F495995

General Info

Members Datasets Scaffolds Average Seq Length
1893 1275 3786 148

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2515154107|2515611499
Length 175
Sequence RDPQREAGHKCAASLIFSRCSLNSQSMPHFETNHVVKHSAEQMFALVADVERYPEFLPLCEALSVRSRKERDGKVLLLADMTVGYKAIRETFTTQVLLKREERIIDVNYIEGPFKYLDNVWRFEPVNDNQSIVHFCIDYEFKSRLLGALMGSMFDRAFRMFSEAFEKRADVIYGA

Samples

Sample ID Description Type Environment
1 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
6 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
7 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
8 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
9 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
10 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
11 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
12 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
13 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
14 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
15 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
16 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
17 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
18 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
19 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
20 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
21 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
22 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
23 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
24 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
25 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
26 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
27 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
28 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
29 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
30 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
31 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
32 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
33 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
34 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
35 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
36 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
37 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
38 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
39 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
40 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
41 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
42 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
43 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
44 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
45 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
46 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
47 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
48 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
49 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
50 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
51 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
52 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
53 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
54 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
55 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
56 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
57 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
58 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
59 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
60 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
61 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
62 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
63 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
64 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
65 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
66 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
67 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
68 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
69 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
70 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
71 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
72 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
73 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
74 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
75 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
76 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
77 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
78 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
79 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
80 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
81 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
82 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
83 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
84 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
85 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
86 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
87 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
88 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
89 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
90 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
91 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
92 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
93 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
94 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
95 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
96 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
97 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
98 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
99 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
100 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
101 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
102 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
103 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
104 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
105 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
106 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
107 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
108 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
109 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
110 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
111 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
112 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
113 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
114 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
115 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
116 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
117 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
118 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
119 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
120 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
121 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
122 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
123 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
124 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
125 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
126 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
127 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
128 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
129 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
130 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
131 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
132 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
133 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
134 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
135 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
136 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
137 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
138 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
139 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
140 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
141 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
142 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
143 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
144 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
145 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
146 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
147 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
148 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
149 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
150 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
151 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
152 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
153 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
154 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
155 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
156 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
157 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
158 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
159 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
160 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
161 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
162 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
163 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
205 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
206 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
207 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
209 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
213 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
214 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
215 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
216 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
217 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
218 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
219 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
220 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
221 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
222 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
223 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
224 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
225 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
226 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
227 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
228 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
229 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
230 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
231 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
232 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
233 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
234 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
235 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
236 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
237 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
238 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
239 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
240 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
241 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
242 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
243 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
244 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
245 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
246 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
247 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
248 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
249 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
250 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
251 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
252 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
253 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
254 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
255 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
256 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
257 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
258 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
259 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
260 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
261 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
262 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
263 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
264 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
265 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
266 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
267 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
268 3300041497 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaT Metatranscriptome Unclassified
269 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
270 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
271 3300041502 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaT Metatranscriptome Unclassified
272 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
273 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
274 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
275 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
276 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
277 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
278 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
279 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
280 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
281 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
282 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
283 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
284 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
285 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
286 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
287 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
288 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
289 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
290 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
291 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
292 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
293 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
294 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
295 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
296 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
297 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
298 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
299 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
300 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
301 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
302 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
303 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
304 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
305 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
306 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
307 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
308 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
309 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
310 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
311 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
312 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
313 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
314 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
315 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
316 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
317 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
318 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
319 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
320 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
321 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
322 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
323 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
324 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
325 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
326 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
327 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
328 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
329 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
330 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
331 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
332 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
333 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
334 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
335 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
336 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
337 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
338 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
339 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
340 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
341 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
342 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
343 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
344 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
345 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
346 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
347 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
348 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
349 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
350 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
351 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
352 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
353 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
354 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
355 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
356 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
357 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
358 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
359 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
360 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
361 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
362 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
363 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
364 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
365 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
366 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
367 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
368 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
369 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
370 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
371 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
372 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
373 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
374 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
375 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
376 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
377 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
378 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
379 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
380 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
381 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
382 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
383 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
384 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
385 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
386 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
387 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
388 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
389 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
390 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
391 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
392 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
393 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
394 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
395 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
396 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
397 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
398 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
399 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
400 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
401 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
402 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
403 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
404 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
405 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
406 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
407 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
408 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
409 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
410 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
411 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
412 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
413 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
414 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
415 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
416 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
417 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
418 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
419 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
420 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
421 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
422 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
423 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
424 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
425 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
426 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
427 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
428 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
429 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
430 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
431 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
432 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
433 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
434 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
435 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
436 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
437 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
438 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
439 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
440 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
441 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
442 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
443 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
444 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
445 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
446 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
447 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
448 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
449 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
450 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
451 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
452 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
453 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
454 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
455 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
456 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
457 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
458 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
459 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
460 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
461 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
462 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
463 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
464 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
465 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
466 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
467 2509276019 Ensifer aridi TW10 Isolate Nodule
468 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
469 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
470 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
471 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
472 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
473 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
474 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
475 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
476 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
477 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
478 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
479 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
480 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
481 2512875024
482 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
483 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
484 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
485 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
486 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
487 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
488 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
489 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
490 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
491 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
492 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
493 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
494 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
495 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
496 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
497 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
498 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
499 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
500 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
501 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
502 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
503 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
504 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
505 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
506 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
507 2516143018 Ensifer sp. BR816 Isolate Nodule
508 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
509 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
510 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
511 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
512 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
513 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
514 2519899620 Rhizobium sp. Pop5 Isolate Nodule
515 2523231067 Pleomorphomonas oryzae DSM 16300 Isolate Unclassified
516 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
517 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
518 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
519 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
520 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
521 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
522 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
523 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
524 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
525 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
526 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
527 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
528 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
529 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
530 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
531 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
532 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
533 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
534 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
535 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
536 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
537 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
538 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
539 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
540 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
541 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
542 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
543 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
544 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
545 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
546 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
547 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
548 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
549 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
550 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
551 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
552 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
553 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
554 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
555 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
556 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
557 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
558 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
559 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
560 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
561 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
562 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
563 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
564 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
565 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
566 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
567 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
568 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
569 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
570 2643221551 Mesorhizobium sp. Root1471 Isolate Unclassified
571 2643221555 Mesorhizobium sp. Root554 Isolate Unclassified
572 2643221557 Ensifer sp. Root558 Isolate Unclassified
573 2643221564 Mesorhizobium sp. Root157 Isolate Unclassified
574 2643221568 Rhizobium sp. Root564 Isolate Unclassified
575 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
576 2643221599 Rhizobium sp. Root708 Isolate Unclassified
577 2643221607 Rhizobium sp. Root73 Isolate Unclassified
578 2643221610 Ensifer sp. Root74 Isolate Unclassified
579 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
580 2643221626 Ensifer sp. Root31 Isolate Unclassified
581 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
582 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
583 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
584 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
585 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
586 2643221655 Ensifer sp. Root1252 Isolate Unclassified
587 2643221659 Ensifer sp. Root127 Isolate Unclassified
588 2643221668 Ensifer sp. Root423 Isolate Unclassified
589 2643221675 Ensifer sp. Root1298 Isolate Unclassified
590 2643221680 Ensifer sp. Root1312 Isolate Unclassified
591 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
592 2643221688 Rhizobium sp. Root482 Isolate Unclassified
593 2643221698 Ensifer sp. Root142 Isolate Unclassified
594 2643221712 Ensifer sp. Root258 Isolate Unclassified
595 2643221718 Rhizobium sp. Root268 Isolate Unclassified
596 2643221719 Rhizobium sp. Root274 Isolate Unclassified
597 2643221723 Ensifer sp. Root278 Isolate Unclassified
598 2643221726 Ensifer sp. Root954 Isolate Unclassified
599 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
600 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
601 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
602 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
603 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
604 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
605 2718217882 Rhizobium sp. N741 Isolate Nodule
606 2718217927 Rhizobium sp. N324 Isolate Nodule
607 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
608 2718218009 Rhizobium sp. N561 Isolate Nodule
609 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
610 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
611 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
612 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
613 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
614 2718218363 Rhizobium sp. N113 Isolate Nodule
615 2718218365 Rhizobium sp. N731 Isolate Nodule
616 2718218366 Rhizobium sp. N621 Isolate Nodule
617 2718218423 Rhizobium sp. N941 Isolate Nodule
618 2721755514 Rhizobium sp. N6212 Isolate Nodule
619 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
620 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
621 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
622 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
623 2721755809 Rhizobium sp. N541 Isolate Nodule
624 2721755810 Rhizobium sp. N871 Isolate Nodule
625 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
626 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
627 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
628 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
629 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
630 2728369365 Rhizobium sp. N1341 Isolate Nodule
631 2728369397 Rhizobium sp. N1314 Isolate Nodule
632 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
633 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
634 2738543024 Aminobacter sp. AP02 Isolate Unclassified
635 2738543031 Pleomorphomonas sp. CF100 Isolate Unclassified
636 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
637 2757320392 Phyllobacterium leguminum ORS 1419 Isolate Nodule
638 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
639 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
640 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
641 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
642 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
643 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
644 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
645 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
646 2791355256 Rhizobium sp. M10 Isolate Nodule
647 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
648 2791355260 Rhizobium sp. L9 Isolate Nodule
649 2791355261 Rhizobium sp. J15 Isolate Nodule
650 2791355262 Rhizobium sp. M1 Isolate Nodule
651 2791355263 Rhizobium chutanense C5 Isolate Nodule
652 2791355264 Rhizobium sp. S9 Isolate Nodule
653 2791355265 Rhizobium sp. H4 Isolate Nodule
654 2791355266 Rhizobium sp. L43 Isolate Nodule
655 2791355267 Rhizobium sp. L18 Isolate Nodule
656 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
657 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
658 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
659 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
660 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
661 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
662 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
663 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
664 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
665 2802429633 Rhizobium anhuiense J3 Isolate Nodule
666 2802429634 Rhizobium anhuiense S10 Isolate Nodule
667 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
668 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
669 2802429637 Rhizobium anhuiense C15 Isolate Nodule
670 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
671 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
672 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
673 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
674 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
675 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
676 2837651117 Pseudohoeflea suaedae YC6898 Isolate Unclassified
677 2837678835 Jiella endophytica CBS5Q-3 Isolate Unclassified
678 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
679 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
680 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
681 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
682 2838048938 Rhizobium pisi 27/80 Isolate Nodule
683 2838061910 Rhizobium phaseoli L15 Isolate Nodule
684 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
685 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
686 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
687 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
688 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
689 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
690 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
691 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
692 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
693 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
694 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
695 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
696 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
697 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
698 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
699 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
700 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
701 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
702 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
703 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
704 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
705 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
706 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
707 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
708 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
709 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
710 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
711 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
712 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
713 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
714 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
715 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
716 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
717 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
718 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
719 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
720 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
721 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
722 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
723 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
724 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
725 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
726 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
727 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
728 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
729 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
730 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
731 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
732 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
733 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
734 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
735 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
736 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
737 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
738 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
739 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
740 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
741 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
742 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
743 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
744 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
745 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
746 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
747 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
748 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
749 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
750 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
751 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
752 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
753 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
754 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
755 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
756 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
757 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
758 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
759 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
760 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
761 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
762 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
763 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
764 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
765 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
766 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
767 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
768 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
769 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
770 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
771 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
772 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
773 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
774 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
775 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
776 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
777 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
778 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
779 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
780 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
781 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
782 2856349417 Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 Isolate Nodule
783 2856356410 Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 Isolate Nodule
784 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
785 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
786 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
787 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
788 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
789 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
790 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
791 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
792 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
793 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
794 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
795 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
796 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
797 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
798 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
799 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
800 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
801 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
802 2871444079 Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 Isolate Nodule
803 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
804 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
805 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
806 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
807 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
808 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
809 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
810 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
811 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
812 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
813 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
814 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
815 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
816 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
817 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
818 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
819 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
820 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
821 2876377896 Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 Isolate Nodule
822 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
823 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
824 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
825 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
826 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
827 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
828 2878730984 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 Isolate Nodule
829 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
830 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
831 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
832 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
833 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
834 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
835 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
836 2878788777 Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 Isolate Nodule
837 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
838 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
839 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
840 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
841 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
842 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
843 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
844 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
845 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
846 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
847 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
848 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
849 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
850 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
851 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
852 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
853 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
854 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
855 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
856 2891048133 Martelella lutilitoris GH2-6 Isolate Rhizosphere
857 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
858 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
859 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
860 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
861 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
862 2903513507 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 Isolate Nodule
863 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
864 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
865 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
866 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
867 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
868 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
869 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
870 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
871 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
872 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
873 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
874 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
875 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
876 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
877 2909042592 Labrys sp. LIt4 Isolate Nodule
878 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
879 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
880 2915650412 Ochrobactrum sp. CM-21-5 Isolate Rhizosphere
881 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
882 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
883 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
884 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
885 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
886 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
887 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
888 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
889 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
890 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
891 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
892 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
893 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
894 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
895 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
896 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
897 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
898 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
899 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
900 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
901 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
902 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
903 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
904 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
905 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
906 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
907 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
908 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
909 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
910 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
911 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
912 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
913 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
914 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
915 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
916 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
917 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
918 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
919 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
920 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
921 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
922 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
923 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
924 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
925 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
926 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
927 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
928 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
929 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
930 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
931 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
932 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
933 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
934 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
935 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
936 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
937 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
938 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
939 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
940 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
941 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
942 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
943 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
944 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
945 2933599457 Rhizobium phaseoli M3 Isolate Nodule
946 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
947 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
948 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
949 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
950 2936381700 Rhizobium chutanense C16 Isolate Unclassified
951 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
952 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
953 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
954 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
955 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
956 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
957 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
958 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
959 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
960 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
961 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
962 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
963 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
964 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
965 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
966 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
967 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
968 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
969 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
970 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
971 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
972 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
973 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
974 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
975 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
976 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
977 2937868953 Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 Isolate Nodule
978 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
979 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
980 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
981 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
982 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
983 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
984 2939669807 Kaistia defluvii 3207 Isolate Rhizosphere
985 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
986 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
987 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
988 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
989 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
990 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
991 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
992 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
993 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
994 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
995 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
996 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
997 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
998 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
999 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
1000 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
1001 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
1002 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
1003 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
1004 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
1005 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
1006 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
1007 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
1008 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
1009 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
1010 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
1011 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
1012 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
1013 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
1014 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
1015 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
1016 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
1017 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
1018 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
1019 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
1020 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
1021 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
1022 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
1023 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
1024 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
1025 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
1026 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
1027 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
1028 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
1029 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
1030 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
1031 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
1032 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
1033 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
1034 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
1035 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
1036 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
1037 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
1038 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
1039 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
1040 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
1041 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
1042 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
1043 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
1044 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
1045 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
1046 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
1047 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
1048 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
1049 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
1050 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
1051 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
1052 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
1053 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
1054 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
1055 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
1056 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
1057 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
1058 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
1059 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
1060 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
1061 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
1062 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
1063 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
1064 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
1065 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
1066 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
1067 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
1068 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
1069 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
1070 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
1071 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
1072 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
1073 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
1074 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
1075 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
1076 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
1077 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
1078 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
1079 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
1080 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
1081 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
1082 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
1083 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
1084 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
1085 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
1086 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
1087 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
1088 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
1089 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
1090 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
1091 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
1092 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
1093 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
1094 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
1095 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
1096 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
1097 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
1098 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
1099 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
1100 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
1101 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
1102 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
1103 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
1104 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
1105 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
1106 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
1107 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
1108 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
1109 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
1110 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
1111 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
1112 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
1113 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
1114 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
1115 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
1116 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
1117 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
1118 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
1119 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
1120 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
1121 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
1122 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
1123 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
1124 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
1125 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
1126 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
1127 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
1128 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
1129 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
1130 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
1131 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
1132 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
1133 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
1134 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
1135 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
1136 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
1137 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
1138 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
1139 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
1140 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
1141 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
1142 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
1143 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
1144 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
1145 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
1146 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
1147 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
1148 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
1149 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
1150 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
1151 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
1152 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
1153 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
1154 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
1155 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
1156 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
1157 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
1158 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
1159 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
1160 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
1161 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
1162 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
1163 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
1164 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
1165 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
1166 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
1167 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
1168 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule
1169 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
1170 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
1171 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
1172 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
1173 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
1174 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
1175 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
1176 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
1177 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
1178 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
1179 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
1180 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
1181 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
1182 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
1183 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
1184 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
1185 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
1186 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
1187 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
1188 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
1189 2996336353 Mesorhizobium sp. YM1C-6-2 Isolate Unclassified
1190 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
1191 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
1192 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
1193 2996887358 Rhizobium sp. R711 Isolate Nodule
1194 2996893221 Rhizobium sp. R635 Isolate Nodule
1195 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
1196 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
1197 3004167301 Mesorhizobium loti 582 Isolate Unclassified
1198 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
1199 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
1200 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
1201 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
1202 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
1203 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
1204 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
1205 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
1206 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
1207 3004289098 Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 Isolate Nodule
1208 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
1209 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
1210 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
1211 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
1212 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
1213 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
1214 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
1215 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
1216 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
1217 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
1218 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
1219 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
1220 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
1221 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
1222 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
1223 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
1224 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
1225 8004395343 Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 Isolate Nodule
1226 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
1227 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
1228 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
1229 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
1230 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
1231 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
1232 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
1233 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
1234 8005258706 Rhizobium sp. R693 Isolate Nodule
1235 8005275841 Rhizobium sp. N4311 Isolate Nodule
1236 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
1237 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
1238 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
1239 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
1240 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
1241 8005321885 Rhizobium sp. R72 Isolate Nodule
1242 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
1243 8005382845 Rhizobium sp. R634 Isolate Nodule
1244 8005395548 Rhizobium sp. R339 Isolate Nodule
1245 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
1246 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
1247 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
1248 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
1249 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
1250 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
1251 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
1252 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
1253 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
1254 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
1255 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
1256 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
1257 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
1258 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
1259 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
1260 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
1261 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
1262 8018176218 Rhizobium sp. N122 Isolate Nodule
1263 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
1264 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
1265 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
1266 8024501048 Rhizobium sp. H4 Isolate Nodule
1267 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
1268 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
1269 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
1270 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified
1271 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule
1272 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
1273 8056382006 Rhizobium croatiense 13T Isolate Nodule
1274 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
1275 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 56.52
Metatranscriptomes 0.26
Isolates 43.21

Biome Distribution

Category Percentage (%)
Aerial Root 0.26
Bulb 0
Endosphere 14.26
Nodule 35.55
Rhizoplane 2.32
Rhizosphere 35.82
Stem 0
Stem Tuber 0
Unclassified 0.53

