteria | 6300551 |
| 1632 | 2601692337 | 2600255296 | Bacteria | 5784754 |
| 1633 | 2601698094 | 2600255298 | Bacteria | 5215185 |
| 1634 | 2601702462 | 2600255299 | Bacteria | 5218662 |
| 1635 | 2601707349 | 2600255300 | Bacteria | 5287774 |
| 1636 | 2601712370 | 2600255301 | Bacteria | 5280532 |
| 1637 | 2601717866 | 2600255302 | Bacteria | 5288235 |
| 1638 | 2601722965 | 2600255303 | Bacteria | 5219315 |
| 1639 | 2601727794 | 2600255304 | Bacteria | 5283973 |
| 1640 | 2601732811 | 2600255305 | Bacteria | 5282329 |
| 1641 | 2601737420 | 2600255306 | Bacteria | 5281613 |
| 1642 | 2601741839 | 2600255307 | Bacteria | 5439064 |
| 1643 | 2601752737 | 2600255309 | Bacteria | 5431045 |
| 1644 | 2601757559 | 2600255310 | Bacteria | 5600903 |
| 1645 | 2601763918 | 2600255311 | Bacteria | 5598766 |
| 1646 | 2601776259 | 2600255313 | Bacteria | 6842543 |
| 1647 | 2601797823 | 2600255318 | Bacteria | 6383414 |
| 1648 | 2602008632 | 2600255389 | Bacteria | 5275336 |
| 1649 | 2602019691 | 2600255392 | Bacteria | 5437392 |
| 1650 | 2603640265 | 2602042046 | Bacteria | 5483348 |
| 1651 | 2603645947 | 2602042047 | Bacteria | 4697674 |
| 1652 | 2603662537 | 2602042052 | Bacteria | 5215873 |
| 1653 | 2603667433 | 2602042053 | Bacteria | 5214361 |
| 1654 | 2603701833 | 2602042066 | Bacteria | 4423871 |
| 1655 | 2603706458 | 2602042067 | Bacteria | 4863713 |
| 1656 | 2603840220 | 2602042103 | Bacteria | 5284714 |
| 1657 | 2603845297 | 2602042104 | Bacteria | 5281639 |
| 1658 | 2603850370 | 2602042105 | Bacteria | 5282303 |
| 1659 | 2603855438 | 2602042106 | Bacteria | 5282744 |
| 1660 | 2603868299 | 2602042109 | Bacteria | 5152801 |
| 1661 | 2603873114 | 2602042110 | Bacteria | 5283285 |
| 1662 | 2603878244 | 2602042111 | Bacteria | 5212080 |
| 1663 | 2606050199 | 2603880178 | Bacteria | 5283018 |
| 1664 | 2606071861 | 2603880184 | Bacteria | 5217896 |
| 1665 | 2606076694 | 2603880185 | Bacteria | 6379190 |
| 1666 | 2606128892 | 2603880199 | Bacteria | 6377649 |
| 1667 | 2606147882 | 2603880202 | Bacteria | 5284684 |
| 1668 | 2606178183 | 2603880211 | Bacteria | 5284226 |
| 1669 | 2608668994 | 2608642108 | Bacteria | 4104624 |
| 1670 | 2621302188 | 2619619299 | Bacteria | 6649820 |
| 1671 | 2624478212 | 2623620443 | Bacteria | 6427864 |
| 1672 | 2630650182 | 2627854209 | Bacteria | 3093011 |
| 1673 | 2643791609 | 2643221554 | Bacteria | 6603920 |
| 1674 | 2643840980 | 2643221565 | Bacteria | 6216018 |
| 1675 | 2643872629 | 2643221571 | Bacteria | 6228673 |
| 1676 | 2643954911 | 2643221589 | Bacteria | 6250934 |
| 1677 | 2644024551 | 2643221602 | Bacteria | 6249926 |
| 1678 | 2644060851 | 2643221609 | Bacteria | 6756331 |
| 1679 | 2644074530 | 2643221611 | Bacteria | 6820941 |
| 1680 | 2644186112 | 2643221633 | Bacteria | 6733554 |
| 1681 | 2644252445 | 2643221645 | Bacteria | 7207331 |
| 1682 | 2644619638 | 2643221713 | Bacteria | 6554480 |
| 1683 | 2650896933 | 2648501693 | Bacteria | 5069560 |
| 1684 | 2656279243 | 2654587920 | Bacteria | 5475511 |
| 1685 | 2671099980 | 2667528171 | Bacteria | 6900659 |
| 1686 | 2671105339 | 2667528172 | Bacteria | 5170840 |
| 1687 | 2671107457 | 2667528173 | Bacteria | 5375747 |
| 1688 | 2671586449 | 2671180115 | Bacteria | 5353919 |
| 1689 | 2671772333 | 2671180172 | Bacteria | 6495783 |
| 1690 | 2676408836 | 2675903046 | Bacteria | 5451247 |
| 1691 | 2677898964 | 2675903420 | Bacteria | 6247433 |
| 1692 | 2681998867 | 2681812866 | Bacteria | 4552357 |
| 1693 | 2682009716 | 2681812869 | Bacteria | 5014465 |
| 1694 | 2689443270 | 2687453601 | Bacteria | 5546041 |
| 1695 | 2712472076 | 2711768156 | Bacteria | 4471618 |
| 1696 | 2715749197 | 2713897148 | Bacteria | 5883533 |
| 1697 | 2715755467 | 2713897149 | Bacteria | 6506249 |
| 1698 | 2718632149 | 2718217725 | Bacteria | 5758958 |
| 1699 | 2722884172 | 2721755523 | Bacteria | 6430384 |
| 1700 | 2723246550 | 2721755607 | Bacteria | 5841722 |
| 1701 | 2738674077 | 2738541265 | Bacteria | 6594665 |
| 1702 | 2738714086 | 2738541276 | Bacteria | 4690596 |
| 1703 | 2738752470 | 2738541282 | Bacteria | 6593925 |
| 1704 | 2738807917 | 2738541294 | Bacteria | 6925949 |
| 1705 | 2738861511 | 2738541303 | Bacteria | 6591772 |
| 1706 | 2738895277 | 2738541309 | Bacteria | 6926455 |
| 1707 | 2739198017 | 2738543004 | Bacteria | 6381073 |
| 1708 | 2739260307 | 2738543015 | Bacteria | 6750701 |
| 1709 | 2739288602 | 2738543020 | Bacteria | 5718238 |
| 1710 | 2739293914 | 2738543021 | Bacteria | 5718241 |
| 1711 | 2739311270 | 2738543025 | Bacteria | 6600348 |
| 1712 | 2740995155 | 2740891818 | Bacteria | 6711283 |
| 1713 | 2743735068 | 2740892503 | Bacteria | 6855563 |
| 1714 | 2753857964 | 2751185917 | Bacteria | 4551186 |
| 1715 | 2765591130 | 2765235842 | Bacteria | 4799256 |
| 1716 | 2774119571 | 2773857670 | Bacteria | 6407454 |
| 1717 | 2774131506 | 2773857672 | Bacteria | 4993178 |
| 1718 | 2774134727 | 2773857673 | Bacteria | 6513460 |
| 1719 | 2775542817 | 2775506706 | Bacteria | 4873073 |
| 1720 | 2784261057 | 2784132063 | Bacteria | 6262788 |
| 1721 | 2784315982 | 2784132072 | Bacteria | 6596533 |
| 1722 | 2791922865 | 2791354903 | Bacteria | 4937680 |
| 1723 | 2808905445 | 2808606373 | Bacteria | 4423627 |
| 1724 | 2808932167 | 2808606377 | Bacteria | 6646337 |
| 1725 | 2808939695 | 2808606379 | Bacteria | 5022697 |
| 1726 | 2808954232 | 2808606381 | Bacteria | 6646461 |
| 1727 | 2808955859 | 2808606382 | Bacteria | 6841132 |
| 1728 | 2808976670 | 2808606385 | Bacteria | 6711065 |
| 1729 | 2808991892 | 2808606388 | Bacteria | 6706662 |
| 1730 | 2809124181 | 2808606414 | Bacteria | 4917181 |
| 1731 | 2809217967 | 2808606445 | Bacteria | 6057339 |
| 1732 | 2812370168 | 2811994881 | Bacteria | 6298475 |
| 1733 | 2813726510 | 2811995292 | Bacteria | 5303342 |
| 1734 | 2814693884 | 2814123068 | Bacteria | 5687681 |
| 1735 | 2816476018 | 2816332133 | Bacteria | 7249298 |
| 1736 | 2817488402 | 2816332298 | Bacteria | 6852809 |
| 1737 | 2819541021 | 2818991436 | Bacteria | 5376622 |
| 1738 | 2819592228 | 2818991445 | Bacteria | 4955017 |
| 1739 | 2819657221 | 2818991456 | Bacteria | 6123676 |
| 1740 | 2819705204 | 2818991464 | Bacteria | 6907494 |
| 1741 | 2821122417 | 2821118458 | Bacteria | 4714306 |
| 1742 | 2823378106 | 2823373977 | Bacteria | 4779415 |
| 1743 | 2823425513 | 2823421272 | Bacteria | 5372474 |
| 1744 | 2826586887 | 2826581358 | Bacteria | 5963467 |
| 1745 | 2834032221 | 2834028612 | Bacteria | 6354979 |
| 1746 | 2839098070 | 2839094727 | Bacteria | 5534556 |
| 1747 | 2842714483 | 2842711865 | Bacteria | 7155354 |
| 1748 | 2842807122 | 2842805378 | Bacteria | 5385175 |
| 1749 | 2842816704 | 2842815866 | Bacteria | 5947510 |
| 1750 | 2842832075 | 2842826826 | Bacteria | 5974129 |
| 1751 | 2842834149 | 2842832357 | Bacteria | 5959113 |
| 1752 | 2842838625 | 2842837860 | Bacteria | 6066181 |
| 1753 | 2842846374 | 2842843487 | Bacteria | 6004777 |
| 1754 | 2842852247 | 2842849001 | Bacteria | 5924277 |
| 1755 | 2844530455 | 2844528606 | Bacteria | 4733806 |
| 1756 | 2844667887 | 2844665904 | Bacteria | 6817974 |
| 1757 | 2846041917 | 2846037992 | Bacteria | 4526407 |
| 1758 | 2847801382 | 2847797336 | Bacteria | 5176640 |
| 1759 | 2852617066 | 2852612431 | Bacteria | 6885235 |
| 1760 | 2852660462 | 2852657418 | Bacteria | 6472974 |
| 1761 | 2852671945 | 2852667396 | Bacteria | 6885555 |
| 1762 | 2854603544 | 2854601825 | Bacteria | 4797592 |
| 1763 | 2855199489 | 2855195626 | Bacteria | 4927512 |
| 1764 | 2857552516 | 2857547612 | Bacteria | 6179999 |
| 1765 | 2857553516 | 2857553236 | Bacteria | 6166726 |
| 1766 | 2857561589 | 2857558681 | Bacteria | 6617694 |
| 1767 | 2857565152 | 2857564685 | Bacteria | 6290584 |
| 1768 | 2858470370 | 2858466076 | Bacteria | 4722413 |
| 1769 | 2860343652 | 2860339153 | Bacteria | 6846989 |
| 1770 | 2860868426 | 2860867994 | Bacteria | 5645326 |
| 1771 | 2865015603 | 2865014394 | Bacteria | 4764573 |
| 1772 | 2869552676 | 2869551831 | Bacteria | 5474685 |
| 1773 | 2871274681 | 2871272651 | Bacteria | 5042015 |
| 1774 | 2871284339 | 2871282230 | Bacteria | 4917173 |
| 1775 | 2876602015 | 2876601092 | Bacteria | 5114497 |
| 1776 | 2878030155 | 2878029506 | Bacteria | 6418441 |
| 1777 | 2880231102 | 2880230671 | Bacteria | 6140320 |
| 1778 | 2881612359 | 2881609920 | Bacteria | 4405319 |
| 1779 | 2883357789 | 2883354860 | Bacteria | 5865246 |
| 1780 | 2884089542 | 2884086401 | Bacteria | 5005459 |
| 1781 | 2884341550 | 2884338543 | Bacteria | 4610696 |
| 1782 | 2884816675 | 2884811622 | Bacteria | 5552861 |
| 1783 | 2884840345 | 2884836552 | Bacteria | 5219991 |
| 1784 | 2884855601 | 2884852848 | Bacteria | 5221161 |
| 1785 | 2885081624 | 2885080285 | Bacteria | 6355622 |
| 1786 | 2888371068 | 2888366609 | Bacteria | 5155009 |
| 1787 | 2888374850 | 2888373701 | Bacteria | 5098052 |
| 1788 | 2891672624 | 2891670763 | Bacteria | 4967099 |
| 1789 | 2894513814 | 2894510363 | Bacteria | 5121143 |
| 1790 | 2896157473 | 2896154374 | Bacteria | 5221518 |
| 1791 | 2900054867 | 2900051742 | Bacteria | 4985156 |
| 1792 | 2904426461 | 2904424332 | Bacteria | 7633521 |
| 1793 | 2904443255 | 2904439833 | Bacteria | 5931679 |
| 1794 | 2904476405 | 2904474040 | Bacteria | 5504324 |
| 1795 | 2904506839 | 2904504865 | Bacteria | 5152820 |
| 1796 | 2904519561 | 2904518522 | Bacteria | 6068986 |
| 1797 | 2904532964 | 2904530477 | Bacteria | 5876334 |
| 1798 | 2904552169 | 2904550169 | Bacteria | 6221258 |
| 1799 | 2904585516 | 2904584206 | Bacteria | 6028872 |
| 1800 | 2904593865 | 2904589729 | Bacteria | 6113573 |
| 1801 | 2904603984 | 2904601388 | Bacteria | 5884906 |
| 1802 | 2908447019 | 2908446538 | Bacteria | 6829095 |
