F495996

General Info

Members Datasets Scaffolds Average Seq Length
1895 413 1894 193

Family's Representative Sequence

Representative Sequence 3300001991|JGI24743J22301_10015365|JGI24743J22301_100153652
Length 232
Sequence MKKPSSPRGRGLGEGELGRTGASALCCSPLPNPLPSRGEGVSRAVQLWVGLGNPGAEYALNRHNVGFMAVDAIAEVHGFEPWKKGFQGWISAGRIGTTRILLLKPATYMNESGRAVGEALRFYKLDLAALTAFHDELDLDPFRVKVKTGGGAAGHNGLRSIDAHLGQEYRRVRLGIGHPGHKDRVTGYVLGNYAKAEMDDLSDMLGAVAAEAPLLVVGDDARFMNEVALRLA

Samples

Sample ID Description Type Environment
1 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
2 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
3 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
4 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
5 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
6 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
7 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
8 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
9 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
10 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
11 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
12 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
13 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
14 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
15 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
16 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
17 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
18 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
19 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
20 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
21 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
22 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
23 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
24 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
25 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
26 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
27 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
28 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
29 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
30 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
31 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
32 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
33 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
34 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
35 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
36 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
37 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
38 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
39 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
40 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
41 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
42 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
43 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
44 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
45 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
46 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
47 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
48 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
49 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
50 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
51 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
52 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
53 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
54 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
55 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
56 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
57 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
58 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
59 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
60 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
61 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
62 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
63 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
64 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
65 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
66 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
67 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
68 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
69 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
70 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
71 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
72 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
73 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
74 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
75 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
76 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
77 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
78 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
79 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
80 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
81 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
82 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
83 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
84 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
85 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
86 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
87 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
88 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
89 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
90 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
91 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
92 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
93 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
94 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
95 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
96 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
97 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
98 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
99 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
100 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
101 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
102 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
103 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
104 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
105 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
106 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
107 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
108 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
109 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
110 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
111 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
112 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
113 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
114 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
115 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
116 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
117 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
118 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
119 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
120 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
121 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
122 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
123 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
124 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
125 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
126 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
127 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
128 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
129 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
130 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
131 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
132 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
133 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
134 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
135 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
136 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