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 2214702717 2209111006 Bacteria 511
2 JGI24740J21852_10024850 3300001979 Bacteria 2026
3 JGI24739J22299_10085637 3300001989 Bacteria 963
4 JGI24735J21928_10045816 3300002067 Bacteria 1269
5 JGI25155J39150_1000011 3300002704 Bacteria 207685
6 JGI25156J39149_1000027 3300002705 Bacteria 127396
7 JGI25156J39149_1000030 3300002705 Bacteria 126029
8 JGI25156J39149_1004453 3300002705 Bacteria 4265
9 JGI25154J39366_1000057 3300002738 Bacteria 110584
10 JGI25157J39369_1000010 3300002741 Bacteria 207685
11 JGI25157J39369_1000604 3300002741 Bacteria 20770
12 JGI25152J39213_1002131 3300002773 Bacteria 7762
13 JGI25150J39212_1004304 3300002774 Bacteria 3185
14 JGI25159J45721_1000006 3300002987 Bacteria 188201
15 JGI25151J46595_10000238 3300003187 Bacteria 64884
16 JGI25151J46595_10009568 3300003187 Bacteria 4573
17 JGI25406J46586_10008536 3300003203 Bacteria 4633
18 JGI25406J46586_10045653 3300003203 Bacteria 1506
19 JGI25165J46597_1000033 3300003214 Bacteria 293030
20 JGI25165J46597_1000777 3300003214 Bacteria 24294
21 JGI25165J46597_1007469 3300003214 Bacteria 1811
22 JGI25153J46596_10002466 3300003215 Bacteria 10638
23 JGI25153J46596_10010613 3300003215 Bacteria 4148
24 JGI25153J46596_10070545 3300003215 Bacteria 906
25 rootH2_10012004 3300003320 Bacteria 1765
26 rootH2_10040546 3300003320 Bacteria 5255
27 rootL2_10034778 3300003322 Bacteria 2514
28 rootH1_10017647 3300003323 Bacteria 1657
29 rootH1_10113295 3300003323 Bacteria 2515
30 JGI25160J50197_1000004 3300003354 Bacteria 419797
31 JGI25160J50197_1000019 3300003354 Bacteria 233980
32 JGI25160J50197_1004387 3300003354 Bacteria 6112
33 JGI25160J50197_1036036 3300003354 Bacteria 1206
34 JGI25160J50197_1043041 3300003354 Bacteria 1021
35 JGI25161J50226_1000003 3300003374 Bacteria 413345
36 JGI25161J50226_1000330 3300003374 Bacteria 25735
37 JGI25161J50226_1001454 3300003374 Bacteria 7115
38 JGI25161J50226_1008427 3300003374 Bacteria 1589
39 Ga0055542_1000762 3300003762 Bacteria 24410
40 Ga0055529_1002106 3300003763 Bacteria 4232
41 Ga0055526_1000565 3300003771 Bacteria 29180
42 Ga0055526_1000669 3300003771 Bacteria 26309
43 Ga0055526_1002226 3300003771 Bacteria 13285
44 Ga0055526_1040249 3300003771 Bacteria 1180
45 Ga0055524_1004582 3300003775 Bacteria 6358
46 Ga0055524_1006212 3300003775 Bacteria 5213
47 Ga0055524_1007214 3300003775 Bacteria 4752
48 Ga0055524_1010237 3300003775 Bacteria 3747
49 Ga0055524_1035612 3300003775 Bacteria 1354
50 Ga0055536_1000212 3300003781 Bacteria 47611
51 Ga0055536_1004763 3300003781 Bacteria 6809
52 Ga0055534_1047945 3300003784 Bacteria 613
53 Ga0055528_1000918 3300003790 Bacteria 19824
54 Ga0055528_1005988 3300003790 Bacteria 5570
55 Ga0055528_1008737 3300003790 Bacteria 4297
56 Ga0055528_1015144 3300003790 Bacteria 2802
57 Ga0055528_1020888 3300003790 Bacteria 2102
58 Ga0055530_10015221 3300003791 Bacteria 2523
59 Ga0055530_10068443 3300003791 Bacteria 772
60 Ga0055540_1000285 3300003792 Bacteria 45310
61 Ga0055540_1001884 3300003792 Bacteria 11760
62 Ga0055540_1002932 3300003792 Bacteria 8600
63 Ga0055540_1023537 3300003792 Bacteria 1549
64 Ga0055540_1026148 3300003792 Bacteria 1416
65 Ga0055540_1059536 3300003792 Bacteria 766
66 Ga0055540_1059940 3300003792 Bacteria 763
67 Ga0055531_10001165 3300003794 Bacteria 20245
68 Ga0055531_10014995 3300003794 Bacteria 3448
69 Ga0055531_10069570 3300003794 Bacteria 818
70 Ga0058692_1004051 3300003856 Bacteria 4402
71 Ga0055543_1000001 3300004625 Bacteria 419949
72 Ga0055543_1000019 3300004625 Bacteria 161035
73 Ga0055543_1000147 3300004625 Bacteria 58621
74 Ga0055543_1000808 3300004625 Bacteria 15443
75 Ga0065165_1000049 3300005262 Bacteria 195588
76 Ga0065165_1000180 3300005262 Bacteria 111768
77 Ga0065165_1005995 3300005262 Bacteria 6555
78 Ga0065165_1017852 3300005262 Bacteria 2595
79 Ga0065165_1024195 3300005262 Bacteria 2044
80 Ga0070658_10032973 3300005327 Bacteria 4165
81 Ga0070658_11253983 3300005327 Bacteria 644
82 Ga0070670_100001443 3300005331 Bacteria 19089
83 Ga0068869_101109938 3300005334 Bacteria 692
84 Ga0070687_100035726 3300005343 Bacteria 2470
85 Ga0070661_100680165 3300005344 Bacteria 837
86 Ga0070668_100629226 3300005347 Bacteria 941
87 Ga0070675_100238243 3300005354 Bacteria 1589
88 Ga0070671_100310609 3300005355 Bacteria 1343
89 Ga0070671_100434568 3300005355 Bacteria 1125
90 Ga0070674_100319133 3300005356 Bacteria 1245
91 Ga0070659_100090030 3300005366 Bacteria 2459
92 Ga0070667_101468578 3300005367 Bacteria 640
93 Ga0070703_10001607 3300005406 Bacteria 6715
94 Ga0070709_10145167 3300005434 Bacteria 1634
95 Ga0070701_10001368 3300005438 Bacteria 8996
96 Ga0070711_100859884 3300005439 Bacteria 772
97 Ga0070705_100000487 3300005440 Bacteria 22874
98 Ga0070700_100003143 3300005441 Bacteria 8482
99 Ga0070694_100023927 3300005444 Bacteria 3936
100 Ga0070708_100029082 3300005445 Bacteria 4763
101 Ga0070663_100004621 3300005455 Bacteria 8109
102 Ga0070663_101228536 3300005455 Bacteria 659
103 Ga0070662_100411200 3300005457 Bacteria 1118
104 Ga0070662_100910096 3300005457 Bacteria 751
105 Ga0070662_101332326 3300005457 Bacteria 618
106 Ga0070681_10171682 3300005458 Bacteria 2090
107 Ga0070706_100058590 3300005467 Bacteria 3554
108 Ga0070698_100665481 3300005471 Bacteria 983
109 Ga0070699_100002474 3300005518 Bacteria 16609
110 Ga0070679_100050610 3300005530 Bacteria 4138
111 Ga0070679_100065325 3300005530 Bacteria 3627
112 Ga0070697_100000987 3300005536 Bacteria 21511
113 Ga0070697_100119415 3300005536 Bacteria 2204
114 Ga0068853_100002083 3300005539 Bacteria 14829
115 Ga0068853_100320060 3300005539 Bacteria 1438
116 Ga0068853_101041001 3300005539 Bacteria 788
117 Ga0070686_100403550 3300005544 Bacteria 1040
118 Ga0070695_100004914 3300005545 Bacteria 7882
119 Ga0070696_100001714 3300005546 Bacteria 14378
120 Ga0070693_100064714 3300005547 Bacteria 2135
121 Ga0070665_100100274 3300005548 Bacteria 2900
122 Ga0070665_100166889 3300005548 Bacteria 2204
123 Ga0070665_100244907 3300005548 Bacteria 1793
124 Ga0070665_100287216 3300005548 Bacteria 1647
125 Ga0070665_100464658 3300005548 Bacteria 1276
126 Ga0070665_100642398 3300005548 Bacteria 1074
127 Ga0070665_100715156 3300005548 Bacteria 1015
128 Ga0070704_100004568 3300005549 Bacteria 7999
129 Ga0068855_100081541 3300005563 Bacteria 3749
130 Ga0068855_100147887 3300005563 Bacteria 2673
131 Ga0068855_101151476 3300005563 Bacteria 808
132 Ga0068857_100030653 3300005577 Bacteria 4750
133 Ga0068857_100057532 3300005577 Bacteria 3451
134 Ga0068856_100069999 3300005614 Bacteria 3470
135 Ga0068856_100108448 3300005614 Bacteria 2773
136 Ga0068856_100382539 3300005614 Bacteria 1427
137 Ga0068856_100523781 3300005614 Bacteria 1207
138 Ga0068852_100082239 3300005616 Bacteria 2861
139 Ga0068852_101959714 3300005616 Bacteria 608
140 Ga0068859_100011400 3300005617 Bacteria 8936
141 Ga0068859_100051166 3300005617 Bacteria 4151
142 Ga0068864_100081043 3300005618 Bacteria 2845
143 Ga0068851_10104616 3300005834 Bacteria 1505
144 Ga0068863_100170600 3300005841 Bacteria 2087
145 Ga0068858_100051707 3300005842 Bacteria 3802
146 Ga0068858_100136804 3300005842 Bacteria 2299
147 Ga0068860_100007101 3300005843 Bacteria 11206
148 Ga0068860_100877418 3300005843 Bacteria 913
149 Ga0068862_100011359 3300005844 Bacteria 7353
150 Ga0081455_10262695 3300005937 Bacteria 1257
151 Ga0081455_10706243 3300005937 Bacteria 642
152 Ga0081539_10001354 3300005985 Bacteria 42654
153 Ga0081539_10002915 3300005985 Bacteria 22591
154 Ga0075365_10000771 3300006038 Bacteria 13047
155 Ga0075365_10019973 3300006038 Bacteria 4145
156 Ga0075365_10028318 3300006038 Bacteria 3573
157 Ga0075365_10049392 3300006038 Bacteria 2772
158 Ga0075365_10055143 3300006038 Bacteria 2637
159 Ga0075365_10253425 3300006038 Bacteria 1237
160 Ga0075365_10365111 3300006038 Bacteria 1018
161 Ga0075365_10536379 3300006038 Bacteria 827
162 Ga0075368_10058667 3300006042 Bacteria 1538
163 Ga0075368_10063670 3300006042 Bacteria 1480
164 Ga0075368_10119436 3300006042 Bacteria 1091
165 Ga0075363_100012667 3300006048 Bacteria 4068
166 Ga0075363_100050250 3300006048 Bacteria 2221
167 Ga0075363_100099987 3300006048 Bacteria 1604
168 Ga0075363_100100272 3300006048 Bacteria 1602
169 Ga0075363_100133720 3300006048 Bacteria 1392
170 Ga0075363_100731597 3300006048 Bacteria 599
171 Ga0075364_10008131 3300006051 Bacteria 6257
172 Ga0075364_10120674 3300006051 Bacteria 1754
173 Ga0075364_10148623 3300006051 Bacteria 1578
174 Ga0075364_10920067 3300006051 Bacteria 595
175 Ga0070715_10383836 3300006163 Bacteria 776
176 Ga0075362_10051910 3300006177 Bacteria 1836
177 Ga0075362_10224417 3300006177 Bacteria 919
178 Ga0075367_10026480 3300006178 Bacteria 3290
179 Ga0075367_10050505 3300006178 Bacteria 2456
180 Ga0075367_10087828 3300006178 Bacteria 1889
181 Ga0075367_10184751 3300006178 Bacteria 1300
182 Ga0075367_10197438 3300006178 Bacteria 1257
183 Ga0075367_10279322 3300006178 Bacteria 1050
184 Ga0075367_10516081 3300006178 Bacteria 758
185 Ga0075369_10002912 3300006186 Bacteria 6173
186 Ga0075369_10004806 3300006186 Bacteria 5024
187 Ga0075369_10019597 3300006186 Bacteria 2763
188 Ga0075369_10086170 3300006186 Bacteria 1398
189 Ga0075369_10097492 3300006186 Bacteria 1317
190 Ga0075369_10316536 3300006186 Bacteria 730
191 Ga0075366_10003432 3300006195 Bacteria 8356
192 Ga0075366_10365675 3300006195 Bacteria 886
193 Ga0075370_10006155 3300006353 Bacteria 6019
194 Ga0075370_10041398 3300006353 Bacteria 2601
195 Ga0075370_10070723 3300006353 Bacteria 1996
196 Ga0075370_10165121 3300006353 Bacteria 1300
197 Ga0075370_10208580 3300006353 Bacteria 1153
198 Ga0075370_10619750 3300006353 Bacteria 656
199 Ga0075428_100157306 3300006844 Bacteria 2468
200 Ga0075430_100013715 3300006846 Bacteria 6908
201 Ga0075431_100001091 3300006847 Bacteria 24310
202 Ga0075433_10445911 3300006852 Bacteria 1141
203 Ga0075429_100764842 3300006880 Unclassified 846
204 Ga0068865_101490036 3300006881 Bacteria 606
205 Ga0097620_100011399 3300006931 Bacteria 8936
206 Ga0097620_100051168 3300006931 Bacteria 4151
207 Ga0079104_1000187 3300006946 Bacteria 86957
208 Ga0079104_1001924 3300006946 Bacteria 12460
209 Ga0099826_10004117 3300006948 Bacteria 10107
210 Ga0075435_100061966 3300007076 Bacteria 3035
211 Ga0099794_10068986 3300007265 Unclassified 1729
212 Ga0099794_10384984 3300007265 Unclassified 732
213 Ga0099795_10321821 3300007788 Unclassified 685
214 Ga0105251_10011989 3300009011 Bacteria 4921
215 Ga0105240_10000005 3300009093 Bacteria 702630
216 Ga0105240_10483353 3300009093 Bacteria 1380
217 Ga0105240_10698477 3300009093 Bacteria 1107
218 Ga0105240_10799296 3300009093 Bacteria 1022
219 Ga0105245_10504020 3300009098 Bacteria 1227
220 Ga0105245_11155304 3300009098 Bacteria 821
221 Ga0105247_10011923 3300009101 Bacteria 5225
222 Ga0105247_11150484 3300009101 Bacteria 615
223 Ga0105243_10121413 3300009148 Bacteria 2203
224 Ga0105243_10175176 3300009148 Bacteria 1861
225 Ga0105241_10012824 3300009174 Bacteria 6153
226 Ga0105241_10203860 3300009174 Bacteria 1654
227 Ga0105241_10389862 3300009174 Bacteria 1219
228 Ga0105237_10002240 3300009545 Bacteria 24098
229 Ga0105238_10038126 3300009551 Bacteria 4882
230 Ga0105238_10605306 3300009551 Bacteria 1104
231 Ga0105238_11301184 3300009551 Bacteria 753
232 Ga0105249_10000834 3300009553 Bacteria 27750
233 Ga0105249_12837275 3300009553 Bacteria 556
234 Ga0123341_1000001 3300009765 Bacteria 314908
235 Ga0123342_1008195 3300009766 Bacteria 13325
236 Ga0123342_1028840 3300009766 Bacteria 2947
237 Ga0099796_10020084 3300010159 Bacteria 2036
238 Ga0105239_10000739 3300010375 Bacteria 46483
239 Ga0105239_10164100 3300010375 Bacteria 2483
240 Ga0105239_10558827 3300010375 Bacteria 1304
241 Ga0105239_10799707 3300010375 Bacteria 1080
242 Ga0105239_11064602 3300010375 Bacteria 931
243 Ga0105246_10016031 3300011119 Bacteria 4741
244 Ga0105246_11329567 3300011119 Bacteria 667
245 Ga0157319_1053546 3300012497 Bacteria 508
246 Ga0157371_10005765 3300013102 Bacteria 10378
247 Ga0157371_10275070 3300013102 Bacteria 1216
248 Ga0157370_10000284 3300013104 Bacteria 64323
249 Ga0157370_10337116 3300013104 Bacteria 1390
250 Ga0157369_11347411 3300013105 Bacteria 727
251 Ga0171463_1011 3300013249 Bacteria 230603
252 Ga0157374_10261982 3300013296 Bacteria 1703
253 Ga0157374_10515065 3300013296 Bacteria 1202
254 Ga0157374_11875973 3300013296 Bacteria 625
255 Ga0157378_10428295 3300013297 Bacteria 1309
256 Ga0157378_10821988 3300013297 Bacteria 956
257 Ga0157378_10858029 3300013297 Bacteria 937
258 Ga0157372_10704181 3300013307 Bacteria 1175
259 Ga0157372_11034046 3300013307 Bacteria 951
260 Ga0157372_11765158 3300013307 Bacteria 712
261 Ga0157375_11897175 3300013308 Bacteria 707
262 Ga0157375_12566204 3300013308 Bacteria 609
263 Ga0163163_11471464 3300014325 Bacteria 743
264 Ga0163163_11571178 3300014325 Bacteria 719
265 Ga0182008_10132875 3300014497 Bacteria 1242
266 Ga0182008_10336259 3300014497 Bacteria 798
267 Ga0182006_1014407 3300015261 Bacteria 3410
268 Ga0182007_10108824 3300015262 Bacteria 921
269 Ga0182007_10287558 3300015262 Bacteria 600
270 Ga0182005_1003903 3300015265 Bacteria 4936
271 Ga0182005_1006191 3300015265 Bacteria 3676
272 Ga0183363_1111 3300015690 Bacteria 22277
273 Ga0163161_10684764 3300017792 Bacteria 852
274 Ga0163161_11316251 3300017792 Bacteria 628
275 Ga0214544_1000265 3300021320 Bacteria 87060
276 Ga0214542_1000015 3300021321 Bacteria 227912
277 Ga0214543_1000011 3300021327 Bacteria 344093
278 Ga0214543_1000032 3300021327 Bacteria 200766
279 Ga0228711_1000012 3300022739 Bacteria 132594
280 Ga0228710_1000006 3300022740 Bacteria 209134
281 Ga0209435_100022 3300025206 Bacteria 207766
282 Ga0209436_100038 3300025208 Bacteria 76733
283 Ga0209436_100837 3300025208 Bacteria 12443
284 Ga0209436_111465 3300025208 Bacteria 1556
285 Ga0209672_111952 3300025228 Bacteria 1097
286 Ga0209437_100160 3300025233 Bacteria 149451
287 Ga0209437_100310 3300025233 Bacteria 65905
288 Ga0207425_1011762 3300025245 Bacteria 2073
289 Ga0207425_1017027 3300025245 Bacteria 1605
290 Ga0207425_1021384 3300025245 Bacteria 1372
291 Ga0207425_1032792 3300025245 Bacteria 1027
292 Ga0207425_1046284 3300025245 Bacteria 811
293 Ga0209646_1000078 3300025246 Bacteria 207766
294 Ga0209026_1000002 3300025250 Bacteria 1136158
295 Ga0209026_1000065 3300025250 Bacteria 207766
296 Ga0209677_101256 3300025253 Bacteria 11408
297 Ga0209148_1000570 3300025254 Bacteria 34441
298 Ga0209759_1000055 3300025256 Bacteria 207766
299 Ga0209759_1000119 3300025256 Bacteria 141051
300 Ga0209759_1012005 3300025256 Bacteria 2425
301 Ga0209129_1000349 3300025258 Bacteria 38942
302 Ga0209129_1000432 3300025258 Bacteria 31411
303 Ga0209129_1000442 3300025258 Bacteria 30980
304 Ga0209129_1002862 3300025258 Bacteria 7972
305 Ga0209129_1012729 3300025258 Bacteria 1904
306 Ga0209233_1000027 3300025261 Bacteria 652089
307 Ga0209233_1000168 3300025261 Bacteria 149312
308 Ga0209233_1000269 3300025261 Bacteria 74071
309 Ga0209233_1000303 3300025261 Bacteria 59138
310 Ga0209455_1000204 3300025272 Bacteria 85420
311 Ga0209673_1000068 3300025273 Bacteria 245891
312 Ga0209673_1000139 3300025273 Bacteria 157765
313 Ga0209673_1001538 3300025273 Bacteria 20946
314 Ga0209673_1002227 3300025273 Bacteria 14064
315 Ga0209673_1005579 3300025273 Bacteria 6290
316 Ga0209673_1008099 3300025273 Bacteria 4725
317 Ga0209673_1015353 3300025273 Bacteria 2915
318 Ga0209673_1056305 3300025273 Bacteria 1007
319 Ga0209130_1000007 3300025284 Bacteria 591584
320 Ga0209130_1000012 3300025284 Bacteria 421329
321 Ga0209130_1000097 3300025284 Bacteria 143750
322 Ga0209130_1015683 3300025284 Bacteria 1858
323 Ga0209130_1029780 3300025284 Bacteria 1134
324 Ga0209675_1050911 3300025291 Bacteria 855
325 Ga0209675_1061028 3300025291 Bacteria 745
326 Ga0209676_1000399 3300025292 Bacteria 79312
327 Ga0209676_1006026 3300025292 Bacteria 6116
328 Ga0209025_1000237 3300025294 Bacteria 128553
329 Ga0209025_1000358 3300025294 Bacteria 97655
330 Ga0209025_1000729 3300025294 Bacteria 55773
331 Ga0209025_1000923 3300025294 Bacteria 45012
332 Ga0209025_1000949 3300025294 Bacteria 43938
333 Ga0209025_1004865 3300025294 Bacteria 11329
334 Ga0209025_1005123 3300025294 Bacteria 10878
335 Ga0209025_1058527 3300025294 Bacteria 1463
336 Ga0209025_1071341 3300025294 Bacteria 1231
337 Ga0209025_1099690 3300025294 Bacteria 923
338 Ga0209025_1131642 3300025294 Bacteria 726
339 Ga0209564_1000140 3300025295 Bacteria 179856
340 Ga0209564_1000794 3300025295 Bacteria 43506
341 Ga0209564_1000802 3300025295 Bacteria 43078
342 Ga0209564_1000868 3300025295 Bacteria 40261
343 Ga0209564_1001618 3300025295 Bacteria 21851
344 Ga0209564_1005687 3300025295 Bacteria 6993
345 Ga0209564_1014049 3300025295 Bacteria 3356
346 Ga0209564_1041733 3300025295 Bacteria 1227
347 Ga0209758_1000155 3300025297 Bacteria 160455
348 Ga0209758_1000545 3300025297 Bacteria 59830
349 Ga0209758_1000587 3300025297 Bacteria 56803
350 Ga0209758_1001100 3300025297 Bacteria 34985
351 Ga0209758_1002445 3300025297 Bacteria 18964
352 Ga0209758_1007782 3300025297 Bacteria 7170
353 Ga0209758_1019396 3300025297 Bacteria 3280
354 Ga0209758_1026684 3300025297 Bacteria 2492
355 Ga0209758_1100007 3300025297 Bacteria 827
356 Ga0209050_1000650 3300025298 Bacteria 53753
357 Ga0209050_1005095 3300025298 Bacteria 8471
358 Ga0209050_1021205 3300025298 Bacteria 2378
359 Ga0209256_1000557 3300025299 Bacteria 53444
360 Ga0209256_1000687 3300025299 Bacteria 45327
361 Ga0209256_1001048 3300025299 Bacteria 32169
362 Ga0209256_1001371 3300025299 Bacteria 25602
363 Ga0209256_1004147 3300025299 Bacteria 9357
364 Ga0209256_1004371 3300025299 Bacteria 8941
365 Ga0209256_1010809 3300025299 Bacteria 3756
366 Ga0209256_1023871 3300025299 Bacteria 1814
367 Ga0209256_1048199 3300025299 Bacteria 1044
368 Ga0207426_1000003 3300025302 Bacteria 1063212
369 Ga0207426_1000010 3300025302 Bacteria 796003
370 Ga0207426_1000094 3300025302 Bacteria 275293
371 Ga0207426_1000111 3300025302 Bacteria 234032
372 Ga0207426_1001840 3300025302 Bacteria 15628
373 Ga0209051_1000095 3300025303 Bacteria 167840
374 Ga0209051_1001031 3300025303 Bacteria 26450
375 Ga0209051_1001191 3300025303 Bacteria 23500
376 Ga0209051_1003503 3300025303 Bacteria 10260
377 Ga0209051_1007144 3300025303 Bacteria 6154
378 Ga0209051_1008543 3300025303 Bacteria 5410
379 Ga0209051_1017165 3300025303 Bacteria 3243
380 Ga0209051_1072572 3300025303 Bacteria 1029
381 Ga0209257_1001962 3300025304 Bacteria 22185
382 Ga0209257_1003296 3300025304 Bacteria 14065
383 Ga0209257_1010294 3300025304 Bacteria 4766
384 Ga0209257_1060930 3300025304 Bacteria 1025
385 Ga0207656_10064226 3300025321 Bacteria 1618
386 Ga0207653_10001674 3300025885 Bacteria 7097
387 Ga0207647_10072033 3300025904 Bacteria 2084
388 Ga0207647_10402909 3300025904 Bacteria 771
389 Ga0207685_10391020 3300025905 Bacteria 711
390 Ga0207705_10743623 3300025909 Bacteria 762
391 Ga0207654_10024617 3300025911 Bacteria 3238
392 Ga0207654_10119520 3300025911 Bacteria 1652
393 Ga0207654_10161375 3300025911 Bacteria 1448
394 Ga0207654_10581839 3300025911 Bacteria 797
395 Ga0207707_10027670 3300025912 Bacteria 4958
396 Ga0207695_10000011 3300025913 Bacteria 910221
397 Ga0207695_10116388 3300025913 Bacteria 2647
398 Ga0207695_10416388 3300025913 Bacteria 1228
399 Ga0207695_10881666 3300025913 Bacteria 774
400 Ga0207671_10001291 3300025914 Bacteria 29425
401 Ga0207671_10057729 3300025914 Bacteria 2877
402 Ga0207671_10068428 3300025914 Bacteria 2646
403 Ga0207660_10113774 3300025917 Bacteria 2040
404 Ga0207662_10084295 3300025918 Bacteria 1944
405 Ga0207657_10208952 3300025919 Bacteria 1567
406 Ga0207652_10040467 3300025921 Bacteria 3958
407 Ga0207681_11041881 3300025923 Bacteria 687
408 Ga0207694_10018894 3300025924 Bacteria 5211
409 Ga0207650_10002090 3300025925 Bacteria 13962
410 Ga0207650_10101930 3300025925 Bacteria 2211
411 Ga0207687_10068838 3300025927 Bacteria 2522
412 Ga0207687_10449791 3300025927 Bacteria 1068
413 Ga0207687_10734934 3300025927 Bacteria 839
414 Ga0207644_10136348 3300025931 Bacteria 1885
415 Ga0207690_10022460 3300025932 Bacteria 3926
416 Ga0207706_10039545 3300025933 Bacteria 4182
417 Ga0207706_10967608 3300025933 Bacteria 716
418 Ga0207709_10114712 3300025935 Bacteria 1808
419 Ga0207709_10323219 3300025935 Bacteria 1156
420 Ga0207709_10324599 3300025935 Bacteria 1153
421 Ga0207669_10229582 3300025937 Bacteria 1368
422 Ga0207704_10877843 3300025938 Bacteria 753
423 Ga0207665_10065871 3300025939 Bacteria 2464
424 Ga0207667_10060300 3300025949 Bacteria 3971
425 Ga0207667_10375499 3300025949 Bacteria 1449
426 Ga0207667_10888412 3300025949 Bacteria 883
427 Ga0207712_10003210 3300025961 Bacteria 10390
428 Ga0207712_11567645 3300025961 Bacteria 590
429 Ga0207668_10454674 3300025972 Bacteria 1094
430 Ga0207668_10488791 3300025972 Bacteria 1057
431 Ga0207668_12083217 3300025972 Bacteria 511
432 Ga0207640_11271407 3300025981 Unclassified 656
433 Ga0207658_10195410 3300025986 Bacteria 1685
434 Ga0207658_10549102 3300025986 Bacteria 1034
435 Ga0207703_10281150 3300026035 Bacteria 1511