| 1803 | 2917071158 | 2917070673 | Bacteria | 6868303 |
| 1804 | 2917836390 | 2917832318 | Bacteria | 5346010 |
| 1805 | 2919066163 | 2919063839 | Bacteria | 6302690 |
| 1806 | 2919081781 | 2919079590 | Bacteria | 5946433 |
| 1807 | 2919127477 | 2919125081 | Bacteria | 5385106 |
| 1808 | 2919152574 | 2919150387 | Bacteria | 5500879 |
| 1809 | 2919155799 | 2919155634 | Bacteria | 4860545 |
| 1810 | 2919389787 | 2919385768 | Bacteria | 5897293 |
| 1811 | 2919459975 | 2919456309 | Bacteria | 6586567 |
| 1812 | 2919481394 | 2919476304 | Bacteria | 5888696 |
| 1813 | 2919488714 | 2919487758 | Bacteria | 5929766 |
| 1814 | 2919493773 | 2919493220 | Bacteria | 4598500 |
| 1815 | 2919500915 | 2919497567 | Bacteria | 4408621 |
| 1816 | 2919502248 | 2919501602 | Bacteria | 5286340 |
| 1817 | 2919545657 | 2919543075 | Bacteria | 4728703 |
| 1818 | 2919708489 | 2919704043 | Bacteria | 5560311 |
| 1819 | 2923154063 | 2923153595 | Bacteria | 6870622 |
| 1820 | 2923513407 | 2923510766 | Bacteria | 5926163 |
| 1821 | 2923524259 | 2923519811 | Bacteria | 6298479 |
| 1822 | 2926063921 | 2926063275 | Bacteria | 5285848 |
| 1823 | 2927145243 | 2927143783 | Bacteria | 5504251 |
| 1824 | 2927836566 | 2927833300 | Bacteria | 4923934 |
| 1825 | 2928134053 | 2928130867 | Bacteria | 5467269 |
| 1826 | 2929190291 | 2929189879 | Bacteria | 5930554 |
| 1827 | 2931391370 | 2931390751 | Bacteria | 6273349 |
| 1828 | 2931398829 | 2931396565 | Bacteria | 7251677 |
| 1829 | 2935358986 | 2935353572 | Unclassified | 6955622 |
| 1830 | 2937540137 | 2937539931 | Bacteria | 4639830 |
| 1831 | 2939572156 | 2939568625 | Bacteria | 4542555 |
| 1832 | 2939602563 | 2939602548 | Bacteria | 4950493 |
| 1833 | 2939611490 | 2939607340 | Bacteria | 4719256 |
| 1834 | 2939641103 | 2939636861 | Bacteria | 6297853 |
| 1835 | 2939646468 | 2939642701 | Bacteria | 4475280 |
| 1836 | 2941472993 | 2941471342 | Bacteria | 5018624 |
| 1837 | 2945876184 | 2945874760 | Bacteria | 5527237 |
| 1838 | 2945930176 | 2945928738 | Bacteria | 6053221 |
| 1839 | 2945953496 | 2945951305 | Bacteria | 4918162 |
| 1840 | 2945967580 | 2945961074 | Bacteria | 7342064 |
| 1841 | 2946012523 | 2946006987 | Bacteria | 6705746 |
| 1842 | 2946028634 | 2946027586 | Bacteria | 6049274 |
| 1843 | 2947235161 | 2947233263 | Bacteria | 6439278 |
| 1844 | 2969304948 | 2969304461 | Bacteria | 6601805 |
| 1845 | 2974293360 | 2974289157 | Bacteria | 6080362 |
| 1846 | 2974314638 | 2974310843 | Bacteria | 4947816 |
| 1847 | 2978975988 | 2978975091 | Bacteria | 4704313 |
| 1848 | 2984291996 | 2984286254 | Bacteria | 6702062 |
| 1849 | 2984498214 | 2984494565 | Bacteria | 5000175 |
| 1850 | 2984500685 | 2984499530 | Bacteria | 5020881 |
| 1851 | 2984507208 | 2984504281 | Bacteria | 5262371 |
| 1852 | 2990265534 | 2990261002 | Bacteria | 4919493 |
| 1853 | 2998140451 | 2998139840 | Bacteria | 6073514 |
| 1854 | 3007255357 | 3007252601 | Bacteria | 4559114 |
| 1855 | 3007315837 | 3007315729 | Bacteria | 5076637 |
| 1856 | 3007399614 | 3007395558 | Bacteria | 6755444 |
| 1857 | 3007420013 | 3007419365 | Bacteria | 7026924 |
| 1858 | 3007517896 | 3007511990 | Bacteria | 6481491 |
| 1859 | 3007618665 | 3007614139 | Bacteria | 6053559 |
| 1860 | 3007624999 | 3007619802 | Bacteria | 6411688 |
| 1861 | 3007721212 | 3007718800 | Bacteria | 5971527 |
| 1862 | 3007859691 | 3007855910 | Bacteria | 5637581 |
| 1863 | 3007864336 | 3007861166 | Bacteria | 6045338 |
| 1864 | 637317804 | 637000220 | Bacteria | 7074893 |
| 1865 | 640936423 | 640753048 | Bacteria | 5495657 |
| 1866 | 8001522612 | 8001522603 | Bacteria | 4726425 |
| 1867 | 8015688312 | 8015687852 | Bacteria | 6613826 |
| 1868 | 8016736393 | 8016733728 | Bacteria | 5274317 |
| 1869 | 8018223139 | 8018221730 | Bacteria | 4616064 |
| 1870 | 8018408855 | 8018405270 | Bacteria | 4978981 |
| 1871 | 8019503064 | 8019499862 | Bacteria | 5169538 |
| 1872 | 8019770298 | 8019769354 | Bacteria | 6924660 |
| 1873 | 8030000287 | 8029995093 | Bacteria | 5990776 |
| 1874 | 8047673315 | 8047673197 | Bacteria | 7395230 |
| 1875 | 8054291514 | 8054285046 | Bacteria | 6919322 |
| 1876 | 8054350140 | 8054347763 | Bacteria | 5901107 |
| 1877 | 8054503957 | 8054503363 | Bacteria | 6101651 |
| 1878 | 8054846290 | 8054844752 | Bacteria | 4450330 |
| 1879 | 8054850416 | 8054849141 | Bacteria | 5232694 |
| 1880 | 8055092398 | 8055087960 | Bacteria | 4784273 |
| 1881 | 8055093595 | 8055092621 | Bacteria | 4873875 |
| 1882 | 8055097674 | 8055097453 | Bacteria | 4865496 |
| 1883 | 8055771409 | 8055770955 | Bacteria | 6827675 |
| 1884 | 8055818353 | 8055817908 | Bacteria | 6609162 |
| 1885 | 8056126464 | 8056125926 | Bacteria | 6228218 |
| 1886 | 8056132327 | 8056131705 | Bacteria | 6107031 |
| 1887 | 8056152467 | 8056148874 | Bacteria | 6479865 |
| 1888 | 8056164333 | 8056161164 | Bacteria | 6106669 |
| 1889 | 8056170600 | 8056166840 | Bacteria | 5820959 |
| 1890 | 8056183052 | 8056177738 | Bacteria | 6748268 |
| 1891 | 8056572310 | 8056569372 | Bacteria | 5997322 |
| 1892 | 8057307969 | 8057304971 | Bacteria | 4649742 |
| 1893 | 8057802700 | 8057798959 | Bacteria | 6713499 |
| 1894 | Ga0055526_1007031 | |||
| 1895 | MRS2a_Contig_66 | |||
| 1896 | SwRhRL2b_contig_111498 | |||
| 1897 | SwRhRL2b_contig_3150169 | |||
| 1898 | SwRhRL2b_contig_677248 | |||
| 1899 | JGI24736J21556_1001491 | |||
| 1900 | JGI25162J39368_1000002 | |||
| 1901 | JGI25162J39368_1000140 | |||
| 1902 | JGI25162J39368_1000181 | |||
| 1903 | JGI25154J39366_1000156 | |||
| 1904 | JGI25154J39366_1000230 | |||
| 1905 | JGI25154J39366_1001243 | |||
| 1906 | JGI25157J39369_1000127 | |||
| 1907 | JGI25157J39369_1000241 | |||
| 1908 | JGI25163J39215_1000166 | |||
| 1909 | JGI25163J39215_1000195 | |||
| 1910 | JGI25163J39215_1000805 | |||
| 1911 | JGI25163J39215_1001748 | |||
| 1912 | JGI25164J39214_1000066 | |||
| 1913 | JGI25164J39214_1000110 | |||
| 1914 | JGI25164J39214_1000146 | |||
| 1915 | JGI25152J39213_1000052 | |||
| 1916 | JGI25150J39212_1000260 | |||
| 1917 | JGI25150J39212_1000643 | |||
| 1918 | JGI25159J45721_1010505 | |||
| 1919 | JGI25165J46597_1000001 | |||
| 1920 | JGI25165J46597_1000228 | |||
| 1921 | JGI25165J46597_1000267 | |||
| 1922 | JGI25153J46596_10018456 | |||
| 1923 | JGI25153J46596_10020340 | |||
| 1924 | rootH1_10077162 | |||
| 1925 | rootH2_10034969 | |||
| 1926 | rootL2_10018704 | |||
| 1927 | rootH1_10009899 | |||
| 1928 | rootH1_10025721 | |||
| 1929 | JGI25160J50197_1011257 | |||
| 1930 | JGI25161J50226_1000052 | |||
| 1931 | JGI25161J50226_1005753 | |||
| 1932 | Ga0055538_1000001 | |||
| 1933 | Ga0055538_1000003 | |||
| 1934 | Ga0055538_1000037 | |||
| 1935 | Ga0055538_1000057 | |||
| 1936 | Ga0055539_1000001 | |||
| 1937 | Ga0055539_1000003 | |||
| 1938 | Ga0055539_1000048 | |||
| 1939 | Ga0055539_1000088 | |||
| 1940 | Ga0055539_1000405 | |||
| 1941 | Ga0055533_1000003 | |||
| 1942 | Ga0055533_1000005 | |||
| 1943 | Ga0055533_1000024 | |||
| 1944 | Ga0055533_1000059 | |||
| 1945 | Ga0055533_1000096 | |||
| 1946 | Ga0055532_1000015 | |||
| 1947 | Ga0055532_1000105 | |||
| 1948 | Ga0055525_1000005 | |||
| 1949 | Ga0055525_1000057 | |||
| 1950 | Ga0055525_1000087 | |||
| 1951 | Ga0055525_1000128 | |||
| 1952 | Ga0055525_1000129 | |||
| 1953 | Ga0055525_1000778 | |||
| 1954 | Ga0055535_1005791 | |||
| 1955 | Ga0055526_1000066 | |||
| 1956 | Ga0055526_1000100 | |||
| 1957 | Ga0055537_1001797 | |||
| 1958 | Ga0055524_1000383 | |||
| 1959 | Ga0055524_1001387 | |||
| 1960 | Ga0055536_1000392 | |||
| 1961 | Ga0055536_1000624 | |||
| 1962 | Ga0055530_10000050 | |||
| 1963 | Ga0055530_10000333 | |||
| 1964 | Ga0055530_10001393 | |||
| 1965 | Ga0055530_10006688 | |||
| 1966 | Ga0055530_10020690 | |||
| 1967 | Ga0055540_1000279 | |||
| 1968 | Ga0055540_1001037 | |||
| 1969 | Ga0055531_10000321 | |||
| 1970 | Ga0055531_10000334 | |||
| 1971 | Ga0055541_1000001 | |||
| 1972 | Ga0055541_1000003 | |||
| 1973 | Ga0055541_1000035 | |||
| 1974 | Ga0055541_1000059 | |||
| 1975 | Ga0058692_1000467 | |||
| 1976 | Ga0058692_1000511 | |||
| 1977 | Ga0058692_1000526 | |||
| 1978 | Ga0058692_1000596 | |||
| 1979 | Ga0058692_1005707 | |||
| 1980 | Ga0055543_1000038 | |||
| 1981 | Ga0065165_1000117 | |||
| 1982 | Ga0065714_10002942 | |||
| 1983 | Ga0065714_10066785 | |||
| 1984 | Ga0065714_10118969 | |||
| 1985 | Ga0065704_10000264 | |||
| 1986 | Ga0065704_10005832 | |||
| 1987 | Ga0065704_10070138 | |||
| 1988 | Ga0065704_10070840 | |||
| 1989 | Ga0065704_10117084 | |||
| 1990 | Ga0065712_10002256 | |||
| 1991 | Ga0065707_10004433 | |||
| 1992 | Ga0070658_10051357 | |||
| 1993 | Ga0070690_100009303 | |||
| 1994 | Ga0070670_100002353 | |||
| 1995 | Ga0068869_100004475 | |||
| 1996 | Ga0068869_100259175 | |||
| 1997 | Ga0070666_10129865 | |||
| 1998 | Ga0070660_100061895 | |||
| 1999 | Ga0070661_100000078 | |||
| 2000 | Ga0070669_100000221 | |||
| 2001 | Ga0070669_100001965 | |||
| 2002 | Ga0070673_100002270 | |||
| 2003 | Ga0070673_100206336 | |||
| 2004 | Ga0070688_100140697 | |||
| 2005 | Ga0070659_100009757 | |||
| 2006 | Ga0070659_100022514 | |||
| 2007 | Ga0070714_100002975 | |||
| 2008 | Ga0070711_100039163 | |||
| 2009 | Ga0070705_100051014 | |||
| 2010 | Ga0070708_100046554 | |||
| 2011 | Ga0070662_100000095 | |||
| 2012 | Ga0070706_100206242 | |||
| 2013 | Ga0070707_100068328 | |||
| 2014 | Ga0068853_100000089 | |||
| 2015 | Ga0068853_100135139 | |||
| 2016 | Ga0070696_100059361 | |||
| 2017 | Ga0070665_100000117 | |||
| 2018 | Ga0070665_100302846 | |||
| 2019 | Ga0068855_100002195 | |||
| 2020 | Ga0068855_100066169 | |||
| 2021 | Ga0070664_100000391 | |||
| 2022 | Ga0070664_100014872 | |||
| 2023 | Ga0070664_100119058 | |||
| 2024 | Ga0068857_100000006 | |||