137 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
138 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
139 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
140 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
141 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
142 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
143 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
144 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
145 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
146 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
147 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
148 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
149 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
150 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
151 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
152 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
153 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
154 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
155 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
156 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
157 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
223 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
224 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
225 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
229 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
230 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
231 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
232 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
233 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
234 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
235 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
236 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
237 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
238 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
239 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
240 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
241 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
242 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
243 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
244 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
245 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
246 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
247 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
248 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
249 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
250 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
251 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
252 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
253 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
254 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
255 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
256 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
257 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
258 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
259 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
260 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
261 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
262 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
263 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
264 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
265 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
266 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
267 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
268 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
269 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
270 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
271 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
272 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
273 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
274 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
275 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
276 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
277 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
278 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
279 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
280 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
281 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
282 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
283 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
284 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
285 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
286 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
287 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
288 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
289 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
290 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
291 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
292 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
293 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
294 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
295 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
296 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
297 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
298 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
299 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
300 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
301 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
302 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
303 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
304 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
305 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
306 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
307 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
308 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
309 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
310 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
311 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
312 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
313 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
314 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
315 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
316 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
317 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
318 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
319 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
320 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
321 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
322 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
323 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
324 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
325 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
326 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
327 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
328 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
329 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
330 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
331 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
332 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
333 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
334 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
335 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
336 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
337 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
338 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
339 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
340 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
341 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
342 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
343 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
344 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
345 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
346 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