436 Ga0207639_10032104 3300026041 Bacteria 3863
437 Ga0207639_10290502 3300026041 Bacteria 1441
438 Ga0207678_10015487 3300026067 Bacteria 6703
439 Ga0207678_11150419 3300026067 Unclassified 687
440 Ga0207708_10002508 3300026075 Bacteria 13503
441 Ga0207702_10055211 3300026078 Bacteria 3368
442 Ga0207702_10076099 3300026078 Bacteria 2901
443 Ga0207702_10222409 3300026078 Bacteria 1759
444 Ga0207641_10307664 3300026088 Bacteria 1499
445 Ga0207648_10166316 3300026089 Bacteria 1949
446 Ga0207676_10078838 3300026095 Bacteria 2669
447 Ga0207674_10071651 3300026116 Bacteria 3481
448 Ga0207674_10154489 3300026116 Bacteria 2250
449 Ga0207674_10244903 3300026116 Bacteria 1740
450 Ga0207675_101058742 3300026118 Bacteria 830
451 Ga0207683_10197424 3300026121 Bacteria 1828
452 Ga0207698_10391441 3300026142 Bacteria 1325
453 Ga0207698_10750481 3300026142 Bacteria 975
454 Ga0209281_1000310 3300027111 Bacteria 87212
455 Ga0209281_1000334 3300027111 Bacteria 81109
456 Ga0209281_1000361 3300027111 Bacteria 74287
457 Ga0209371_1000021 3300027312 Bacteria 555864
458 Ga0209371_1000469 3300027312 Bacteria 39757
459 Ga0209371_1001465 3300027312 Bacteria 15917
460 Ga0209282_1000073 3300027666 Bacteria 81125
461 Ga0209282_1000162 3300027666 Bacteria 38224
462 Ga0209282_1182870 3300027666 Bacteria 981
463 Ga0209588_1004150 3300027671 Bacteria 4064
464 Ga0209588_1123431 3300027671 Unclassified 828
465 Ga0209813_10117222 3300027866 Bacteria 923
466 Ga0268266_10182102 3300028379 Bacteria 1913
467 Ga0268266_10220018 3300028379 Bacteria 1745
468 Ga0268266_10817448 3300028379 Bacteria 900
469 Ga0268265_10014314 3300028380 Bacteria 5402
470 Ga0268264_10003917 3300028381 Bacteria 12744
471 Ga0268264_10773687 3300028381 Bacteria 958
472 Ga0307515_10000844 3300028794 Bacteria 70375
473 Ga0307515_10004389 3300028794 Bacteria 29220
474 Ga0307515_10013773 3300028794 Bacteria 15073
475 Ga0307515_10020621 3300028794 Bacteria 11742
476 Ga0307515_10767339 3300028794 Bacteria 584
477 Ga0268256_1000020 3300030500 Bacteria 557873
478 Ga0268256_1001794 3300030500 Bacteria 12086
479 Ga0268256_1003189 3300030500 Bacteria 7611
480 Ga0307513_10002223 3300031456 Bacteria 27113
481 Ga0307513_10134632 3300031456 Bacteria 2409
482 Ga0307513_10674661 3300031456 Bacteria 740
483 Ga0307408_100164938 3300031548 Bacteria 1763
484 Ga0307408_100731680 3300031548 Bacteria 892
485 Ga0307514_10300077 3300031649 Bacteria 901
486 Ga0307413_10429669 3300031824 Bacteria 1043
487 Ga0307410_10349349 3300031852 Bacteria 1181
488 Ga0307406_10459222 3300031901 Bacteria 1024
489 Ga0307412_10083096 3300031911 Bacteria 2219
490 Ga0307412_10914255 3300031911 Bacteria 770
491 Ga0307412_11859820 3300031911 Bacteria 555
492 Ga0315914_1000008 3300031967 Bacteria 209133
493 Ga0307409_100255774 3300031995 Bacteria 1604
494 Ga0307416_100266271 3300032002 Bacteria 1679
495 Ga0307416_100668926 3300032002 Bacteria 1125
496 Ga0307414_10072609 3300032004 Bacteria 2486
497 Ga0307411_10544797 3300032005 Bacteria 989
498 Ga0316593_10129338 3300032168 Bacteria 910
499 Ga0307510_10380280 3300033180 Bacteria 857
500 Ga0315913_1000688 3300033430 Bacteria 32300
501 Ga0315915_1000014 3300033464 Bacteria 171068
502 Ga0373934_0000226 3300035086 Bacteria 20517
503 Ga0373934_0004407 3300035086 Bacteria 5200
504 Ga0373952_0071202 3300035092 Bacteria 870
505 Ga0373923_0004582 3300035111 Bacteria 4600
506 Ga0373923_0068921 3300035111 Bacteria 1516
507 Ga0373923_0257184 3300035111 Bacteria 818
508 Ga0373932_0296923 3300035112 Bacteria 602
509 Ga0373936_0007633 3300035113 Bacteria 4064
510 Ga0373939_0115591 3300035114 Bacteria 940
511 Ga0373953_0002165 3300035117 Bacteria 5877
512 Ga0373953_0086933 3300035117 Bacteria 1305
513 Ga0373953_0201701 3300035117 Bacteria 860
514 Ga0373954_0007204 3300035118 Bacteria 4858
515 Ga0373954_0014860 3300035118 Bacteria 3474
516 Ga0373956_0000177 3300035119 Bacteria 24286
517 Ga0373956_0002563 3300035119 Bacteria 7384
518 Ga0373957_0012200 3300035120 Bacteria 2887
519 Ga0373943_0011672 3300035170 Bacteria 3955
520 Ga0373946_0369115 3300035171 Bacteria 720
521 Ga0373955_0161588 3300035172 Unclassified 1322
522 Ga0373955_0182539 3300035172 Bacteria 1245
523 Ga0373955_0951468 3300035172 Unclassified 529
524 Ga0316574_0038897 3300035398 Bacteria 2922
525 Ga0316574_0167518 3300035398 Bacteria 1415
526 Ga0373924_0012475 3300035410 Bacteria 3175
527 Ga0373935_0059231 3300035692 Bacteria 2447
528 Ga0373927_0000055 3300035695 Bacteria 81098
529 Ga0373933_0000312 3300035724 Bacteria 31477
530 Ga0373933_0052360 3300035724 Bacteria 2442
531 Ga0373933_0445669 3300035724 Bacteria 846
532 Ga0373947_0318717 3300035725 Bacteria 1039
533 Ga0373937_0000096 3300036401 Bacteria 81963
534 Ga0373937_0155279 3300036401 Bacteria 2144
535 Ga0373937_0482522 3300036401 Bacteria 1177
536 Ga0316582_0060645 3300036647 Bacteria 2426
537 Ga0316584_0016744 3300036712 Bacteria 5260
538 Ga0373925_0002979 3300037068 Bacteria 13365
539 Ga0373925_0054502 3300037068 Bacteria 2991
540 Ga0395899_0000213 3300037312 Bacteria 83403
541 Ga0395900_0000121 3300037418 Bacteria 135026
542 Ga0395900_0022761 3300037418 Bacteria 6413
543 Ga0395900_0246642 3300037418 Bacteria 1789
544 Ga0395900_0560544 3300037418 Bacteria 1086
545 Ga0395898_0000247 3300037466 Bacteria 135026
546 Ga0395905_0000112 3300037471 Bacteria 135010
547 Ga0395905_0000325 3300037471 Bacteria 68813
548 Ga0395905_0013938 3300037471 Bacteria 7688
549 Ga0395905_0018905 3300037471 Bacteria 6534
550 Ga0395905_0105392 3300037471 Bacteria 2647
551 Ga0395905_0341137 3300037471 Bacteria 1389
552 Ga0395901_0000078 3300038443 Bacteria 135026
553 Ga0395901_0068865 3300038443 Bacteria 3686
554 Ga0395901_0108822 3300038443 Bacteria 2909
555 Ga0395901_0659512 3300038443 Bacteria 1048
556 Ga0439436_0063219 3300041404 Bacteria 1034
557 Ga0439439_0032082 3300041406 Bacteria 1341
558 Ga0439439_0047680 3300041406 Bacteria 1120
559 Ga0439465_0014361 3300041413 Bacteria 2468
560 Ga0439465_0016011 3300041413 Bacteria 2338
561 Ga0439465_0019035 3300041413 Bacteria 2146
562 Ga0439465_0074391 3300041413 Bacteria 1143
563 Ga0439465_0143370 3300041413 Bacteria 850
564 Ga0451791_1489124 3300041451 Bacteria 590
565 Ga0451793_1791429 3300041452 Bacteria 1552
566 Ga0451795_0456879 3300041456 Bacteria 756
567 Ga0451804_0736472 3300041463 Bacteria 1023
568 Ga0451833_0281263 3300041491 Bacteria 1433
569 Ga0451835_0487550 3300041492 Bacteria 917
570 Ga0451837_1680411 3300041494 Bacteria 647
571 Ga0451840_11095 3300041497 Bacteria 756
572 Ga0451841_1014141 3300041498 Bacteria 1841
573 Ga0451845_0513581 3300041501 Bacteria 2368
574 Ga0451846_68000 3300041502 Bacteria 565
575 Ga0451847_0867267 3300041503 Bacteria 1815
576 Ga0451849_1243659 3300041505 Bacteria 1587
577 Ga0451851_0085356 3300041507 Bacteria 2421
578 Ga0451851_0906446 3300041507 Bacteria 1180
579 Ga0451843_0556366 3300041509 Bacteria 3307
580 Ga0451855_0767112 3300041511 Bacteria 1369
581 Ga0451855_1623492 3300041511 Bacteria 537
582 Ga0451853_0114112 3300041512 Bacteria 3097
583 Ga0451853_1600377 3300041512 Bacteria 1441
584 Ga0439431_0084742 3300041997 Bacteria 858
585 Ga0439437_031430 3300042000 Bacteria 668
586 Ga0439432_035895 3300042006 Bacteria 1588
587 Ga0439432_091543 3300042006 Bacteria 915
588 Ga0439449_0024497 3300042007 Bacteria 2256
589 Ga0439449_0030648 3300042007 Bacteria 2005
590 Ga0439449_0113867 3300042007 Bacteria 1002
591 Ga0439455_0113540 3300042012 Bacteria 755
592 Ga0450920_061976 3300042122 Bacteria 756
593 Ga0439458_0151510 3300042157 Bacteria 621
594 Ga0439434_0136733 3300042435 Bacteria 806
595 Ga0450918_083669 3300042531 Bacteria 611
596 Ga0466972_0066750 3300044658 Bacteria 1720
597 Ga0466965_0097468 3300044683 Bacteria 1501
598 Ga0466966_0037410 3300044684 Bacteria 3130
599 Ga0466963_0014097 3300044694 Bacteria 4925
600 Ga0466968_0298045 3300044735 Bacteria 775
601 Ga0466970_0005266 3300044765 Bacteria 6405
602 Ga0466960_0196335 3300044901 Bacteria 1100
603 Ga0466967_0358143 3300045976 Bacteria 1413
604 Ga0466967_0536706 3300045976 Bacteria 1150
605 Ga0495592_0000886 3300046454 Bacteria 20768
606 Ga0495592_0111349 3300046454 Bacteria 1937
607 Ga0495592_0152555 3300046454 Bacteria 1596
608 Ga0495603_0783841 3300046455 Unclassified 544
609 Ga0495590_0338167 3300046457 Bacteria 571
610 Ga0495629_0037247 3300046459 Bacteria 3428
611 Ga0495629_0091148 3300046459 Bacteria 2127
612 Ga0495629_0108595 3300046459 Bacteria 1935
613 Ga0495638_0011505 3300046460 Bacteria 6094
614 Ga0495638_0112270 3300046460 Bacteria 1617
615 Ga0495638_0134219 3300046460 Bacteria 1451
616 Ga0495641_0007023 3300046461 Bacteria 7144
617 Ga0495651_0001037 3300046462 Bacteria 21470
618 Ga0495651_0012125 3300046462 Bacteria 6633
619 Ga0495653_0006555 3300046463 Bacteria 9552
620 Ga0495650_0170839 3300046471 Bacteria 770
621 Ga0495639_0002333 3300046475 Bacteria 8294
622 Ga0495662_0011759 3300046476 Bacteria 4278
623 Ga0495662_0049854 3300046476 Bacteria 2021
624 Ga0495664_0022744 3300046477 Bacteria 3636
625 Ga0495585_0030296 3300046492 Bacteria 3078
626 Ga0495585_0045607 3300046492 Bacteria 2446
627 Ga0495607_0082802 3300046501 Bacteria 1759
628 Ga0495583_0091176 3300046506 Bacteria 1312
629 Ga0495610_0010608 3300046512 Bacteria 5711
630 Ga0495610_0075657 3300046512 Bacteria 1558
631 Ga0495616_0026034 3300046513 Bacteria 3118
632 Ga0495616_0287975 3300046513 Bacteria 697
633 Ga0495618_0010612 3300046514 Bacteria 5574
634 Ga0495618_0202102 3300046514 Bacteria 1257
635 Ga0495620_0031522 3300046515 Bacteria 2429
636 Ga0495620_0062294 3300046515 Bacteria 1549
637 Ga0495620_0066156 3300046515 Bacteria 1490
638 Ga0495628_0060049 3300046516 Bacteria 2984
639 Ga0495628_0200303 3300046516 Bacteria 1504
640 Ga0495630_0001439 3300046517 Bacteria 16463
641 Ga0495631_0082915 3300046518 Bacteria 1382
642 Ga0495631_0183483 3300046518 Bacteria 896
643 Ga0495632_0017000 3300046519 Bacteria 4029
644 Ga0495632_0287786 3300046519 Bacteria 731
645 Ga0495643_0001636 3300046522 Bacteria 19772
646 Ga0495643_0027496 3300046522 Bacteria 3195
647 Ga0495648_0076360 3300046524 Bacteria 1924
648 Ga0495666_0017744 3300046526 Bacteria 3543
649 Ga0495652_0149866 3300046529 Bacteria 1824
650 Ga0495652_0151995 3300046529 Bacteria 1808
651 Ga0495652_0652893 3300046529 Bacteria 712
652 Ga0495654_0006825 3300046530 Bacteria 6442
653 Ga0495654_0047409 3300046530 Bacteria 2112
654 Ga0495654_0056366 3300046530 Bacteria 1900
655 Ga0495640_0008228 3300046533 Bacteria 8184
656 Ga0495586_0010436 3300046535 Bacteria 4936
657 Ga0495587_0069446 3300046536 Bacteria 2051
658 Ga0495587_0317009 3300046536 Bacteria 871
659 Ga0495609_0025916 3300046538 Bacteria 2686
660 Ga0495633_0058720 3300046558 Bacteria 1805
661 Ga0495667_0086244 3300046559 Bacteria 2036
662 Ga0495667_0114995 3300046559 Bacteria 1738
663 Ga0495667_0154021 3300046559 Bacteria 1479
664 Ga0495656_0166823 3300046615 Bacteria 1074
665 Ga0495668_0038831 3300046616 Bacteria 2659
666 Ga0495668_0101187 3300046616 Bacteria 1577
667 Ga0495668_0121572 3300046616 Bacteria 1428
668 Ga0495668_0133404 3300046616 Bacteria 1359
669 Ga0495634_0026780 3300046642 Bacteria 4019
670 Ga0495634_0133055 3300046642 Bacteria 1584
671 Ga0495611_0009786 3300046648 Bacteria 4053
672 Ga0495625_0022163 3300046660 Bacteria 4874
673 Ga0495625_0044796 3300046660 Bacteria 3201
674 Ga0495625_0056641 3300046660 Bacteria 2789
675 Ga0495635_0086793 3300046663 Bacteria 2141
676 Ga0495635_0161182 3300046663 Bacteria 1526
677 Ga0495588_0048733 3300046674 Bacteria 2177
678 Ga0495588_0370574 3300046674 Bacteria 752
679 Ga0495657_0014287 3300046675 Bacteria 5832
680 Ga0495657_0085419 3300046675 Bacteria 2034
681 Ga0495657_0091190 3300046675 Bacteria 1955
682 Ga0495599_0032502 3300046678 Bacteria 3275
683 Ga0495658_0004331 3300046683 Bacteria 6991
684 Ga0495624_0113855 3300046690 Bacteria 1663
685 Ga0495624_0319834 3300046690 Bacteria 935
686 Ga0495670_0031733 3300046691 Bacteria 2626
687 Ga0495670_0363084 3300046691 Bacteria 780
688 Ga0495671_0310575 3300046692 Bacteria 758
689 Ga0495649_0122502 3300046694 Bacteria 1374
690 Ga0495649_0226196 3300046694 Bacteria 967
691 Ga0495600_0000925 3300046809 Bacteria 15753
692 Ga0495600_0036061 3300046809 Bacteria 3213
693 Ga0495660_0191214 3300046810 Bacteria 983
694 Ga0495604_0021238 3300047317 Bacteria 5182
695 Ga0495604_0024264 3300047317 Bacteria 4839
696 Ga0495636_0044906 3300047318 Bacteria 1841
697 Ga0495636_0080229 3300047318 Bacteria 1404
698 Ga0495636_0160057 3300047318 Bacteria 1014
699 Ga0495674_0005040 3300047319 Bacteria 12704
700 Ga0495672_0021456 3300047320 Bacteria 4213
701 Ga0495676_0917551 3300047321 Bacteria 561
702 Ga0495680_0012165 3300047322 Bacteria 7593
703 Ga0495680_0232488 3300047322 Bacteria 1312
704 Ga0495680_0468693 3300047322 Bacteria 859
705 Ga0495683_0398430 3300047323 Bacteria 573
706 Ga0495687_066877 3300047443 Bacteria 1457
707 Ga0495687_227815 3300047443 Bacteria 571
708 Ga0495675_0003423 3300047444 Bacteria 9556
709 Ga0495675_0033960 3300047444 Bacteria 3257
710 Ga0495675_0175941 3300047444 Bacteria 1312
711 Ga0495675_0580147 3300047444 Bacteria 637
712 Ga0495685_062052 3300047447 Bacteria 1259
713 Ga0495684_0062577 3300047471 Bacteria 2830
714 Ga0495684_0107115 3300047471 Bacteria 2111
715 Ga0495684_1010807 3300047471 Bacteria 528
716 Ga0495686_0004865 3300047472 Bacteria 10832
717 Ga0495686_0119407 3300047472 Bacteria 1573
718 Ga0495686_0157036 3300047472 Bacteria 1332
719 Ga0495686_0180354 3300047472 Bacteria 1224
720 Ga0495686_0221559 3300047472 Bacteria 1076
721 Ga0495686_0245842 3300047472 Bacteria 1007
722 Ga0495686_0345242 3300047472 Bacteria 810
723 Ga0495593_0529683 3300047673 Bacteria 591
724 Ga0495614_0035261 3300048089 Bacteria 2150
725 Ga0495615_0115979 3300048090 Bacteria 770
726 Ga0495626_0162717 3300048091 Bacteria 935
727 Ga0495626_0198657 3300048091 Bacteria 823
728 Ga0496100_0012838 3300048903 Bacteria 4815
729 Ga0496101_0208502 3300048904 Bacteria 1513
730 Ga0496102_0008570 3300048905 Bacteria 8769
731 Ga0496102_0014003 3300048905 Bacteria 6964
732 Ga0496102_0177393 3300048905 Bacteria 2007
733 Ga0496102_0296643 3300048905 Bacteria 1524
734 Ga0496102_0766906 3300048905 Bacteria 887
735 Ga0496103_0010686 3300048906 Bacteria 5431
736 Ga0496103_0017556 3300048906 Bacteria 4283
737 Ga0496104_0066142 3300048907 Bacteria 3432
738 Ga0496105_0182249 3300048908 Bacteria 1719
739 Ga0496105_0208925 3300048908 Bacteria 1592
740 Ga0496106_0001217 3300048909 Bacteria 19264
741 Ga0496106_0004921 3300048909 Bacteria 9886
742 Ga0496106_0452007 3300048909 Bacteria 1032
743 Ga0496108_0114926 3300048911 Bacteria 2305
744 Ga0496108_0371611 3300048911 Bacteria 1248
745 Ga0496109_0132401 3300048912 Bacteria 2328
746 Ga0496109_0301457 3300048912 Bacteria 1511
747 Ga0496109_1146305 3300048912 Bacteria 714
748 Ga0496110_0180740 3300048913 Bacteria 1915
749 Ga0496110_0802990 3300048913 Bacteria 845
750 Ga0496110_1133930 3300048913 Bacteria 690
751 Ga0496113_0312317 3300048916 Bacteria 1259
752 Ga0496113_0377285 3300048916 Bacteria 1138
753 Ga0496113_0570148 3300048916 Bacteria 907
754 Ga0496114_0236430 3300048917 Bacteria 1606
755 Ga0496114_0584059 3300048917 Bacteria 986
756 Ga0496115_0023828 3300048918 Bacteria 4753
757 Ga0496115_0237130 3300048918 Bacteria 1504
758 Ga0496115_0653995 3300048918 Bacteria 830
759 Ga0496116_0000043 3300048919 Bacteria 328085
760 Ga0496116_0008089 3300048919 Bacteria 9192
761 Ga0496116_0043036 3300048919 Bacteria 3080
762 Ga0496116_0103446 3300048919 Bacteria 1694
763 Ga0496117_0000338 3300048920 Bacteria 82688
764 Ga0496117_0089281 3300048920 Bacteria 1991
765 Ga0496117_0109558 3300048920 Bacteria 1724
766 Ga0496117_0109935 3300048920 Bacteria 1720
767 Ga0496118_0000958 3300048921 Bacteria 45054
768 Ga0496118_0019045 3300048921 Bacteria 6152
769 Ga0496118_0225279 3300048921 Bacteria 1087
770 Ga0496118_0428829 3300048921 Bacteria 678
771 Ga0496118_0497471 3300048921 Bacteria 607
772 Ga0496118_0566227 3300048921 Bacteria 551
773 Ga0496119_0004440 3300048922 Bacteria 13967
774 Ga0496119_0111222 3300048922 Bacteria 1520
775 Ga0496119_0163672 3300048922 Bacteria 1180
776 Ga0496119_0193562 3300048922 Bacteria 1058
777 Ga0496119_0243093 3300048922 Bacteria 911
778 Ga0496120_0000589 3300048923 Bacteria 55133
779 Ga0496120_0001472 3300048923 Bacteria 28063
780 Ga0496120_0069230 3300048923 Bacteria 1944
781 Ga0496120_0187793 3300048923 Bacteria 1010
782 Ga0496121_0002723 3300048924 Bacteria 26365
783 Ga0496121_0009248 3300048924 Bacteria 11379
784 Ga0496121_0009941 3300048924 Bacteria 10830
785 Ga0496121_0027323 3300048924 Bacteria 5341
786 Ga0496121_0038973 3300048924 Bacteria 4197
787 Ga0496121_0074244 3300048924 Bacteria 2721
788 Ga0496121_0082726 3300048924 Bacteria 2536
789 Ga0496121_0088329 3300048924 Bacteria 2430
790 Ga0496121_0206430 3300048924 Bacteria 1395
791 Ga0496121_0229266 3300048924 Bacteria 1302
792 Ga0496121_0879236 3300048924 Bacteria 518
793 Ga0496122_0000025 3300048925 Bacteria 362915
794 Ga0496122_0016499 3300048925 Bacteria 6981
795 Ga0496122_0018139 3300048925 Bacteria 6519
796 Ga0496122_0055102 3300048925 Bacteria 2978
797 Ga0496122_0062877 3300048925 Bacteria 2714
798 Ga0496122_0093482 3300048925 Bacteria 2039
799 Ga0496122_0246008 3300048925 Bacteria 1004
800 Ga0496123_0000032 3300048926 Bacteria 285282
801 Ga0496123_0000043 3300048926 Bacteria 253752
802 Ga0496123_0012797 3300048926 Bacteria 7114
803 Ga0496123_0016748 3300048926 Bacteria 5931
804 Ga0496123_0064778 3300048926 Bacteria 2327
805 Ga0496123_0079012 3300048926 Bacteria 2012
806 Ga0496123_0263882 3300048926 Bacteria 842
807 Ga0496123_0422272 3300048926 Bacteria 601
808 Ga0496124_0017870 3300048927 Bacteria 6667
809 Ga0496124_0023770 3300048927 Bacteria 5586
810 Ga0496124_0025733 3300048927 Bacteria 5322
811 Ga0496124_0061282 3300048927 Bacteria 3153
812 Ga0496124_0274378 3300048927 Bacteria 1233
813 Ga0496124_0298730 3300048927 Bacteria 1164
814 Ga0496125_0000946 3300048928 Bacteria 45578
815 Ga0496125_0025175 3300048928 Bacteria 5456
816 Ga0496125_0027520 3300048928 Bacteria 5152
817 Ga0496125_0066860 3300048928 Bacteria 2837
818 Ga0496125_0141564 3300048928 Bacteria 1671
819 Ga0496125_0169920 3300048928 Bacteria 1467
820 Ga0496125_0283632 3300048928 Bacteria 1024
821 Ga0496125_0310552 3300048928 Bacteria 961
822 Ga0496126_0000362 3300048929 Bacteria 94734
823 Ga0496126_0034554 3300048929 Bacteria 4747
824 Ga0496126_0047224 3300048929 Bacteria 3943
825 Ga0496126_0244916 3300048929 Bacteria 1496
826 Ga0496126_0266039 3300048929 Bacteria 1424
827 Ga0496126_0267396 3300048929 Bacteria 1420
828 Ga0496126_0340153 3300048929 Bacteria 1229
829 Ga0496126_0445237 3300048929 Bacteria 1043
830 Ga0496126_0756347 3300048929 Bacteria 750
831 Ga0501031_0000095 3300049568 Bacteria 47538
832 Ga0501031_0418336 3300049568 Bacteria 866
833 Ga0501032_0000064 3300049569 Bacteria 91971
834 Ga0501032_0000084 3300049569 Bacteria 82148
835 Ga0501032_0002338 3300049569 Bacteria 14870
836 Ga0501032_0048602 3300049569 Bacteria 2864
837 Ga0501032_1008883 3300049569 Bacteria 523
838 Ga0501033_0000102 3300049570 Bacteria 81583
839 Ga0501033_0000286 3300049570 Bacteria 48628
840 Ga0501033_0007597 3300049570 Bacteria 8429
841 Ga0501033_0020657 3300049570 Bacteria 4975
842 Ga0501033_0029534 3300049570 Bacteria 4119
843 Ga0501033_0050740 3300049570 Bacteria 3076
844 Ga0501033_0083256 3300049570 Bacteria 2345
845 Ga0501033_0528873 3300049570 Bacteria 814
846 Ga0501033_0904293 3300049570 Bacteria 593
847 Ga0501034_0000174 3300049571 Bacteria 119615
848 Ga0501034_0001404 3300049571 Bacteria 32372
849 Ga0501034_0002078 3300049571 Bacteria 24998
850 Ga0501034_0090803 3300049571 Bacteria 3051
851 Ga0501034_0125398 3300049571 Bacteria 2553
852 Ga0501034_0202154 3300049571 Bacteria 1944
853 Ga0501034_0240027 3300049571 Bacteria 1759
854 Ga0501034_0339786 3300049571 Bacteria 1431
855 Ga0501034_0655917 3300049571 Bacteria 951
856 Ga0501034_0831896 3300049571 Bacteria 814
857 Ga0501036_0000040 3300049572 Bacteria 81588
858 Ga0501036_0011420 3300049572 Bacteria 7352
859 Ga0501036_0064582 3300049572 Bacteria 3098
860 Ga0501036_0122760 3300049572 Bacteria 2193
861 Ga0501036_0160163 3300049572 Bacteria 1897
862 Ga0501037_0000098 3300049573 Bacteria 81588
863 Ga0501037_0009152 3300049573 Bacteria 7255
864 Ga0501037_0095169 3300049573 Bacteria 2153
865 Ga0501037_0127415 3300049573 Bacteria 1827
866 Ga0501037_0403344 3300049573 Bacteria 937
867 Ga0501037_0456452 3300049573 Bacteria 871
868 Ga0501038_0000002 3300049574 Bacteria 330446
869 Ga0501038_0000031 3300049574 Bacteria 132231
870 Ga0501038_0022666 3300049574 Bacteria 5622
871 Ga0501038_0031557 3300049574 Bacteria 4682
872 Ga0501038_0117560 3300049574 Bacteria 2196
873 Ga0501038_0272214 3300049574 Bacteria 1335
874 Ga0501038_1112264 3300049574 Bacteria 576
875 Ga0501039_0000002 3300049575 Bacteria 375152
876 Ga0501039_0000057 3300049575 Bacteria 89756
877 Ga0501039_0227793 3300049575 Bacteria 1465
878 Ga0501039_0639444 3300049575 Bacteria 833
879 Ga0501040_0043172 3300049576 Bacteria 3072
880 Ga0501040_0117786 3300049576 Bacteria 1862