| 2025 | Ga0068857_100001885 | |||
| 2026 | Ga0068857_100369670 | |||
| 2027 | Ga0068854_100005598 | |||
| 2028 | Ga0068856_100005894 | |||
| 2029 | Ga0068861_100005127 | |||
| 2030 | Ga0068851_10000024 | |||
| 2031 | Ga0068851_10001161 | |||
| 2032 | Ga0068863_100104359 | |||
| 2033 | Ga0068860_100032190 | |||
| 2034 | Ga0068860_100225729 | |||
| 2035 | Ga0068862_100142116 | |||
| 2036 | Ga0081455_10000094 | |||
| 2037 | Ga0081538_10002691 | |||
| 2038 | Ga0075364_10000923 | |||
| 2039 | Ga0075364_10008290 | |||
| 2040 | Ga0075364_10044409 | |||
| 2041 | Ga0075364_10074101 | |||
| 2042 | Ga0075432_10033245 | |||
| 2043 | Ga0070712_100074217 | |||
| 2044 | Ga0097621_100023910 | |||
| 2045 | Ga0068871_100012427 | |||
| 2046 | Ga0075431_100041519 | |||
| 2047 | Ga0075431_100110820 | |||
| 2048 | Ga0075431_100269780 | |||
| 2049 | Ga0075433_10002631 | |||
| 2050 | Ga0075433_10025385 | |||
| 2051 | Ga0075434_100025667 | |||
| 2052 | Ga0075434_100069988 | |||
| 2053 | Ga0075429_100095061 | |||
| 2054 | Ga0079104_1000078 | |||
| 2055 | Ga0079104_1000130 | |||
| 2056 | Ga0079104_1000296 | |||
| 2057 | Ga0079104_1000398 | |||
| 2058 | Ga0079104_1000527 | |||
| 2059 | Ga0079104_1000564 | |||
| 2060 | Ga0079104_1001042 | |||
| 2061 | Ga0079104_1001578 | |||
| 2062 | Ga0079104_1001940 | |||
| 2063 | Ga0079104_1019295 | |||
| 2064 | Ga0075435_100003659 | |||
| 2065 | Ga0075435_100065755 | |||
| 2066 | Ga0075435_100098519 | |||
| 2067 | Ga0105251_10000113 | |||
| 2068 | Ga0105251_10000361 | |||
| 2069 | Ga0105251_10000488 | |||
| 2070 | Ga0105251_10001520 | |||
| 2071 | Ga0105251_10001591 | |||
| 2072 | Ga0105251_10002600 | |||
| 2073 | Ga0105251_10003514 | |||
| 2074 | Ga0105251_10003914 | |||
| 2075 | Ga0105251_10006822 | |||
| 2076 | Ga0105251_10016397 | |||
| 2077 | Ga0105251_10047549 | |||
| 2078 | Ga0105251_10057511 | |||
| 2079 | Ga0105244_10000021 | |||
| 2080 | Ga0105244_10000034 | |||
| 2081 | Ga0105244_10000557 | |||
| 2082 | Ga0105244_10000982 | |||
| 2083 | Ga0105244_10002091 | |||
| 2084 | Ga0105244_10002327 | |||
| 2085 | Ga0105244_10002351 | |||
| 2086 | Ga0105244_10003420 | |||
| 2087 | Ga0105244_10003749 | |||
| 2088 | Ga0105244_10003972 | |||
| 2089 | Ga0105244_10004754 | |||
| 2090 | Ga0105244_10010109 | |||
| 2091 | Ga0105244_10011859 | |||
| 2092 | Ga0105244_10037378 | |||
| 2093 | Ga0105244_10044227 | |||
| 2094 | Ga0105244_10073766 | |||
| 2095 | Ga0105250_10000004 | |||
| 2096 | Ga0105250_10000189 | |||
| 2097 | Ga0105250_10000211 | |||
| 2098 | Ga0105250_10000447 | |||
| 2099 | Ga0105250_10001416 | |||
| 2100 | Ga0105250_10001514 | |||
| 2101 | Ga0105250_10004436 | |||
| 2102 | Ga0105250_10005745 | |||
| 2103 | Ga0105250_10009521 | |||
| 2104 | Ga0105240_10004079 | |||
| 2105 | Ga0105240_10046807 | |||
| 2106 | Ga0105240_10047323 | |||
| 2107 | Ga0105240_10122372 | |||
| 2108 | Ga0111539_10050989 | |||
| 2109 | Ga0111539_10452857 | |||
| 2110 | Ga0105245_10162449 | |||
| 2111 | Ga0114129_10002450 | |||
| 2112 | Ga0114129_10011473 | |||
| 2113 | Ga0114129_10044965 | |||
| 2114 | Ga0114129_10062432 | |||
| 2115 | Ga0114129_10075748 | |||
| 2116 | Ga0105243_10000595 | |||
| 2117 | Ga0105243_10000918 | |||
| 2118 | Ga0105243_10013794 | |||
| 2119 | Ga0105243_10039308 | |||
| 2120 | Ga0105243_10061309 | |||
| 2121 | Ga0105243_10111717 | |||
| 2122 | Ga0105241_10000004 | |||
| 2123 | Ga0105241_10002206 | |||
| 2124 | Ga0105242_10000136 | |||
| 2125 | Ga0105242_10012557 | |||
| 2126 | Ga0105248_10012631 | |||
| 2127 | Ga0105248_10034319 | |||
| 2128 | Ga0105248_10165972 | |||
| 2129 | Ga0105237_10000939 | |||
| 2130 | Ga0105237_10013428 | |||
| 2131 | Ga0105237_10029202 | |||
| 2132 | Ga0105238_10000006 | |||
| 2133 | Ga0105238_10021866 | |||
| 2134 | Ga0105239_10030781 | |||
| 2135 | Ga0105239_10325231 | |||
| 2136 | Ga0105239_10426401 | |||
| 2137 | Ga0105246_10000042 | |||
| 2138 | Ga0105246_10003799 | |||
| 2139 | Ga0105246_10010036 | |||
| 2140 | Ga0105246_10179365 | |||
| 2141 | Ga0157373_10001463 | |||
| 2142 | Ga0157373_10002210 | |||
| 2143 | Ga0157373_10021939 | |||
| 2144 | Ga0157373_10030530 | |||
| 2145 | Ga0157373_10067906 | |||
| 2146 | Ga0157371_10000811 | |||
| 2147 | Ga0157371_10001070 | |||
| 2148 | Ga0157371_10001080 | |||
| 2149 | Ga0157371_10002984 | |||
| 2150 | Ga0157371_10005453 | |||
| 2151 | Ga0157371_10005644 | |||
| 2152 | Ga0157371_10025390 | |||
| 2153 | Ga0157371_10025844 | |||
| 2154 | Ga0157371_10096412 | |||
| 2155 | Ga0157370_10000150 | |||
| 2156 | Ga0157370_10000655 | |||
| 2157 | Ga0157370_10001869 | |||
| 2158 | Ga0157370_10002081 | |||
| 2159 | Ga0157370_10003150 | |||
| 2160 | Ga0157370_10024113 | |||
| 2161 | Ga0157370_10034674 | |||
| 2162 | Ga0157370_10047672 | |||
| 2163 | Ga0157370_10074019 | |||
| 2164 | Ga0157369_10000080 | |||
| 2165 | Ga0157369_10001555 | |||
| 2166 | Ga0157369_10010831 | |||
| 2167 | Ga0157369_10022077 | |||
| 2168 | Ga0157369_10027225 | |||
| 2169 | Ga0157369_10027876 | |||
| 2170 | Ga0157369_10059033 | |||
| 2171 | Ga0157378_10004257 | |||
| 2172 | Ga0163162_10000737 | |||
| 2173 | Ga0163162_10028226 | |||
| 2174 | Ga0163162_10111392 | |||
| 2175 | Ga0163162_10120879 | |||
| 2176 | Ga0163162_10313256 | |||
| 2177 | Ga0157372_10001529 | |||
| 2178 | Ga0157372_10005514 | |||
| 2179 | Ga0157372_10009617 | |||
| 2180 | Ga0157372_10038144 | |||
| 2181 | Ga0157375_10001875 | |||
| 2182 | Ga0157375_10172300 | |||
| 2183 | Ga0157375_10259389 | |||
| 2184 | Ga0182008_10000203 | |||
| 2185 | Ga0182008_10001562 | |||
| 2186 | Ga0182008_10002570 | |||
| 2187 | Ga0182008_10003277 | |||
| 2188 | Ga0182008_10009036 | |||
| 2189 | Ga0182008_10048080 | |||
| 2190 | Ga0182008_10061975 | |||
| 2191 | Ga0157379_10000183 | |||
| 2192 | Ga0157376_10026443 | |||
| 2193 | Ga0182006_1000002 | |||
| 2194 | Ga0182006_1000009 | |||
| 2195 | Ga0182006_1000021 | |||
| 2196 | Ga0182006_1000380 | |||
| 2197 | Ga0182006_1001000 | |||
| 2198 | Ga0182006_1004320 | |||
| 2199 | Ga0182006_1004510 | |||
| 2200 | Ga0182006_1006485 | |||
| 2201 | Ga0182006_1008456 | |||
| 2202 | Ga0182006_1008677 | |||
| 2203 | Ga0182006_1011832 | |||
| 2204 | Ga0182006_1022085 | |||
| 2205 | Ga0182006_1030459 | |||
| 2206 | Ga0182005_1000013 | |||
| 2207 | Ga0182005_1000070 | |||
| 2208 | Ga0182005_1000227 | |||
| 2209 | Ga0182005_1004756 | |||
| 2210 | Ga0182005_1012826 | |||
| 2211 | Ga0182005_1014570 | |||
| 2212 | Ga0163161_10000107 | |||
| 2213 | Ga0163161_10000719 | |||
| 2214 | Ga0163161_10005392 | |||
| 2215 | Ga0163161_10018069 | |||
| 2216 | Ga0163161_10026492 | |||
| 2217 | Ga0163161_10040439 | |||
| 2218 | Ga0163161_10096785 | |||
| 2219 | Ga0213872_10000840 | |||
| 2220 | Ga0213876_10000660 | |||
| 2221 | Ga0213876_10013285 | |||
| 2222 | Ga0209435_100021 | |||
| 2223 | Ga0209435_100318 | |||
| 2224 | Ga0209760_100005 | |||
| 2225 | Ga0209760_100037 | |||
| 2226 | Ga0209760_100128 | |||
| 2227 | Ga0209436_100063 | |||
| 2228 | Ga0209436_100337 | |||
| 2229 | Ga0209784_100001 | |||
| 2230 | Ga0209784_100004 | |||
| 2231 | Ga0209784_100009 | |||
| 2232 | Ga0209784_100028 | |||
| 2233 | Ga0209566_100001 | |||
| 2234 | Ga0209566_100004 | |||
| 2235 | Ga0209566_100007 | |||
| 2236 | Ga0209566_100028 | |||
| 2237 | Ga0209674_100002 | |||
| 2238 | Ga0209674_100006 | |||
| 2239 | Ga0209674_100007 | |||
| 2240 | Ga0209674_100018 | |||
| 2241 | Ga0209674_100047 | |||
| 2242 | Ga0209672_104838 | |||
| 2243 | Ga0209147_100004 | |||
| 2244 | Ga0209147_100031 | |||
| 2245 | Ga0209563_100002 | |||
| 2246 | Ga0209563_100009 | |||
| 2247 | Ga0209563_100014 | |||
| 2248 | Ga0209563_100020 | |||
| 2249 | Ga0209563_100050 | |||
| 2250 | Ga0209563_100052 | |||
| 2251 | Ga0209563_102415 | |||
| 2252 | Ga0207427_100009 | |||
| 2253 | Ga0207427_100014 | |||
| 2254 | Ga0207427_100016 | |||
| 2255 | Ga0207427_100851 | |||
| 2256 | Ga0209437_100001 | |||
| 2257 | Ga0209437_100004 | |||
| 2258 | Ga0209437_100011 | |||
| 2259 | Ga0209437_100016 | |||
| 2260 | Ga0209437_100035 | |||
| 2261 | Ga0209437_100045 | |||
| 2262 | Ga0209437_103337 | |||
| 2263 | Ga0209437_104234 | |||
| 2264 | Ga0209258_100083 | |||
| 2265 | Ga0209258_100150 | |||
| 2266 | Ga0209258_100534 | |||
| 2267 | Ga0207425_1000001 | |||
| 2268 | Ga0207425_1000048 | |||
| 2269 | Ga0207425_1000484 | |||
| 2270 | Ga0209646_1000010 | |||
| 2271 | Ga0209646_1000020 | |||
| 2272 | Ga0209646_1000074 | |||
| 2273 | Ga0209646_1000094 | |||
| 2274 | Ga0209646_1000183 | |||
| 2275 | Ga0209026_1000009 | |||
| 2276 | Ga0209026_1000058 | |||
| 2277 | Ga0209677_100002 | |||
| 2278 | Ga0209677_100005 | |||
| 2279 | Ga0209677_100010 | |||
| 2280 | Ga0209677_100015 | |||
| 2281 | Ga0209677_100029 | |||
| 2282 | Ga0209677_100097 | |||
| 2283 | Ga0209677_101137 | |||
| 2284 | Ga0209759_1000046 | |||
| 2285 | Ga0209759_1000065 | |||
| 2286 | Ga0209759_1000073 | |||
| 2287 | Ga0209129_1000001 | |||
| 2288 | Ga0209129_1002226 | |||
| 2289 | Ga0209233_1000005 | |||
| 2290 | Ga0209233_1000019 | |||
| 2291 | Ga0209233_1000036 | |||
| 2292 | Ga0209233_1000634 | |||
| 2293 | Ga0209565_1003393 | |||
| 2294 | Ga0209565_1003550 | |||
| 2295 | Ga0209565_1004335 | |||
| 2296 | Ga0209565_1008440 | |||
| 2297 | Ga0209455_1001956 | |||
| 2298 | Ga0209130_1000059 | |||
| 2299 | Ga0209130_1003699 | |||
| 2300 | Ga0209130_1009134 | |||
| 2301 | Ga0209675_1004660 | |||
| 2302 | Ga0209676_1000025 | |||
| 2303 | Ga0209676_1000026 | |||
| 2304 | Ga0209676_1000032 | |||
| 2305 | Ga0209676_1000318 | |||
| 2306 | Ga0209676_1009868 | |||
| 2307 | Ga0209025_1002077 | |||
| 2308 | Ga0209564_1000009 | |||
| 2309 | Ga0209564_1000045 | |||
| 2310 | Ga0209564_1000219 | |||
| 2311 | Ga0209564_1004579 | |||