347 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
348 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
349 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
350 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
351 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
352 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
353 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
354 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
355 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
356 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
357 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
358 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
359 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
360 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
361 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
362 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
363 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
364 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
365 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
366 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
367 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
368 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
369 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
370 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
371 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
372 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
373 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
374 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
375 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
376 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
377 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
378 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
379 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
380 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
381 3300049684 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control Metagenome Rhizosphere
382 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
383 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
384 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
385 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
386 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
387 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
388 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
389 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
390 3300049771 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control Metagenome Rhizosphere
391 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
392 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
393 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
394 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
395 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
396 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
397 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
398 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
399 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
400 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
401 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
402 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
403 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
404 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
405 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
406 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
407 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
408 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
409 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
410 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
411 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
412 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
413 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.84
Metatranscriptomes 0.11
Isolates 0.05

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.59
Nodule 0.05
Rhizoplane 3.43
Rhizosphere 91.45
Stem 0
Stem Tuber 0
Unclassified 2.48

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 ARcpr5yngRDRAFT_c003288 3300000043 Bacteria 1607
2 JGI24741J21665_1001659 3300001915 Bacteria 6187
3 JGI24741J21665_1040782 3300001915 Bacteria 685
4 JGI24747J21853_1002986 3300001978 Bacteria 1431
5 JGI24740J21852_10002705 3300001979 Bacteria 7960
6 JGI24740J21852_10004469 3300001979 Bacteria 6016
7 JGI24739J22299_10005463 3300001989 Bacteria 4827
8 JGI24739J22299_10007970 3300001989 Bacteria 3963
9 JGI24739J22299_10038262 3300001989 Bacteria 1613
10 JGI24739J22299_10126294 3300001989 Bacteria 762
11 JGI24737J22298_10000770 3300001990 Bacteria 11319
12 JGI24737J22298_10002400 3300001990 Bacteria 6678
13 JGI24737J22298_10002874 3300001990 Bacteria 6106
14 JGI24737J22298_10003448 3300001990 Bacteria 5588
15 JGI24737J22298_10013246 3300001990 Bacteria 2685
16 JGI24737J22298_10019311 3300001990 Bacteria 2180
17 JGI24743J22301_10013975 3300001991 Bacteria 1476
18 JGI24743J22301_10015365 3300001991 Bacteria 1419
19 JGI24735J21928_10003315 3300002067 Bacteria 5493
20 JGI24735J21928_10006419 3300002067 Bacteria 3869
21 JGI24735J21928_10009097 3300002067 Bacteria 3197
22 JGI24735J21928_10009599 3300002067 Bacteria 3102
23 JGI24735J21928_10012916 3300002067 Bacteria 2635
24 JGI24735J21928_10014582 3300002067 Bacteria 2460
25 JGI24735J21928_10014595 3300002067 Bacteria 2459
26 JGI24735J21928_10016361 3300002067 Bacteria 2303
27 JGI24735J21928_10019585 3300002067 Bacteria 2079
28 JGI24735J21928_10021602 3300002067 Bacteria 1964
29 JGI24735J21928_10127769 3300002067 Bacteria 733
30 JGI24738J21930_10001329 3300002075 Bacteria 6901
31 JGI24738J21930_10004706 3300002075 Bacteria 3324
32 JGI24738J21930_10095422 3300002075 Bacteria 632
33 JGI24749J21850_1002330 3300002076 Bacteria 2673
34 JGI24744J21845_10002153 3300002077 Bacteria 3999
35 JGI24034J26672_10020287 3300002239 Bacteria 1041
36 JGI25150J39212_1008610 3300002774 Bacteria 1987
37 JGI25165J46597_1000173 3300003214 Bacteria 100834
38 JGI25153J46596_10000028 3300003215 Bacteria 209842
39 JGI25153J46596_10014361 3300003215 Bacteria 3295
40 rootL2_10006415 3300003322 Bacteria 1557
41 rootL2_10032995 3300003322 Bacteria 2016
42 Ga0055529_1010275 3300003763 Bacteria 1218
43 Ga0055537_1000888 3300003773 Bacteria 14255
44 Ga0055524_1000656 3300003775 Bacteria 24453
45 Ga0055530_10010618 3300003791 Bacteria 3381
46 Ga0055530_10012009 3300003791 Bacteria 3052
47 Ga0055530_10027289 3300003791 Bacteria 1562
48 Ga0055540_1004107 3300003792 Bacteria 6740
49 Ga0055531_10015136 3300003794 Bacteria 3422
50 Ga0055531_10032939 3300003794 Bacteria 1681
51 Ga0065712_10068360 3300005290 Bacteria 11322
52 Ga0065712_10241370 3300005290 Bacteria 977
53 Ga0065712_10331206 3300005290 Bacteria 814
54 Ga0065712_10430474 3300005290 Bacteria 703
55 Ga0065715_10002750 3300005293 Bacteria 5794
56 Ga0065715_10208429 3300005293 Bacteria 1326
57 Ga0065707_10606122 3300005295 Bacteria 687
58 Ga0070658_10000183 3300005327 Bacteria 54970
59 Ga0070658_10000774 3300005327 Bacteria 27456
60 Ga0070658_10000967 3300005327 Bacteria 24637
61 Ga0070658_10003948 3300005327 Bacteria 12159
62 Ga0070658_10013926 3300005327 Bacteria 6457
63 Ga0070658_10036947 3300005327 Bacteria 3936
64 Ga0070658_10135781 3300005327 Bacteria 2052
65 Ga0070658_10323621 3300005327 Bacteria 1317
66 Ga0070658_10495619 3300005327 Bacteria 1055
67 Ga0070658_10797609 3300005327 Bacteria 820
68 Ga0070676_10000711 3300005328 Bacteria 16259
69 Ga0070676_10002711 3300005328 Bacteria 9126
70 Ga0070676_10036515 3300005328 Bacteria 2831
71 Ga0070676_10307875 3300005328 Bacteria 1076
72 Ga0070683_100009410 3300005329 Bacteria 8354
73 Ga0070683_100013936 3300005329 Bacteria 7023
74 Ga0070683_100024621 3300005329 Bacteria 5394
75 Ga0070683_100036108 3300005329 Bacteria 4520
76 Ga0070683_100419202 3300005329 Bacteria 1277
77 Ga0070690_100398122 3300005330 Bacteria 1011
78 Ga0070670_100000716 3300005331 Bacteria 25784
79 Ga0070670_100000968 3300005331 Bacteria 22548
80 Ga0070670_100007965 3300005331 Bacteria 9011
81 Ga0070670_100018969 3300005331 Bacteria 5898
82 Ga0070670_100041634 3300005331 Bacteria 3948