881 Ga0501040_0450861 3300049576 Bacteria 926
882 Ga0501040_0673642 3300049576 Bacteria 748
883 Ga0501041_0160634 3300049577 Bacteria 1405
884 Ga0501042_0137759 3300049578 Bacteria 1759
885 Ga0501043_0000048 3300049579 Bacteria 109146
886 Ga0501043_0000104 3300049579 Bacteria 78808
887 Ga0501043_0006479 3300049579 Bacteria 9399
888 Ga0501043_0074629 3300049579 Bacteria 2664
889 Ga0501043_0128235 3300049579 Bacteria 1989
890 Ga0501043_0130374 3300049579 Bacteria 1970
891 Ga0501043_0230438 3300049579 Bacteria 1431
892 Ga0501043_0674507 3300049579 Bacteria 757
893 Ga0501046_0000023 3300049580 Bacteria 213965
894 Ga0501046_0059772 3300049580 Bacteria 2984
895 Ga0501046_0175337 3300049580 Bacteria 1606
896 Ga0501046_0193784 3300049580 Bacteria 1515
897 Ga0501046_0200778 3300049580 Bacteria 1484
898 Ga0501047_0002237 3300049581 Bacteria 18521
899 Ga0501047_0027746 3300049581 Bacteria 5455
900 Ga0501047_0036169 3300049581 Bacteria 4771
901 Ga0501047_0140440 3300049581 Bacteria 2294
902 Ga0501047_0187248 3300049581 Bacteria 1934
903 Ga0501047_0292240 3300049581 Bacteria 1473
904 Ga0501047_0716479 3300049581 Bacteria 818
905 Ga0501048_0022955 3300049582 Bacteria 4560
906 Ga0501048_0038065 3300049582 Bacteria 3453
907 Ga0501048_1215189 3300049582 Bacteria 542
908 Ga0501067_0042887 3300049583 Bacteria 2513
909 Ga0501067_0271062 3300049583 Bacteria 945
910 Ga0501068_0182523 3300049584 Bacteria 1327
911 Ga0501068_0316121 3300049584 Bacteria 1001
912 Ga0501068_0319333 3300049584 Bacteria 995
913 Ga0501068_0365952 3300049584 Bacteria 927
914 Ga0501069_0000018 3300049585 Bacteria 133550
915 Ga0501069_0015350 3300049585 Bacteria 4104
916 Ga0501069_0159953 3300049585 Bacteria 1297
917 Ga0501069_0551510 3300049585 Bacteria 690
918 Ga0501070_0000048 3300049586 Bacteria 105951
919 Ga0501070_0000420 3300049586 Bacteria 38500
920 Ga0501070_0002333 3300049586 Bacteria 16663
921 Ga0501070_0041003 3300049586 Bacteria 3857
922 Ga0501070_0053889 3300049586 Bacteria 3335
923 Ga0501070_0086815 3300049586 Bacteria 2590
924 Ga0501070_0113114 3300049586 Bacteria 2243
925 Ga0501070_0271796 3300049586 Bacteria 1384
926 Ga0501070_0297951 3300049586 Bacteria 1314
927 Ga0501070_0338762 3300049586 Bacteria 1222
928 Ga0501071_0017994 3300049587 Bacteria 4886
929 Ga0501071_0094533 3300049587 Bacteria 2199
930 Ga0501071_0150442 3300049587 Bacteria 1736
931 Ga0501072_0069505 3300049588 Bacteria 2781
932 Ga0501073_0006660 3300049589 Bacteria 8605
933 Ga0501073_0072808 3300049589 Bacteria 2393
934 Ga0501073_0127897 3300049589 Bacteria 1761
935 Ga0501073_0161074 3300049589 Bacteria 1554
936 Ga0501074_0000001 3300049590 Bacteria 123588
937 Ga0501074_0054142 3300049590 Bacteria 2894
938 Ga0501074_0059274 3300049590 Bacteria 2758
939 Ga0501074_0079423 3300049590 Bacteria 2354
940 Ga0501074_0266406 3300049590 Bacteria 1218
941 Ga0501074_0452599 3300049590 Bacteria 910
942 Ga0501074_0678614 3300049590 Bacteria 727
943 Ga0501075_0181324 3300049591 Bacteria 1606
944 Ga0501076_0786847 3300049592 Bacteria 785
945 Ga0501076_1727592 3300049592 Bacteria 513
946 Ga0501079_0807143 3300049741 Bacteria 739
947 Ga0501079_1276381 3300049741 Bacteria 578
948 Ga0501080_0000197 3300049742 Bacteria 44169
949 Ga0501080_0000413 3300049742 Bacteria 32813
950 Ga0501080_0015859 3300049742 Bacteria 6951
951 Ga0501080_0133094 3300049742 Bacteria 2302
952 Ga0501080_0243232 3300049742 Bacteria 1642
953 Ga0501080_0245976 3300049742 Bacteria 1631
954 Ga0501081_0912448 3300049743 Bacteria 663
955 Ga0501083_0005530 3300049744 Bacteria 8955
956 Ga0501083_0008060 3300049744 Bacteria 7452
957 Ga0501083_0502426 3300049744 Bacteria 789
958 Ga0501083_0659780 3300049744 Bacteria 680
959 Ga0501083_0820992 3300049744 Bacteria 605
960 Ga0501280_012617 3300049776 Bacteria 1188
961 Ga0501035_0000048 3300049822 Bacteria 146466
962 Ga0501035_0000163 3300049822 Bacteria 81898
963 Ga0501035_0001343 3300049822 Bacteria 25356
964 Ga0501035_0004746 3300049822 Bacteria 12904
965 Ga0501035_0007944 3300049822 Bacteria 9902
966 Ga0501035_0063455 3300049822 Bacteria 3286
967 Ga0501035_0094218 3300049822 Bacteria 2633
968 Ga0501035_0130236 3300049822 Bacteria 2194
969 Ga0501035_0273987 3300049822 Bacteria 1428
970 Ga0501035_0307036 3300049822 Bacteria 1335
971 Ga0501035_0336768 3300049822 Bacteria 1265
972 Ga0501035_0632845 3300049822 Bacteria 869
973 Ga0501044_0000002 3300049823 Bacteria 375152
974 Ga0501044_0000003 3300049823 Bacteria 345647
975 Ga0501044_0002384 3300049823 Bacteria 21412
976 Ga0501044_0010560 3300049823 Bacteria 10015
977 Ga0501044_0020100 3300049823 Bacteria 7129
978 Ga0501044_0021489 3300049823 Bacteria 6882
979 Ga0501044_0049943 3300049823 Bacteria 4318
980 Ga0501044_0057802 3300049823 Bacteria 3979
981 Ga0501044_0187627 3300049823 Bacteria 2031
982 Ga0501044_0219738 3300049823 Bacteria 1851
983 Ga0501044_0239744 3300049823 Bacteria 1757
984 Ga0501044_0550038 3300049823 Bacteria 1051
985 Ga0501044_0590090 3300049823 Bacteria 1005
986 Ga0501045_0154648 3300049824 Bacteria 1706
987 Ga0501045_0688966 3300049824 Bacteria 754
988 nmdc:mga03683_86913_c1 3300050489 Bacteria 1358
989 nmdc:mga03n38_3751_c1 3300050490 Bacteria 4924
990 nmdc:mga03n38_65686_c1 3300050490 Bacteria 1664
991 nmdc:mga03n38_90093_c1 3300050490 Bacteria 1458
992 nmdc:mga00v17_111801_c1 3300050491 Bacteria 1733
993 nmdc:mga00v17_29610_c1 3300050491 Bacteria 3214
994 nmdc:mga00v17_498650_c1 3300050491 Bacteria 789
995 nmdc:mga0yw44_13733_c1 3300050492 Bacteria 4275
996 nmdc:mga0yw44_17832_c1 3300050492 Bacteria 3873
997 nmdc:mga0yw44_2486_c2 3300050492 Bacteria 7320
998 nmdc:mga0yw44_3537_c1 3300050492 Bacteria 5906
999 nmdc:mga0yw44_354317_c1 3300050492 Bacteria 988
1000 nmdc:mga0yw44_44196_c1 3300050492 Bacteria 2664
1001 nmdc:mga0yw44_47949_c1 3300050492 Bacteria 2574
1002 nmdc:mga0yw44_94644_c1 3300050492 Bacteria 1894
1003 nmdc:mga0k408_126867_c1 3300050493 Bacteria 1514
1004 nmdc:mga0k408_127554_c1 3300050493 Bacteria 1509
1005 nmdc:mga0k408_544382_c1 3300050493 Bacteria 686
1006 nmdc:mga06z11_18343_c1 3300050494 Bacteria 3195
1007 nmdc:mga06z11_255289_c1 3300050494 Bacteria 1033
1008 nmdc:mga06z11_320891_c1 3300050494 Bacteria 924
1009 nmdc:mga06z11_41928_c1 3300050494 Bacteria 2293
1010 nmdc:mga06z11_72589_c1 3300050494 Bacteria 1825
1011 nmdc:mga04h51_362632_c1 3300050495 Bacteria 601
1012 nmdc:mga07m45_10513_c1 3300050496 Bacteria 4836
1013 nmdc:mga07m45_200148_c1 3300050496 Bacteria 1162
1014 nmdc:mga07m45_213173_c1 3300050496 Bacteria 633
1015 nmdc:mga07m45_28645_c1 3300050496 Bacteria 3074
1016 nmdc:mga0qj67_716_c1 3300050509 Bacteria 22579
1017 nmdc:mga06r32_538_c1 3300050510 Bacteria 32874
1018 nmdc:mga08y16_1475345_c1 3300050511 Bacteria 641
1019 nmdc:mga0rr50_53176_c1 3300050513 Bacteria 3012
1020 nmdc:mga08x19_14_c1 3300050514 Bacteria 365567
1021 nmdc:mga0a205_655192_c1 3300050515 Bacteria 901
1022 nmdc:mga0sz30_15908_c1 3300050516 Bacteria 2978
1023 nmdc:mga0sz30_173779_c1 3300050516 Bacteria 955
1024 nmdc:mga0sz30_55470_c1 3300050516 Bacteria 1686
1025 nmdc:mga0sz30_7864_c1 3300050516 Bacteria 4012
1026 nmdc:mga0sz30_85576_c1 3300050516 Bacteria 1368
1027 Ga0495601_0011073 3300053077 Bacteria 5388
1028 Ga0495601_0148381 3300053077 Bacteria 1531
1029 Ga0500610_0019111 3300053079 Bacteria 3325
1030 Ga0500610_0045559 3300053079 Bacteria 2276
1031 Ga0495655_0098817 3300053083 Bacteria 861
1032 Ga0495595_0026834 3300053084 Bacteria 2561
1033 Ga0495619_0009507 3300053085 Bacteria 6133
1034 Ga0495619_0262729 3300053085 Bacteria 1196
1035 Ga0500578_0108162 3300053086 Bacteria 1754
1036 Ga0500644_0195949 3300053088 Bacteria 833
1037 Ga0500651_0208329 3300053093 Bacteria 1151
1038 Ga0500562_045885 3300053108 Bacteria 1165
1039 Ga0500594_0101165 3300053118 Bacteria 887
1040 Ga0500595_079905 3300053119 Bacteria 959
1041 Ga0500608_002494 3300053122 Bacteria 6706
1042 Ga0500618_001230 3300053125 Bacteria 11999
1043 Ga0500618_001417 3300053125 Bacteria 10714
1044 Ga0500618_005279 3300053125 Bacteria 3959
1045 Ga0500658_0001009 3300053134 Bacteria 11474
1046 Ga0500658_0015794 3300053134 Bacteria 2808
1047 Ga0500658_0357987 3300053134 Bacteria 669
1048 Ga0500559_0012609 3300053136 Bacteria 3589
1049 Ga0500559_0031862 3300053136 Bacteria 2262
1050 Ga0500568_0000175 3300053139 Bacteria 56086
1051 Ga0500568_0005268 3300053139 Bacteria 6725
1052 Ga0500568_0016433 3300053139 Bacteria 3291
1053 Ga0500577_0068985 3300053142 Bacteria 1382
1054 Ga0500604_0021875 3300053151 Bacteria 1811
1055 Ga0500616_0000417 3300053153 Bacteria 57047
1056 Ga0500616_0011795 3300053153 Bacteria 5142
1057 Ga0500616_0043680 3300053153 Bacteria 2394
1058 Ga0500616_0165368 3300053153 Bacteria 1010
1059 Ga0500616_0217736 3300053153 Bacteria 835
1060 Ga0500620_000455 3300053155 Bacteria 7365
1061 Ga0500622_0000168 3300053156 Bacteria 70303
1062 Ga0500622_0002307 3300053156 Bacteria 13947
1063 Ga0500627_0231349 3300053158 Bacteria 822
1064 Ga0500633_0001613 3300053160 Bacteria 4343
1065 Ga0500633_0148991 3300053160 Bacteria 877
1066 Ga0500636_0027374 3300053177 Bacteria 3368
1067 Ga0500636_0326033 3300053177 Bacteria 744
1068 Ga0501084_0193881 3300054114 Bacteria 1714
1069 Ga0501084_1159304 3300054114 Bacteria 648
1070 Ga0587090_026434 3300059510 Bacteria 944
1071 Ga0587092_088796 3300059512 Bacteria 621
1072 Ga0501082_0385991 3300060353 Bacteria 1222
1073 Ga0501082_0424074 3300060353 Bacteria 1162
1074 Ga0501082_0473178 3300060353 Bacteria 1095
1075 Ga0501082_0925755 3300060353 Bacteria 762
1076 2515611499 2515154107 Bacteria 6795637
1077 2503202584 2503198000 Bacteria 6884444
1078 2509107870 2508501122 Bacteria 6292184
1079 2509114391 2508501123 Bacteria 6283661
1080 2509143520 2508501127 Bacteria 7037543
1081 2509373171 2509276018 Bacteria 6910194
1082 2509376267 2509276019 Bacteria 6802256
1083 2509387057 2509276021 Bacteria 7634384
1084 2509397098 2509276022 Bacteria 6200534
1085 2509442553 2509276033 Bacteria 7180565
1086 2510132906 2510065019 Bacteria 6903379
1087 2510307044 2510065057 Bacteria 6649661
1088 2510317133 2510065059 Bacteria 6847884
1089 2510894278 2510461076 Bacteria 8618824
1090 2510899303 2510461076 Bacteria 8618824
1091 2511133710 2510917022 Bacteria 6504556
1092 2511182766 2510917028 Bacteria 6185411
1093 2511198270 2510917030 Bacteria 7460662
1094 2511501363 2511231052 Bacteria 6974333
1095 2512532782 2512047086 Bacteria 6850303
1096 2512930639 2512875016 Bacteria 6529530
1097 2512958386 2512875024 Bacteria 7195110
1098 2512971886 2512875026 Bacteria 6861065
1099 2513570007 2513237084 Bacteria 7231967
1100 2513575262 2513237085 Bacteria 7695351
1101 2513587774 2513237086 Bacteria 7265287
1102 2513598987 2513237088 Bacteria 6927906
1103 2513606288 2513237089 Bacteria 6553624
1104 2513614324 2513237090 Bacteria 7096802
1105 2513617806 2513237091 Bacteria 6900273
1106 2513633050 2513237093 Bacteria 7545552
1107 2513710229 2513237103 Bacteria 7647401
1108 2513886243 2513237140 Bacteria 7076289
1109 2513906298 2513237143 Bacteria 6664116
1110 2513909791 2513237144 Bacteria 7530820
1111 2513987427 2513237156 Bacteria 6402557
1112 2514000272 2513237159 Bacteria 6810126
1113 2514005437 2513237160 Bacteria 6650282
1114 2514019901 2513237162 Bacteria 7468464
1115 2514038351 2513237164 Bacteria 7563725
1116 2514419076 2513237305 Bacteria 7293571
1117 2514590244 2513237351 Bacteria 6968952
1118 2515111858 2515075009 Bacteria 7288508
1119 2515633643 2515154113 Bacteria 7807172
1120 2515642186 2515154114 Bacteria 7848616
1121 2515656241 2515154116 Bacteria 7552979
1122 2515738960 2515154134 Bacteria 7220242
1123 2516209237 2516143018 Bacteria 6951533
1124 2516892641 2516653046 Bacteria 6989037
1125 2517035576 2516653077 Bacteria 7555578
1126 2517076035 2516653085 Bacteria 7346596
1127 2517094775 2517093000 Bacteria 7412387
1128 2517406402 2517287029 Bacteria 6905599
1129 2517569456 2517487022 Bacteria 7227575
1130 2520376179 2519899620 Bacteria 6499161
1131 2523470292 2523231067 Bacteria 5230452
1132 2524452869 2524023207 Bacteria 6813453
1133 2524460391 2524023209 Bacteria 6679728
1134 2530645158 2529292951 Bacteria 6916614
1135 2535516175 2534681796 Bacteria 7146037
1136 2537874647 2537561587 Bacteria 5425293
1137 2551682275 2551306084 Bacteria 8942552
1138 2551684598 2551306085 Bacteria 7347181
1139 2551693596 2551306086 Bacteria 6843938
1140 2551703236 2551306087 Bacteria 7351905
1141 2551708978 2551306089 Bacteria 7162724
1142 2551719091 2551306090 Bacteria 7953713
1143 2551728214 2551306091 Bacteria 7086830
1144 2551734100 2551306092 Bacteria 6992595
1145 2551740120 2551306093 Bacteria 7064773
1146 2558863135 2558860100 Bacteria 8458965
1147 2585168289 2582581283 Bacteria 6030556
1148 2585199895 2582581294 Bacteria 6626667
1149 2585225878 2582581298 Bacteria 7315509
1150 2585230118 2582581299 Bacteria 6518058
1151 2585254382 2582581304 Bacteria 5831370
1152 2585268916 2582581306 Bacteria 6450535
1153 2585270600 2582581307 Bacteria 6597605
1154 2585276947 2582581308 Bacteria 7413247
1155 2585324053 2582581315 Bacteria 7318924
1156 2585333554 2582581316 Bacteria 7774528
1157 2585389441 2582581865 Bacteria 6644329
1158 2585393948 2582581866 Bacteria 6859583
1159 2585400733 2582581867 Bacteria 7184437
1160 2585528177 2585427526 Bacteria 7258840
1161 2585534747 2585427527 Bacteria 7273426
1162 2585540385 2585427528 Bacteria 6842387
1163 2585546838 2585427529 Bacteria 7395659
1164 2585551808 2585427530 Bacteria 7383882
1165 2585558305 2585427531 Bacteria 6992870
1166 2585819707 2585427590 Bacteria 6824633
1167 2585838584 2585427593 Bacteria 7141551
1168 2585897697 2585427608 Bacteria 6544331
1169 2585904707 2585427609 Bacteria 6667127
1170 2586000229 2585427634 Bacteria 6455027
1171 2587980177 2585428125 Bacteria 6662905
1172 2588516289 2588253730 Bacteria 6881675
1173 2597813753 2597489875 Bacteria 7010078
1174 2599333427 2599185156 Bacteria 5403036
1175 2599602214 2599185210 Bacteria 5624189
1176 2599721199 2599185236 Bacteria 6875203
1177 2599939609 2599185301 Bacteria 6161860
1178 2600192318 2599185352 Bacteria 7228948
1179 2600374446 2600254933 Bacteria 4750527
1180 2601608343 2600255279 Bacteria 5605316
1181 2601745117 2600255308 Bacteria 5611129
1182 2616292793 2615840624 Bacteria 6557588
1183 2616308320 2615840626 Bacteria 7921970
1184 2616556620 2615840698 Bacteria 7319877
1185 2617381670 2617270742 Bacteria 6808054
1186 2643775649 2643221551 Bacteria 3750538
1187 2643794096 2643221555 Bacteria 3749717
1188 2643808399 2643221557 Bacteria 7184309
1189 2643837880 2643221564 Bacteria 4193379
1190 2643855522 2643221568 Bacteria 5187270
1191 2643987147 2643221595 Bacteria 6565519
1192 2644005865 2643221599 Bacteria 6292121
1193 2644049573 2643221607 Bacteria 6314006
1194 2644066507 2643221610 Bacteria 7480339
1195 2644132121 2643221623 Bacteria 5239945
1196 2644145223 2643221626 Bacteria 8069654
1197 2644155698 2643221627 Bacteria 6761570
1198 2644193089 2643221634 Bacteria 6705461
1199 2644204019 2643221636 Bacteria 6583769
1200 2644207616 2643221637 Bacteria 5345260
1201 2644300407 2643221653 Bacteria 4569637
1202 2644307804 2643221655 Bacteria 7722067
1203 2644332580 2643221659 Bacteria 7890716
1204 2644378096 2643221668 Bacteria 7306521
1205 2644415280 2643221675 Bacteria 7473456
1206 2644450319 2643221680 Bacteria 7473610
1207 2644482607 2643221686 Bacteria 6310811
1208 2644494724 2643221688 Bacteria 5260751
1209 2644544326 2643221698 Bacteria 7756764
1210 2644613893 2643221712 Bacteria 7729434
1211 2644654577 2643221718 Bacteria 5345506
1212 2644658631 2643221719 Bacteria 4568197
1213 2644677894 2643221723 Bacteria 7095460
1214 2644687871 2643221726 Bacteria 7455827
1215 2657683713 2657244999 Bacteria 5946535
1216 2671115716 2667528174 Bacteria 6435400
1217 2688599134 2687453392 Bacteria 6880454
1218 2692316441 2690316117 Bacteria 6800650
1219 2694631980 2693429783 Bacteria 7019804
1220 2694634599 2693429784 Bacteria 7241525
1221 2719180796 2718217882 Bacteria 6556348
1222 2719385435 2718217927 Bacteria 6972593
1223 2719665262 2718217997 Bacteria 6740740
1224 2719731545 2718218009 Bacteria 6478651
1225 2720491682 2718218199 Bacteria 6740745
1226 2720612936 2718218232 Bacteria 6720332
1227 2720619795 2718218233 Bacteria 6662049
1228 2720631226 2718218235 Bacteria 6630699
1229 2720774953 2718218269 Bacteria 6906114
1230 2721146890 2718218363 Bacteria 6524337
1231 2721158417 2718218365 Bacteria 6274507
1232 2721163769 2718218366 Bacteria 6425255
1233 2721399184 2718218423 Bacteria 6438183
1234 2722839939 2721755514 Bacteria 6424414
1235 2723026590 2721755556 Bacteria 6745503
1236 2723560194 2721755684 Bacteria 6859907
1237 2723566773 2721755685 Bacteria 6704835
1238 2723576139 2721755686 Bacteria 7343952
1239 2724037997 2721755809 Bacteria 6438790
1240 2724044301 2721755810 Bacteria 6479005
1241 2724089560 2721755819 Bacteria 6906405
1242 2724104038 2721755822 Bacteria 6726041
1243 2724109854 2721755823 Bacteria 6752556
1244 2725952350 2724679232 Bacteria 7646494
1245 2730107526 2728369352 Bacteria 6745171
1246 2730164033 2728369365 Bacteria 6555560
1247 2730298049 2728369397 Bacteria 6274511
1248 2738945512 2738541317 Bacteria 5340176
1249 2739038310 2738541333 Bacteria 7106503
1250 2739307934 2738543024 Bacteria 5603683
1251 2739350329 2738543031 Bacteria 5769731
1252 2756676990 2756170246 Bacteria 7451806
1253 2757572399 2757320392 Bacteria 3737298
1254 2766067895 2765235942 Bacteria 7445910
1255 2776913332 2775507049 Bacteria 6284736
1256 2778176457 2775507266 Bacteria 7392367
1257 2792581205 2791355082 Bacteria 5973319
1258 2792623213 2791355091 Bacteria 6135441
1259 2792626977 2791355092 Bacteria 6248105
1260 2792642487 2791355094 Bacteria 7011481
1261 2792752930 2791355123 Bacteria 8049106
1262 2793299214 2791355256 Bacteria 6798008
1263 2793313851 2791355259 Bacteria 7254731
1264 2793321227 2791355260 Bacteria 6598818
1265 2793326358 2791355261 Bacteria 6661293
1266 2793336943 2791355262 Bacteria 6774204
1267 2793344842 2791355263 Bacteria 6872478
1268 2793347746 2791355264 Bacteria 6429314
1269 2793352292 2791355265 Bacteria 6539969
1270 2793360362 2791355266 Bacteria 7116587
1271 2793366430 2791355267 Bacteria 7222458
1272 2802718882 2802428858 Bacteria 6636079
1273 2802726493 2802428859 Bacteria 6667919
1274 2802733785 2802428860 Bacteria 6525526
1275 2802738391 2802428861 Bacteria 6534206
1276 2802744723 2802428862 Bacteria 6633353
1277 2802751071 2802428863 Bacteria 6410669
1278 2804751850 2802429268 Bacteria 6094027
1279 2805927619 2802429605 Bacteria 6875453
1280 2805936095 2802429606 Bacteria 6346811
1281 2806045514 2802429633 Bacteria 7341974
1282 2806051681 2802429634 Bacteria 7083200
1283 2806061725 2802429635 Bacteria 7650140
1284 2806067906 2802429636 Bacteria 7597525
1285 2806072742 2802429637 Bacteria 7067217
1286 2819241975 2818991272 Bacteria 4622173
1287 2819559995 2818991439 Bacteria 6907412
1288 2819610429 2818991448 Bacteria 6772224
1289 2819638164 2818991453 Bacteria 7181617
1290 2819687405 2818991461 Bacteria 7026071
1291 2821127710 2821123053 Bacteria 7836056
1292 2837653798 2837651117 Bacteria 3772164
1293 2837679460 2837678835 Bacteria 5252418
1294 2837682938 2837678835 Bacteria 5252418
1295 2838018790 2838016132 Bacteria 6577831
1296 2838025504 2838022645 Bacteria 6494267
1297 2838034621 2838029111 Bacteria 6603031
1298 2838043097 2838042994 Bacteria 6046894
1299 2838052138 2838048938 Bacteria 6044578
1300 2838067251 2838061910 Bacteria 6794874
1301 2838071357 2838068647 Bacteria 6208656
1302 2838670061 2838668709 Bacteria 6671819
1303 2838676413 2838675328 Bacteria 4909118
1304 2838682589 2838680041 Bacteria 6545511
1305 2838689108 2838686498 Bacteria 7807632
1306 2838697168 2838694306 Bacteria 6853137
1307 2838702433 2838701080 Bacteria 6669771
1308 2838709599 2838707686 Bacteria 6619912
1309 2838715296 2838714209 Bacteria 5525906
1310 2838720904 2838719591 Bacteria 5523910
1311 2838726054 2838724970 Bacteria 4908691
1312 2838730443 2838729681 Bacteria 7400765
1313 2838738133 2838736955 Bacteria 5760694
1314 2838743384 2838742623 Bacteria 7396178
1315 2841740380 2841734538 Bacteria 6784580
1316 2841841498 2841840854 Bacteria 5761912
1317 2841847833 2841846520 Bacteria 5345850
1318 2841854929 2841851746 Bacteria 7532261
1319 2841859629 2841859092 Bacteria 5436171
1320 2841864927 2841864319 Bacteria 6742987
1321 2842077765 2842077413 Bacteria 6508645
1322 2842110906 2842110456 Bacteria 7656360
1323 2842119726 2842118031 Bacteria 7033875
1324 2842126137 2842124991 Bacteria 5346824
1325 2842131307 2842130223 Bacteria 4909145
1326 2842141276 2842140634 Bacteria 5759631
1327 2842147022 2842146304 Bacteria 5957337
1328 2842153523 2842152218 Bacteria 4908957
1329 2842157791 2842156927 Bacteria 6894975
1330 2842165004 2842163707 Bacteria 6916235
1331 2842171539 2842170452 Bacteria 5525737
1332 2842177143 2842175837 Bacteria 4908771
1333 2842180625 2842180545 Bacteria 6888678
1334 2842188404 2842187318 Bacteria 5524014
1335 2842197017 2842192696 Bacteria 6147454
1336 2842201073 2842198810 Bacteria 6608673
1337 2842206420 2842205361 Bacteria 6340321
1338 2842212715 2842211629 Bacteria 5523832