| 2312 | Ga0209758_1000166 | |||
| 2313 | Ga0209758_1000489 | |||
| 2314 | Ga0209050_1000025 | |||
| 2315 | Ga0209050_1000058 | |||
| 2316 | Ga0209050_1000331 | |||
| 2317 | Ga0209050_1000398 | |||
| 2318 | Ga0209050_1000520 | |||
| 2319 | Ga0209050_1001196 | |||
| 2320 | Ga0209050_1003847 | |||
| 2321 | Ga0209256_1000350 | |||
| 2322 | Ga0209256_1001089 | |||
| 2323 | Ga0207426_1001606 | |||
| 2324 | Ga0209051_1000026 | |||
| 2325 | Ga0209051_1000299 | |||
| 2326 | Ga0209051_1009700 | |||
| 2327 | Ga0209051_1012533 | |||
| 2328 | Ga0209051_1016351 | |||
| 2329 | Ga0209257_1000003 | |||
| 2330 | Ga0209257_1000034 | |||
| 2331 | Ga0209257_1001074 | |||
| 2332 | Ga0207697_10015082 | |||
| 2333 | Ga0207696_1000020 | |||
| 2334 | Ga0207696_1000033 | |||
| 2335 | Ga0207696_1000040 | |||
| 2336 | Ga0207696_1000057 | |||
| 2337 | Ga0207696_1000070 | |||
| 2338 | Ga0207696_1000084 | |||
| 2339 | Ga0207696_1000114 | |||
| 2340 | Ga0207696_1000482 | |||
| 2341 | Ga0207696_1000553 | |||
| 2342 | Ga0207696_1000679 | |||
| 2343 | Ga0207696_1000885 | |||
| 2344 | Ga0207696_1002459 | |||
| 2345 | Ga0207696_1002728 | |||
| 2346 | Ga0207696_1017321 | |||
| 2347 | Ga0207655_1000014 | |||
| 2348 | Ga0207655_1000040 | |||
| 2349 | Ga0207655_1000043 | |||
| 2350 | Ga0207655_1000046 | |||
| 2351 | Ga0207655_1000082 | |||
| 2352 | Ga0207655_1000326 | |||
| 2353 | Ga0207655_1000405 | |||
| 2354 | Ga0207655_1000683 | |||
| 2355 | Ga0207655_1000935 | |||
| 2356 | Ga0207655_1002391 | |||
| 2357 | Ga0207655_1002944 | |||
| 2358 | Ga0207655_1003197 | |||
| 2359 | Ga0207655_1005952 | |||
| 2360 | Ga0207655_1006383 | |||
| 2361 | Ga0207655_1013293 | |||
| 2362 | Ga0207655_1013387 | |||
| 2363 | Ga0207655_1013571 | |||
| 2364 | Ga0207655_1022358 | |||
| 2365 | Ga0207655_1022931 | |||
| 2366 | Ga0207655_1045584 | |||
| 2367 | Ga0207713_1000001 | |||
| 2368 | Ga0207713_1000017 | |||
| 2369 | Ga0207713_1000031 | |||
| 2370 | Ga0207713_1000065 | |||
| 2371 | Ga0207713_1000114 | |||
| 2372 | Ga0207713_1000331 | |||
| 2373 | Ga0207713_1000434 | |||
| 2374 | Ga0207713_1000632 | |||
| 2375 | Ga0207713_1001357 | |||
| 2376 | Ga0207713_1001639 | |||
| 2377 | Ga0207713_1002107 | |||
| 2378 | Ga0207713_1019084 | |||
| 2379 | Ga0207713_1019183 | |||
| 2380 | Ga0207713_1021830 | |||
| 2381 | Ga0207692_10100118 | |||
| 2382 | Ga0207710_10000016 | |||
| 2383 | Ga0207647_10000342 | |||
| 2384 | Ga0207705_10144152 | |||
| 2385 | Ga0207684_10117411 | |||
| 2386 | Ga0207654_10000006 | |||
| 2387 | Ga0207654_10011436 | |||
| 2388 | Ga0207695_10002480 | |||
| 2389 | Ga0207695_10003589 | |||
| 2390 | Ga0207695_10006850 | |||
| 2391 | Ga0207695_10074976 | |||
| 2392 | Ga0207671_10000015 | |||
| 2393 | Ga0207671_10016677 | |||
| 2394 | Ga0207663_10044006 | |||
| 2395 | Ga0207657_10007271 | |||
| 2396 | Ga0207657_10103833 | |||
| 2397 | Ga0207649_10000001 | |||
| 2398 | Ga0207649_10002460 | |||
| 2399 | Ga0207681_10000236 | |||
| 2400 | Ga0207681_10047262 | |||
| 2401 | Ga0207694_10000315 | |||
| 2402 | Ga0207694_10246888 | |||
| 2403 | Ga0207650_10000273 | |||
| 2404 | Ga0207650_10000449 | |||
| 2405 | Ga0207659_10048719 | |||
| 2406 | Ga0207664_10005354 | |||
| 2407 | Ga0207690_10004543 | |||
| 2408 | Ga0207690_10005500 | |||
| 2409 | Ga0207690_10014280 | |||
| 2410 | Ga0207706_10000069 | |||
| 2411 | Ga0207706_10000936 | |||
| 2412 | Ga0207686_10006292 | |||
| 2413 | Ga0207709_10000022 | |||
| 2414 | Ga0207709_10000164 | |||
| 2415 | Ga0207709_10000484 | |||
| 2416 | Ga0207709_10000505 | |||
| 2417 | Ga0207709_10027046 | |||
| 2418 | Ga0207709_10038884 | |||
| 2419 | Ga0207709_10068927 | |||
| 2420 | Ga0207709_10155160 | |||
| 2421 | Ga0207691_10118786 | |||
| 2422 | Ga0207711_10021445 | |||
| 2423 | Ga0207711_10107701 | |||
| 2424 | Ga0207679_10000011 | |||
| 2425 | Ga0207679_10001201 | |||
| 2426 | Ga0207679_10044762 | |||
| 2427 | Ga0207679_10116154 | |||
| 2428 | Ga0207667_10000120 | |||
| 2429 | Ga0207667_10004008 | |||
| 2430 | Ga0207667_10015507 | |||
| 2431 | Ga0207651_10001180 | |||
| 2432 | Ga0207640_10012068 | |||
| 2433 | Ga0207640_10045798 | |||
| 2434 | Ga0207639_10001824 | |||
| 2435 | Ga0207678_10166436 | |||
| 2436 | Ga0207708_10124510 | |||
| 2437 | Ga0207702_10000610 | |||
| 2438 | Ga0207674_10000018 | |||
| 2439 | Ga0207674_10012892 | |||
| 2440 | Ga0207674_10173445 | |||
| 2441 | Ga0207675_100005379 | |||
| 2442 | Ga0207683_10137991 | |||
| 2443 | Ga0209281_1000008 | |||
| 2444 | Ga0209281_1000026 | |||
| 2445 | Ga0209281_1000031 | |||
| 2446 | Ga0209281_1000112 | |||
| 2447 | Ga0209281_1000162 | |||
| 2448 | Ga0209281_1000233 | |||
| 2449 | Ga0209281_1000248 | |||
| 2450 | Ga0209281_1000618 | |||
| 2451 | Ga0209281_1000832 | |||
| 2452 | Ga0209281_1000833 | |||
| 2453 | Ga0209281_1003539 | |||
| 2454 | Ga0209281_1004394 | |||
| 2455 | Ga0209281_1008543 | |||
| 2456 | Ga0209281_1012097 | |||
| 2457 | Ga0209371_1000027 | |||
| 2458 | Ga0209371_1000032 | |||
| 2459 | Ga0209371_1000092 | |||
| 2460 | Ga0209371_1000167 | |||
| 2461 | Ga0209371_1000266 | |||
| 2462 | Ga0209371_1000388 | |||
| 2463 | Ga0209371_1001638 | |||
| 2464 | Ga0209371_1017903 | |||
| 2465 | Ga0210002_1007854 | |||
| 2466 | Ga0209983_1000145 | |||
| 2467 | Ga0209974_10022065 | |||
| 2468 | Ga0207428_10036325 | |||
| 2469 | Ga0207428_10172221 | |||
| 2470 | Ga0268266_10000079 | |||
| 2471 | Ga0268266_10013364 | |||
| 2472 | Ga0268266_10065771 | |||
| 2473 | Ga0268266_10214035 | |||
| 2474 | Ga0268266_10240601 | |||
| 2475 | Ga0268265_10251337 | |||
| 2476 | Ga0268264_10100046 | |||
| 2477 | Ga0265334_10000500 | |||
| 2478 | Ga0265334_10005163 | |||
| 2479 | Ga0265334_10036366 | |||
| 2480 | Ga0265336_10000061 | |||
| 2481 | Ga0307517_10023043 | |||
| 2482 | Ga0265338_10003945 | |||
| 2483 | Ga0265324_10001696 | |||
| 2484 | Ga0268256_1000045 | |||
| 2485 | Ga0268256_1000050 | |||
| 2486 | Ga0268256_1000082 | |||
| 2487 | Ga0268256_1000124 | |||
| 2488 | Ga0268256_1000269 | |||
| 2489 | Ga0268256_1000750 | |||
| 2490 | Ga0268256_1001428 | |||
| 2491 | Ga0268256_1019975 | |||
| 2492 | Ga0307511_10002002 | |||
| 2493 | Ga0307511_10094074 | |||
| 2494 | Ga0316178_1026759 | |||
| 2495 | Ga0316181_1059262 | |||
| 2496 | Ga0265328_10003176 | |||
| 2497 | Ga0265327_10001649 | |||
| 2498 | Ga0307513_10002356 | |||
| 2499 | Ga0307513_10021955 | |||
| 2500 | Ga0307513_10109937 | |||
| 2501 | Ga0307509_10130334 | |||
| 2502 | Ga0307408_100000024 | |||
| 2503 | Ga0307408_100000181 | |||
| 2504 | Ga0307408_100000299 | |||
| 2505 | Ga0307408_100000786 | |||
| 2506 | Ga0307408_100024220 | |||
| 2507 | Ga0307408_100060212 | |||
| 2508 | Ga0307408_100063817 | |||
| 2509 | Ga0307514_10000643 | |||
| 2510 | Ga0316575_10000758 | |||
| 2511 | Ga0316576_10009330 | |||
| 2512 | Ga0316576_10011679 | |||
| 2513 | Ga0316578_10038352 | |||
| 2514 | Ga0316578_10064426 | |||
| 2515 | Ga0307516_10003778 | |||
| 2516 | Ga0307413_10063185 | |||
| 2517 | Ga0307410_10023799 | |||
| 2518 | Ga0307406_10000113 | |||
| 2519 | Ga0307412_10039050 | |||
| 2520 | Ga0307412_10121731 | |||
| 2521 | Ga0307409_100008148 | |||
| 2522 | Ga0307409_100065517 | |||
| 2523 | Ga0307409_100193004 | |||
| 2524 | Ga0307416_100001332 | |||
| 2525 | Ga0307416_100115749 | |||
| 2526 | Ga0307416_100125903 | |||
| 2527 | Ga0307411_10015387 | |||
| 2528 | Ga0307411_10018213 | |||
| 2529 | Ga0307411_10023151 | |||
| 2530 | Ga0307510_10001604 | |||
| 2531 | Ga0373943_0066733 | |||
| 2532 | Ga0316574_0000934 | |||
| 2533 | Ga0373935_0069580 | |||
| 2534 | Ga0373937_0023046 | |||
| 2535 | Ga0316584_0059505 | |||
| 2536 | Ga0316584_0207081 | |||
| 2537 | Ga0373925_0062659 | |||
| 2538 | Ga0395899_0004137 | |||
| 2539 | Ga0395899_0014968 | |||
| 2540 | Ga0395899_0067437 | |||
| 2541 | Ga0395900_0013133 | |||
| 2542 | Ga0395900_0092907 | |||
| 2543 | Ga0395900_0130360 | |||
| 2544 | Ga0395900_0168005 | |||
| 2545 | Ga0395898_0043252 | |||
| 2546 | Ga0395898_0140996 | |||
| 2547 | Ga0395898_0199964 | |||
| 2548 | Ga0395905_0024179 | |||
| 2549 | Ga0395905_0046172 | |||
| 2550 | Ga0395905_0119354 | |||
| 2551 | Ga0395905_0119887 | |||
| 2552 | Ga0395905_0156102 | |||
| 2553 | Ga0395901_0000033 | |||
| 2554 | Ga0395901_0004756 | |||
| 2555 | Ga0395901_0014131 | |||
| 2556 | Ga0395901_0049958 | |||
| 2557 | Ga0395901_0115919 | |||
| 2558 | Ga0436365_0743852 | |||
| 2559 | Ga0436361_0475217 | |||
| 2560 | Ga0436361_0941622 | |||
| 2561 | Ga0439438_000001 | |||
| 2562 | Ga0439438_000579 | |||
| 2563 | Ga0439438_003785 | |||
| 2564 | Ga0439447_000222 | |||
| 2565 | Ga0439447_021038 | |||
| 2566 | Ga0439447_025902 | |||
| 2567 | Ga0439466_0000003 | |||
| 2568 | Ga0439466_0008703 | |||
| 2569 | Ga0439466_0014344 | |||
| 2570 | Ga0439466_0021313 | |||
| 2571 | Ga0451807_1250449 | |||
| 2572 | Ga0451833_0043619 | |||
| 2573 | Ga0451853_3838449 | |||
| 2574 | Ga0439431_0005176 | |||
| 2575 | Ga0439437_001461 | |||
| 2576 | Ga0439448_0000301 | |||
| 2577 | Ga0439448_0037632 | |||
| 2578 | Ga0439432_000409 | |||
| 2579 | Ga0439432_002502 | |||
| 2580 | Ga0439432_003370 | |||
| 2581 | Ga0439432_018396 | |||
| 2582 | Ga0439432_040066 | |||
| 2583 | Ga0439449_0051331 | |||
| 2584 | Ga0439452_000010 | |||
| 2585 | Ga0439452_000039 | |||
| 2586 | Ga0439452_000212 | |||
| 2587 | Ga0439452_000227 | |||
| 2588 | Ga0439452_000231 | |||
| 2589 | Ga0439452_000245 | |||
| 2590 | Ga0439452_000977 | |||
| 2591 | Ga0439452_009132 | |||
| 2592 | Ga0450911_000018 | |||
| 2593 | Ga0450911_000158 | |||
| 2594 | Ga0450911_002722 | |||
| 2595 | Ga0450920_001399 | |||
| 2596 | Ga0450891_002871 | |||
| 2597 | Ga0450902_000315 | |||
| 2598 | Ga0450904_000622 | |||
| 2599 | Ga0450906_002414 | |||