83 Ga0070670_100047859 3300005331 Bacteria 3680
84 Ga0070670_100583006 3300005331 Bacteria 1000
85 Ga0070670_100685515 3300005331 Bacteria 921
86 Ga0070670_101332002 3300005331 Bacteria 658
87 Ga0070677_10002901 3300005333 Bacteria 5507
88 Ga0070677_10015185 3300005333 Bacteria 2725
89 Ga0070677_10032066 3300005333 Bacteria 2013
90 Ga0070677_10058710 3300005333 Bacteria 1581
91 Ga0068869_100001660 3300005334 Bacteria 13288
92 Ga0068869_100213227 3300005334 Bacteria 1527
93 Ga0070666_10000849 3300005335 Bacteria 18514
94 Ga0070666_10025296 3300005335 Bacteria 3869
95 Ga0070666_10029463 3300005335 Bacteria 3609
96 Ga0070666_10476800 3300005335 Bacteria 903
97 Ga0070680_100000385 3300005336 Bacteria 29938
98 Ga0070680_100005976 3300005336 Bacteria 9232
99 Ga0070680_100021639 3300005336 Bacteria 5113
100 Ga0070680_100038994 3300005336 Bacteria 3843
101 Ga0070680_100093855 3300005336 Bacteria 2487
102 Ga0070680_100158342 3300005336 Bacteria 1903
103 Ga0070680_100269885 3300005336 Bacteria 1440
104 Ga0070680_100602965 3300005336 Bacteria 942
105 Ga0070682_100008091 3300005337 Bacteria 5925
106 Ga0068868_100001759 3300005338 Bacteria 14835
107 Ga0068868_100010535 3300005338 Bacteria 6699
108 Ga0068868_100031093 3300005338 Bacteria 4097
109 Ga0068868_100701948 3300005338 Bacteria 905
110 Ga0070660_100000536 3300005339 Bacteria 25355
111 Ga0070660_100000692 3300005339 Bacteria 22324
112 Ga0070660_100013544 3300005339 Bacteria 5853
113 Ga0070660_100022506 3300005339 Bacteria 4661
114 Ga0070660_100036128 3300005339 Bacteria 3742
115 Ga0070660_100056487 3300005339 Bacteria 3037
116 Ga0070660_100065030 3300005339 Bacteria 2838
117 Ga0070660_100071313 3300005339 Bacteria 2712
118 Ga0070660_100091521 3300005339 Bacteria 2399
119 Ga0070660_100110598 3300005339 Bacteria 2185
120 Ga0070660_100115645 3300005339 Bacteria 2138
121 Ga0070660_100241202 3300005339 Bacteria 1472
122 Ga0070660_100245551 3300005339 Bacteria 1459
123 Ga0070660_100334922 3300005339 Bacteria 1245
124 Ga0070660_100355589 3300005339 Bacteria 1207
125 Ga0070660_100409199 3300005339 Bacteria 1122
126 Ga0070660_100490219 3300005339 Bacteria 1022
127 Ga0070660_100947572 3300005339 Bacteria 727
128 Ga0070691_10005850 3300005341 Bacteria 5610
129 Ga0070687_100050942 3300005343 Bacteria 2141
130 Ga0070687_100132264 3300005343 Bacteria 1442
131 Ga0070661_100000682 3300005344 Bacteria 24927
132 Ga0070661_100004481 3300005344 Bacteria 9633
133 Ga0070661_100011672 3300005344 Bacteria 6125
134 Ga0070661_100018506 3300005344 Bacteria 4953
135 Ga0070661_100023317 3300005344 Bacteria 4435
136 Ga0070661_100031251 3300005344 Bacteria 3849
137 Ga0070661_100035425 3300005344 Bacteria 3624
138 Ga0070661_100071006 3300005344 Bacteria 2562
139 Ga0070661_100086292 3300005344 Bacteria 2320
140 Ga0070661_100125863 3300005344 Bacteria 1922
141 Ga0070661_100134928 3300005344 Bacteria 1856
142 Ga0070661_100341724 3300005344 Bacteria 1173
143 Ga0070661_100625944 3300005344 Bacteria 872
144 Ga0070692_10002543 3300005345 Bacteria 7102
145 Ga0070692_10055556 3300005345 Bacteria 2070
146 Ga0070692_10069554 3300005345 Bacteria 1873
147 Ga0070692_10103580 3300005345 Bacteria 1563
148 Ga0070692_10171488 3300005345 Bacteria 1251
149 Ga0070692_10608348 3300005345 Bacteria 724
150 Ga0070668_100001032 3300005347 Bacteria 19554
151 Ga0070668_100026256 3300005347 Bacteria 4418
152 Ga0070668_100042128 3300005347 Bacteria 3499
153 Ga0070668_100045957 3300005347 Bacteria 3351
154 Ga0070668_100107975 3300005347 Bacteria 2213
155 Ga0070668_100332947 3300005347 Bacteria 1281
156 Ga0070668_100982910 3300005347 Bacteria 758
157 Ga0070668_101420593 3300005347 Bacteria 633
158 Ga0070669_100048848 3300005353 Bacteria 3089
159 Ga0070669_100120388 3300005353 Bacteria 2002
160 Ga0070669_100275436 3300005353 Bacteria 1347
161 Ga0070675_100000229 3300005354 Bacteria 36015
162 Ga0070675_100000245 3300005354 Bacteria 35240
163 Ga0070675_100004718 3300005354 Bacteria 10404
164 Ga0070675_100035763 3300005354 Bacteria 4038
165 Ga0070671_100000407 3300005355 Bacteria 29738
166 Ga0070671_100002662 3300005355 Bacteria 13841
167 Ga0070671_100010693 3300005355 Bacteria 7367
168 Ga0070671_100016777 3300005355 Bacteria 5922
169 Ga0070671_100017120 3300005355 Bacteria 5864
170 Ga0070671_100025494 3300005355 Bacteria 4852
171 Ga0070671_100064434 3300005355 Bacteria 3052
172 Ga0070671_100066831 3300005355 Bacteria 2996
173 Ga0070671_100069989 3300005355 Bacteria 2927
174 Ga0070671_100100056 3300005355 Bacteria 2432
175 Ga0070671_100194385 3300005355 Bacteria 1720
176 Ga0070671_100219842 3300005355 Bacteria 1612
177 Ga0070671_100227748 3300005355 Bacteria 1582
178 Ga0070671_100236246 3300005355 Bacteria 1551
179 Ga0070671_100273270 3300005355 Bacteria 1436
180 Ga0070671_100561234 3300005355 Bacteria 985
181 Ga0070671_100963714 3300005355 Bacteria 746
182 Ga0070674_100002839 3300005356 Bacteria 9578
183 Ga0070674_100003998 3300005356 Bacteria 8358
184 Ga0070674_100006636 3300005356 Bacteria 6768
185 Ga0070674_100071806 3300005356 Bacteria 2449
186 Ga0070674_100076288 3300005356 Bacteria 2383
187 Ga0070674_100259067 3300005356 Bacteria 1369
188 Ga0070674_100286189 3300005356 Bacteria 1308
189 Ga0070673_100000013 3300005364 Bacteria 137021
190 Ga0070673_100030052 3300005364 Bacteria 4060
191 Ga0070673_100033990 3300005364 Bacteria 3853
192 Ga0070673_100115526 3300005364 Bacteria 2232
193 Ga0070673_100134501 3300005364 Bacteria 2079
194 Ga0070673_100247681 3300005364 Bacteria 1552
195 Ga0070673_100435440 3300005364 Bacteria 1177
196 Ga0070673_100505136 3300005364 Bacteria 1094
197 Ga0070673_100537286 3300005364 Bacteria 1061
198 Ga0070673_100697977 3300005364 Bacteria 932
199 Ga0070673_100711826 3300005364 Bacteria 923
200 Ga0070673_100733533 3300005364 Bacteria 909
201 Ga0070659_100000683 3300005366 Bacteria 24702
202 Ga0070659_100027322 3300005366 Bacteria 4396
203 Ga0070659_100035680 3300005366 Bacteria 3873
204 Ga0070659_100051806 3300005366 Bacteria 3228
205 Ga0070659_100083672 3300005366 Bacteria 2551
206 Ga0070659_100160221 3300005366 Bacteria 1839
207 Ga0070659_100332046 3300005366 Bacteria 1273
208 Ga0070659_100365114 3300005366 Bacteria 1214
209 Ga0070659_100530505 3300005366 Bacteria 1006
210 Ga0070659_100966510 3300005366 Bacteria 746
211 Ga0070667_100000016 3300005367 Bacteria 237028
212 Ga0070667_100003558 3300005367 Bacteria 13271
213 Ga0070667_100005475 3300005367 Bacteria 10597
214 Ga0070667_100005510 3300005367 Bacteria 10572
215 Ga0070667_100006422 3300005367 Bacteria 9769
216 Ga0070667_100012781 3300005367 Bacteria 6938
217 Ga0070667_100021279 3300005367 Bacteria 5388
218 Ga0070667_100035304 3300005367 Bacteria 4187
219 Ga0070667_100036361 3300005367 Bacteria 4129
220 Ga0070667_100092392 3300005367 Bacteria 2604
221 Ga0070667_100092405 3300005367 Bacteria 2604
222 Ga0070667_100099952 3300005367 Bacteria 2504
223 Ga0070667_100146907 3300005367 Bacteria 2068
224 Ga0070667_100167583 3300005367 Bacteria 1938
225 Ga0070667_100214936 3300005367 Bacteria 1710
226 Ga0070667_100255572 3300005367 Bacteria 1567
227 Ga0070667_100817040 3300005367 Bacteria 866
228 Ga0070709_10027245 3300005434 Bacteria 3396
229 Ga0070709_10037839 3300005434 Bacteria 2950
230 Ga0070709_10061510 3300005434 Bacteria 2391
231 Ga0070714_100013844 3300005435 Bacteria 6467
232 Ga0070714_100017921 3300005435 Bacteria 5742
233 Ga0070714_100059247 3300005435 Bacteria 3282
234 Ga0070714_100115651 3300005435 Bacteria 2381
235 Ga0070714_100354751 3300005435 Bacteria 1378
236 Ga0070714_100481438 3300005435 Bacteria 1182
237 Ga0070713_100032306 3300005436 Bacteria 4179
238 Ga0070713_100046967 3300005436 Bacteria 3546
239 Ga0070713_100249655 3300005436 Bacteria 1618
240 Ga0070713_100280346 3300005436 Bacteria 1529
241 Ga0070713_100457739 3300005436 Bacteria 1199
242 Ga0070710_10002630 3300005437 Bacteria 8527
243 Ga0070710_10414725 3300005437 Bacteria 905
244 Ga0070711_100101618 3300005439 Bacteria 2092
245 Ga0070700_100036553 3300005441 Bacteria 2979
246 Ga0070708_100202369 3300005445 Bacteria 1859
247 Ga0070663_100002889 3300005455 Bacteria 9769
248 Ga0070663_100003431 3300005455 Bacteria 9139
249 Ga0070663_100010382 3300005455 Bacteria 5804
250 Ga0070663_100020955 3300005455 Bacteria 4337
251 Ga0070663_100026996 3300005455 Bacteria 3894
252 Ga0070663_100054289 3300005455 Bacteria 2863