1339 2842220603 2842217011 Bacteria 7497767
1340 2842225666 2842224351 Bacteria 5524473
1341 2842231324 2842229732 Bacteria 7475766
1342 2842239012 2842237096 Bacteria 6620661
1343 2842244562 2842243621 Bacteria 7421798
1344 2842252087 2842250916 Bacteria 6579627
1345 2842258375 2842257432 Bacteria 7401195
1346 2842267536 2842264693 Bacteria 6472963
1347 2842273128 2842271015 Bacteria 7807131
1348 2842279877 2842278818 Bacteria 6340002
1349 2842287510 2842285085 Bacteria 6011953
1350 2842291427 2842291075 Bacteria 7076806
1351 2842301856 2842298080 Bacteria 6123127
1352 2842309389 2842304105 Bacteria 7023636
1353 2842315414 2842311132 Bacteria 6616990
1354 2842318268 2842317721 Bacteria 6793725
1355 2842347157 2842341865 Bacteria 7003929
1356 2842362346 2842357229 Bacteria 6485165
1357 2842366753 2842363717 Bacteria 6844742
1358 2842373164 2842370503 Bacteria 7038661
1359 2842377823 2842377471 Bacteria 7140707
1360 2842386236 2842384541 Bacteria 7057858
1361 2842397282 2842395702 Bacteria 6780583
1362 2842404961 2842402390 Bacteria 6681310
1363 2842411543 2842409023 Bacteria 6687331
1364 2842418006 2842415677 Bacteria 6596907
1365 2842424986 2842422224 Bacteria 6239196
1366 2842431886 2842428310 Bacteria 6767288
1367 2842437999 2842434925 Bacteria 6502746
1368 2842444813 2842441272 Bacteria 6769273
1369 2842451729 2842447887 Bacteria 6754142
1370 2842465810 2842462802 Bacteria 6588055
1371 2842472616 2842469257 Bacteria 6752936
1372 2842481368 2842475841 Bacteria 6603183
1373 2842487152 2842482326 Bacteria 7212537
1374 2842492751 2842489311 Bacteria 6620893
1375 2842496539 2842495871 Bacteria 6820686
1376 2842508268 2842502639 Bacteria 6604161
1377 2842510193 2842509118 Bacteria 6850950
1378 2842516414 2842515876 Bacteria 5436280
1379 2842525941 2842521101 Bacteria 6569494
1380 2844006718 2844002411 Bacteria 7168230
1381 2844014314 2844009547 Bacteria 6728125
1382 2844459538 2844454524 Bacteria 7952546
1383 2847418491 2847417321 Bacteria 6913799
1384 2847670858 2847670302 Bacteria 6165597
1385 2847687000 2847686936 Bacteria 6278406
1386 2848993469 2848992105 Bacteria 6810864
1387 2850080793 2850079185 Bacteria 6848280
1388 2852389601 2852387548 Bacteria 8025568
1389 2854899078 2854896431 Bacteria 5869725
1390 2854916966 2854916844 Bacteria 5725939
1391 2855825454 2855825444 Bacteria 6785811
1392 2855840831 2855839649 Bacteria 7135830
1393 2855873346 2855872281 Bacteria 6964271
1394 2856316315 2856314179 Bacteria 6477897
1395 2856323617 2856320880 Bacteria 7263508
1396 2856329082 2856328259 Bacteria 6528202
1397 2856335904 2856334872 Bacteria 7037011
1398 2856346780 2856342000 Bacteria 7176905
1399 2856353279 2856349417 Bacteria 6230045
1400 2856362202 2856356410 Bacteria 6297484
1401 2856369074 2856364286 Bacteria 6939991
1402 2857355658 2857349434 Bacteria 7926032
1403 2857371157 2857367948 Bacteria 6965560
1404 2857523700 2857516855 Bacteria 7787325
1405 2857534627 2857531043 Bacteria 6754041
1406 2858801376 2858800743 Bacteria 6603254
1407 2869167954 2869162929 Bacteria 6399702
1408 2869173877 2869169390 Bacteria 6659796
1409 2869236390 2869234852 Bacteria 6654993
1410 2869247899 2869242130 Bacteria 6609239
1411 2869251105 2869249662 Bacteria 6868783
1412 2869263503 2869256925 Bacteria 6981691
1413 2869268067 2869264136 Bacteria 6880765
1414 2869272290 2869271264 Bacteria 6908218
1415 2869278888 2869278585 Bacteria 7077053
1416 2869291592 2869285874 Bacteria 6901219
1417 2871433892 2871429161 Bacteria 6547891
1418 2871443336 2871435913 Bacteria 6880295
1419 2871445827 2871444079 Bacteria 6423508
1420 2871455718 2871451962 Bacteria 7336357
1421 2871463096 2871459585 Bacteria 6866887
1422 2871469784 2871466892 Bacteria 6923287
1423 2871477692 2871474448 Bacteria 6806570
1424 2871485584 2871481445 Bacteria 6700002
1425 2871495034 2871488783 Bacteria 6929816
1426 2871500530 2871495908 Bacteria 6935695
1427 2874108168 2874102143 Bacteria 6342645
1428 2874109389 2874109183 Bacteria 6517025
1429 2874119857 2874116593 Bacteria 6674494
1430 2874125775 2874123672 Bacteria 7238285
1431 2874138158 2874131515 Bacteria 6820270
1432 2874145479 2874139085 Bacteria 7021506
1433 2874153451 2874146452 Bacteria 7533118
1434 2874160715 2874155637 Bacteria 6724144
1435 2874167887 2874162495 Bacteria 6174670
1436 2874172642 2874168670 Bacteria 8062617
1437 2876368014 2876363079 Bacteria 6544991
1438 2876385116 2876377896 Bacteria 6565995
1439 2876387864 2876386047 Bacteria 6698674
1440 2876403318 2876399893 Bacteria 6927900
1441 2876411169 2876406927 Bacteria 6191900
1442 2876419741 2876413966 Bacteria 6831344
1443 2876424923 2876420981 Bacteria 6687741
1444 2878041638 2878035449 Bacteria 6555736
1445 2878737340 2878730984 Bacteria 6380721
1446 2878743783 2878738818 Bacteria 7136951
1447 2878751504 2878745973 Bacteria 6867388
1448 2878758245 2878753008 Bacteria 6922523
1449 2878764619 2878760144 Bacteria 6823465
1450 2878771720 2878767105 Bacteria 6898628
1451 2878780088 2878774303 Bacteria 6108671
1452 2878782230 2878781027 Bacteria 6834456
1453 2878793542 2878788777 Bacteria 6567085
1454 2881152629 2881147464 Bacteria 7779814
1455 2881156196 2881155292 Bacteria 6461656
1456 2881168557 2881161766 Bacteria 7127907
1457 2881848978 2881845957 Bacteria 6611900
1458 2881860820 2881853255 Bacteria 6698367
1459 2881861879 2881861095 Bacteria 7128710
1460 2882633137 2882632389 Bacteria 8154593
1461 2882917876 2882912400 Bacteria 6801539
1462 2885310605 2885305155 Bacteria 7348390
1463 2885317368 2885312484 Bacteria 6415165
1464 2885325726 2885318864 Bacteria 6729568
1465 2885329242 2885326080 Bacteria 7134805
1466 2885335103 2885334103 Bacteria 7216818
1467 2885346511 2885342637 Bacteria 7011821
1468 2885353975 2885350715 Bacteria 6787678
1469 2888340612 2888337043 Bacteria 6629336
1470 2888356817 2888350351 Bacteria 7372807
1471 2889011869 2889010040 Bacteria 6749192
1472 2889023202 2889016732 Bacteria 6700763
1473 2891051563 2891048133 Bacteria 4447501
1474 2891375572 2891373044 Bacteria 5202277
1475 2899796386 2899792073 Bacteria 4926588
1476 2899808942 2899803654 Bacteria 5577784
1477 2903449775 2903448605 Bacteria 7357801
1478 2903495968 2903492973 Bacteria 13473544
1479 2903505488 2903492973 Bacteria 13473544
1480 2903521313 2903513507 Bacteria 6344008
1481 2903527010 2903521522 Bacteria 6525694
1482 2903533237 2903528002 Bacteria 6586099
1483 2903545343 2903540706 Bacteria 7062119
1484 2904661820 2904659560 Bacteria 6685615
1485 2906313402 2906308376 Bacteria 6841989
1486 2906326111 2906321335 Bacteria 6579571
1487 2906328427 2906328253 Bacteria 6585166
1488 2906367053 2906363423 Bacteria 6856682
1489 2906375307 2906370794 Bacteria 6881062
1490 2906390081 2906386501 Bacteria 5977019
1491 2906399185 2906393657 Bacteria 6790866
1492 2906404580 2906401398 Bacteria 6693206
1493 2906414376 2906408224 Bacteria 6162342
1494 2906416452 2906414383 Bacteria 6580790
1495 2909048097 2909042592 Bacteria 6499737
1496 2913300405 2913295892 Bacteria 6333755
1497 2913310218 2913308742 Bacteria 5350706
1498 2915651813 2915650412 Bacteria 4288180
1499 2915985197 2915980308 Bacteria 6624279
1500 2915987811 2915986958 Bacteria 6739310
1501 2915997475 2915993759 Bacteria 7016183
1502 2916003910 2916000859 Bacteria 6865702
1503 2916014445 2916007675 Bacteria 6898660
1504 2916015342 2916014648 Bacteria 6946486
1505 2916028369 2916021584 Bacteria 6854472
1506 2916034857 2916028427 Bacteria 6748433
1507 2916041164 2916035215 Bacteria 6755766
1508 2916046292 2916041962 Bacteria 6820487
1509 2916051080 2916048683 Bacteria 6543552
1510 2916060618 2916055098 Bacteria 6758838
1511 2916067396 2916061851 Bacteria 6737736
1512 2916070784 2916068649 Bacteria 6943657
1513 2916082843 2916076590 Bacteria 6596108
1514 2919107794 2919100787 Bacteria 7710546
1515 2919115389 2919114240 Bacteria 5700270
1516 2919167717 2919166419 Bacteria 4952238
1517 2919175332 2919171160 Bacteria 6499771
1518 2919409770 2919408235 Bacteria 6149349
1519 2920824204 2920822456 Bacteria 6897201
1520 2921207796 2921201388 Bacteria 6926299
1521 2921210224 2921208531 Bacteria 6745326
1522 2921243780 2921237296 Bacteria 6876710
1523 2921250336 2921244191 Bacteria 6568419
1524 2921253046 2921250672 Bacteria 6677771
1525 2921260462 2921257292 Bacteria 6808382
1526 2921270427 2921263974 Bacteria 6864552
1527 2921289136 2921282425 Bacteria 6826397
1528 2921293504 2921289301 Bacteria 7316391
1529 2921304616 2921296804 Bacteria 7176999
1530 2922136095 2922130491 Bacteria 7173936
1531 2922153788 2922151315 Bacteria 6902399
1532 2922165481 2922158528 Bacteria 6573167
1533 2922172411 2922172374 Bacteria 6167644
1534 2922192182 2922185730 Bacteria 7113964
1535 2924147583 2924144063 Bacteria 6883928
1536 2924156411 2924150972 Bacteria 7169444
1537 2924165137 2924158325 Bacteria 7188855
1538 2924172838 2924165586 Bacteria 7260590
1539 2924179339 2924172951 Bacteria 6749356
1540 2924183010 2924179722 Bacteria 6843264
1541 2924192764 2924186466 Bacteria 6876637
1542 2924197853 2924193448 Bacteria 6955718
1543 2924206429 2924200457 Bacteria 6757188
1544 2924211548 2924207177 Bacteria 6917007
1545 2924215555 2924214083 Bacteria 7080103
1546 2924223350 2924221636 Bacteria 7113495
1547 2924234677 2924228884 Bacteria 6633132
1548 2924726779 2924726620 Bacteria 6271473
1549 2924734640 2924733363 Bacteria 7574837
1550 2924745657 2924741084 Bacteria 6661321
1551 2924749311 2924748358 Bacteria 6154725
1552 2924757085 2924754689 Bacteria 6774424
1553 2924763902 2924762789 Bacteria 6561353
1554 2924781596 2924776078 Bacteria 7492003
1555 2924789535 2924784321 Bacteria 7416538
1556 2926756439 2926754445 Bacteria 5964435
1557 2933008167 2933006813 Bacteria 4912075
1558 2933012946 2933011516 Bacteria 5439334
1559 2933019229 2933016740 Bacteria 6355406
1560 2933575837 2933570622 Bacteria 7023390
1561 2933586931 2933586486 Bacteria 7667493
1562 2933595465 2933594066 Bacteria 5594265
1563 2933602156 2933599457 Bacteria 5858799
1564 2935898975 2935894831 Bacteria 6620579
1565 2935904839 2935901341 Bacteria 7341747
1566 2936373135 2936367885 Bacteria 7324495
1567 2936381280 2936375103 Bacteria 6652732
1568 2936384552 2936381700 Bacteria 7006523
1569 2936997721 2936996657 Bacteria 6298727
1570 2937007267 2937002841 Bacteria 6934057
1571 2937012428 2937009748 Bacteria 6746052
1572 2937022578 2937016420 Bacteria 6782579
1573 2937029203 2937023124 Bacteria 6815156
1574 2937031172 2937029754 Bacteria 6424026
1575 2937040882 2937036028 Bacteria 6846469
1576 2937049693 2937042894 Bacteria 6741576
1577 2937050089 2937049772 Bacteria 6757901
1578 2937059648 2937056579 Bacteria 7107896
1579 2937071211 2937063883 Bacteria 7199456
1580 2937075649 2937071275 Bacteria 6984483
1581 2937079966 2937078374 Bacteria 6610289
1582 2937089186 2937084907 Bacteria 6618516
1583 2937092271 2937091812 Bacteria 6979387
1584 2937105861 2937098957 Bacteria 7249374
1585 2937113121 2937106411 Bacteria 6947143
1586 2937117269 2937113482 Bacteria 6505872
1587 2937125326 2937119839 Bacteria 6597547
1588 2937130392 2937126314 Bacteria 6771275
1589 2937820448 2937813078 Bacteria 7783518
1590 2937827011 2937822353 Bacteria 7290551
1591 2937840066 2937836603 Bacteria 6811263
1592 2937846153 2937843397 Bacteria 5256375
1593 2937853703 2937848649 Bacteria 6983481
1594 2937862053 2937861824 Bacteria 6660327
1595 2937869549 2937868953 Bacteria 6639878
1596 2937879248 2937877337 Bacteria 7246526
1597 2937895071 2937891427 Bacteria 6357007
1598 2937975019 2937972304 Bacteria 7532020
1599 2937981721 2937980651 Bacteria 6517427
1600 2937999193 2937994558 Bacteria 7036190
1601 2938016190 2938014810 Bacteria 6700592
1602 2939670879 2939669807 Bacteria 5028511
1603 2941499838 2941499720 Bacteria 7599444
1604 2957380852 2957375807 Bacteria 6425588
1605 2957388041 2957382221 Bacteria 6737050
1606 2957394233 2957388812 Bacteria 6778072
1607 2957399339 2957395598 Bacteria 6822399
1608 2957407896 2957402308 Bacteria 6741770
1609 2957412574 2957408893 Bacteria 6558585
1610 2957416080 2957415311 Bacteria 6991633
1611 2957422943 2957422303 Bacteria 7172205
1612 2957436769 2957430029 Bacteria 7022557
1613 2957439169 2957437181 Bacteria 6568994
1614 2957450055 2957443900 Bacteria 6869977
1615 2957456758 2957450854 Bacteria 6765715
1616 2957464636 2957457609 Bacteria 6967680
1617 2957470648 2957464669 Bacteria 6568877
1618 2957472317 2957471148 Bacteria 6797643
1619 2957483513 2957478035 Bacteria 6756658
1620 2957491520 2957484790 Bacteria 6703082
1621 2957494967 2957491536 Bacteria 6695180
1622 2957505075 2957498199 Bacteria 7126688
1623 2957505862 2957505466 Bacteria 7253085
1624 2958035003 2958034702 Bacteria 6989922
1625 2958042867 2958041894 Bacteria 13082850
1626 2958067202 2958064165 Bacteria 7158582
1627 2958072495 2958071322 Bacteria 6815895
1628 2958086423 2958084443 Bacteria 7312792
1629 2958100037 2958092219 Bacteria 6861151
1630 2958103289 2958100919 Bacteria 6800575
1631 2958113334 2958108152 Bacteria 6681128
1632 2958122562 2958115193 Bacteria 6923548
1633 2958126378 2958122699 Bacteria 7280457
1634 2958135993 2958130278 Bacteria 6897202
1635 2958139663 2958137437 Bacteria 6050276
1636 2958162085 2958158011 Bacteria 6058449
1637 2958169667 2958165035 Bacteria 6906348
1638 2958177688 2958172287 Bacteria 6716688
1639 2958185459 2958179912 Bacteria 6874908
1640 2960590900 2960584000 Bacteria 6864594
1641 2960596132 2960591022 Bacteria 6622873
1642 2960602832 2960597568 Bacteria 6550735
1643 2960607250 2960603979 Bacteria 6898737
1644 2960614985 2960610863 Bacteria 6691244
1645 2960623205 2960617483 Bacteria 6727748
1646 2960628864 2960624210 Bacteria 6875384
1647 2960634638 2960631154 Bacteria 6732508
1648 2960639208 2960637947 Bacteria 7296468
1649 2960652686 2960645483 Bacteria 7211087
1650 2960653107 2960652885 Bacteria 7083688
1651 2960666729 2960660292 Bacteria 7041660
1652 2960673339 2960667422 Bacteria 6763020
1653 2960680458 2960674078 Bacteria 6609048
1654 2960686828 2960680706 Bacteria 6624464
1655 2960693813 2960687367 Bacteria 6535474
1656 2960699779 2960693952 Bacteria 6749742
1657 2961083727 2961077736 Bacteria 7079850
1658 2961116973 2961114664 Bacteria 6680456
1659 2961136397 2961127735 Bacteria 7196641
1660 2961141197 2961136820 Bacteria 6775228
1661 2961168127 2961163497 Bacteria 6901077
1662 2961174875 2961170736 Bacteria 7072258
1663 2961187944 2961183825 Bacteria 6688536
1664 2963648587 2963644680 Bacteria 6530403
1665 2964611135 2964607997 Bacteria 7101408
1666 2964620755 2964615318 Bacteria 6809089
1667 2964628858 2964621998 Bacteria 6834995
1668 2964635920 2964628898 Bacteria 7083044
1669 2964637896 2964636051 Bacteria 7091832
1670 2964649140 2964643177 Bacteria 6820887
1671 2964655804 2964649959 Bacteria 6675118
1672 2964660217 2964656573 Bacteria 7100150
1673 2964666189 2964663802 Bacteria 7019362
1674 2964678092 2964670856 Bacteria 6851364
1675 2964679327 2964678106 Bacteria 6792020
1676 2964685368 2964685014 Bacteria 6839111
1677 2964698656 2964691889 Bacteria 6802758
1678 2964702085 2964698721 Bacteria 6765331
1679 2964709240 2964705432 Bacteria 7114648
1680 2964714672 2964712639 Bacteria 6695970
1681 2964719618 2964719344 Bacteria 7286602
1682 2965022946 2965018300 Bacteria 6883036
1683 2965029236 2965025482 Bacteria 6532201
1684 2965036369 2965032056 Bacteria 6887443
1685 2965046192 2965040258 Bacteria 6855979
1686 2965067483 2965062239 Bacteria 7412989
1687 2965095016 2965089291 Bacteria 6866420
1688 2965104648 2965102966 Bacteria 6800987
1689 2965111589 2965110997 Bacteria 6693150
1690 2965121026 2965119406 Bacteria 6956431
1691 2967668631 2967664464 Bacteria 6948836
1692 2967674553 2967671571 Bacteria 7021409
1693 2967685646 2967678726 Bacteria 7264382
1694 2967688762 2967686174 Bacteria 6678622
1695 2967699145 2967693043 Bacteria 6804451
1696 2967700002 2967699805 Bacteria 6854538
1697 2967714352 2967706974 Bacteria 7186053
1698 2967720569 2967714385 Bacteria 7000047
1699 2967728170 2967721400 Bacteria 7073753
1700 2967734269 2967728569 Bacteria 6641507
1701 2967741293 2967735183 Bacteria 6827012
1702 2967744958 2967742019 Bacteria 6794534
1703 2967753385 2967748971 Bacteria 6733771
1704 2967757999 2967755722 Bacteria 6814706
1705 2967769182 2967762386 Bacteria 6923502
1706 2967775282 2967769361 Bacteria 6587838
1707 2967782812 2967775926 Bacteria 6738189
1708 2968000811 2967996073 Bacteria 6787468
1709 2968009763 2968003550 Bacteria 6929263
1710 2968017534 2968016561 Bacteria 7022047
1711 2968083815 2968083720 Bacteria 7351627
1712 2968092438 2968091066 Bacteria 6052692
1713 2968100500 2968097103 Bacteria 6107094
1714 2968112881 2968110612 Bacteria 6814636
1715 2968122887 2968117919 Bacteria 6536078
1716 2968128832 2968128360 Bacteria 6270294
1717 2968143538 2968138860 Bacteria 6605449
1718 2968176527 2968171901 Bacteria 6894245
1719 2970026397 2970019648 Bacteria 7072033
1720 2970032693 2970026789 Bacteria 6785236
1721 2970038233 2970033650 Bacteria 7118744
1722 2970041711 2970040964 Bacteria 6731123
1723 2970054889 2970047711 Bacteria 7088379
1724 2970060861 2970054988 Bacteria 6611507
1725 2970061923 2970061556 Bacteria 7099761
1726 2970075929 2970068827 Bacteria 7123112
1727 2970081103 2970076120 Bacteria 6697332
1728 2970084820 2970082768 Bacteria 6183754
1729 2970095259 2970088815 Bacteria 6933825
1730 2970099392 2970095765 Bacteria 6936963
1731 2970103654 2970102677 Bacteria 6812532
1732 2970112186 2970109326 Bacteria 6863976
1733 2970121823 2970116247 Bacteria 6501857
1734 2970127057 2970122695 Bacteria 6625855
1735 2970135110 2970129317 Bacteria 6806560
1736 2970136592 2970136068 Bacteria 7207982
1737 2970145550 2970143518 Bacteria 6446480
1738 2970155273 2970149975 Bacteria 6779706
1739 2970158381 2970156795 Bacteria 7168044
1740 2970168128 2970164137 Bacteria 6861252
1741 2970174823 2970170962 Bacteria 6876229
1742 2970181736 2970177841 Bacteria 6768001
1743 2970187949 2970184632 Bacteria 7054431
1744 2970193543 2970191845 Bacteria 7032787
1745 2970472290 2970469710 Bacteria 6969209
1746 2970489785 2970489779 Bacteria 6517260
1747 2970507461 2970503327 Bacteria 7099517
1748 2970517950 2970510686 Bacteria 7006402
1749 2970530081 2970524798 Bacteria 6840927
1750 2970538621 2970532167 Bacteria 6553173
1751 2970545617 2970540015 Bacteria 6977556
1752 2970551938 2970547951 Bacteria 6931819
1753 2970559466 2970554993 Bacteria 6814252
1754 2970593483 2970593180 Bacteria 7073582
1755 2970625003 2970619444 Bacteria 6986144
1756 2970632416 2970627176 Bacteria 6680862
1757 2977520716 2977516862 Bacteria 6940108
1758 2977524397 2977523885 Bacteria 6960446
1759 2977533829 2977530762 Bacteria 6951399
1760 2977542210 2977537788 Bacteria 6929320
1761 2977547238 2977544691 Bacteria 6875412
1762 2977557412 2977551784 Bacteria 7125765
1763 2977565871 2977558990 Bacteria 6863948
1764 2977571970 2977565890 Bacteria 6901543
1765 2977579120 2977572785 Bacteria 6763888
1766 2977585325 2977579622 Bacteria 6772100
1767 2977828682 2977821940 Bacteria 6906439
1768 2977831583 2977828996 Bacteria 7007971
1769 2977848748 2977843712 Bacteria 6753583
1770 2977854143 2977851361 Bacteria 6694324
1771 2977860982 2977858184 Bacteria 6215359
1772 2977872031 2977864932 Bacteria 7534097
1773 2977879619 2977872689 Bacteria 7270173
1774 2977906559 2977898635 Bacteria 6675551
1775 2977907984 2977907340 Bacteria 6577984
1776 2977918761 2977915119 Bacteria 6829656
1777 2977929141 2977922695 Bacteria 6956781
1778 2977937520 2977935797 Bacteria 6252826
1779 2977946123 2977942078 Bacteria 7570577
1780 2977954017 2977950692 Bacteria 6893264
1781 2977958587 2977957713 Bacteria 6877875
1782 2977987535 2977986579 Bacteria 6581278
1783 2978974172 2978969890 Bacteria 5400756
1784 2979106070 2979100975 Bacteria 5423623
1785 2979713997 2979710463 Bacteria 6785254
1786 2979747198 2979742915 Bacteria 7301278
1787 2979767352 2979764755 Bacteria 6610066
1788 2979775261 2979772303 Bacteria 6618277
1789 2979779954 2979779861 Bacteria 6219781
1790 2979795161 2979793036 Bacteria 6808957
1791 2979812657 2979808191 Bacteria 7179355
1792 2984512140 2984509177 Bacteria 5274802
1793 2984521499 2984518228 Bacteria 5277463
1794 2984540793 2984537506 Bacteria 5277481
1795 2984589500 2984587000 Bacteria 5263363
1796 2984603060 2984601300 Bacteria 5455244
1797 2987640792 2987636660 Bacteria 8088555
1798 2987645734 2987645492 Bacteria 6117018
1799 2987656292 2987652177 Bacteria 6969023
1800 2987664141 2987659509 Bacteria 6966464
1801 2987670370 2987666974 Bacteria 6509233
1802 2987680956 2987673487 Bacteria 6884027
1803 2989352911 2989349275 Bacteria 6349068
1804 2989773702 2989771324 Bacteria 5605128
1805 2989778751 2989776772 Bacteria 4843317
1806 2996311119 2996310559 Bacteria 6357320
1807 2996341809 2996336353 Bacteria 5511628
1808 2996348856 2996341866 Bacteria 6643098
1809 2996351161 2996348954 Bacteria 7239054
1810 2996388326 2996386984 Bacteria 6978667
1811 2996892435 2996887358 Bacteria 5795980
1812 2996898455 2996893221 Bacteria 5823108
1813 3000136244 3000135777 Bacteria 6891109
1814 3003933382 3003930520 Bacteria 5667563