| 2600 | Ga0450907_000206 | |||
| 2601 | Ga0450908_009773 | |||
| 2602 | Ga0450909_002236 | |||
| 2603 | Ga0439434_0000122 | |||
| 2604 | Ga0439464_0000216 | |||
| 2605 | Ga0439464_0002678 | |||
| 2606 | Ga0439464_0006312 | |||
| 2607 | Ga0450893_0002000 | |||
| 2608 | Ga0450901_000195 | |||
| 2609 | Ga0451577_0000137 | |||
| 2610 | Ga0451577_0000162 | |||
| 2611 | Ga0451577_0001379 | |||
| 2612 | Ga0451577_0004703 | |||
| 2613 | Ga0451577_0175850 | |||
| 2614 | Ga0453683_0000766 | |||
| 2615 | Ga0466965_0015129 | |||
| 2616 | Ga0466961_0116641 | |||
| 2617 | Ga0466964_0006082 | |||
| 2618 | Ga0453684_0000014 | |||
| 2619 | Ga0453684_0000377 | |||
| 2620 | Ga0453684_0000384 | |||
| 2621 | Ga0453684_0000524 | |||
| 2622 | Ga0453684_0001213 | |||
| 2623 | Ga0453684_0002367 | |||
| 2624 | Ga0453684_0003729 | |||
| 2625 | Ga0453684_0004733 | |||
| 2626 | Ga0453684_0069376 | |||
| 2627 | Ga0453684_0158496 | |||
| 2628 | Ga0466957_0001593 | |||
| 2629 | Ga0466957_0029147 | |||
| 2630 | Ga0466960_0034067 | |||
| 2631 | Ga0451576_0000033 | |||
| 2632 | Ga0451576_0000169 | |||
| 2633 | Ga0451576_0001166 | |||
| 2634 | Ga0451576_0112608 | |||
| 2635 | Ga0451576_0225830 | |||
| 2636 | Ga0466958_0108320 | |||
| 2637 | Ga0495617_000136 | |||
| 2638 | Ga0495617_003902 | |||
| 2639 | Ga0495617_003925 | |||
| 2640 | Ga0495617_007971 | |||
| 2641 | Ga0495617_009658 | |||
| 2642 | Ga0495617_023089 | |||
| 2643 | Ga0495627_000023 | |||
| 2644 | Ga0495627_000194 | |||
| 2645 | Ga0495627_000700 | |||
| 2646 | Ga0495627_001188 | |||
| 2647 | Ga0495627_003088 | |||
| 2648 | Ga0495627_016887 | |||
| 2649 | Ga0495592_0013806 | |||
| 2650 | Ga0495603_0005812 | |||
| 2651 | Ga0495590_0000003 | |||
| 2652 | Ga0495590_0002491 | |||
| 2653 | Ga0495590_0003931 | |||
| 2654 | Ga0495590_0004480 | |||
| 2655 | Ga0495590_0007145 | |||
| 2656 | Ga0495591_000014 | |||
| 2657 | Ga0495591_000025 | |||
| 2658 | Ga0495591_000029 | |||
| 2659 | Ga0495591_000244 | |||
| 2660 | Ga0495591_000717 | |||
| 2661 | Ga0495591_001158 | |||
| 2662 | Ga0495591_001191 | |||
| 2663 | Ga0495591_001492 | |||
| 2664 | Ga0495591_001672 | |||
| 2665 | Ga0495591_001689 | |||
| 2666 | Ga0495591_006448 | |||
| 2667 | Ga0495591_007569 | |||
| 2668 | Ga0495591_009001 | |||
| 2669 | Ga0495591_009994 | |||
| 2670 | Ga0495591_017937 | |||
| 2671 | Ga0495629_0052049 | |||
| 2672 | Ga0495638_0000091 | |||
| 2673 | Ga0495638_0001218 | |||
| 2674 | Ga0495638_0001551 | |||
| 2675 | Ga0495638_0004653 | |||
| 2676 | Ga0495638_0006661 | |||
| 2677 | Ga0495638_0013609 | |||
| 2678 | Ga0495638_0076050 | |||
| 2679 | Ga0495651_0081988 | |||
| 2680 | Ga0495653_0000549 | |||
| 2681 | Ga0495653_0004499 | |||
| 2682 | Ga0495653_0006284 | |||
| 2683 | Ga0495653_0011868 | |||
| 2684 | Ga0495653_0062377 | |||
| 2685 | Ga0495650_0000032 | |||
| 2686 | Ga0495650_0000097 | |||
| 2687 | Ga0495650_0000103 | |||
| 2688 | Ga0495650_0000386 | |||
| 2689 | Ga0495650_0001058 | |||
| 2690 | Ga0495650_0001865 | |||
| 2691 | Ga0495650_0006713 | |||
| 2692 | Ga0495650_0007354 | |||
| 2693 | Ga0495650_0010356 | |||
| 2694 | Ga0495650_0011972 | |||
| 2695 | Ga0495650_0016850 | |||
| 2696 | Ga0495650_0017796 | |||
| 2697 | Ga0495580_0046926 | |||
| 2698 | Ga0495582_0000880 | |||
| 2699 | Ga0495582_0008606 | |||
| 2700 | Ga0495605_0000095 | |||
| 2701 | Ga0495605_0000237 | |||
| 2702 | Ga0495605_0000246 | |||
| 2703 | Ga0495605_0000251 | |||
| 2704 | Ga0495605_0000311 | |||
| 2705 | Ga0495605_0000328 | |||
| 2706 | Ga0495605_0000673 | |||
| 2707 | Ga0495605_0000878 | |||
| 2708 | Ga0495605_0001867 | |||
| 2709 | Ga0495605_0003763 | |||
| 2710 | Ga0495605_0004933 | |||
| 2711 | Ga0495605_0007006 | |||
| 2712 | Ga0495605_0008057 | |||
| 2713 | Ga0495605_0016771 | |||
| 2714 | Ga0495605_0060012 | |||
| 2715 | Ga0495605_0106440 | |||
| 2716 | Ga0495639_0010865 | |||
| 2717 | Ga0495584_0000695 | |||
| 2718 | Ga0495584_0001738 | |||
| 2719 | Ga0495584_0002471 | |||
| 2720 | Ga0495584_0011709 | |||
| 2721 | Ga0495584_0026343 | |||
| 2722 | Ga0495584_0030102 | |||
| 2723 | Ga0495584_0031955 | |||
| 2724 | Ga0495585_0000005 | |||
| 2725 | Ga0495585_0000279 | |||
| 2726 | Ga0495585_0000790 | |||
| 2727 | Ga0495585_0001195 | |||
| 2728 | Ga0495585_0002554 | |||
| 2729 | Ga0495585_0004763 | |||
| 2730 | Ga0495585_0005582 | |||
| 2731 | Ga0495585_0008791 | |||
| 2732 | Ga0495585_0022472 | |||
| 2733 | Ga0495585_0024974 | |||
| 2734 | Ga0495585_0031614 | |||
| 2735 | Ga0495585_0050086 | |||
| 2736 | Ga0495585_0074612 | |||
| 2737 | Ga0495594_0006507 | |||
| 2738 | Ga0495594_0006764 | |||
| 2739 | Ga0495594_0008636 | |||
| 2740 | Ga0495594_0063337 | |||
| 2741 | Ga0495596_0001177 | |||
| 2742 | Ga0495596_0001477 | |||
| 2743 | Ga0495596_0006433 | |||
| 2744 | Ga0495596_0016068 | |||
| 2745 | Ga0495596_0016079 | |||
| 2746 | Ga0495607_0000181 | |||
| 2747 | Ga0495607_0000347 | |||
| 2748 | Ga0495607_0000552 | |||
| 2749 | Ga0495607_0000776 | |||
| 2750 | Ga0495607_0001128 | |||
| 2751 | Ga0495607_0001875 | |||
| 2752 | Ga0495607_0002014 | |||
| 2753 | Ga0495607_0003010 | |||
| 2754 | Ga0495607_0006297 | |||
| 2755 | Ga0495607_0007143 | |||
| 2756 | Ga0495607_0008065 | |||
| 2757 | Ga0495607_0011290 | |||
| 2758 | Ga0495607_0012842 | |||
| 2759 | Ga0495607_0017978 | |||
| 2760 | Ga0495607_0024174 | |||
| 2761 | Ga0495607_0026649 | |||
| 2762 | Ga0495607_0031719 | |||
| 2763 | Ga0495583_0000015 | |||
| 2764 | Ga0495583_0000060 | |||
| 2765 | Ga0495583_0000062 | |||
| 2766 | Ga0495583_0000155 | |||
| 2767 | Ga0495583_0000197 | |||
| 2768 | Ga0495583_0000756 | |||
| 2769 | Ga0495583_0001189 | |||
| 2770 | Ga0495583_0001231 | |||
| 2771 | Ga0495583_0001514 | |||
| 2772 | Ga0495583_0001852 | |||
| 2773 | Ga0495583_0003070 | |||
| 2774 | Ga0495583_0003993 | |||
| 2775 | Ga0495606_0000068 | |||
| 2776 | Ga0495606_0000141 | |||
| 2777 | Ga0495606_0000177 | |||
| 2778 | Ga0495606_0000214 | |||
| 2779 | Ga0495606_0000266 | |||
| 2780 | Ga0495606_0000371 | |||
| 2781 | Ga0495606_0000461 | |||
| 2782 | Ga0495606_0000696 | |||
| 2783 | Ga0495606_0000843 | |||
| 2784 | Ga0495606_0002268 | |||
| 2785 | Ga0495606_0002328 | |||
| 2786 | Ga0495606_0003165 | |||
| 2787 | Ga0495606_0004642 | |||
| 2788 | Ga0495606_0007052 | |||
| 2789 | Ga0495606_0016853 | |||
| 2790 | Ga0495606_0056002 | |||
| 2791 | Ga0495608_0018979 | |||
| 2792 | Ga0495610_0000003 | |||
| 2793 | Ga0495610_0001476 | |||
| 2794 | Ga0495610_0003651 | |||
| 2795 | Ga0495610_0009810 | |||
| 2796 | Ga0495610_0010298 | |||
| 2797 | Ga0495610_0014621 | |||
| 2798 | Ga0495610_0015071 | |||
| 2799 | Ga0495610_0025482 | |||
| 2800 | Ga0495616_0000184 | |||
| 2801 | Ga0495616_0001441 | |||
| 2802 | Ga0495616_0004461 | |||
| 2803 | Ga0495616_0005947 | |||
| 2804 | Ga0495616_0008293 | |||
| 2805 | Ga0495616_0009974 | |||
| 2806 | Ga0495616_0014276 | |||
| 2807 | Ga0495616_0017305 | |||
| 2808 | Ga0495616_0019028 | |||
| 2809 | Ga0495616_0038840 | |||
| 2810 | Ga0495618_0011571 | |||
| 2811 | Ga0495618_0102076 | |||
| 2812 | Ga0495620_0000042 | |||
| 2813 | Ga0495620_0000456 | |||
| 2814 | Ga0495620_0001496 | |||
| 2815 | Ga0495620_0002041 | |||
| 2816 | Ga0495620_0004368 | |||
| 2817 | Ga0495620_0006298 | |||
| 2818 | Ga0495620_0045501 | |||
| 2819 | Ga0495628_0070535 | |||
| 2820 | Ga0495630_0025997 | |||
| 2821 | Ga0495630_0129753 | |||
| 2822 | Ga0495631_0000722 | |||
| 2823 | Ga0495631_0000794 | |||
| 2824 | Ga0495631_0004320 | |||
| 2825 | Ga0495631_0004837 | |||
| 2826 | Ga0495631_0026043 | |||
| 2827 | Ga0495631_0062453 | |||
| 2828 | Ga0495632_0000573 | |||
| 2829 | Ga0495632_0001250 | |||
| 2830 | Ga0495632_0001313 | |||
| 2831 | Ga0495632_0001532 | |||
| 2832 | Ga0495632_0009908 | |||
| 2833 | Ga0495632_0025653 | |||
| 2834 | Ga0495632_0057255 | |||
| 2835 | Ga0495637_0000020 | |||
| 2836 | Ga0495637_0000087 | |||
| 2837 | Ga0495637_0000260 | |||
| 2838 | Ga0495637_0000848 | |||
| 2839 | Ga0495637_0002194 | |||
| 2840 | Ga0495637_0002273 | |||
| 2841 | Ga0495637_0002495 | |||
| 2842 | Ga0495637_0005014 | |||
| 2843 | Ga0495637_0010737 | |||
| 2844 | Ga0495637_0045902 | |||
| 2845 | Ga0495643_0000179 | |||
| 2846 | Ga0495643_0000287 | |||
| 2847 | Ga0495643_0000411 | |||
| 2848 | Ga0495643_0000585 | |||
| 2849 | Ga0495643_0001628 | |||
| 2850 | Ga0495643_0002022 | |||
| 2851 | Ga0495643_0011258 | |||
| 2852 | Ga0495643_0015794 | |||
| 2853 | Ga0495643_0055851 | |||
| 2854 | Ga0495644_0000218 | |||
| 2855 | Ga0495644_0000952 | |||
| 2856 | Ga0495644_0002342 | |||
| 2857 | Ga0495644_0003908 | |||
| 2858 | Ga0495644_0005160 | |||
| 2859 | Ga0495644_0014154 | |||
| 2860 | Ga0495644_0015839 | |||
| 2861 | Ga0495644_0020449 | |||
| 2862 | Ga0495644_0028708 | |||
| 2863 | Ga0495644_0032761 | |||
| 2864 | Ga0495648_0000058 | |||
| 2865 | Ga0495648_0000076 | |||
| 2866 | Ga0495648_0000299 | |||
| 2867 | Ga0495648_0001064 | |||
| 2868 | Ga0495648_0002580 | |||
| 2869 | Ga0495648_0009200 | |||
| 2870 | Ga0495648_0010573 | |||
| 2871 | Ga0495648_0012123 | |||
| 2872 | Ga0495648_0016557 | |||
| 2873 | Ga0495648_0023158 | |||
| 2874 | Ga0495648_0032542 | |||
| 2875 | Ga0495648_0042121 | |||
| 2876 | Ga0495648_0046654 | |||
| 2877 | Ga0495648_0111533 | |||
| 2878 | Ga0495666_0000514 | |||
| 2879 | Ga0495666_0007844 | |||
| 2880 | Ga0495666_0039645 | |||
| 2881 | Ga0495666_0043376 | |||
| 2882 | Ga0495642_0000088 | |||
| 2883 | Ga0495642_0000223 | |||
| 2884 | Ga0495642_0000463 | |||
| 2885 | Ga0495642_0006585 | |||
| 2886 | Ga0495642_0038639 | |||
| 2887 | Ga0495652_0038065 | |||
| 2888 | Ga0495652_0131616 | |||
| 2889 | Ga0495654_0000019 | |||
| 2890 | Ga0495654_0000074 | |||
| 2891 | Ga0495654_0000451 | |||