253 Ga0070663_100057221 3300005455 Bacteria 2796
254 Ga0070663_100060586 3300005455 Bacteria 2723
255 Ga0070663_100067013 3300005455 Bacteria 2603
256 Ga0070663_100106713 3300005455 Bacteria 2098
257 Ga0070663_100125694 3300005455 Bacteria 1942
258 Ga0070663_100311799 3300005455 Bacteria 1263
259 Ga0070663_100528783 3300005455 Bacteria 983
260 Ga0070663_100586431 3300005455 Bacteria 936
261 Ga0070678_100001779 3300005456 Bacteria 11617
262 Ga0070678_100003165 3300005456 Bacteria 9116
263 Ga0070678_100024305 3300005456 Bacteria 4055
264 Ga0070678_100061906 3300005456 Bacteria 2760
265 Ga0070678_100089819 3300005456 Bacteria 2353
266 Ga0070678_100345086 3300005456 Bacteria 1278
267 Ga0070662_100001032 3300005457 Bacteria 17006
268 Ga0070662_100001340 3300005457 Bacteria 15141
269 Ga0070662_100002309 3300005457 Bacteria 11710
270 Ga0070662_100002550 3300005457 Bacteria 11217
271 Ga0070662_100015381 3300005457 Bacteria 5123
272 Ga0070662_100018411 3300005457 Bacteria 4724
273 Ga0070662_100031773 3300005457 Bacteria 3708
274 Ga0070662_100084537 3300005457 Bacteria 2370
275 Ga0070662_100088187 3300005457 Bacteria 2325
276 Ga0070662_100221265 3300005457 Bacteria 1511
277 Ga0070662_100258741 3300005457 Bacteria 1402
278 Ga0070662_100725694 3300005457 Bacteria 842
279 Ga0070662_100783936 3300005457 Bacteria 810
280 Ga0070662_100938116 3300005457 Bacteria 739
281 Ga0070681_10042114 3300005458 Bacteria 4577
282 Ga0070681_10050076 3300005458 Bacteria 4169
283 Ga0070681_10176284 3300005458 Bacteria 2060
284 Ga0070681_10245937 3300005458 Bacteria 1702
285 Ga0070681_10394153 3300005458 Bacteria 1295
286 Ga0070681_10413469 3300005458 Bacteria 1261
287 Ga0068867_100000009 3300005459 Bacteria 137021
288 Ga0068867_100002596 3300005459 Bacteria 12739
289 Ga0068867_100011890 3300005459 Bacteria 6148
290 Ga0068867_100029067 3300005459 Bacteria 3982
291 Ga0070707_100115765 3300005468 Bacteria 2602
292 Ga0070707_100493072 3300005468 Bacteria 1187
293 Ga0070698_100002776 3300005471 Bacteria 19261
294 Ga0070698_100163676 3300005471 Bacteria 2168
295 Ga0070698_100757718 3300005471 Bacteria 914
296 Ga0070699_100443062 3300005518 Bacteria 1177
297 Ga0070679_100015604 3300005530 Bacteria 7300
298 Ga0070679_100062481 3300005530 Bacteria 3713
299 Ga0070679_100078716 3300005530 Bacteria 3285
300 Ga0070679_100160360 3300005530 Bacteria 2224
301 Ga0070679_100192949 3300005530 Bacteria 2005
302 Ga0070679_100268766 3300005530 Bacteria 1659
303 Ga0070679_100474623 3300005530 Bacteria 1195
304 Ga0070679_100558051 3300005530 Bacteria 1089
305 Ga0070679_100575586 3300005530 Bacteria 1070
306 Ga0070679_100750377 3300005530 Bacteria 919
307 Ga0070679_100872075 3300005530 Bacteria 843
308 Ga0070679_101008731 3300005530 Bacteria 776
309 Ga0070679_101365447 3300005530 Bacteria 655
310 Ga0070684_100001781 3300005535 Bacteria 15732
311 Ga0070684_100064441 3300005535 Bacteria 3214
312 Ga0070684_100073894 3300005535 Bacteria 3005
313 Ga0070684_100253809 3300005535 Bacteria 1607
314 Ga0070684_100717243 3300005535 Bacteria 933
315 Ga0070684_100721904 3300005535 Bacteria 929
316 Ga0068853_100007843 3300005539 Bacteria 8561
317 Ga0068853_100020622 3300005539 Bacteria 5481
318 Ga0068853_100031692 3300005539 Bacteria 4472
319 Ga0068853_100036855 3300005539 Bacteria 4160
320 Ga0068853_100049338 3300005539 Bacteria 3617
321 Ga0068853_100067678 3300005539 Bacteria 3103
322 Ga0068853_100169378 3300005539 Bacteria 1975
323 Ga0068853_100279131 3300005539 Bacteria 1540
324 Ga0068853_100406751 3300005539 Bacteria 1275
325 Ga0068853_100487219 3300005539 Bacteria 1163
326 Ga0068853_100622598 3300005539 Bacteria 1026
327 Ga0068853_100696796 3300005539 Bacteria 969
328 Ga0070672_100003890 3300005543 Bacteria 9732
329 Ga0070672_100041996 3300005543 Bacteria 3519
330 Ga0070672_100062289 3300005543 Bacteria 2943
331 Ga0070672_100063546 3300005543 Bacteria 2915
332 Ga0070672_100069994 3300005543 Bacteria 2787
333 Ga0070672_100174392 3300005543 Bacteria 1789
334 Ga0070672_100365105 3300005543 Bacteria 1233
335 Ga0070686_100224933 3300005544 Bacteria 1358
336 Ga0070695_100238134 3300005545 Bacteria 1319
337 Ga0070696_100231254 3300005546 Bacteria 1391
338 Ga0070693_100001146 3300005547 Bacteria 11900
339 Ga0070693_100066081 3300005547 Bacteria 2116
340 Ga0070693_100099272 3300005547 Bacteria 1771
341 Ga0070693_100178327 3300005547 Bacteria 1366
342 Ga0070693_100256687 3300005547 Bacteria 1161
343 Ga0070665_100003564 3300005548 Bacteria 16507
344 Ga0070665_100017144 3300005548 Bacteria 7267
345 Ga0070665_100023457 3300005548 Bacteria 6213
346 Ga0070665_100025738 3300005548 Bacteria 5927
347 Ga0070665_100029212 3300005548 Bacteria 5549
348 Ga0070665_100148204 3300005548 Bacteria 2349
349 Ga0070665_100481396 3300005548 Bacteria 1252
350 Ga0070665_101008973 3300005548 Bacteria 844
351 Ga0070665_101193253 3300005548 Bacteria 772
352 Ga0068855_100000040 3300005563 Bacteria 153617
353 Ga0068855_100004727 3300005563 Bacteria 16630
354 Ga0068855_100013283 3300005563 Bacteria 9931
355 Ga0068855_100033034 3300005563 Bacteria 6177
356 Ga0068855_100033251 3300005563 Bacteria 6156
357 Ga0068855_100136587 3300005563 Bacteria 2797
358 Ga0068855_100200167 3300005563 Bacteria 2249
359 Ga0068855_100234573 3300005563 Bacteria 2052
360 Ga0068855_100255065 3300005563 Bacteria 1955
361 Ga0068855_100422656 3300005563 Bacteria 1457
362 Ga0068855_100544742 3300005563 Bacteria 1257
363 Ga0068855_100688596 3300005563 Bacteria 1095
364 Ga0068855_100781498 3300005563 Bacteria 1016
365 Ga0068855_101383833 3300005563 Bacteria 726
366 Ga0070664_100000247 3300005564 Bacteria 38997
367 Ga0070664_100001349 3300005564 Bacteria 19586
368 Ga0070664_100002842 3300005564 Bacteria 14008
369 Ga0070664_100009084 3300005564 Bacteria 8065
370 Ga0070664_100010096 3300005564 Bacteria 7654
371 Ga0070664_100011650 3300005564 Bacteria 7135
372 Ga0070664_100012567 3300005564 Bacteria 6887
373 Ga0070664_100012690 3300005564 Bacteria 6859
374 Ga0070664_100024820 3300005564 Bacteria 4964
375 Ga0070664_100038751 3300005564 Bacteria 4013
376 Ga0070664_100039188 3300005564 Bacteria 3992
377 Ga0070664_100065825 3300005564 Bacteria 3093
378 Ga0070664_100240859 3300005564 Bacteria 1624
379 Ga0070664_100276072 3300005564 Bacteria 1515
380 Ga0070664_100302862 3300005564 Bacteria 1445
381 Ga0068857_100004827 3300005577 Bacteria 11423
382 Ga0068857_100028808 3300005577 Bacteria 4900
383 Ga0068857_100093641 3300005577 Bacteria 2690
384 Ga0068857_100114801 3300005577 Bacteria 2422
385 Ga0068857_100245843 3300005577 Bacteria 1639
386 Ga0068857_100301801 3300005577 Bacteria 1476
387 Ga0068857_100484889 3300005577 Bacteria 1159
388 Ga0068857_100932098 3300005577 Bacteria 834
389 Ga0068854_100004295 3300005578 Bacteria 8979
390 Ga0068854_100005287 3300005578 Bacteria 8150
391 Ga0068854_100008596 3300005578 Bacteria 6573
392 Ga0068854_100011168 3300005578 Bacteria 5835
393 Ga0068854_100015912 3300005578 Bacteria 4999
394 Ga0068854_100041198 3300005578 Bacteria 3262
395 Ga0068854_100067194 3300005578 Bacteria 2611
396 Ga0068854_100077547 3300005578 Bacteria 2446
397 Ga0068854_100534538 3300005578 Bacteria 992
398 Ga0068854_100577923 3300005578 Bacteria 956
399 Ga0068856_100000213 3300005614 Bacteria 62582
400 Ga0068856_100036691 3300005614 Bacteria 4807
401 Ga0068856_100051792 3300005614 Bacteria 4047
402 Ga0068856_100072241 3300005614 Bacteria 3416
403 Ga0068856_100112829 3300005614 Bacteria 2716
404 Ga0068856_100245553 3300005614 Bacteria 1805
405 Ga0068856_100276924 3300005614 Bacteria 1694
406 Ga0068856_100327059 3300005614 Bacteria 1550
407 Ga0068856_100342318 3300005614 Bacteria 1514
408 Ga0068856_100452031 3300005614 Bacteria 1305
409 Ga0068856_100503944 3300005614 Bacteria 1232
410 Ga0070702_100291567 3300005615 Bacteria 1125
411 Ga0068852_100001218 3300005616 Bacteria 17107
412 Ga0068852_100001899 3300005616 Bacteria 14214
413 Ga0068852_100002661 3300005616 Bacteria 12350
414 Ga0068852_100003585 3300005616 Bacteria 10864
415 Ga0068852_100006724 3300005616 Bacteria 8341
416 Ga0068852_100023778 3300005616 Bacteria 4940
417 Ga0068852_100041821 3300005616 Bacteria 3876
418 Ga0068852_100079368 3300005616 Bacteria 2907
419 Ga0068852_100112812 3300005616 Bacteria 2474
420 Ga0068852_100132036 3300005616 Bacteria 2301