1815 3004170113 3004167301 Bacteria 8330599
1816 3004193196 3004188549 Bacteria 6952365
1817 3004208989 3004203850 Bacteria 7307914
1818 3004212677 3004211236 Bacteria 7417683
1819 3004222746 3004218560 Bacteria 7421728
1820 3004236746 3004232784 Bacteria 6662140
1821 3004245527 3004239961 Bacteria 6892290
1822 3004255485 3004248173 Bacteria 6563236
1823 3004269792 3004268573 Bacteria 7043476
1824 3004277859 3004275668 Bacteria 7114440
1825 3004296652 3004289098 Bacteria 6135450
1826 3004340328 3004334049 Bacteria 8449246
1827 3005409651 3005409236 Bacteria 7188837
1828 3005420367 3005416602 Bacteria 7064308
1829 3005447243 3005445848 Bacteria 6906074
1830 637073630 637000159 Bacteria 7596297
1831 639648136 639633055 Bacteria 7751309
1832 643825497 643692032 Bacteria 6891900
1833 648740128 648276728 Bacteria 6968865
1834 649873565 649633066 Bacteria 6690028
1835 8002286149 8002285264 Bacteria 6717907
1836 8003993329 8003992118 Bacteria 7266902
1837 8004000585 8003999396 Bacteria 7063185
1838 8004306589 8004300914 Bacteria 6132239
1839 8004313777 8004312739 Bacteria 7444653
1840 8004364013 8004361976 Bacteria 6858373
1841 8004379756 8004374579 Bacteria 6898112
1842 8004393852 8004387939 Bacteria 7049250
1843 8004400035 8004395343 Bacteria 6620908
1844 8004450050 8004445564 Bacteria 6322258
1845 8004639214 8004633249 Bacteria 6723080
1846 8004643184 8004640170 Bacteria 6723001
1847 8004702742 8004695233 Bacteria 6731676
1848 8004714522 8004703790 Bacteria 8006957
1849 8004719656 8004714634 Bacteria 6776161
1850 8004729378 8004727605 Bacteria 6643904
1851 8005248303 8005246636 Bacteria 4933972
1852 8005259717 8005258706 Bacteria 6184835
1853 8005280206 8005275841 Bacteria 6929066
1854 8005288273 8005282627 Bacteria 6675747
1855 8005294799 8005289223 Bacteria 6634003
1856 8005307042 8005301065 Bacteria 6614431
1857 8005314557 8005307578 Bacteria 7395396
1858 8005317318 8005314921 Bacteria 7072929
1859 8005326962 8005321885 Bacteria 5795980
1860 8005378785 8005376324 Bacteria 6590079
1861 8005388007 8005382845 Bacteria 6732062
1862 8005397038 8005395548 Bacteria 6806915
1863 8005433245 8005430974 Bacteria 6689030
1864 8005462518 8005460587 Bacteria 7157962
1865 8005486618 8005484373 Bacteria 6297373
1866 8005499896 8005497431 Bacteria 6477605
1867 8005558113 8005556819 Bacteria 6908598
1868 8005569291 8005563573 Bacteria 7153261
1869 8005575432 8005570704 Bacteria 6957481
1870 8005621263 8005619151 Bacteria 7030230
1871 8005631437 8005626139 Bacteria 6534237
1872 8005646240 8005645114 Bacteria 6950293
1873 8005659419 8005658619 Bacteria 4500593
1874 8005671314 8005668836 Bacteria 6953162
1875 8005686374 8005682033 Bacteria 6726518
1876 8005694956 8005688590 Bacteria 6610080
1877 8005696156 8005695170 Bacteria 6912330
1878 8018129558 8018127388 Bacteria 7351159
1879 8018168099 8018163183 Bacteria 7277977
1880 8018177895 8018176218 Bacteria 6896178
1881 8023680973 8023680758 Bacteria 7729763
1882 8024485749 8024479707 Bacteria 6954785
1883 8024492566 8024486573 Bacteria 6540512
1884 8024505215 8024501048 Bacteria 6427847
1885 8046770326 8046767195 Bacteria 7547379
1886 8049294384 8049293176 Bacteria 6128433
1887 8054560808 8054558443 Bacteria 5204801
1888 8055435049 8055431914 Bacteria 4551896
1889 8055621933 8055617313 Bacteria 7548464
1890 8056380142 8056375014 Bacteria 7006639
1891 8056387553 8056382006 Bacteria 6408074
1892 8057578256 8057575449 Bacteria 7367519
1893 8057875496 8057874678 Bacteria 7494653
1894 2214702717
1895 JGI24740J21852_10024850
1896 JGI24739J22299_10085637
1897 JGI24735J21928_10045816
1898 JGI25155J39150_1000011
1899 JGI25156J39149_1000027
1900 JGI25156J39149_1000030
1901 JGI25156J39149_1004453
1902 JGI25154J39366_1000057
1903 JGI25157J39369_1000010
1904 JGI25157J39369_1000604
1905 JGI25152J39213_1002131
1906 JGI25150J39212_1004304
1907 JGI25159J45721_1000006
1908 JGI25151J46595_10000238
1909 JGI25151J46595_10009568
1910 JGI25406J46586_10008536
1911 JGI25406J46586_10045653
1912 JGI25165J46597_1000033
1913 JGI25165J46597_1000777
1914 JGI25165J46597_1007469
1915 JGI25153J46596_10002466
1916 JGI25153J46596_10010613
1917 JGI25153J46596_10070545
1918 rootH2_10012004
1919 rootH2_10040546
1920 rootL2_10034778
1921 rootH1_10017647
1922 rootH1_10113295
1923 JGI25160J50197_1000004
1924 JGI25160J50197_1000019
1925 JGI25160J50197_1004387
1926 JGI25160J50197_1036036
1927 JGI25160J50197_1043041
1928 JGI25161J50226_1000003
1929 JGI25161J50226_1000330
1930 JGI25161J50226_1001454
1931 JGI25161J50226_1008427
1932 Ga0055542_1000762
1933 Ga0055529_1002106
1934 Ga0055526_1000565
1935 Ga0055526_1000669
1936 Ga0055526_1002226
1937 Ga0055526_1040249
1938 Ga0055524_1004582
1939 Ga0055524_1006212
1940 Ga0055524_1007214
1941 Ga0055524_1010237
1942 Ga0055524_1035612
1943 Ga0055536_1000212
1944 Ga0055536_1004763
1945 Ga0055534_1047945
1946 Ga0055528_1000918
1947 Ga0055528_1005988
1948 Ga0055528_1008737
1949 Ga0055528_1015144
1950 Ga0055528_1020888
1951 Ga0055530_10015221
1952 Ga0055530_10068443
1953 Ga0055540_1000285
1954 Ga0055540_1001884
1955 Ga0055540_1002932
1956 Ga0055540_1023537
1957 Ga0055540_1026148
1958 Ga0055540_1059536
1959 Ga0055540_1059940
1960 Ga0055531_10001165
1961 Ga0055531_10014995
1962 Ga0055531_10069570
1963 Ga0058692_1004051
1964 Ga0055543_1000001
1965 Ga0055543_1000019
1966 Ga0055543_1000147
1967 Ga0055543_1000808
1968 Ga0065165_1000049
1969 Ga0065165_1000180
1970 Ga0065165_1005995
1971 Ga0065165_1017852
1972 Ga0065165_1024195
1973 Ga0070658_10032973
1974 Ga0070658_11253983
1975 Ga0070670_100001443
1976 Ga0068869_101109938
1977 Ga0070687_100035726
1978 Ga0070661_100680165
1979 Ga0070668_100629226
1980 Ga0070675_100238243
1981 Ga0070671_100310609
1982 Ga0070671_100434568
1983 Ga0070674_100319133
1984 Ga0070659_100090030
1985 Ga0070667_101468578
1986 Ga0070703_10001607
1987 Ga0070709_10145167
1988 Ga0070701_10001368
1989 Ga0070711_100859884
1990 Ga0070705_100000487
1991 Ga0070700_100003143
1992 Ga0070694_100023927
1993 Ga0070708_100029082
1994 Ga0070663_100004621
1995 Ga0070663_101228536
1996 Ga0070662_100411200
1997 Ga0070662_100910096
1998 Ga0070662_101332326
1999 Ga0070681_10171682
2000 Ga0070706_100058590
2001 Ga0070698_100665481
2002 Ga0070699_100002474
2003 Ga0070679_100050610
2004 Ga0070679_100065325
2005 Ga0070697_100000987
2006 Ga0070697_100119415
2007 Ga0068853_100002083
2008 Ga0068853_100320060
2009 Ga0068853_101041001
2010 Ga0070686_100403550
2011 Ga0070695_100004914
2012 Ga0070696_100001714
2013 Ga0070693_100064714
2014 Ga0070665_100100274
2015 Ga0070665_100166889
2016 Ga0070665_100244907
2017 Ga0070665_100287216
2018 Ga0070665_100464658
2019 Ga0070665_100642398
2020 Ga0070665_100715156
2021 Ga0070704_100004568
2022 Ga0068855_100081541
2023 Ga0068855_100147887
2024 Ga0068855_101151476
2025 Ga0068857_100030653
2026 Ga0068857_100057532
2027 Ga0068856_100069999
2028 Ga0068856_100108448
2029 Ga0068856_100382539
2030 Ga0068856_100523781
2031 Ga0068852_100082239
2032 Ga0068852_101959714
2033 Ga0068859_100011400
2034 Ga0068859_100051166
2035 Ga0068864_100081043
2036 Ga0068851_10104616
2037 Ga0068863_100170600
2038 Ga0068858_100051707
2039 Ga0068858_100136804
2040 Ga0068860_100007101
2041 Ga0068860_100877418
2042 Ga0068862_100011359
2043 Ga0081455_10262695
2044 Ga0081455_10706243
2045 Ga0081539_10001354
2046 Ga0081539_10002915
2047 Ga0075365_10000771
2048 Ga0075365_10019973
2049 Ga0075365_10028318
2050 Ga0075365_10049392
2051 Ga0075365_10055143
2052 Ga0075365_10253425
2053 Ga0075365_10365111
2054 Ga0075365_10536379
2055 Ga0075368_10058667
2056 Ga0075368_10063670
2057 Ga0075368_10119436
2058 Ga0075363_100012667
2059 Ga0075363_100050250
2060 Ga0075363_100099987
2061 Ga0075363_100100272
2062 Ga0075363_100133720
2063 Ga0075363_100731597
2064 Ga0075364_10008131
2065 Ga0075364_10120674
2066 Ga0075364_10148623
2067 Ga0075364_10920067
2068 Ga0070715_10383836
2069 Ga0075362_10051910
2070 Ga0075362_10224417
2071 Ga0075367_10026480
2072 Ga0075367_10050505
2073 Ga0075367_10087828
2074 Ga0075367_10184751
2075 Ga0075367_10197438
2076 Ga0075367_10279322
2077 Ga0075367_10516081
2078 Ga0075369_10002912
2079 Ga0075369_10004806
2080 Ga0075369_10019597
2081 Ga0075369_10086170
2082 Ga0075369_10097492
2083 Ga0075369_10316536
2084 Ga0075366_10003432
2085 Ga0075366_10365675
2086 Ga0075370_10006155
2087 Ga0075370_10041398
2088 Ga0075370_10070723
2089 Ga0075370_10165121
2090 Ga0075370_10208580
2091 Ga0075370_10619750
2092 Ga0075428_100157306
2093 Ga0075430_100013715
2094 Ga0075431_100001091
2095 Ga0075433_10445911
2096 Ga0075429_100764842
2097 Ga0068865_101490036
2098 Ga0097620_100011399
2099 Ga0097620_100051168
2100 Ga0079104_1000187
2101 Ga0079104_1001924
2102 Ga0099826_10004117
2103 Ga0075435_100061966
2104 Ga0099794_10068986
2105 Ga0099794_10384984
2106 Ga0099795_10321821
2107 Ga0105251_10011989
2108 Ga0105240_10000005
2109 Ga0105240_10483353
2110 Ga0105240_10698477
2111 Ga0105240_10799296
2112 Ga0105245_10504020
2113 Ga0105245_11155304
2114 Ga0105247_10011923
2115 Ga0105247_11150484
2116 Ga0105243_10121413
2117 Ga0105243_10175176
2118 Ga0105241_10012824
2119 Ga0105241_10203860
2120 Ga0105241_10389862
2121 Ga0105237_10002240
2122 Ga0105238_10038126
2123 Ga0105238_10605306
2124 Ga0105238_11301184
2125 Ga0105249_10000834
2126 Ga0105249_12837275
2127 Ga0123341_1000001
2128 Ga0123342_1008195
2129 Ga0123342_1028840
2130 Ga0099796_10020084
2131 Ga0105239_10000739
2132 Ga0105239_10164100
2133 Ga0105239_10558827
2134 Ga0105239_10799707
2135 Ga0105239_11064602
2136 Ga0105246_10016031
2137 Ga0105246_11329567
2138 Ga0157319_1053546
2139 Ga0157371_10005765
2140 Ga0157371_10275070
2141 Ga0157370_10000284
2142 Ga0157370_10337116
2143 Ga0157369_11347411
2144 Ga0171463_1011
2145 Ga0157374_10261982
2146 Ga0157374_10515065
2147 Ga0157374_11875973
2148 Ga0157378_10428295
2149 Ga0157378_10821988
2150 Ga0157378_10858029
2151 Ga0157372_10704181
2152 Ga0157372_11034046
2153 Ga0157372_11765158
2154 Ga0157375_11897175
2155 Ga0157375_12566204
2156 Ga0163163_11471464
2157 Ga0163163_11571178
2158 Ga0182008_10132875
2159 Ga0182008_10336259
2160 Ga0182006_1014407
2161 Ga0182007_10108824
2162 Ga0182007_10287558
2163 Ga0182005_1003903
2164 Ga0182005_1006191
2165 Ga0183363_1111
2166 Ga0163161_10684764
2167 Ga0163161_11316251
2168 Ga0214544_1000265
2169 Ga0214542_1000015
2170 Ga0214543_1000011
2171 Ga0214543_1000032
2172 Ga0228711_1000012
2173 Ga0228710_1000006
2174 Ga0209435_100022
2175 Ga0209436_100038
2176 Ga0209436_100837
2177 Ga0209436_111465
2178 Ga0209672_111952
2179 Ga0209437_100160
2180 Ga0209437_100310
2181 Ga0207425_1011762
2182 Ga0207425_1017027
2183 Ga0207425_1021384
2184 Ga0207425_1032792
2185 Ga0207425_1046284
2186 Ga0209646_1000078
2187 Ga0209026_1000002
2188 Ga0209026_1000065
2189 Ga0209677_101256
2190 Ga0209148_1000570
2191 Ga0209759_1000055
2192 Ga0209759_1000119
2193 Ga0209759_1012005
2194 Ga0209129_1000349
2195 Ga0209129_1000432
2196 Ga0209129_1000442
2197 Ga0209129_1002862
2198 Ga0209129_1012729
2199 Ga0209233_1000027
2200 Ga0209233_1000168
2201 Ga0209233_1000269
2202 Ga0209233_1000303
2203 Ga0209455_1000204
2204 Ga0209673_1000068
2205 Ga0209673_1000139
2206 Ga0209673_1001538
2207 Ga0209673_1002227
2208 Ga0209673_1005579
2209 Ga0209673_1008099
2210 Ga0209673_1015353
2211 Ga0209673_1056305
2212 Ga0209130_1000007
2213 Ga0209130_1000012
2214 Ga0209130_1000097
2215 Ga0209130_1015683
2216 Ga0209130_1029780
2217 Ga0209675_1050911
2218 Ga0209675_1061028
2219 Ga0209676_1000399
2220 Ga0209676_1006026
2221 Ga0209025_1000237
2222 Ga0209025_1000358
2223 Ga0209025_1000729
2224 Ga0209025_1000923
2225 Ga0209025_1000949
2226 Ga0209025_1004865
2227 Ga0209025_1005123
2228 Ga0209025_1058527
2229 Ga0209025_1071341
2230 Ga0209025_1099690
2231 Ga0209025_1131642
2232 Ga0209564_1000140
2233 Ga0209564_1000794
2234 Ga0209564_1000802
2235 Ga0209564_1000868
2236 Ga0209564_1001618
2237 Ga0209564_1005687
2238 Ga0209564_1014049
2239 Ga0209564_1041733
2240 Ga0209758_1000155
2241 Ga0209758_1000545
2242 Ga0209758_1000587
2243 Ga0209758_1001100
2244 Ga0209758_1002445
2245 Ga0209758_1007782
2246 Ga0209758_1019396
2247 Ga0209758_1026684
2248 Ga0209758_1100007
2249 Ga0209050_1000650
2250 Ga0209050_1005095
2251 Ga0209050_1021205
2252 Ga0209256_1000557
2253 Ga0209256_1000687
2254 Ga0209256_1001048
2255 Ga0209256_1001371
2256 Ga0209256_1004147
2257 Ga0209256_1004371
2258 Ga0209256_1010809
2259 Ga0209256_1023871
2260 Ga0209256_1048199
2261 Ga0207426_1000003
2262 Ga0207426_1000010
2263 Ga0207426_1000094
2264 Ga0207426_1000111
2265 Ga0207426_1001840
2266 Ga0209051_1000095
2267 Ga0209051_1001031
2268 Ga0209051_1001191
2269 Ga0209051_1003503
2270 Ga0209051_1007144
2271 Ga0209051_1008543
2272 Ga0209051_1017165
2273 Ga0209051_1072572
2274 Ga0209257_1001962
2275 Ga0209257_1003296
2276 Ga0209257_1010294
2277 Ga0209257_1060930
2278 Ga0207656_10064226
2279 Ga0207653_10001674
2280 Ga0207647_10072033
2281 Ga0207647_10402909
2282 Ga0207685_10391020
2283 Ga0207705_10743623
2284 Ga0207654_10024617
2285 Ga0207654_10119520
2286 Ga0207654_10161375
2287 Ga0207654_10581839
2288 Ga0207707_10027670
2289 Ga0207695_10000011
2290 Ga0207695_10116388
2291 Ga0207695_10416388
2292 Ga0207695_10881666
2293 Ga0207671_10001291
2294 Ga0207671_10057729
2295 Ga0207671_10068428
2296 Ga0207660_10113774
2297 Ga0207662_10084295
2298 Ga0207657_10208952
2299 Ga0207652_10040467
2300 Ga0207681_11041881
2301 Ga0207694_10018894
2302 Ga0207650_10002090
2303 Ga0207650_10101930
2304 Ga0207687_10068838
2305 Ga0207687_10449791
2306 Ga0207687_10734934
2307 Ga0207644_10136348
2308 Ga0207690_10022460
2309 Ga0207706_10039545
2310 Ga0207706_10967608
2311 Ga0207709_10114712
2312 Ga0207709_10323219
2313 Ga0207709_10324599
2314 Ga0207669_10229582
2315 Ga0207704_10877843
2316 Ga0207665_10065871
2317 Ga0207667_10060300
2318 Ga0207667_10375499
2319 Ga0207667_10888412
2320 Ga0207712_10003210
2321 Ga0207712_11567645
2322 Ga0207668_10454674
2323 Ga0207668_10488791
2324 Ga0207668_12083217
2325 Ga0207640_11271407
2326 Ga0207658_10195410
2327 Ga0207658_10549102
2328 Ga0207703_10281150
2329 Ga0207639_10032104
2330 Ga0207639_10290502
2331 Ga0207678_10015487
2332 Ga0207678_11150419
2333 Ga0207708_10002508
2334 Ga0207702_10055211
2335 Ga0207702_10076099
2336 Ga0207702_10222409
2337 Ga0207641_10307664
2338 Ga0207648_10166316
2339 Ga0207676_10078838
2340 Ga0207674_10071651
2341 Ga0207674_10154489
2342 Ga0207674_10244903
2343 Ga0207675_101058742
2344 Ga0207683_10197424
2345 Ga0207698_10391441
2346 Ga0207698_10750481
2347 Ga0209281_1000310
2348 Ga0209281_1000334
2349 Ga0209281_1000361
2350 Ga0209371_1000021
2351 Ga0209371_1000469
2352 Ga0209371_1001465
2353 Ga0209282_1000073
2354 Ga0209282_1000162
2355 Ga0209282_1182870
2356 Ga0209588_1004150
2357 Ga0209588_1123431
2358 Ga0209813_10117222
2359 Ga0268266_10182102
2360 Ga0268266_10220018
2361 Ga0268266_10817448
2362 Ga0268265_10014314
2363 Ga0268264_10003917
2364 Ga0268264_10773687
2365 Ga0307515_10000844
2366 Ga0307515_10004389
2367 Ga0307515_10013773
2368 Ga0307515_10020621
2369 Ga0307515_10767339
2370 Ga0268256_1000020
2371 Ga0268256_1001794
2372 Ga0268256_1003189
2373 Ga0307513_10002223
2374 Ga0307513_10134632
2375 Ga0307513_10674661
2376 Ga0307408_100164938
2377 Ga0307408_100731680
2378 Ga0307514_10300077
2379 Ga0307413_10429669
2380 Ga0307410_10349349
2381 Ga0307406_10459222
2382 Ga0307412_10083096
2383 Ga0307412_10914255
2384 Ga0307412_11859820
2385 Ga0315914_1000008
2386 Ga0307409_100255774
2387 Ga0307416_100266271
2388 Ga0307416_100668926
2389 Ga0307414_10072609
2390 Ga0307411_10544797
2391 Ga0316593_10129338
2392 Ga0307510_10380280
2393 Ga0315913_1000688
2394 Ga0315915_1000014
2395 Ga0373934_0000226
2396 Ga0373934_0004407
2397 Ga0373952_0071202
2398 Ga0373923_0004582
2399 Ga0373923_0068921
2400 Ga0373923_0257184
2401 Ga0373932_0296923
2402 Ga0373936_0007633
2403 Ga0373939_0115591
2404 Ga0373953_0002165
2405 Ga0373953_0086933
2406 Ga0373953_0201701
2407 Ga0373954_0007204
2408 Ga0373954_0014860
2409 Ga0373956_0000177
2410 Ga0373956_0002563
2411 Ga0373957_0012200
2412 Ga0373943_0011672
2413 Ga0373946_0369115
2414 Ga0373955_0161588
2415 Ga0373955_0182539
2416 Ga0373955_0951468
2417 Ga0316574_0038897
2418 Ga0316574_0167518
2419 Ga0373924_0012475
2420 Ga0373935_0059231
2421 Ga0373927_0000055
2422 Ga0373933_0000312
2423 Ga0373933_0052360
2424 Ga0373933_0445669
2425 Ga0373947_0318717
2426 Ga0373937_0000096
2427 Ga0373937_0155279
2428 Ga0373937_0482522
2429 Ga0316582_0060645
2430 Ga0316584_0016744
2431 Ga0373925_0002979
2432 Ga0373925_0054502
2433 Ga0395899_0000213
2434 Ga0395900_0000121
2435 Ga0395900_0022761
2436 Ga0395900_0246642
2437 Ga0395900_0560544
2438 Ga0395898_0000247
2439 Ga0395905_0000112
2440 Ga0395905_0000325
2441 Ga0395905_0013938
2442 Ga0395905_0018905
2443 Ga0395905_0105392
2444 Ga0395905_0341137
2445 Ga0395901_0000078
2446 Ga0395901_0068865
2447 Ga0395901_0108822
2448 Ga0395901_0659512
2449 Ga0439436_0063219
2450 Ga0439439_0032082
2451 Ga0439439_0047680
2452 Ga0439465_0014361
2453 Ga0439465_0016011
2454 Ga0439465_0019035
2455 Ga0439465_0074391
2456 Ga0439465_0143370
2457 Ga0451791_1489124
2458 Ga0451793_1791429
2459 Ga0451795_0456879
2460 Ga0451804_0736472
2461 Ga0451833_0281263
2462 Ga0451835_0487550
2463 Ga0451837_1680411
2464 Ga0451840_11095
2465 Ga0451841_1014141
2466 Ga0451845_0513581
2467 Ga0451846_68000
2468 Ga0451847_0867267
2469 Ga0451849_1243659
2470 Ga0451851_0085356
2471 Ga0451851_0906446
2472 Ga0451843_0556366
2473 Ga0451855_0767112
2474 Ga0451855_1623492
2475 Ga0451853_0114112
2476 Ga0451853_1600377
2477 Ga0439431_0084742
2478 Ga0439437_031430
2479 Ga0439432_035895
2480 Ga0439432_091543
2481 Ga0439449_0024497
2482 Ga0439449_0030648
2483 Ga0439449_0113867
2484 Ga0439455_0113540
2485 Ga0450920_061976
2486 Ga0439458_0151510
2487 Ga0439434_0136733
2488 Ga0450918_083669
2489 Ga0466972_0066750
2490 Ga0466965_0097468
2491 Ga0466966_0037410
2492 Ga0466963_0014097
2493 Ga0466968_0298045
2494 Ga0466970_0005266
2495 Ga0466960_0196335
2496 Ga0466967_0358143
2497 Ga0466967_0536706
2498 Ga0495592_0000886
2499 Ga0495592_0111349
2500 Ga0495592_0152555
2501 Ga0495603_0783841
2502 Ga0495590_0338167
2503 Ga0495629_0037247
2504 Ga0495629_0091148
2505 Ga0495629_0108595
2506 Ga0495638_0011505
2507 Ga0495638_0112270
2508 Ga0495638_0134219
2509 Ga0495641_0007023
2510 Ga0495651_0001037
2511 Ga0495651_0012125
2512 Ga0495653_0006555
2513 Ga0495650_0170839
2514 Ga0495639_0002333
2515 Ga0495662_0011759
2516 Ga0495662_0049854
2517 Ga0495664_0022744
2518 Ga0495585_0030296
2519 Ga0495585_0045607
2520 Ga0495607_0082802
2521 Ga0495583_0091176
2522 Ga0495610_0010608
2523 Ga0495610_0075657
2524 Ga0495616_0026034
2525 Ga0495616_0287975
2526 Ga0495618_0010612
2527 Ga0495618_0202102
2528 Ga0495620_0031522
2529 Ga0495620_0062294
2530 Ga0495620_0066156
2531 Ga0495628_0060049
2532 Ga0495628_0200303
2533 Ga0495630_0001439
2534 Ga0495631_0082915
2535 Ga0495631_0183483
2536 Ga0495632_0017000
2537 Ga0495632_0287786
2538 Ga0495643_0001636
2539 Ga0495643_0027496
2540 Ga0495648_0076360
2541 Ga0495666_0017744
2542 Ga0495652_0149866
2543 Ga0495652_0151995
2544 Ga0495652_0652893
2545 Ga0495654_0006825
2546 Ga0495654_0047409
2547 Ga0495654_0056366
2548 Ga0495640_0008228
2549 Ga0495586_0010436
2550 Ga0495587_0069446
2551 Ga0495587_0317009
2552 Ga0495609_0025916
2553 Ga0495633_0058720
2554 Ga0495667_0086244
2555 Ga0495667_0114995
2556 Ga0495667_0154021
2557 Ga0495656_0166823
2558 Ga0495668_0038831
2559 Ga0495668_0101187
2560 Ga0495668_0121572
2561 Ga0495668_0133404
2562 Ga0495634_0026780
2563 Ga0495634_0133055
2564 Ga0495611_0009786
2565 Ga0495625_0022163
2566 Ga0495625_0044796
2567 Ga0495625_0056641
2568 Ga0495635_0086793
2569 Ga0495635_0161182
2570 Ga0495588_0048733
2571 Ga0495588_0370574
2572 Ga0495657_0014287
2573 Ga0495657_0085419
2574 Ga0495657_0091190
2575 Ga0495599_0032502
2576 Ga0495658_0004331
2577 Ga0495624_0113855
2578 Ga0495624_0319834
2579 Ga0495670_0031733
2580 Ga0495670_0363084
2581 Ga0495671_0310575
2582 Ga0495649_0122502
2583 Ga0495649_0226196
2584 Ga0495600_0000925
2585 Ga0495600_0036061
2586 Ga0495660_0191214
2587 Ga0495604_0021238
2588 Ga0495604_0024264
2589 Ga0495636_0044906
2590 Ga0495636_0080229
2591 Ga0495636_0160057
2592 Ga0495674_0005040
2593 Ga0495672_0021456
2594 Ga0495676_0917551
2595 Ga0495680_0012165
2596 Ga0495680_0232488
2597 Ga0495680_0468693
2598 Ga0495683_0398430
2599 Ga0495687_066877
2600 Ga0495687_227815
2601 Ga0495675_0003423
2602 Ga0495675_0033960
2603 Ga0495675_0175941
2604 Ga0495675_0580147
2605 Ga0495685_062052
2606 Ga0495684_0062577
2607 Ga0495684_0107115
2608 Ga0495684_1010807
2609 Ga0495686_0004865
2610 Ga0495686_0119407
2611 Ga0495686_0157036
2612 Ga0495686_0180354
2613 Ga0495686_0221559
2614 Ga0495686_0245842
2615 Ga0495686_0345242
2616 Ga0495593_0529683
2617 Ga0495614_0035261
2618 Ga0495615_0115979
2619 Ga0495626_0162717
2620 Ga0495626_0198657
2621 Ga0496100_0012838
2622 Ga0496101_0208502
2623 Ga0496102_0008570
2624 Ga0496102_0014003
2625 Ga0496102_0177393
2626 Ga0496102_0296643
2627 Ga0496102_0766906
2628 Ga0496103_0010686
2629 Ga0496103_0017556
2630 Ga0496104_0066142
2631 Ga0496105_0182249
2632 Ga0496105_0208925
2633 Ga0496106_0001217