| 2892 | Ga0495654_0000985 | |||
| 2893 | Ga0495654_0001089 | |||
| 2894 | Ga0495654_0001254 | |||
| 2895 | Ga0495654_0001271 | |||
| 2896 | Ga0495654_0004701 | |||
| 2897 | Ga0495654_0006622 | |||
| 2898 | Ga0495654_0011325 | |||
| 2899 | Ga0495654_0017372 | |||
| 2900 | Ga0495654_0018225 | |||
| 2901 | Ga0495654_0054647 | |||
| 2902 | Ga0495640_0065769 | |||
| 2903 | Ga0495586_0031574 | |||
| 2904 | Ga0495587_0065213 | |||
| 2905 | Ga0495609_0000039 | |||
| 2906 | Ga0495609_0000053 | |||
| 2907 | Ga0495609_0000102 | |||
| 2908 | Ga0495609_0000685 | |||
| 2909 | Ga0495609_0001189 | |||
| 2910 | Ga0495609_0003042 | |||
| 2911 | Ga0495609_0029907 | |||
| 2912 | Ga0495597_0000153 | |||
| 2913 | Ga0495597_0000186 | |||
| 2914 | Ga0495597_0000209 | |||
| 2915 | Ga0495597_0000242 | |||
| 2916 | Ga0495597_0000537 | |||
| 2917 | Ga0495597_0000808 | |||
| 2918 | Ga0495597_0002455 | |||
| 2919 | Ga0495597_0033447 | |||
| 2920 | Ga0495597_0035248 | |||
| 2921 | Ga0495597_0062226 | |||
| 2922 | Ga0495597_0074476 | |||
| 2923 | Ga0495645_0009101 | |||
| 2924 | Ga0495645_0031956 | |||
| 2925 | Ga0495645_0159292 | |||
| 2926 | Ga0495622_0000054 | |||
| 2927 | Ga0495622_0000468 | |||
| 2928 | Ga0495622_0000584 | |||
| 2929 | Ga0495622_0002858 | |||
| 2930 | Ga0495622_0009925 | |||
| 2931 | Ga0495633_0000119 | |||
| 2932 | Ga0495633_0000249 | |||
| 2933 | Ga0495633_0000366 | |||
| 2934 | Ga0495633_0001297 | |||
| 2935 | Ga0495633_0002317 | |||
| 2936 | Ga0495633_0004532 | |||
| 2937 | Ga0495633_0009262 | |||
| 2938 | Ga0495633_0011956 | |||
| 2939 | Ga0495633_0025940 | |||
| 2940 | Ga0495633_0075050 | |||
| 2941 | Ga0495667_0055871 | |||
| 2942 | Ga0495667_0114760 | |||
| 2943 | Ga0495656_0030753 | |||
| 2944 | Ga0495668_0000337 | |||
| 2945 | Ga0495668_0000466 | |||
| 2946 | Ga0495668_0000866 | |||
| 2947 | Ga0495668_0015652 | |||
| 2948 | Ga0495668_0024652 | |||
| 2949 | Ga0495668_0080776 | |||
| 2950 | Ga0495634_0001452 | |||
| 2951 | Ga0495634_0040408 | |||
| 2952 | Ga0495611_0000386 | |||
| 2953 | Ga0495611_0000546 | |||
| 2954 | Ga0495611_0002380 | |||
| 2955 | Ga0495611_0004289 | |||
| 2956 | Ga0495611_0005319 | |||
| 2957 | Ga0495611_0023655 | |||
| 2958 | Ga0495611_0096133 | |||
| 2959 | Ga0495625_0000086 | |||
| 2960 | Ga0495625_0000132 | |||
| 2961 | Ga0495625_0000139 | |||
| 2962 | Ga0495625_0001396 | |||
| 2963 | Ga0495625_0002129 | |||
| 2964 | Ga0495625_0002623 | |||
| 2965 | Ga0495625_0003090 | |||
| 2966 | Ga0495625_0003498 | |||
| 2967 | Ga0495625_0003977 | |||
| 2968 | Ga0495625_0010314 | |||
| 2969 | Ga0495625_0010440 | |||
| 2970 | Ga0495625_0013007 | |||
| 2971 | Ga0495625_0028160 | |||
| 2972 | Ga0495625_0048669 | |||
| 2973 | Ga0495625_0072932 | |||
| 2974 | Ga0495635_0010447 | |||
| 2975 | Ga0495635_0066463 | |||
| 2976 | Ga0495659_0000684 | |||
| 2977 | Ga0495659_0001118 | |||
| 2978 | Ga0495661_0000048 | |||
| 2979 | Ga0495661_0000058 | |||
| 2980 | Ga0495661_0000094 | |||
| 2981 | Ga0495661_0000131 | |||
| 2982 | Ga0495661_0000171 | |||
| 2983 | Ga0495661_0001840 | |||
| 2984 | Ga0495661_0002376 | |||
| 2985 | Ga0495661_0008362 | |||
| 2986 | Ga0495661_0011367 | |||
| 2987 | Ga0495661_0017452 | |||
| 2988 | Ga0495661_0022149 | |||
| 2989 | Ga0495661_0027405 | |||
| 2990 | Ga0495661_0035739 | |||
| 2991 | Ga0495661_0036819 | |||
| 2992 | Ga0495661_0039514 | |||
| 2993 | Ga0495661_0072285 | |||
| 2994 | Ga0495661_0077161 | |||
| 2995 | Ga0495588_0000110 | |||
| 2996 | Ga0495588_0004605 | |||
| 2997 | Ga0495588_0026084 | |||
| 2998 | Ga0495599_0000399 | |||
| 2999 | Ga0495599_0004483 | |||
| 3000 | Ga0495623_0005943 | |||
| 3001 | Ga0495623_0006642 | |||
| 3002 | Ga0495623_0066232 | |||
| 3003 | Ga0495646_0000446 | |||
| 3004 | Ga0495646_0024671 | |||
| 3005 | Ga0495669_0000041 | |||
| 3006 | Ga0495669_0026695 | |||
| 3007 | Ga0495669_0080805 | |||
| 3008 | Ga0495613_0092878 | |||
| 3009 | Ga0495624_0001848 | |||
| 3010 | Ga0495670_0000302 | |||
| 3011 | Ga0495670_0002252 | |||
| 3012 | Ga0495670_0005988 | |||
| 3013 | Ga0495670_0006106 | |||
| 3014 | Ga0495670_0007946 | |||
| 3015 | Ga0495670_0011561 | |||
| 3016 | Ga0495671_0000157 | |||
| 3017 | Ga0495671_0000582 | |||
| 3018 | Ga0495671_0000796 | |||
| 3019 | Ga0495671_0001635 | |||
| 3020 | Ga0495671_0003155 | |||
| 3021 | Ga0495671_0005078 | |||
| 3022 | Ga0495671_0008993 | |||
| 3023 | Ga0495671_0012930 | |||
| 3024 | Ga0495671_0017322 | |||
| 3025 | Ga0495671_0032264 | |||
| 3026 | Ga0495649_0000049 | |||
| 3027 | Ga0495649_0000510 | |||
| 3028 | Ga0495649_0000847 | |||
| 3029 | Ga0495649_0000965 | |||
| 3030 | Ga0495649_0003527 | |||
| 3031 | Ga0495649_0003587 | |||
| 3032 | Ga0495649_0005204 | |||
| 3033 | Ga0495649_0010593 | |||
| 3034 | Ga0495649_0013796 | |||
| 3035 | Ga0495649_0036011 | |||
| 3036 | Ga0495649_0066360 | |||
| 3037 | Ga0495649_0088894 | |||
| 3038 | Ga0495649_0120197 | |||
| 3039 | Ga0495589_0000006 | |||
| 3040 | Ga0495589_0000019 | |||
| 3041 | Ga0495589_0000445 | |||
| 3042 | Ga0495589_0000647 | |||
| 3043 | Ga0495589_0000866 | |||
| 3044 | Ga0495589_0001426 | |||
| 3045 | Ga0495589_0002079 | |||
| 3046 | Ga0495589_0003754 | |||
| 3047 | Ga0495589_0011721 | |||
| 3048 | Ga0495589_0017134 | |||
| 3049 | Ga0495589_0024381 | |||
| 3050 | Ga0495589_0050380 | |||
| 3051 | Ga0495600_0002038 | |||
| 3052 | Ga0495600_0100251 | |||
| 3053 | Ga0495660_0000021 | |||
| 3054 | Ga0495660_0000056 | |||
| 3055 | Ga0495660_0000168 | |||
| 3056 | Ga0495660_0000245 | |||
| 3057 | Ga0495660_0000608 | |||
| 3058 | Ga0495660_0005539 | |||
| 3059 | Ga0495660_0007449 | |||
| 3060 | Ga0495660_0009308 | |||
| 3061 | Ga0495660_0015517 | |||
| 3062 | Ga0495660_0016457 | |||
| 3063 | Ga0495660_0022873 | |||
| 3064 | Ga0495660_0073548 | |||
| 3065 | Ga0495581_0014620 | |||
| 3066 | Ga0495604_0014483 | |||
| 3067 | Ga0495604_0050582 | |||
| 3068 | Ga0495604_0101791 | |||
| 3069 | Ga0495636_0001360 | |||
| 3070 | Ga0495636_0001666 | |||
| 3071 | Ga0495636_0008015 | |||
| 3072 | Ga0495636_0014610 | |||
| 3073 | Ga0495674_0002066 | |||
| 3074 | Ga0495674_0085409 | |||
| 3075 | Ga0495672_0000002 | |||
| 3076 | Ga0495672_0000012 | |||
| 3077 | Ga0495672_0000020 | |||
| 3078 | Ga0495672_0000263 | |||
| 3079 | Ga0495672_0001472 | |||
| 3080 | Ga0495672_0002315 | |||
| 3081 | Ga0495672_0002439 | |||
| 3082 | Ga0495672_0003847 | |||
| 3083 | Ga0495672_0007415 | |||
| 3084 | Ga0495672_0010293 | |||
| 3085 | Ga0495672_0031579 | |||
| 3086 | Ga0495672_0058653 | |||
| 3087 | Ga0495672_0070641 | |||
| 3088 | Ga0495676_0000022 | |||
| 3089 | Ga0495676_0004002 | |||
| 3090 | Ga0495680_0037898 | |||
| 3091 | Ga0495680_0091818 | |||
| 3092 | Ga0495680_0103548 | |||
| 3093 | Ga0495680_0115054 | |||
| 3094 | Ga0495680_0124245 | |||
| 3095 | Ga0495683_0000030 | |||
| 3096 | Ga0495683_0000520 | |||
| 3097 | Ga0495683_0000927 | |||
| 3098 | Ga0495683_0003113 | |||
| 3099 | Ga0495683_0011966 | |||
| 3100 | Ga0495683_0019467 | |||
| 3101 | Ga0495683_0020424 | |||
| 3102 | Ga0495683_0024380 | |||
| 3103 | Ga0495683_0048266 | |||
| 3104 | Ga0495687_000059 | |||
| 3105 | Ga0495687_000296 | |||
| 3106 | Ga0495687_001460 | |||
| 3107 | Ga0495687_001591 | |||
| 3108 | Ga0495687_001767 | |||
| 3109 | Ga0495675_0074373 | |||
| 3110 | Ga0495677_0000006 | |||
| 3111 | Ga0495677_0000590 | |||
| 3112 | Ga0495677_0002558 | |||
| 3113 | Ga0495677_0003280 | |||
| 3114 | Ga0495677_0010069 | |||
| 3115 | Ga0495677_0025054 | |||
| 3116 | Ga0495677_0050358 | |||
| 3117 | Ga0495679_000020 | |||
| 3118 | Ga0495679_000218 | |||
| 3119 | Ga0495679_000494 | |||
| 3120 | Ga0495679_001364 | |||
| 3121 | Ga0495679_002504 | |||
| 3122 | Ga0495679_002509 | |||
| 3123 | Ga0495679_002913 | |||
| 3124 | Ga0495679_003549 | |||
| 3125 | Ga0495685_000416 | |||
| 3126 | Ga0495685_003595 | |||
| 3127 | Ga0495673_0000006 | |||
| 3128 | Ga0495673_0000024 | |||
| 3129 | Ga0495673_0000079 | |||
| 3130 | Ga0495673_0000544 | |||
| 3131 | Ga0495673_0001080 | |||
| 3132 | Ga0495673_0001326 | |||
| 3133 | Ga0495673_0002964 | |||
| 3134 | Ga0495673_0003791 | |||
| 3135 | Ga0495673_0004931 | |||
| 3136 | Ga0495673_0009417 | |||
| 3137 | Ga0495673_0011178 | |||
| 3138 | Ga0495673_0019270 | |||
| 3139 | Ga0495673_0024681 | |||
| 3140 | Ga0495681_0000351 | |||
| 3141 | Ga0495681_0000411 | |||
| 3142 | Ga0495681_0000534 | |||
| 3143 | Ga0495681_0001568 | |||
| 3144 | Ga0495681_0001787 | |||
| 3145 | Ga0495681_0003728 | |||
| 3146 | Ga0495681_0010655 | |||
| 3147 | Ga0495681_0019212 | |||
| 3148 | Ga0495681_0025685 | |||
| 3149 | Ga0495681_0057034 | |||
| 3150 | Ga0495681_0095140 | |||
| 3151 | Ga0495686_0000017 | |||
| 3152 | Ga0495686_0001364 | |||
| 3153 | Ga0495686_0003766 | |||
| 3154 | Ga0495686_0014853 | |||
| 3155 | Ga0495686_0015703 | |||
| 3156 | Ga0495686_0061115 | |||
| 3157 | Ga0495593_0014612 | |||
| 3158 | Ga0495593_0044222 | |||
| 3159 | Ga0495602_0040199 | |||
| 3160 | Ga0495614_0005763 | |||
| 3161 | Ga0495626_0000039 | |||
| 3162 | Ga0495626_0000103 | |||
| 3163 | Ga0495626_0000391 | |||
| 3164 | Ga0495626_0000494 | |||
| 3165 | Ga0495626_0000562 | |||
| 3166 | Ga0495626_0000711 | |||
| 3167 | Ga0495626_0002239 | |||
| 3168 | Ga0495626_0005483 | |||
| 3169 | Ga0495626_0029382 | |||
| 3170 | Ga0495626_0035165 | |||
| 3171 | Ga0495626_0039518 | |||
| 3172 | Ga0495626_0042079 | |||
| 3173 | Ga0496101_0000671 | |||
| 3174 | Ga0496102_0001161 | |||
| 3175 | Ga0496102_0008716 | |||
| 3176 | Ga0496102_0077507 | |||
| 3177 | Ga0496103_0000631 | |||
| 3178 | Ga0496103_0005456 | |||
| 3179 | Ga0496103_0128194 | |||
| 3180 | Ga0496104_0000119 | |||
| 3181 | Ga0496104_0002141 | |||
| 3182 | Ga0496104_0004930 | |||
| 3183 | Ga0496105_0006486 | |||