421 Ga0068852_100178483 3300005616 Bacteria 1995
422 Ga0068852_100217005 3300005616 Bacteria 1818
423 Ga0068852_100223148 3300005616 Bacteria 1793
424 Ga0068852_100269579 3300005616 Bacteria 1638
425 Ga0068852_100418991 3300005616 Bacteria 1320
426 Ga0068852_100480502 3300005616 Bacteria 1235
427 Ga0068859_100002199 3300005617 Bacteria 19802
428 Ga0068859_100025518 3300005617 Bacteria 5928
429 Ga0068859_100026116 3300005617 Bacteria 5858
430 Ga0068859_100026638 3300005617 Bacteria 5797
431 Ga0068859_100094906 3300005617 Bacteria 3035
432 Ga0068859_100278717 3300005617 Bacteria 1764
433 Ga0068859_101276808 3300005617 Bacteria 809
434 Ga0068864_100000287 3300005618 Bacteria 44806
435 Ga0068864_100000901 3300005618 Bacteria 24987
436 Ga0068864_100026990 3300005618 Bacteria 4845
437 Ga0068864_100037478 3300005618 Bacteria 4138
438 Ga0068864_100039736 3300005618 Bacteria 4021
439 Ga0068864_100042247 3300005618 Bacteria 3901
440 Ga0068864_100053069 3300005618 Bacteria 3496
441 Ga0068864_100093737 3300005618 Bacteria 2653
442 Ga0068864_100136984 3300005618 Bacteria 2205
443 Ga0068864_100287410 3300005618 Bacteria 1536
444 Ga0068864_100335393 3300005618 Bacteria 1424
445 Ga0068864_101097047 3300005618 Bacteria 792
446 Ga0068861_100005527 3300005719 Bacteria 8561
447 Ga0068861_100028462 3300005719 Bacteria 4078
448 Ga0068861_100381294 3300005719 Bacteria 1246
449 Ga0068851_10002865 3300005834 Bacteria 7618
450 Ga0068851_10102504 3300005834 Bacteria 1520
451 Ga0068851_10187786 3300005834 Bacteria 1147
452 Ga0068851_10193756 3300005834 Bacteria 1131
453 Ga0068851_10332904 3300005834 Bacteria 880
454 Ga0068851_10344346 3300005834 Bacteria 866
455 Ga0068870_10109624 3300005840 Bacteria 1574
456 Ga0068870_10705261 3300005840 Bacteria 696
457 Ga0068863_100000116 3300005841 Bacteria 84030
458 Ga0068863_100002674 3300005841 Bacteria 17620
459 Ga0068863_100014396 3300005841 Bacteria 7618
460 Ga0068863_100026576 3300005841 Bacteria 5520
461 Ga0068863_100045217 3300005841 Bacteria 4178
462 Ga0068863_100076737 3300005841 Bacteria 3161
463 Ga0068863_100081192 3300005841 Bacteria 3071
464 Ga0068863_100140721 3300005841 Bacteria 2306
465 Ga0068863_100855858 3300005841 Bacteria 908
466 Ga0068858_100001510 3300005842 Bacteria 23893
467 Ga0068858_100034185 3300005842 Bacteria 4715
468 Ga0068858_100055495 3300005842 Bacteria 3662
469 Ga0068858_100115813 3300005842 Bacteria 2505
470 Ga0068858_100124042 3300005842 Bacteria 2417
471 Ga0068858_100154341 3300005842 Bacteria 2160
472 Ga0068858_100229060 3300005842 Bacteria 1761
473 Ga0068858_100367898 3300005842 Bacteria 1378
474 Ga0068858_100430960 3300005842 Bacteria 1269
475 Ga0068860_100000192 3300005843 Bacteria 97363
476 Ga0068860_100000361 3300005843 Bacteria 60231
477 Ga0068860_100002208 3300005843 Bacteria 20485
478 Ga0068860_100038196 3300005843 Bacteria 4594
479 Ga0068860_100090168 3300005843 Bacteria 2920
480 Ga0068860_100273262 3300005843 Bacteria 1650
481 Ga0068860_100574396 3300005843 Bacteria 1131
482 Ga0068860_100707965 3300005843 Bacteria 1017
483 Ga0068862_100001874 3300005844 Bacteria 19050
484 Ga0068862_100032827 3300005844 Bacteria 4385
485 Ga0068862_100175792 3300005844 Bacteria 1919
486 Ga0068862_100325247 3300005844 Bacteria 1420
487 Ga0068862_100758696 3300005844 Bacteria 944
488 Ga0068862_100765025 3300005844 Bacteria 941
489 Ga0081455_10417199 3300005937 Bacteria 927
490 Ga0081540_1005349 3300005983 Bacteria 9601
491 Ga0081539_10011568 3300005985 Bacteria 6955
492 Ga0081539_10109299 3300005985 Bacteria 1395
493 Ga0070717_10000240 3300006028 Bacteria 37664
494 Ga0070717_10023468 3300006028 Bacteria 4888
495 Ga0070717_10126828 3300006028 Bacteria 2191
496 Ga0070716_100013250 3300006173 Bacteria 4198
497 Ga0070716_100184426 3300006173 Bacteria 1373
498 Ga0070712_100011282 3300006175 Bacteria 5661
499 Ga0070712_100021257 3300006175 Bacteria 4259
500 Ga0070712_100022155 3300006175 Bacteria 4181
501 Ga0070712_100087135 3300006175 Bacteria 2277
502 Ga0070712_100948395 3300006175 Bacteria 743
503 Ga0075366_10064061 3300006195 Bacteria 2186
504 Ga0097621_100037355 3300006237 Bacteria 3891
505 Ga0097621_100055585 3300006237 Bacteria 3233
506 Ga0097621_100124103 3300006237 Bacteria 2192
507 Ga0097621_100154435 3300006237 Bacteria 1969
508 Ga0097621_100187887 3300006237 Bacteria 1788
509 Ga0097621_100228280 3300006237 Bacteria 1625
510 Ga0097621_101263686 3300006237 Bacteria 696
511 Ga0075370_10031389 3300006353 Bacteria 2966
512 Ga0068871_100019956 3300006358 Bacteria 5126
513 Ga0068871_100033132 3300006358 Bacteria 4088
514 Ga0068871_100034208 3300006358 Bacteria 4031
515 Ga0068871_100055299 3300006358 Bacteria 3222
516 Ga0068871_100237621 3300006358 Bacteria 1583
517 Ga0068871_100524105 3300006358 Bacteria 1070
518 Ga0068871_100526070 3300006358 Bacteria 1068
519 Ga0068871_100609412 3300006358 Bacteria 993
520 Ga0075431_100038488 3300006847 Bacteria 4924
521 Ga0068865_100001251 3300006881 Bacteria 14774
522 Ga0068865_100021693 3300006881 Bacteria 4181
523 Ga0068865_100076819 3300006881 Bacteria 2385
524 Ga0097620_100002199 3300006931 Bacteria 19802
525 Ga0097620_100025518 3300006931 Bacteria 5928
526 Ga0097620_100026116 3300006931 Bacteria 5858
527 Ga0097620_100026637 3300006931 Bacteria 5797
528 Ga0097620_100094903 3300006931 Bacteria 3035
529 Ga0097620_100278716 3300006931 Bacteria 1764
530 Ga0097620_101277361 3300006931 Bacteria 809
531 Ga0099795_10087037 3300007788 Bacteria 1205
532 Ga0099795_10270610 3300007788 Bacteria 738
533 Ga0105251_10034715 3300009011 Bacteria 2494
534 Ga0105240_10017486 3300009093 Bacteria 9664
535 Ga0105240_10019972 3300009093 Bacteria 8946
536 Ga0105240_10070485 3300009093 Bacteria 4324
537 Ga0105240_10666109 3300009093 Bacteria 1139
538 Ga0111539_10092291 3300009094 Bacteria 3558
539 Ga0111539_10756359 3300009094 Bacteria 1131
540 Ga0105245_10002910 3300009098 Bacteria 15364
541 Ga0105245_10094564 3300009098 Bacteria 2755
542 Ga0105245_10287679 3300009098 Bacteria 1609
543 Ga0105247_10114224 3300009101 Bacteria 1741
544 Ga0105247_10168599 3300009101 Bacteria 1454
545 Ga0105243_10000032 3300009148 Bacteria 183324
546 Ga0105241_10035069 3300009174 Bacteria 3773
547 Ga0105241_10055386 3300009174 Bacteria 3038
548 Ga0105242_10000166 3300009176 Bacteria 49832
549 Ga0105242_10395908 3300009176 Bacteria 1288
550 Ga0105248_10001704 3300009177 Bacteria 24459
551 Ga0105248_10003197 3300009177 Bacteria 18161
552 Ga0105248_10015961 3300009177 Bacteria 8270
553 Ga0105248_10028113 3300009177 Bacteria 6263
554 Ga0105248_10028918 3300009177 Bacteria 6178
555 Ga0105248_10031829 3300009177 Bacteria 5894
556 Ga0105248_10056805 3300009177 Bacteria 4391
557 Ga0105248_10119410 3300009177 Bacteria 2974
558 Ga0105248_10140409 3300009177 Bacteria 2725
559 Ga0105248_10141637 3300009177 Bacteria 2713
560 Ga0105248_10152178 3300009177 Bacteria 2610
561 Ga0105248_10156577 3300009177 Bacteria 2571
562 Ga0105248_10243737 3300009177 Bacteria 2023
563 Ga0105248_10271955 3300009177 Bacteria 1908
564 Ga0105248_10439121 3300009177 Bacteria 1470
565 Ga0105248_10529776 3300009177 Bacteria 1329
566 Ga0105248_10743979 3300009177 Bacteria 1106
567 Ga0105248_11881106 3300009177 Bacteria 679
568 Ga0105237_10008286 3300009545 Bacteria 11286
569 Ga0105237_10009240 3300009545 Bacteria 10574
570 Ga0105237_10113509 3300009545 Bacteria 2702
571 Ga0105237_10216369 3300009545 Bacteria 1916
572 Ga0105237_10814795 3300009545 Bacteria 940
573 Ga0105238_10030456 3300009551 Bacteria 5493
574 Ga0105238_10050979 3300009551 Bacteria 4165
575 Ga0105238_10064076 3300009551 Bacteria 3676
576 Ga0105238_10075225 3300009551 Bacteria 3369
577 Ga0105238_10221692 3300009551 Bacteria 1867
578 Ga0105238_10293566 3300009551 Bacteria 1608
579 Ga0105249_10037814 3300009553 Bacteria 4379
580 Ga0105249_10038017 3300009553 Bacteria 4367
581 Ga0105249_10077081 3300009553 Bacteria 3091
582 Ga0105249_10145242 3300009553 Bacteria 2278
583 Ga0105249_10580957 3300009553 Bacteria 1174
584 Ga0099796_10001572 3300010159 Bacteria 4672
585 Ga0105239_10021649 3300010375 Bacteria 7088
586 Ga0105239_10843823 3300010375 Bacteria 1050
587 Ga0105246_10019315 3300011119 Bacteria 4353
588 Ga0105246_10139223 3300011119 Bacteria 1823
589 Ga0105246_10192927 3300011119 Bacteria 1578
590 Ga0105246_10299790 3300011119 Bacteria 1297