2634 Ga0496106_0004921
2635 Ga0496106_0452007
2636 Ga0496108_0114926
2637 Ga0496108_0371611
2638 Ga0496109_0132401
2639 Ga0496109_0301457
2640 Ga0496109_1146305
2641 Ga0496110_0180740
2642 Ga0496110_0802990
2643 Ga0496110_1133930
2644 Ga0496113_0312317
2645 Ga0496113_0377285
2646 Ga0496113_0570148
2647 Ga0496114_0236430
2648 Ga0496114_0584059
2649 Ga0496115_0023828
2650 Ga0496115_0237130
2651 Ga0496115_0653995
2652 Ga0496116_0000043
2653 Ga0496116_0008089
2654 Ga0496116_0043036
2655 Ga0496116_0103446
2656 Ga0496117_0000338
2657 Ga0496117_0089281
2658 Ga0496117_0109558
2659 Ga0496117_0109935
2660 Ga0496118_0000958
2661 Ga0496118_0019045
2662 Ga0496118_0225279
2663 Ga0496118_0428829
2664 Ga0496118_0497471
2665 Ga0496118_0566227
2666 Ga0496119_0004440
2667 Ga0496119_0111222
2668 Ga0496119_0163672
2669 Ga0496119_0193562
2670 Ga0496119_0243093
2671 Ga0496120_0000589
2672 Ga0496120_0001472
2673 Ga0496120_0069230
2674 Ga0496120_0187793
2675 Ga0496121_0002723
2676 Ga0496121_0009248
2677 Ga0496121_0009941
2678 Ga0496121_0027323
2679 Ga0496121_0038973
2680 Ga0496121_0074244
2681 Ga0496121_0082726
2682 Ga0496121_0088329
2683 Ga0496121_0206430
2684 Ga0496121_0229266
2685 Ga0496121_0879236
2686 Ga0496122_0000025
2687 Ga0496122_0016499
2688 Ga0496122_0018139
2689 Ga0496122_0055102
2690 Ga0496122_0062877
2691 Ga0496122_0093482
2692 Ga0496122_0246008
2693 Ga0496123_0000032
2694 Ga0496123_0000043
2695 Ga0496123_0012797
2696 Ga0496123_0016748
2697 Ga0496123_0064778
2698 Ga0496123_0079012
2699 Ga0496123_0263882
2700 Ga0496123_0422272
2701 Ga0496124_0017870
2702 Ga0496124_0023770
2703 Ga0496124_0025733
2704 Ga0496124_0061282
2705 Ga0496124_0274378
2706 Ga0496124_0298730
2707 Ga0496125_0000946
2708 Ga0496125_0025175
2709 Ga0496125_0027520
2710 Ga0496125_0066860
2711 Ga0496125_0141564
2712 Ga0496125_0169920
2713 Ga0496125_0283632
2714 Ga0496125_0310552
2715 Ga0496126_0000362
2716 Ga0496126_0034554
2717 Ga0496126_0047224
2718 Ga0496126_0244916
2719 Ga0496126_0266039
2720 Ga0496126_0267396
2721 Ga0496126_0340153
2722 Ga0496126_0445237
2723 Ga0496126_0756347
2724 Ga0501031_0000095
2725 Ga0501031_0418336
2726 Ga0501032_0000064
2727 Ga0501032_0000084
2728 Ga0501032_0002338
2729 Ga0501032_0048602
2730 Ga0501032_1008883
2731 Ga0501033_0000102
2732 Ga0501033_0000286
2733 Ga0501033_0007597
2734 Ga0501033_0020657
2735 Ga0501033_0029534
2736 Ga0501033_0050740
2737 Ga0501033_0083256
2738 Ga0501033_0528873
2739 Ga0501033_0904293
2740 Ga0501034_0000174
2741 Ga0501034_0001404
2742 Ga0501034_0002078
2743 Ga0501034_0090803
2744 Ga0501034_0125398
2745 Ga0501034_0202154
2746 Ga0501034_0240027
2747 Ga0501034_0339786
2748 Ga0501034_0655917
2749 Ga0501034_0831896
2750 Ga0501036_0000040
2751 Ga0501036_0011420
2752 Ga0501036_0064582
2753 Ga0501036_0122760
2754 Ga0501036_0160163
2755 Ga0501037_0000098
2756 Ga0501037_0009152
2757 Ga0501037_0095169
2758 Ga0501037_0127415
2759 Ga0501037_0403344
2760 Ga0501037_0456452
2761 Ga0501038_0000002
2762 Ga0501038_0000031
2763 Ga0501038_0022666
2764 Ga0501038_0031557
2765 Ga0501038_0117560
2766 Ga0501038_0272214
2767 Ga0501038_1112264
2768 Ga0501039_0000002
2769 Ga0501039_0000057
2770 Ga0501039_0227793
2771 Ga0501039_0639444
2772 Ga0501040_0043172
2773 Ga0501040_0117786
2774 Ga0501040_0450861
2775 Ga0501040_0673642
2776 Ga0501041_0160634
2777 Ga0501042_0137759
2778 Ga0501043_0000048
2779 Ga0501043_0000104
2780 Ga0501043_0006479
2781 Ga0501043_0074629
2782 Ga0501043_0128235
2783 Ga0501043_0130374
2784 Ga0501043_0230438
2785 Ga0501043_0674507
2786 Ga0501046_0000023
2787 Ga0501046_0059772
2788 Ga0501046_0175337
2789 Ga0501046_0193784
2790 Ga0501046_0200778
2791 Ga0501047_0002237
2792 Ga0501047_0027746
2793 Ga0501047_0036169
2794 Ga0501047_0140440
2795 Ga0501047_0187248
2796 Ga0501047_0292240
2797 Ga0501047_0716479
2798 Ga0501048_0022955
2799 Ga0501048_0038065
2800 Ga0501048_1215189
2801 Ga0501067_0042887
2802 Ga0501067_0271062
2803 Ga0501068_0182523
2804 Ga0501068_0316121
2805 Ga0501068_0319333
2806 Ga0501068_0365952
2807 Ga0501069_0000018
2808 Ga0501069_0015350
2809 Ga0501069_0159953
2810 Ga0501069_0551510
2811 Ga0501070_0000048
2812 Ga0501070_0000420
2813 Ga0501070_0002333
2814 Ga0501070_0041003
2815 Ga0501070_0053889
2816 Ga0501070_0086815
2817 Ga0501070_0113114
2818 Ga0501070_0271796
2819 Ga0501070_0297951
2820 Ga0501070_0338762
2821 Ga0501071_0017994
2822 Ga0501071_0094533
2823 Ga0501071_0150442
2824 Ga0501072_0069505
2825 Ga0501073_0006660
2826 Ga0501073_0072808
2827 Ga0501073_0127897
2828 Ga0501073_0161074
2829 Ga0501074_0000001
2830 Ga0501074_0054142
2831 Ga0501074_0059274
2832 Ga0501074_0079423
2833 Ga0501074_0266406
2834 Ga0501074_0452599
2835 Ga0501074_0678614
2836 Ga0501075_0181324
2837 Ga0501076_0786847
2838 Ga0501076_1727592
2839 Ga0501079_0807143
2840 Ga0501079_1276381
2841 Ga0501080_0000197
2842 Ga0501080_0000413
2843 Ga0501080_0015859
2844 Ga0501080_0133094
2845 Ga0501080_0243232
2846 Ga0501080_0245976
2847 Ga0501081_0912448
2848 Ga0501083_0005530
2849 Ga0501083_0008060
2850 Ga0501083_0502426
2851 Ga0501083_0659780
2852 Ga0501083_0820992
2853 Ga0501280_012617
2854 Ga0501035_0000048
2855 Ga0501035_0000163
2856 Ga0501035_0001343
2857 Ga0501035_0004746
2858 Ga0501035_0007944
2859 Ga0501035_0063455
2860 Ga0501035_0094218
2861 Ga0501035_0130236
2862 Ga0501035_0273987
2863 Ga0501035_0307036
2864 Ga0501035_0336768
2865 Ga0501035_0632845
2866 Ga0501044_0000002
2867 Ga0501044_0000003
2868 Ga0501044_0002384
2869 Ga0501044_0010560
2870 Ga0501044_0020100
2871 Ga0501044_0021489
2872 Ga0501044_0049943
2873 Ga0501044_0057802
2874 Ga0501044_0187627
2875 Ga0501044_0219738
2876 Ga0501044_0239744
2877 Ga0501044_0550038
2878 Ga0501044_0590090
2879 Ga0501045_0154648
2880 Ga0501045_0688966
2881 nmdc:mga03683_86913_c1
2882 nmdc:mga03n38_3751_c1
2883 nmdc:mga03n38_65686_c1
2884 nmdc:mga03n38_90093_c1
2885 nmdc:mga00v17_111801_c1
2886 nmdc:mga00v17_29610_c1
2887 nmdc:mga00v17_498650_c1
2888 nmdc:mga0yw44_13733_c1
2889 nmdc:mga0yw44_17832_c1
2890 nmdc:mga0yw44_2486_c2
2891 nmdc:mga0yw44_3537_c1
2892 nmdc:mga0yw44_354317_c1
2893 nmdc:mga0yw44_44196_c1
2894 nmdc:mga0yw44_47949_c1
2895 nmdc:mga0yw44_94644_c1
2896 nmdc:mga0k408_126867_c1
2897 nmdc:mga0k408_127554_c1
2898 nmdc:mga0k408_544382_c1
2899 nmdc:mga06z11_18343_c1
2900 nmdc:mga06z11_255289_c1
2901 nmdc:mga06z11_320891_c1
2902 nmdc:mga06z11_41928_c1
2903 nmdc:mga06z11_72589_c1
2904 nmdc:mga04h51_362632_c1
2905 nmdc:mga07m45_10513_c1
2906 nmdc:mga07m45_200148_c1
2907 nmdc:mga07m45_213173_c1
2908 nmdc:mga07m45_28645_c1
2909 nmdc:mga0qj67_716_c1
2910 nmdc:mga06r32_538_c1
2911 nmdc:mga08y16_1475345_c1
2912 nmdc:mga0rr50_53176_c1
2913 nmdc:mga08x19_14_c1
2914 nmdc:mga0a205_655192_c1
2915 nmdc:mga0sz30_15908_c1
2916 nmdc:mga0sz30_173779_c1
2917 nmdc:mga0sz30_55470_c1
2918 nmdc:mga0sz30_7864_c1
2919 nmdc:mga0sz30_85576_c1
2920 Ga0495601_0011073
2921 Ga0495601_0148381
2922 Ga0500610_0019111
2923 Ga0500610_0045559
2924 Ga0495655_0098817
2925 Ga0495595_0026834
2926 Ga0495619_0009507
2927 Ga0495619_0262729
2928 Ga0500578_0108162
2929 Ga0500644_0195949
2930 Ga0500651_0208329
2931 Ga0500562_045885
2932 Ga0500594_0101165
2933 Ga0500595_079905
2934 Ga0500608_002494
2935 Ga0500618_001230
2936 Ga0500618_001417
2937 Ga0500618_005279
2938 Ga0500658_0001009
2939 Ga0500658_0015794
2940 Ga0500658_0357987
2941 Ga0500559_0012609
2942 Ga0500559_0031862
2943 Ga0500568_0000175
2944 Ga0500568_0005268
2945 Ga0500568_0016433
2946 Ga0500577_0068985
2947 Ga0500604_0021875
2948 Ga0500616_0000417
2949 Ga0500616_0011795
2950 Ga0500616_0043680
2951 Ga0500616_0165368
2952 Ga0500616_0217736
2953 Ga0500620_000455
2954 Ga0500622_0000168
2955 Ga0500622_0002307
2956 Ga0500627_0231349
2957 Ga0500633_0001613
2958 Ga0500633_0148991
2959 Ga0500636_0027374
2960 Ga0500636_0326033
2961 Ga0501084_0193881
2962 Ga0501084_1159304
2963 Ga0587090_026434
2964 Ga0587092_088796
2965 Ga0501082_0385991
2966 Ga0501082_0424074
2967 Ga0501082_0473178
2968 Ga0501082_0925755
2969 2515611499
2970 2503202584
2971 2509107870
2972 2509114391
2973 2509143520
2974 2509373171
2975 2509376267
2976 2509387057
2977 2509397098
2978 2509442553
2979 2510132906
2980 2510307044
2981 2510317133
2982 2510894278
2983 2510899303
2984 2511133710
2985 2511182766
2986 2511198270
2987 2511501363
2988 2512532782
2989 2512930639
2990 2512958386
2991 2512971886
2992 2513570007
2993 2513575262
2994 2513587774
2995 2513598987
2996 2513606288
2997 2513614324
2998 2513617806
2999 2513633050
3000 2513710229
3001 2513886243
3002 2513906298
3003 2513909791
3004 2513987427
3005 2514000272
3006 2514005437
3007 2514019901
3008 2514038351
3009 2514419076
3010 2514590244
3011 2515111858
3012 2515633643
3013 2515642186
3014 2515656241
3015 2515738960
3016 2516209237
3017 2516892641
3018 2517035576
3019 2517076035
3020 2517094775
3021 2517406402
3022 2517569456
3023 2520376179
3024 2523470292
3025 2524452869
3026 2524460391
3027 2530645158
3028 2535516175
3029 2537874647
3030 2551682275
3031 2551684598
3032 2551693596
3033 2551703236
3034 2551708978
3035 2551719091
3036 2551728214
3037 2551734100
3038 2551740120
3039 2558863135
3040 2585168289
3041 2585199895
3042 2585225878
3043 2585230118
3044 2585254382
3045 2585268916
3046 2585270600
3047 2585276947
3048 2585324053
3049 2585333554
3050 2585389441
3051 2585393948
3052 2585400733
3053 2585528177
3054 2585534747
3055 2585540385
3056 2585546838
3057 2585551808
3058 2585558305
3059 2585819707
3060 2585838584
3061 2585897697
3062 2585904707
3063 2586000229
3064 2587980177
3065 2588516289
3066 2597813753
3067 2599333427
3068 2599602214
3069 2599721199
3070 2599939609
3071 2600192318
3072 2600374446
3073 2601608343
3074 2601745117
3075 2616292793
3076 2616308320
3077 2616556620
3078 2617381670
3079 2643775649
3080 2643794096
3081 2643808399
3082 2643837880
3083 2643855522
3084 2643987147
3085 2644005865
3086 2644049573
3087 2644066507
3088 2644132121
3089 2644145223
3090 2644155698
3091 2644193089
3092 2644204019
3093 2644207616
3094 2644300407
3095 2644307804
3096 2644332580
3097 2644378096
3098 2644415280
3099 2644450319
3100 2644482607
3101 2644494724
3102 2644544326
3103 2644613893
3104 2644654577
3105 2644658631
3106 2644677894
3107 2644687871
3108 2657683713
3109 2671115716
3110 2688599134
3111 2692316441
3112 2694631980
3113 2694634599
3114 2719180796
3115 2719385435
3116 2719665262
3117 2719731545
3118 2720491682
3119 2720612936
3120 2720619795
3121 2720631226
3122 2720774953
3123 2721146890
3124 2721158417
3125 2721163769
3126 2721399184
3127 2722839939
3128 2723026590
3129 2723560194
3130 2723566773
3131 2723576139
3132 2724037997
3133 2724044301
3134 2724089560
3135 2724104038
3136 2724109854
3137 2725952350
3138 2730107526
3139 2730164033
3140 2730298049
3141 2738945512
3142 2739038310
3143 2739307934
3144 2739350329
3145 2756676990
3146 2757572399
3147 2766067895
3148 2776913332
3149 2778176457
3150 2792581205
3151 2792623213
3152 2792626977
3153 2792642487
3154 2792752930
3155 2793299214
3156 2793313851
3157 2793321227
3158 2793326358
3159 2793336943
3160 2793344842
3161 2793347746
3162 2793352292
3163 2793360362
3164 2793366430
3165 2802718882
3166 2802726493
3167 2802733785
3168 2802738391
3169 2802744723
3170 2802751071
3171 2804751850
3172 2805927619
3173 2805936095
3174 2806045514
3175 2806051681
3176 2806061725
3177 2806067906
3178 2806072742
3179 2819241975
3180 2819559995
3181 2819610429
3182 2819638164
3183 2819687405
3184 2821127710
3185 2837653798
3186 2837679460
3187 2837682938
3188 2838018790
3189 2838025504
3190 2838034621
3191 2838043097
3192 2838052138
3193 2838067251
3194 2838071357
3195 2838670061
3196 2838676413
3197 2838682589
3198 2838689108
3199 2838697168
3200 2838702433
3201 2838709599
3202 2838715296
3203 2838720904
3204 2838726054
3205 2838730443
3206 2838738133
3207 2838743384
3208 2841740380
3209 2841841498
3210 2841847833
3211 2841854929
3212 2841859629
3213 2841864927
3214 2842077765
3215 2842110906
3216 2842119726
3217 2842126137
3218 2842131307
3219 2842141276
3220 2842147022
3221 2842153523
3222 2842157791
3223 2842165004
3224 2842171539
3225 2842177143
3226 2842180625
3227 2842188404
3228 2842197017
3229 2842201073
3230 2842206420
3231 2842212715
3232 2842220603
3233 2842225666
3234 2842231324
3235 2842239012
3236 2842244562
3237 2842252087
3238 2842258375
3239 2842267536
3240 2842273128
3241 2842279877
3242 2842287510
3243 2842291427
3244 2842301856
3245 2842309389
3246 2842315414
3247 2842318268
3248 2842347157
3249 2842362346
3250 2842366753
3251 2842373164
3252 2842377823
3253 2842386236
3254 2842397282
3255 2842404961
3256 2842411543
3257 2842418006
3258 2842424986
3259 2842431886
3260 2842437999
3261 2842444813
3262 2842451729
3263 2842465810
3264 2842472616
3265 2842481368
3266 2842487152
3267 2842492751
3268 2842496539
3269 2842508268
3270 2842510193
3271 2842516414
3272 2842525941
3273 2844006718
3274 2844014314
3275 2844459538
3276 2847418491
3277 2847670858
3278 2847687000
3279 2848993469
3280 2850080793
3281 2852389601
3282 2854899078
3283 2854916966
3284 2855825454
3285 2855840831
3286 2855873346
3287 2856316315
3288 2856323617
3289 2856329082
3290 2856335904
3291 2856346780
3292 2856353279
3293 2856362202
3294 2856369074
3295 2857355658
3296 2857371157
3297 2857523700
3298 2857534627
3299 2858801376
3300 2869167954
3301 2869173877
3302 2869236390
3303 2869247899
3304 2869251105
3305 2869263503
3306 2869268067
3307 2869272290
3308 2869278888
3309 2869291592
3310 2871433892
3311 2871443336
3312 2871445827
3313 2871455718
3314 2871463096
3315 2871469784
3316 2871477692
3317 2871485584
3318 2871495034
3319 2871500530
3320 2874108168
3321 2874109389
3322 2874119857
3323 2874125775
3324 2874138158
3325 2874145479
3326 2874153451
3327 2874160715
3328 2874167887
3329 2874172642
3330 2876368014
3331 2876385116
3332 2876387864
3333 2876403318
3334 2876411169
3335 2876419741
3336 2876424923
3337 2878041638
3338 2878737340
3339 2878743783
3340 2878751504
3341 2878758245
3342 2878764619
3343 2878771720
3344 2878780088
3345 2878782230
3346 2878793542
3347 2881152629
3348 2881156196
3349 2881168557
3350 2881848978
3351 2881860820
3352 2881861879
3353 2882633137
3354 2882917876
3355 2885310605
3356 2885317368
3357 2885325726
3358 2885329242
3359 2885335103
3360 2885346511
3361 2885353975
3362 2888340612
3363 2888356817
3364 2889011869
3365 2889023202
3366 2891051563
3367 2891375572
3368 2899796386
3369 2899808942
3370 2903449775
3371 2903495968
3372 2903505488
3373 2903521313
3374 2903527010
3375 2903533237
3376 2903545343
3377 2904661820
3378 2906313402
3379 2906326111
3380 2906328427
3381 2906367053
3382 2906375307
3383 2906390081
3384 2906399185
3385 2906404580
3386 2906414376
3387 2906416452
3388 2909048097
3389 2913300405
3390 2913310218
3391 2915651813
3392 2915985197
3393 2915987811
3394 2915997475
3395 2916003910
3396 2916014445
3397 2916015342
3398 2916028369
3399 2916034857
3400 2916041164
3401 2916046292
3402 2916051080
3403 2916060618
3404 2916067396
3405 2916070784
3406 2916082843
3407 2919107794
3408 2919115389
3409 2919167717
3410 2919175332
3411 2919409770
3412 2920824204
3413 2921207796
3414 2921210224
3415 2921243780
3416 2921250336
3417 2921253046
3418 2921260462
3419 2921270427
3420 2921289136
3421 2921293504
3422 2921304616
3423 2922136095
3424 2922153788
3425 2922165481
3426 2922172411
3427 2922192182
3428 2924147583
3429 2924156411
3430 2924165137
3431 2924172838
3432 2924179339
3433 2924183010
3434 2924192764
3435 2924197853
3436 2924206429
3437 2924211548
3438 2924215555
3439 2924223350
3440 2924234677
3441 2924726779
3442 2924734640
3443 2924745657
3444 2924749311
3445 2924757085
3446 2924763902
3447 2924781596
3448 2924789535
3449 2926756439
3450 2933008167
3451 2933012946
3452 2933019229
3453 2933575837
3454 2933586931
3455 2933595465
3456 2933602156
3457 2935898975
3458 2935904839
3459 2936373135
3460 2936381280
3461 2936384552
3462 2936997721
3463 2937007267
3464 2937012428
3465 2937022578
3466 2937029203
3467 2937031172
3468 2937040882
3469 2937049693
3470 2937050089
3471 2937059648
3472 2937071211
3473 2937075649
3474 2937079966
3475 2937089186
3476 2937092271
3477 2937105861
3478 2937113121
3479 2937117269
3480 2937125326
3481 2937130392
3482 2937820448
3483 2937827011
3484 2937840066
3485 2937846153
3486 2937853703
3487 2937862053
3488 2937869549
3489 2937879248
3490 2937895071
3491 2937975019
3492 2937981721
3493 2937999193
3494 2938016190
3495 2939670879
3496 2941499838
3497 2957380852
3498 2957388041
3499 2957394233
3500 2957399339
3501 2957407896
3502 2957412574
3503 2957416080
3504 2957422943
3505 2957436769
3506 2957439169
3507 2957450055
3508 2957456758
3509 2957464636
3510 2957470648
3511 2957472317
3512 2957483513
3513 2957491520
3514 2957494967
3515 2957505075
3516 2957505862
3517 2958035003
3518 2958042867
3519 2958067202
3520 2958072495
3521 2958086423
3522 2958100037
3523 2958103289
3524 2958113334
3525 2958122562
3526 2958126378
3527 2958135993
3528 2958139663
3529 2958162085
3530 2958169667
3531 2958177688
3532 2958185459
3533 2960590900
3534 2960596132
3535 2960602832
3536 2960607250
3537 2960614985
3538 2960623205
3539 2960628864
3540 2960634638
3541 2960639208
3542 2960652686
3543 2960653107
3544 2960666729
3545 2960673339
3546 2960680458
3547 2960686828
3548 2960693813
3549 2960699779
3550 2961083727
3551 2961116973
3552 2961136397
3553 2961141197
3554 2961168127
3555 2961174875
3556 2961187944
3557 2963648587
3558 2964611135
3559 2964620755
3560 2964628858
3561 2964635920
3562 2964637896
3563 2964649140
3564 2964655804
3565 2964660217
3566 2964666189
3567 2964678092
3568 2964679327
3569 2964685368
3570 2964698656
3571 2964702085
3572 2964709240
3573 2964714672
3574 2964719618
3575 2965022946
3576 2965029236
3577 2965036369
3578 2965046192
3579 2965067483
3580 2965095016
3581 2965104648
3582 2965111589
3583 2965121026
3584 2967668631
3585 2967674553
3586 2967685646
3587 2967688762
3588 2967699145
3589 2967700002
3590 2967714352
3591 2967720569
3592 2967728170
3593 2967734269
3594 2967741293
3595 2967744958
3596 2967753385
3597 2967757999
3598 2967769182
3599 2967775282
3600 2967782812
3601 2968000811
3602 2968009763
3603 2968017534
3604 2968083815
3605 2968092438
3606 2968100500
3607 2968112881
3608 2968122887
3609 2968128832
3610 2968143538
3611 2968176527
3612 2970026397
3613 2970032693
3614 2970038233
3615 2970041711
3616 2970054889
3617 2970060861
3618 2970061923
3619 2970075929
3620 2970081103
3621 2970084820
3622 2970095259
3623 2970099392
3624 2970103654
3625 2970112186
3626 2970121823
3627 2970127057
3628 2970135110
3629 2970136592
3630 2970145550
3631 2970155273
3632 2970158381
3633 2970168128
3634 2970174823
3635 2970181736
3636 2970187949
3637 2970193543
3638 2970472290
3639 2970489785
3640 2970507461
3641 2970517950
3642 2970530081
3643 2970538621
3644 2970545617
3645 2970551938
3646 2970559466
3647 2970593483
3648 2970625003
3649 2970632416
3650 2977520716
3651 2977524397
3652 2977533829
3653 2977542210
3654 2977547238
3655 2977557412
3656 2977565871
3657 2977571970
3658 2977579120
3659 2977585325
3660 2977828682
3661 2977831583
3662 2977848748
3663 2977854143
3664 2977860982
3665 2977872031
3666 2977879619
3667 2977906559
3668 2977907984
3669 2977918761
3670 2977929141
3671 2977937520
3672 2977946123
3673 2977954017
3674 2977958587
3675 2977987535
3676 2978974172
3677 2979106070
3678 2979713997
3679 2979747198
3680 2979767352
3681 2979775261
3682 2979779954
3683 2979795161
3684 2979812657
3685 2984512140
3686 2984521499
3687 2984540793
3688 2984589500
3689 2984603060
3690 2987640792
3691 2987645734
3692 2987656292
3693 2987664141
3694 2987670370
3695 2987680956
3696 2989352911
3697 2989773702
3698 2989778751
3699 2996311119
3700 2996341809
3701 2996348856
3702 2996351161
3703 2996388326
3704 2996892435
3705 2996898455
3706 3000136244
3707 3003933382
3708 3004170113
3709 3004193196
3710 3004208989
3711 3004212677
3712 3004222746
3713 3004236746
3714 3004245527
3715 3004255485
3716 3004269792
3717 3004277859
3718 3004296652
3719 3004340328
3720 3005409651
3721 3005420367
3722 3005447243
3723 637073630
3724 639648136
3725 643825497
3726 648740128
3727 649873565
3728 8002286149
3729 8003993329
3730 8004000585
3731 8004306589
3732 8004313777
3733 8004364013
3734 8004379756
3735 8004393852
3736 8004400035
3737 8004450050
3738 8004639214
3739 8004643184
3740 8004702742
3741 8004714522
3742 8004719656
3743 8004729378
3744 8005248303
3745 8005259717
3746 8005280206
3747 8005288273
3748 8005294799
3749 8005307042
3750 8005314557
3751 8005317318
3752 8005326962
3753 8005378785
3754 8005388007
3755 8005397038
3756 8005433245
3757 8005462518
3758 8005486618
3759 8005499896
3760 8005558113
3761 8005569291
3762 8005575432
3763 8005621263
3764 8005631437
3765 8005646240
3766 8005659419
3767 8005671314
3768 8005686374
3769 8005694956
3770 8005696156
3771 8018129558
3772 8018168099
3773 8018177895
3774 8023680973
3775 8024485749
3776 8024492566
3777 8024505215
3778 8046770326
3779 8049294384
3780 8054560808
3781 8055435049
3782 8055621933
3783 8056380142
3784 8056387553
3785 8057578256
3786 8057875496