| 3184 | Ga0496105_0022243 | |||
| 3185 | Ga0496105_0035265 | |||
| 3186 | Ga0496105_0106492 | |||
| 3187 | Ga0496105_0120651 | |||
| 3188 | Ga0496106_0100961 | |||
| 3189 | Ga0496110_0035108 | |||
| 3190 | Ga0496114_0113188 | |||
| 3191 | Ga0496115_0012877 | |||
| 3192 | Ga0496116_0000031 | |||
| 3193 | Ga0496116_0000320 | |||
| 3194 | Ga0496116_0000376 | |||
| 3195 | Ga0496116_0000623 | |||
| 3196 | Ga0496116_0003799 | |||
| 3197 | Ga0496116_0005272 | |||
| 3198 | Ga0496116_0005434 | |||
| 3199 | Ga0496116_0005510 | |||
| 3200 | Ga0496116_0011980 | |||
| 3201 | Ga0496116_0017900 | |||
| 3202 | Ga0496116_0043099 | |||
| 3203 | Ga0496116_0060937 | |||
| 3204 | Ga0496117_0000001 | |||
| 3205 | Ga0496117_0000004 | |||
| 3206 | Ga0496117_0000298 | |||
| 3207 | Ga0496117_0000486 | |||
| 3208 | Ga0496117_0001035 | |||
| 3209 | Ga0496117_0001085 | |||
| 3210 | Ga0496117_0001205 | |||
| 3211 | Ga0496117_0003937 | |||
| 3212 | Ga0496117_0005845 | |||
| 3213 | Ga0496117_0010248 | |||
| 3214 | Ga0496117_0011377 | |||
| 3215 | Ga0496117_0011922 | |||
| 3216 | Ga0496117_0016158 | |||
| 3217 | Ga0496117_0016430 | |||
| 3218 | Ga0496117_0020422 | |||
| 3219 | Ga0496117_0029491 | |||
| 3220 | Ga0496117_0033375 | |||
| 3221 | Ga0496117_0034171 | |||
| 3222 | Ga0496117_0041020 | |||
| 3223 | Ga0496117_0067256 | |||
| 3224 | Ga0496118_0000072 | |||
| 3225 | Ga0496118_0000078 | |||
| 3226 | Ga0496118_0000323 | |||
| 3227 | Ga0496118_0000805 | |||
| 3228 | Ga0496118_0001319 | |||
| 3229 | Ga0496118_0002349 | |||
| 3230 | Ga0496118_0002434 | |||
| 3231 | Ga0496118_0003571 | |||
| 3232 | Ga0496118_0003732 | |||
| 3233 | Ga0496118_0004028 | |||
| 3234 | Ga0496118_0004806 | |||
| 3235 | Ga0496118_0010083 | |||
| 3236 | Ga0496118_0019204 | |||
| 3237 | Ga0496118_0024222 | |||
| 3238 | Ga0496118_0044124 | |||
| 3239 | Ga0496118_0108077 | |||
| 3240 | Ga0496118_0108324 | |||
| 3241 | Ga0496118_0128321 | |||
| 3242 | Ga0496119_0000080 | |||
| 3243 | Ga0496119_0000082 | |||
| 3244 | Ga0496119_0000188 | |||
| 3245 | Ga0496119_0000741 | |||
| 3246 | Ga0496119_0001826 | |||
| 3247 | Ga0496119_0002279 | |||
| 3248 | Ga0496119_0003650 | |||
| 3249 | Ga0496119_0005070 | |||
| 3250 | Ga0496119_0010220 | |||
| 3251 | Ga0496119_0019431 | |||
| 3252 | Ga0496119_0024522 | |||
| 3253 | Ga0496119_0037150 | |||
| 3254 | Ga0496119_0037522 | |||
| 3255 | Ga0496119_0043055 | |||
| 3256 | Ga0496120_0000062 | |||
| 3257 | Ga0496120_0000075 | |||
| 3258 | Ga0496120_0000252 | |||
| 3259 | Ga0496120_0000302 | |||
| 3260 | Ga0496120_0000389 | |||
| 3261 | Ga0496120_0000873 | |||
| 3262 | Ga0496120_0001166 | |||
| 3263 | Ga0496120_0001718 | |||
| 3264 | Ga0496120_0001877 | |||
| 3265 | Ga0496120_0001913 | |||
| 3266 | Ga0496120_0002608 | |||
| 3267 | Ga0496120_0003866 | |||
| 3268 | Ga0496120_0013125 | |||
| 3269 | Ga0496120_0019805 | |||
| 3270 | Ga0496121_0000047 | |||
| 3271 | Ga0496121_0000372 | |||
| 3272 | Ga0496121_0001119 | |||
| 3273 | Ga0496121_0001155 | |||
| 3274 | Ga0496121_0001222 | |||
| 3275 | Ga0496121_0001386 | |||
| 3276 | Ga0496121_0002320 | |||
| 3277 | Ga0496121_0003763 | |||
| 3278 | Ga0496121_0004640 | |||
| 3279 | Ga0496121_0007722 | |||
| 3280 | Ga0496121_0011325 | |||
| 3281 | Ga0496121_0018539 | |||
| 3282 | Ga0496121_0020831 | |||
| 3283 | Ga0496121_0022151 | |||
| 3284 | Ga0496121_0029481 | |||
| 3285 | Ga0496122_0000108 | |||
| 3286 | Ga0496122_0000571 | |||
| 3287 | Ga0496122_0000887 | |||
| 3288 | Ga0496122_0001367 | |||
| 3289 | Ga0496122_0002008 | |||
| 3290 | Ga0496122_0002062 | |||
| 3291 | Ga0496122_0004208 | |||
| 3292 | Ga0496122_0005674 | |||
| 3293 | Ga0496122_0023966 | |||
| 3294 | Ga0496122_0031823 | |||
| 3295 | Ga0496122_0037693 | |||
| 3296 | Ga0496122_0040628 | |||
| 3297 | Ga0496122_0045803 | |||
| 3298 | Ga0496123_0000065 | |||
| 3299 | Ga0496123_0000180 | |||
| 3300 | Ga0496123_0000430 | |||
| 3301 | Ga0496123_0000508 | |||
| 3302 | Ga0496123_0000605 | |||
| 3303 | Ga0496123_0001152 | |||
| 3304 | Ga0496123_0002413 | |||
| 3305 | Ga0496123_0002626 | |||
| 3306 | Ga0496123_0003036 | |||
| 3307 | Ga0496123_0007845 | |||
| 3308 | Ga0496123_0027357 | |||
| 3309 | Ga0496123_0031828 | |||
| 3310 | Ga0496123_0036535 | |||
| 3311 | Ga0496123_0037297 | |||
| 3312 | Ga0496123_0039355 | |||
| 3313 | Ga0496123_0040890 | |||
| 3314 | Ga0496124_0000053 | |||
| 3315 | Ga0496124_0000120 | |||
| 3316 | Ga0496124_0000147 | |||
| 3317 | Ga0496124_0000474 | |||
| 3318 | Ga0496124_0001035 | |||
| 3319 | Ga0496124_0001108 | |||
| 3320 | Ga0496124_0001901 | |||
| 3321 | Ga0496124_0002123 | |||
| 3322 | Ga0496124_0003341 | |||
| 3323 | Ga0496124_0003710 | |||
| 3324 | Ga0496124_0003980 | |||
| 3325 | Ga0496124_0004161 | |||
| 3326 | Ga0496124_0004499 | |||
| 3327 | Ga0496124_0007018 | |||
| 3328 | Ga0496124_0013002 | |||
| 3329 | Ga0496124_0014377 | |||
| 3330 | Ga0496124_0025110 | |||
| 3331 | Ga0496124_0027366 | |||
| 3332 | Ga0496124_0034290 | |||
| 3333 | Ga0496124_0041873 | |||
| 3334 | Ga0496124_0061209 | |||
| 3335 | Ga0496124_0110635 | |||
| 3336 | Ga0496124_0120650 | |||
| 3337 | Ga0496124_0190440 | |||
| 3338 | Ga0496125_0000799 | |||
| 3339 | Ga0496125_0001606 | |||
| 3340 | Ga0496125_0001971 | |||
| 3341 | Ga0496125_0003554 | |||
| 3342 | Ga0496125_0006712 | |||
| 3343 | Ga0496125_0007902 | |||
| 3344 | Ga0496125_0009754 | |||
| 3345 | Ga0496125_0015469 | |||
| 3346 | Ga0496125_0016979 | |||
| 3347 | Ga0496125_0053126 | |||
| 3348 | Ga0496125_0086737 | |||
| 3349 | Ga0496126_0000387 | |||
| 3350 | Ga0496126_0000759 | |||
| 3351 | Ga0496126_0001894 | |||
| 3352 | Ga0496126_0007665 | |||
| 3353 | Ga0496126_0024453 | |||
| 3354 | Ga0496126_0061634 | |||
| 3355 | Ga0496126_0065253 | |||
| 3356 | Ga0496126_0120013 | |||
| 3357 | Ga0496126_0150556 | |||
| 3358 | Ga0501310_000600 | |||
| 3359 | Ga0495678_000006 | |||
| 3360 | Ga0495678_000017 | |||
| 3361 | Ga0495678_000104 | |||
| 3362 | Ga0495678_000283 | |||
| 3363 | Ga0495678_000326 | |||
| 3364 | Ga0495678_000365 | |||
| 3365 | Ga0495678_000693 | |||
| 3366 | Ga0495678_001927 | |||
| 3367 | Ga0495678_002423 | |||
| 3368 | Ga0495678_003240 | |||
| 3369 | Ga0495678_011539 | |||
| 3370 | Ga0495678_014280 | |||
| 3371 | Ga0495678_019135 | |||
| 3372 | Ga0495682_0000015 | |||
| 3373 | Ga0495682_0000182 | |||
| 3374 | Ga0495682_0000188 | |||
| 3375 | Ga0495682_0000659 | |||
| 3376 | Ga0495682_0001301 | |||
| 3377 | Ga0495682_0008465 | |||
| 3378 | Ga0495682_0046868 | |||
| 3379 | Ga0501290_003355 | |||
| 3380 | Ga0501033_0131466 | |||
| 3381 | Ga0501034_0000022 | |||
| 3382 | Ga0501039_0103735 | |||
| 3383 | Ga0501040_0031538 | |||
| 3384 | Ga0501041_0173745 | |||
| 3385 | Ga0501047_0157899 | |||
| 3386 | Ga0501047_0158279 | |||
| 3387 | Ga0501067_0006864 | |||
| 3388 | Ga0501068_0071169 | |||
| 3389 | Ga0501070_0017528 | |||
| 3390 | Ga0501073_0101121 | |||
| 3391 | Ga0501075_0003850 | |||
| 3392 | Ga0501076_0140215 | |||
| 3393 | Ga0501198_000057 | |||
| 3394 | Ga0501222_000017 | |||
| 3395 | Ga0501079_0194910 | |||
| 3396 | Ga0501080_0085223 | |||
| 3397 | Ga0501080_0135208 | |||
| 3398 | Ga0501080_0360148 | |||
| 3399 | Ga0501081_0004297 | |||
| 3400 | Ga0501083_0041654 | |||
| 3401 | Ga0501269_000017 | |||
| 3402 | Ga0501279_004689 | |||
| 3403 | Ga0501035_0028900 | |||
| 3404 | Ga0501044_0000065 | |||
| 3405 | Ga0501044_0071447 | |||
| 3406 | Ga0501045_0102316 | |||
| 3407 | Ga0501226_000002 | |||
| 3408 | nmdc:mga03683_19835_c1 | |||
| 3409 | nmdc:mga03n38_55249_c1 | |||
| 3410 | nmdc:mga00v17_36076_c1 | |||
| 3411 | nmdc:mga00v17_71435_c1 | |||
| 3412 | nmdc:mga00v17_97385_c1 | |||
| 3413 | nmdc:mga05p37_135694_c1 | |||
| 3414 | nmdc:mga05p37_267918_c1 | |||
| 3415 | nmdc:mga05p37_29695_c1 | |||
| 3416 | nmdc:mga05p37_50989_c1 | |||
| 3417 | nmdc:mga05p37_53352_c1 | |||
| 3418 | nmdc:mga0qj67_199974_c1 | |||
| 3419 | nmdc:mga06r32_37200_c1 | |||
| 3420 | nmdc:mga08y16_23075_c1 | |||
| 3421 | nmdc:mga0n895_155737_c1 | |||
| 3422 | nmdc:mga0n895_185107_c1 | |||
| 3423 | nmdc:mga0n895_2762_c1 | |||
| 3424 | nmdc:mga0rr50_137777_c1 | |||
| 3425 | nmdc:mga0rr50_300850_c1 | |||
| 3426 | nmdc:mga0rr50_48426_c1 | |||
| 3427 | nmdc:mga0a205_135148_c1 | |||
| 3428 | nmdc:mga0a205_188559_c1 | |||
| 3429 | nmdc:mga0a205_29557_c1 | |||
| 3430 | nmdc:mga0a205_320295_c1 | |||
| 3431 | nmdc:mga0a205_3269_c1 | |||
| 3432 | nmdc:mga0a205_56645_c1 | |||
| 3433 | Ga0495601_0019691 | |||
| 3434 | Ga0500635_0000026 | |||
| 3435 | Ga0500593_000035 | |||
| 3436 | Ga0500595_002138 | |||
| 3437 | Ga0500621_000001 | |||
| 3438 | Ga0500637_0005602 | |||
| 3439 | Ga0501084_0036114 | |||
| 3440 | Ga0501084_0256612 | |||
| 3441 | Ga0501082_0003999 | |||
| 3442 | Ga0501082_0042873 | |||
| 3443 | Ga0501082_0063221 | |||
| 3444 | Ga0530510_0095888 | |||
| 3445 | Ga0530510_0129518 | |||
| 3446 | 2506576871 | |||
| 3447 | 2506582009 | |||
| 3448 | 2508850838 | |||
| 3449 | 2510284326 | |||
| 3450 | 2510292985 | |||
| 3451 | 2510312491 | |||
| 3452 | 2511249807 | |||
| 3453 | 2511254732 | |||
| 3454 | 2511265543 | |||
| 3455 | 2511288797 | |||
| 3456 | 2511297336 | |||
| 3457 | 2511301703 | |||
| 3458 | 2511316727 | |||
| 3459 | 2511319870 | |||
| 3460 | 2511326036 | |||
| 3461 | 2511330998 | |||
| 3462 | 2511336333 | |||
| 3463 | 2511344322 | |||
| 3464 | 2511349103 | |||
| 3465 | 2511355980 | |||
| 3466 | 2511360664 | |||
| 3467 | 2511366635 | |||
| 3468 | 2511378561 | |||
| 3469 | 2511383819 | |||
| 3470 | 2511411304 | |||
| 3471 | 2511434064 | |||
| 3472 | 2512325944 | |||
| 3473 | 2521559631 | |||
| 3474 | 2525557851 | |||
| 3475 | 2538428561 | |||
| 3476 | 2548648152 | |||
| 3477 | 2550696104 | |||
| 3478 | 2553006337 | |||