591 Ga0157327_1000746 3300012512 Bacteria 1840
592 Ga0157373_10011869 3300013100 Bacteria 6400
593 Ga0157373_10013077 3300013100 Bacteria 6091
594 Ga0157373_10031034 3300013100 Bacteria 3846
595 Ga0157373_10031958 3300013100 Bacteria 3790
596 Ga0157373_10038390 3300013100 Bacteria 3432
597 Ga0157373_10046311 3300013100 Bacteria 3102
598 Ga0157373_10059340 3300013100 Bacteria 2711
599 Ga0157373_10085625 3300013100 Bacteria 2221
600 Ga0157373_10147084 3300013100 Bacteria 1657
601 Ga0157373_10150017 3300013100 Bacteria 1640
602 Ga0157373_10246134 3300013100 Bacteria 1264
603 Ga0157373_10499679 3300013100 Bacteria 878
604 Ga0157373_10621537 3300013100 Bacteria 787
605 Ga0157371_10005349 3300013102 Bacteria 10850
606 Ga0157371_10029159 3300013102 Bacteria 3994
607 Ga0157371_10034479 3300013102 Bacteria 3630
608 Ga0157371_10039907 3300013102 Bacteria 3355
609 Ga0157371_10057552 3300013102 Bacteria 2757
610 Ga0157371_10061900 3300013102 Bacteria 2654
611 Ga0157371_10064540 3300013102 Bacteria 2594
612 Ga0157371_10121309 3300013102 Bacteria 1859
613 Ga0157371_10463962 3300013102 Bacteria 932
614 Ga0157371_10471384 3300013102 Bacteria 925
615 Ga0157370_10000244 3300013104 Bacteria 69583
616 Ga0157370_10001083 3300013104 Bacteria 34095
617 Ga0157370_10011398 3300013104 Bacteria 9300
618 Ga0157370_10030415 3300013104 Bacteria 5290
619 Ga0157370_10041713 3300013104 Bacteria 4424
620 Ga0157370_10043463 3300013104 Bacteria 4324
621 Ga0157370_10191834 3300013104 Bacteria 1896
622 Ga0157370_10275766 3300013104 Bacteria 1554
623 Ga0157370_10284189 3300013104 Bacteria 1528
624 Ga0157370_10358355 3300013104 Bacteria 1344
625 Ga0157370_10452931 3300013104 Bacteria 1180
626 Ga0157370_10762566 3300013104 Bacteria 881
627 Ga0157369_10001746 3300013105 Bacteria 26366
628 Ga0157369_10044629 3300013105 Bacteria 4823
629 Ga0157369_10117020 3300013105 Bacteria 2830
630 Ga0157369_10143786 3300013105 Bacteria 2522
631 Ga0157369_10176214 3300013105 Bacteria 2251
632 Ga0157369_10189290 3300013105 Bacteria 2162
633 Ga0157369_10324532 3300013105 Bacteria 1600
634 Ga0157369_10432262 3300013105 Bacteria 1364
635 Ga0157369_10564455 3300013105 Bacteria 1176
636 Ga0157369_10768989 3300013105 Bacteria 990
637 Ga0157369_10832431 3300013105 Bacteria 948
638 Ga0157369_11642270 3300013105 Bacteria 653
639 Ga0157374_10047999 3300013296 Bacteria 3961
640 Ga0157374_10130761 3300013296 Bacteria 2429
641 Ga0157374_10606243 3300013296 Bacteria 1105
642 Ga0157374_10701798 3300013296 Bacteria 1025
643 Ga0157378_10088959 3300013297 Bacteria 2803
644 Ga0157378_10565473 3300013297 Bacteria 1144
645 Ga0163162_10013856 3300013306 Bacteria 7875
646 Ga0163162_10020524 3300013306 Bacteria 6491
647 Ga0163162_10033509 3300013306 Bacteria 5105
648 Ga0163162_10103769 3300013306 Bacteria 2937
649 Ga0163162_10446377 3300013306 Bacteria 1425
650 Ga0163162_10891250 3300013306 Bacteria 1003
651 Ga0157372_10005230 3300013307 Bacteria 13792
652 Ga0157372_10026595 3300013307 Bacteria 6296
653 Ga0157372_10045649 3300013307 Bacteria 4861
654 Ga0157372_10049005 3300013307 Bacteria 4696
655 Ga0157372_10063253 3300013307 Bacteria 4148
656 Ga0157372_10105563 3300013307 Bacteria 3222
657 Ga0157372_10168632 3300013307 Bacteria 2532
658 Ga0157372_10244023 3300013307 Bacteria 2084
659 Ga0157372_10256889 3300013307 Bacteria 2028
660 Ga0157372_10262837 3300013307 Bacteria 2004
661 Ga0157372_10326096 3300013307 Bacteria 1788
662 Ga0157372_10446460 3300013307 Bacteria 1507
663 Ga0157372_10512492 3300013307 Bacteria 1398
664 Ga0157372_10906662 3300013307 Bacteria 1023
665 Ga0157375_10000242 3300013308 Bacteria 50251
666 Ga0157375_10028201 3300013308 Bacteria 5259
667 Ga0157375_10049398 3300013308 Bacteria 4121
668 Ga0157375_10220751 3300013308 Bacteria 2054
669 Ga0157375_10434722 3300013308 Bacteria 1478
670 Ga0157375_10539692 3300013308 Bacteria 1329
671 Ga0157375_10831854 3300013308 Bacteria 1071
672 Ga0163163_10000178 3300014325 Bacteria 65511
673 Ga0163163_10000390 3300014325 Bacteria 41759
674 Ga0163163_10055744 3300014325 Bacteria 3906
675 Ga0163163_10184873 3300014325 Bacteria 2132
676 Ga0163163_10244341 3300014325 Bacteria 1845
677 Ga0163163_10299834 3300014325 Bacteria 1660
678 Ga0163163_10621242 3300014325 Bacteria 1144
679 Ga0163163_11812168 3300014325 Bacteria 670
680 Ga0157380_10000410 3300014326 Bacteria 26058
681 Ga0157380_10012073 3300014326 Bacteria 6252
682 Ga0157380_10208258 3300014326 Bacteria 1740
683 Ga0157380_10247207 3300014326 Bacteria 1612
684 Ga0182008_10260550 3300014497 Bacteria 897
685 Ga0157377_10261689 3300014745 Bacteria 1126
686 Ga0157379_10005922 3300014968 Bacteria 10527
687 Ga0157379_10018886 3300014968 Bacteria 6083
688 Ga0157376_10000111 3300014969 Bacteria 58460
689 Ga0157376_10156822 3300014969 Bacteria 2059
690 Ga0157376_10186610 3300014969 Bacteria 1899
691 Ga0163161_10009987 3300017792 Bacteria 6575
692 Ga0163161_10279017 3300017792 Bacteria 1310
693 Ga0206353_10917309 3300020082 Bacteria 1897
694 Ga0213873_10118579 3300021358 Bacteria 775
695 Ga0213872_10029901 3300021361 Bacteria 2499
696 Ga0213874_10227671 3300021377 Bacteria 680
697 Ga0228598_1016554 3300024227 Bacteria 1456
698 Ga0207427_103453 3300025231 Bacteria 3300
699 Ga0207425_1000005 3300025245 Bacteria 900502
700 Ga0209148_1000160 3300025254 Bacteria 139522
701 Ga0209129_1002161 3300025258 Bacteria 9937
702 Ga0209233_1000003 3300025261 Bacteria 1607366
703 Ga0209565_1000030 3300025263 Bacteria 325058
704 Ga0209455_1002677 3300025272 Bacteria 6704
705 Ga0209675_1011958 3300025291 Bacteria 2831
706 Ga0209676_1004013 3300025292 Bacteria 8476
707 Ga0209676_1030113 3300025292 Bacteria 1665
708 Ga0209564_1036811 3300025295 Bacteria 1390
709 Ga0209758_1000002 3300025297 Bacteria 1400310
710 Ga0209758_1004865 3300025297 Bacteria 10826
711 Ga0209050_1000005 3300025298 Bacteria 1557793
712 Ga0209050_1000215 3300025298 Bacteria 129179
713 Ga0209050_1003122 3300025298 Bacteria 12690
714 Ga0209050_1017531 3300025298 Bacteria 2846
715 Ga0209050_1045561 3300025298 Bacteria 1161
716 Ga0209256_1000046 3300025299 Bacteria 325040
717 Ga0209051_1000153 3300025303 Bacteria 131166
718 Ga0209257_1000533 3300025304 Bacteria 66037
719 Ga0209257_1002082 3300025304 Bacteria 21069
720 Ga0209257_1002135 3300025304 Bacteria 20606
721 Ga0209257_1003806 3300025304 Bacteria 12410
722 Ga0207697_10000376 3300025315 Bacteria 24993
723 Ga0207697_10015553 3300025315 Bacteria 3142
724 Ga0207697_10016755 3300025315 Bacteria 3017
725 Ga0207697_10107015 3300025315 Bacteria 1195
726 Ga0207656_10013039 3300025321 Bacteria 3169
727 Ga0207656_10073171 3300025321 Bacteria 1527
728 Ga0207656_10079865 3300025321 Bacteria 1468
729 Ga0207656_10423765 3300025321 Bacteria 671
730 Ga0207713_1033004 3300025735 Bacteria 2266
731 Ga0207682_10001851 3300025893 Bacteria 9641
732 Ga0207682_10006247 3300025893 Bacteria 4813
733 Ga0207682_10059456 3300025893 Bacteria 1597
734 Ga0207692_10063424 3300025898 Bacteria 1920
735 Ga0207642_10004223 3300025899 Bacteria 4621
736 Ga0207710_10216717 3300025900 Bacteria 949
737 Ga0207688_10007140 3300025901 Bacteria 6075
738 Ga0207688_10024467 3300025901 Bacteria 3311
739 Ga0207688_10264658 3300025901 Bacteria 1044
740 Ga0207688_10274268 3300025901 Bacteria 1026
741 Ga0207680_10001140 3300025903 Bacteria 12557
742 Ga0207680_10023859 3300025903 Bacteria 3347
743 Ga0207680_10024044 3300025903 Bacteria 3337
744 Ga0207680_10025304 3300025903 Bacteria 3273
745 Ga0207680_10113025 3300025903 Bacteria 1765
746 Ga0207680_10208136 3300025903 Bacteria 1336
747 Ga0207680_10221967 3300025903 Bacteria 1296
748 Ga0207680_10298320 3300025903 Bacteria 1123
749 Ga0207680_10713396 3300025903 Bacteria 719
750 Ga0207680_10759113 3300025903 Bacteria 695
751 Ga0207647_10001105 3300025904 Bacteria 20793
752 Ga0207647_10004841 3300025904 Bacteria 9955
753 Ga0207647_10007345 3300025904 Bacteria 7969
754 Ga0207647_10024667 3300025904 Bacteria 3964
755 Ga0207647_10036120 3300025904 Bacteria 3142
756 Ga0207647_10046411 3300025904 Bacteria 2707
757 Ga0207647_10049354 3300025904 Bacteria 2611
758 Ga0207647_10066001 3300025904 Bacteria 2195
759 Ga0207647_10067407 3300025904 Bacteria 2169
760 Ga0207647_10179060 3300025904 Bacteria 1232
761 Ga0207699_10156387 3300025906 Bacteria 1513
762 Ga0207699_10377806 3300025906 Bacteria 1005
763 Ga0207645_10003719 3300025907 Bacteria 11484