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03364

Polyketide_cyc

Polyketide cyclase / dehydrase and lipid transport

36

166

0.97

PF10604

Polyketide_cyc2

Polyketide cyclase / dehydrase and lipid transport

27

170

0.67

Structural Annotation

Top 5 Hits

ID Description Score Start End
2d4r-assembly1.cif.gz_A crystal structure of ttha0849 from thermus thermophilus hb8 0.8516 2 131
1t17-assembly1.cif.gz_A solution structure of the 18 kda protein cc1736 from caulobacter crescentus: the northeast structural genomics consortium target ccr19 0.8288 1 130
6w3d-assembly1.cif.gz_A rd1ntf2_05 with long sheet 0.8129 32 79
1t17-assembly1.cif.gz_A solution structure of the 18 kda protein cc1736 from caulobacter crescentus: the northeast structural genomics consortium target ccr19 0.8126 1 130
2d4r-assembly1.cif.gz_A crystal structure of ttha0849 from thermus thermophilus hb8 0.811 2 131
ID Description Score Start End Superfamily
af_Q556V1_54_199_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.9053 4 131 3.30.530.20
af_P0AGL5_15_157_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.9011 2 130 3.30.530.20
af_Q8MLL3_83_228_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8962 2 130 3.30.530.20
af_A0A1D6NAC7_96_241_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8866 2 131 3.30.530.20
af_Q9USM9_11_156_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8816 2 125 3.30.530.20
ID Description Score Start End GO Terms
AF-A0A256GYQ5-F1-model_v4 Polyketide cyclase / dehydrase and lipid transport family protein 0.9933 17 131 GO:0045333
GO:0048039
AF-A0A5J4E2I0-F1-model_v4 Persistence and stress-resistance toxin PasT 0.9909 1 130 GO:0045333
GO:0048039
AF-A0A101VI81-F1-model_v4 Cyclase 0.9896 1 131 GO:0045333
GO:0048039
AF-A0A528LFB2-F1-model_v4 Type II toxin-antitoxin system RatA family toxin 0.9883 1 120 GO:0045333
GO:0048039
AF-A0A125NW27-F1-model_v4 Putative oligoketide cyclase/dehydratase or lipid transport protein YfjG 0.9862 1 132 GO:0045333
GO:0048039

Map