| 3479 | 2555245734 | |||
| 3480 | 2555667407 | |||
| 3481 | 2583789815 | |||
| 3482 | 2585829815 | |||
| 3483 | 2585833522 | |||
| 3484 | 2597855651 | |||
| 3485 | 2597861652 | |||
| 3486 | 2597867377 | |||
| 3487 | 2599327433 | |||
| 3488 | 2599356630 | |||
| 3489 | 2599363340 | |||
| 3490 | 2599369708 | |||
| 3491 | 2599376449 | |||
| 3492 | 2599381735 | |||
| 3493 | 2599388121 | |||
| 3494 | 2599395355 | |||
| 3495 | 2599398861 | |||
| 3496 | 2599407120 | |||
| 3497 | 2599411756 | |||
| 3498 | 2599450916 | |||
| 3499 | 2599463463 | |||
| 3500 | 2599469187 | |||
| 3501 | 2599485553 | |||
| 3502 | 2599492480 | |||
| 3503 | 2599506418 | |||
| 3504 | 2599514138 | |||
| 3505 | 2599518739 | |||
| 3506 | 2599806682 | |||
| 3507 | 2599882654 | |||
| 3508 | 2599893527 | |||
| 3509 | 2599928045 | |||
| 3510 | 2599950769 | |||
| 3511 | 2600216092 | |||
| 3512 | 2600364894 | |||
| 3513 | 2601524571 | |||
| 3514 | 2601529725 | |||
| 3515 | 2601534625 | |||
| 3516 | 2601539210 | |||
| 3517 | 2601616559 | |||
| 3518 | 2601621281 | |||
| 3519 | 2601645132 | |||
| 3520 | 2601649678 | |||
| 3521 | 2601654605 | |||
| 3522 | 2601660121 | |||
| 3523 | 2601664373 | |||
| 3524 | 2601667293 | |||
| 3525 | 2601692337 | |||
| 3526 | 2601698094 | |||
| 3527 | 2601702462 | |||
| 3528 | 2601707349 | |||
| 3529 | 2601712370 | |||
| 3530 | 2601717866 | |||
| 3531 | 2601722965 | |||
| 3532 | 2601727794 | |||
| 3533 | 2601732811 | |||
| 3534 | 2601737420 | |||
| 3535 | 2601741839 | |||
| 3536 | 2601752737 | |||
| 3537 | 2601757559 | |||
| 3538 | 2601763918 | |||
| 3539 | 2601776259 | |||
| 3540 | 2601797823 | |||
| 3541 | 2602008632 | |||
| 3542 | 2602019691 | |||
| 3543 | 2603640265 | |||
| 3544 | 2603645947 | |||
| 3545 | 2603662537 | |||
| 3546 | 2603667433 | |||
| 3547 | 2603701833 | |||
| 3548 | 2603706458 | |||
| 3549 | 2603840220 | |||
| 3550 | 2603845297 | |||
| 3551 | 2603850370 | |||
| 3552 | 2603855438 | |||
| 3553 | 2603868299 | |||
| 3554 | 2603873114 | |||
| 3555 | 2603878244 | |||
| 3556 | 2606050199 | |||
| 3557 | 2606071861 | |||
| 3558 | 2606076694 | |||
| 3559 | 2606128892 | |||
| 3560 | 2606147882 | |||
| 3561 | 2606178183 | |||
| 3562 | 2608668994 | |||
| 3563 | 2621302188 | |||
| 3564 | 2624478212 | |||
| 3565 | 2630650182 | |||
| 3566 | 2643791609 | |||
| 3567 | 2643840980 | |||
| 3568 | 2643872629 | |||
| 3569 | 2643954911 | |||
| 3570 | 2644024551 | |||
| 3571 | 2644060851 | |||
| 3572 | 2644074530 | |||
| 3573 | 2644186112 | |||
| 3574 | 2644252445 | |||
| 3575 | 2644619638 | |||
| 3576 | 2650896933 | |||
| 3577 | 2656279243 | |||
| 3578 | 2671099980 | |||
| 3579 | 2671105339 | |||
| 3580 | 2671107457 | |||
| 3581 | 2671586449 | |||
| 3582 | 2671772333 | |||
| 3583 | 2676408836 | |||
| 3584 | 2677898964 | |||
| 3585 | 2681998867 | |||
| 3586 | 2682009716 | |||
| 3587 | 2689443270 | |||
| 3588 | 2712472076 | |||
| 3589 | 2715749197 | |||
| 3590 | 2715755467 | |||
| 3591 | 2718632149 | |||
| 3592 | 2722884172 | |||
| 3593 | 2723246550 | |||
| 3594 | 2738674077 | |||
| 3595 | 2738714086 | |||
| 3596 | 2738752470 | |||
| 3597 | 2738807917 | |||
| 3598 | 2738861511 | |||
| 3599 | 2738895277 | |||
| 3600 | 2739198017 | |||
| 3601 | 2739260307 | |||
| 3602 | 2739288602 | |||
| 3603 | 2739293914 | |||
| 3604 | 2739311270 | |||
| 3605 | 2740995155 | |||
| 3606 | 2743735068 | |||
| 3607 | 2753857964 | |||
| 3608 | 2765591130 | |||
| 3609 | 2774119571 | |||
| 3610 | 2774131506 | |||
| 3611 | 2774134727 | |||
| 3612 | 2775542817 | |||
| 3613 | 2784261057 | |||
| 3614 | 2784315982 | |||
| 3615 | 2791922865 | |||
| 3616 | 2808905445 | |||
| 3617 | 2808932167 | |||
| 3618 | 2808939695 | |||
| 3619 | 2808954232 | |||
| 3620 | 2808955859 | |||
| 3621 | 2808976670 | |||
| 3622 | 2808991892 | |||
| 3623 | 2809124181 | |||
| 3624 | 2809217967 | |||
| 3625 | 2812370168 | |||
| 3626 | 2813726510 | |||
| 3627 | 2814693884 | |||
| 3628 | 2816476018 | |||
| 3629 | 2817488402 | |||
| 3630 | 2819541021 | |||
| 3631 | 2819592228 | |||
| 3632 | 2819657221 | |||
| 3633 | 2819705204 | |||
| 3634 | 2821122417 | |||
| 3635 | 2823378106 | |||
| 3636 | 2823425513 | |||
| 3637 | 2826586887 | |||
| 3638 | 2834032221 | |||
| 3639 | 2839098070 | |||
| 3640 | 2842714483 | |||
| 3641 | 2842807122 | |||
| 3642 | 2842816704 | |||
| 3643 | 2842832075 | |||
| 3644 | 2842834149 | |||
| 3645 | 2842838625 | |||
| 3646 | 2842846374 | |||
| 3647 | 2842852247 | |||
| 3648 | 2844530455 | |||
| 3649 | 2844667887 | |||
| 3650 | 2846041917 | |||
| 3651 | 2847801382 | |||
| 3652 | 2852617066 | |||
| 3653 | 2852660462 | |||
| 3654 | 2852671945 | |||
| 3655 | 2854603544 | |||
| 3656 | 2855199489 | |||
| 3657 | 2857552516 | |||
| 3658 | 2857553516 | |||
| 3659 | 2857561589 | |||
| 3660 | 2857565152 | |||
| 3661 | 2858470370 | |||
| 3662 | 2860343652 | |||
| 3663 | 2860868426 | |||
| 3664 | 2865015603 | |||
| 3665 | 2869552676 | |||
| 3666 | 2871274681 | |||
| 3667 | 2871284339 | |||
| 3668 | 2876602015 | |||
| 3669 | 2878030155 | |||
| 3670 | 2880231102 | |||
| 3671 | 2881612359 | |||
| 3672 | 2883357789 | |||
| 3673 | 2884089542 | |||
| 3674 | 2884341550 | |||
| 3675 | 2884816675 | |||
| 3676 | 2884840345 | |||
| 3677 | 2884855601 | |||
| 3678 | 2885081624 | |||
| 3679 | 2888371068 | |||
| 3680 | 2888374850 | |||
| 3681 | 2891672624 | |||
| 3682 | 2894513814 | |||
| 3683 | 2896157473 | |||
| 3684 | 2900054867 | |||
| 3685 | 2904426461 | |||
| 3686 | 2904443255 | |||
| 3687 | 2904476405 | |||
| 3688 | 2904506839 | |||
| 3689 | 2904519561 | |||
| 3690 | 2904532964 | |||
| 3691 | 2904552169 | |||
| 3692 | 2904585516 | |||
| 3693 | 2904593865 | |||
| 3694 | 2904603984 | |||
| 3695 | 2908447019 | |||
| 3696 | 2917071158 | |||
| 3697 | 2917836390 | |||
| 3698 | 2919066163 | |||
| 3699 | 2919081781 | |||
| 3700 | 2919127477 | |||
| 3701 | 2919152574 | |||
| 3702 | 2919155799 | |||
| 3703 | 2919389787 | |||
| 3704 | 2919459975 | |||
| 3705 | 2919481394 | |||
| 3706 | 2919488714 | |||
| 3707 | 2919493773 | |||
| 3708 | 2919500915 | |||
| 3709 | 2919502248 | |||
| 3710 | 2919545657 | |||
| 3711 | 2919708489 | |||
| 3712 | 2923154063 | |||
| 3713 | 2923513407 | |||
| 3714 | 2923524259 | |||
| 3715 | 2926063921 | |||
| 3716 | 2927145243 | |||
| 3717 | 2927836566 | |||
| 3718 | 2928134053 | |||
| 3719 | 2929190291 | |||
| 3720 | 2931391370 | |||
| 3721 | 2931398829 | |||
| 3722 | 2935358986 | |||
| 3723 | 2937540137 | |||
| 3724 | 2939572156 | |||
| 3725 | 2939602563 | |||
| 3726 | 2939611490 | |||
| 3727 | 2939641103 | |||
| 3728 | 2939646468 | |||
| 3729 | 2941472993 | |||
| 3730 | 2945876184 | |||
| 3731 | 2945930176 | |||
| 3732 | 2945953496 | |||
| 3733 | 2945967580 | |||
| 3734 | 2946012523 | |||
| 3735 | 2946028634 | |||
| 3736 | 2947235161 | |||
| 3737 | 2969304948 | |||
| 3738 | 2974293360 | |||
| 3739 | 2974314638 | |||
| 3740 | 2978975988 | |||
| 3741 | 2984291996 | |||
| 3742 | 2984498214 | |||
| 3743 | 2984500685 | |||
| 3744 | 2984507208 | |||
| 3745 | 2990265534 | |||
| 3746 | 2998140451 | |||
| 3747 | 3007255357 | |||
| 3748 | 3007315837 | |||
| 3749 | 3007399614 | |||
| 3750 | 3007420013 | |||
| 3751 | 3007517896 | |||
| 3752 | 3007618665 | |||
| 3753 | 3007624999 | |||
| 3754 | 3007721212 | |||
| 3755 | 3007859691 | |||
| 3756 | 3007864336 | |||
| 3757 | 637317804 | |||
| 3758 | 640936423 | |||
| 3759 | 8001522612 | |||
| 3760 | 8015688312 | |||
| 3761 | 8016736393 | |||
| 3762 | 8018223139 | |||
| 3763 | 8018408855 | |||
| 3764 | 8019503064 | |||
| 3765 | 8019770298 | |||
| 3766 | 8030000287 | |||
| 3767 | 8047673315 | |||
| 3768 | 8054291514 | |||
| 3769 | 8054350140 | |||
| 3770 | 8054503957 | |||
| 3771 | 8054846290 | |||
| 3772 | 8054850416 | |||
| 3773 | 8055092398 | |||
| 3774 | 8055093595 | |||
| 3775 | 8055097674 | |||
| 3776 | 8055771409 | |||
| 3777 | 8055818353 | |||
| 3778 | 8056126464 | |||
| 3779 | 8056132327 | |||
| 3780 | 8056152467 | |||
| 3781 | 8056164333 | |||
| 3782 | 8056170600 | |||
| 3783 | 8056183052 | |||
| 3784 | 8056572310 | |||
| 3785 | 8057307969 | |||
| 3786 | 8057802700 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4ewg-assembly1.cif.gz_B | crystal structure of a beta-ketoacyl synthase from burkholderia phymatum stm815 | 0.994 | 1 | 407 |
| 4ewg-assembly1.cif.gz_B | crystal structure of a beta-ketoacyl synthase from burkholderia phymatum stm815 | 0.9915 | 1 | 407 |
| 7f27-assembly1.cif.gz_B | crystal structure of polyketide ketosynthase | 0.9906 | 1 | 407 |
| 7f27-assembly2.cif.gz_C | crystal structure of polyketide ketosynthase | 0.9897 | 1 | 407 |
| 7f27-assembly1.cif.gz_B | crystal structure of polyketide ketosynthase | 0.9882 | 1 | 407 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4ewgB02 | Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase | 0.9947 | 260 | 407 | 3.40.47.10 |
| 4ewgB01 | Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase | 0.9897 | 5 | 258 | 3.40.47.10 |
| 4ewgB01 | Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase | 0.982 | 5 | 258 | 3.40.47.10 |
| 4ewgB02 | Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase | 0.9815 | 260 | 407 | 3.40.47.10 |
| af_P9WQD9_267_416_3.40.47.10 | Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase | 0.9594 | 258 | 406 | 3.40.47.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A522KQA2-F1-model_v4 | deleted | 0.9973 | 1 | 354 |
|
| AF-Q6LL26-F1-model_v4 | Beta-ketoacyl-ACP synthase | 0.9962 | 1 | 406 |
GO:0004315
GO:0005829 GO:0006633 |
| AF-A0A855F2L9-F1-model_v4 | Beta-ketoacyl-ACP synthase II | 0.9953 | 2 | 407 |
GO:0004315
GO:0005829 GO:0006633 |
| AF-A0A2X2G657-F1-model_v4 | deleted | 0.9951 | 2 | 407 |
|
| AF-A0A658FYS2-F1-model_v4 | deleted | 0.994 | 1 | 232 |
|