764 Ga0207645_10003851 3300025907 Bacteria 11228
765 Ga0207645_10030468 3300025907 Bacteria 3476
766 Ga0207645_10051413 3300025907 Bacteria 2633
767 Ga0207645_10101642 3300025907 Bacteria 1855
768 Ga0207645_10239238 3300025907 Bacteria 1199
769 Ga0207645_10283397 3300025907 Bacteria 1101
770 Ga0207643_10024604 3300025908 Bacteria 3323
771 Ga0207643_10075342 3300025908 Bacteria 1947
772 Ga0207705_10000046 3300025909 Bacteria 177574
773 Ga0207705_10000234 3300025909 Bacteria 55024
774 Ga0207705_10000875 3300025909 Bacteria 24669
775 Ga0207705_10003289 3300025909 Bacteria 12306
776 Ga0207705_10009392 3300025909 Bacteria 7110
777 Ga0207705_10013013 3300025909 Bacteria 6005
778 Ga0207705_10018421 3300025909 Bacteria 4994
779 Ga0207705_10018597 3300025909 Bacteria 4967
780 Ga0207705_10027512 3300025909 Bacteria 4055
781 Ga0207705_10041691 3300025909 Bacteria 3293
782 Ga0207705_10045860 3300025909 Bacteria 3141
783 Ga0207705_10046483 3300025909 Bacteria 3119
784 Ga0207705_10057582 3300025909 Bacteria 2803
785 Ga0207705_10092924 3300025909 Bacteria 2211
786 Ga0207705_10154067 3300025909 Bacteria 1723
787 Ga0207705_10203441 3300025909 Bacteria 1501
788 Ga0207705_10232853 3300025909 Bacteria 1402
789 Ga0207705_10408005 3300025909 Bacteria 1051
790 Ga0207705_10446996 3300025909 Bacteria 1002
791 Ga0207705_10451057 3300025909 Bacteria 997
792 Ga0207705_10594827 3300025909 Bacteria 860
793 Ga0207654_10208931 3300025911 Bacteria 1289
794 Ga0207707_10042593 3300025912 Bacteria 3961
795 Ga0207707_10131857 3300025912 Bacteria 2185
796 Ga0207707_10719118 3300025912 Bacteria 837
797 Ga0207707_10913563 3300025912 Bacteria 725
798 Ga0207707_11106322 3300025912 Bacteria 646
799 Ga0207695_10040341 3300025913 Bacteria 5008
800 Ga0207695_10086730 3300025913 Bacteria 3156
801 Ga0207695_10842540 3300025913 Bacteria 797
802 Ga0207671_10012843 3300025914 Bacteria 6709
803 Ga0207671_10122863 3300025914 Bacteria 1985
804 Ga0207693_10003200 3300025915 Bacteria 14052
805 Ga0207693_10021799 3300025915 Bacteria 5094
806 Ga0207693_10028351 3300025915 Bacteria 4424
807 Ga0207693_10325435 3300025915 Bacteria 1203
808 Ga0207693_10861201 3300025915 Bacteria 696
809 Ga0207663_10080726 3300025916 Bacteria 2128
810 Ga0207660_10000492 3300025917 Bacteria 26361
811 Ga0207660_10012979 3300025917 Bacteria 5457
812 Ga0207660_10031025 3300025917 Bacteria 3677
813 Ga0207660_10113640 3300025917 Bacteria 2041
814 Ga0207660_10361597 3300025917 Bacteria 1164
815 Ga0207660_10455795 3300025917 Bacteria 1034
816 Ga0207660_10778038 3300025917 Bacteria 781
817 Ga0207662_10024402 3300025918 Bacteria 3480
818 Ga0207662_10128664 3300025918 Bacteria 1594
819 Ga0207657_10000857 3300025919 Bacteria 32134
820 Ga0207657_10001592 3300025919 Bacteria 24383
821 Ga0207657_10001940 3300025919 Bacteria 22345
822 Ga0207657_10003097 3300025919 Bacteria 17783
823 Ga0207657_10011322 3300025919 Bacteria 8857
824 Ga0207657_10011380 3300025919 Bacteria 8836
825 Ga0207657_10016275 3300025919 Bacteria 7177
826 Ga0207657_10019009 3300025919 Bacteria 6537
827 Ga0207657_10020079 3300025919 Bacteria 6327
828 Ga0207657_10021121 3300025919 Bacteria 6134
829 Ga0207657_10028058 3300025919 Bacteria 5144
830 Ga0207657_10034901 3300025919 Bacteria 4515
831 Ga0207657_10037889 3300025919 Bacteria 4300
832 Ga0207657_10039693 3300025919 Bacteria 4181
833 Ga0207657_10046549 3300025919 Bacteria 3799
834 Ga0207657_10055690 3300025919 Bacteria 3415
835 Ga0207657_10056013 3300025919 Bacteria 3403
836 Ga0207657_10094097 3300025919 Bacteria 2495
837 Ga0207657_10096187 3300025919 Bacteria 2463
838 Ga0207657_10211971 3300025919 Bacteria 1554
839 Ga0207657_10235370 3300025919 Bacteria 1464
840 Ga0207657_10288975 3300025919 Bacteria 1300
841 Ga0207649_10000159 3300025920 Bacteria 54703
842 Ga0207649_10004703 3300025920 Bacteria 7387
843 Ga0207649_10005977 3300025920 Bacteria 6604
844 Ga0207649_10019715 3300025920 Bacteria 3859
845 Ga0207649_10023490 3300025920 Bacteria 3571
846 Ga0207649_10047608 3300025920 Bacteria 2640
847 Ga0207649_10054101 3300025920 Bacteria 2497
848 Ga0207649_10096199 3300025920 Bacteria 1950
849 Ga0207649_10144606 3300025920 Bacteria 1631
850 Ga0207649_10154368 3300025920 Bacteria 1584
851 Ga0207649_10209760 3300025920 Bacteria 1381
852 Ga0207649_10389664 3300025920 Bacteria 1040
853 Ga0207649_10751134 3300025920 Bacteria 759
854 Ga0207652_10028036 3300025921 Bacteria 4695
855 Ga0207652_10058145 3300025921 Bacteria 3331
856 Ga0207652_10079593 3300025921 Bacteria 2863
857 Ga0207652_10094813 3300025921 Bacteria 2628
858 Ga0207652_10115046 3300025921 Bacteria 2389
859 Ga0207652_10168317 3300025921 Bacteria 1966
860 Ga0207652_10172329 3300025921 Bacteria 1942
861 Ga0207652_10374786 3300025921 Bacteria 1285
862 Ga0207652_10401409 3300025921 Bacteria 1237
863 Ga0207652_10733458 3300025921 Bacteria 880
864 Ga0207681_10023209 3300025923 Bacteria 3965
865 Ga0207681_10102647 3300025923 Bacteria 2065
866 Ga0207681_10151895 3300025923 Bacteria 1736
867 Ga0207681_10280532 3300025923 Bacteria 1312
868 Ga0207681_10282054 3300025923 Bacteria 1308
869 Ga0207681_10328898 3300025923 Bacteria 1218
870 Ga0207681_10895302 3300025923 Bacteria 743
871 Ga0207694_10001409 3300025924 Bacteria 20627
872 Ga0207694_10030298 3300025924 Bacteria 4132
873 Ga0207694_10038489 3300025924 Bacteria 3677
874 Ga0207694_10065760 3300025924 Bacteria 2828
875 Ga0207694_10780632 3300025924 Bacteria 807
876 Ga0207650_10002087 3300025925 Bacteria 13979
877 Ga0207650_10003374 3300025925 Bacteria 10996
878 Ga0207650_10004763 3300025925 Bacteria 9268
879 Ga0207650_10033612 3300025925 Bacteria 3715
880 Ga0207650_10105923 3300025925 Bacteria 2171
881 Ga0207650_10186764 3300025925 Bacteria 1654
882 Ga0207650_10349312 3300025925 Bacteria 1216
883 Ga0207650_10390522 3300025925 Bacteria 1150
884 Ga0207650_10392531 3300025925 Bacteria 1147
885 Ga0207650_10545478 3300025925 Bacteria 972
886 Ga0207650_10695574 3300025925 Bacteria 859
887 Ga0207659_10008958 3300025926 Bacteria 6239
888 Ga0207659_10014098 3300025926 Bacteria 5147
889 Ga0207659_10041598 3300025926 Bacteria 3219
890 Ga0207659_10128986 3300025926 Bacteria 1949
891 Ga0207659_10369834 3300025926 Bacteria 1193
892 Ga0207659_11006109 3300025926 Bacteria 717
893 Ga0207700_10009000 3300025928 Bacteria 6215
894 Ga0207700_10022357 3300025928 Bacteria 4339
895 Ga0207700_10340670 3300025928 Bacteria 1303
896 Ga0207664_10026728 3300025929 Bacteria 4365
897 Ga0207664_10159013 3300025929 Bacteria 1926
898 Ga0207664_10345403 3300025929 Bacteria 1316
899 Ga0207664_11180072 3300025929 Bacteria 683
900 Ga0207644_10000465 3300025931 Bacteria 26250
901 Ga0207644_10005285 3300025931 Bacteria 8426
902 Ga0207644_10021902 3300025931 Bacteria 4359
903 Ga0207644_10023007 3300025931 Bacteria 4263
904 Ga0207644_10023365 3300025931 Bacteria 4234
905 Ga0207644_10032919 3300025931 Bacteria 3620
906 Ga0207644_10039343 3300025931 Bacteria 3337
907 Ga0207644_10055142 3300025931 Bacteria 2864
908 Ga0207644_10055275 3300025931 Bacteria 2861
909 Ga0207644_10061230 3300025931 Bacteria 2725
910 Ga0207644_10065330 3300025931 Bacteria 2645
911 Ga0207644_10074396 3300025931 Bacteria 2493
912 Ga0207644_10090721 3300025931 Bacteria 2277
913 Ga0207644_10163468 3300025931 Bacteria 1732
914 Ga0207644_10328977 3300025931 Bacteria 1237
915 Ga0207644_10409556 3300025931 Bacteria 1109
916 Ga0207644_10600853 3300025931 Bacteria 913
917 Ga0207644_10657754 3300025931 Bacteria 872
918 Ga0207644_10841092 3300025931 Bacteria 768
919 Ga0207644_10957885 3300025931 Bacteria 718
920 Ga0207690_10000120 3300025932 Bacteria 65338
921 Ga0207690_10007579 3300025932 Bacteria 6441
922 Ga0207690_10014478 3300025932 Bacteria 4764
923 Ga0207690_10018292 3300025932 Bacteria 4297
924 Ga0207690_10041170 3300025932 Bacteria 3026
925 Ga0207690_10048006 3300025932 Bacteria 2836
926 Ga0207690_10123657 3300025932 Bacteria 1883
927 Ga0207690_10135436 3300025932 Bacteria 1808
928 Ga0207690_10159768 3300025932 Bacteria 1679
929 Ga0207690_10160086 3300025932 Bacteria 1677
930 Ga0207690_10184571 3300025932 Bacteria 1573
931 Ga0207690_10185485 3300025932 Bacteria 1569
932 Ga0207690_10220036 3300025932 Bacteria 1452
933 Ga0207690_10272133 3300025932 Bacteria 1316
934 Ga0207690_10300336 3300025932 Bacteria 1256
935 Ga0207690_10793085 3300025932 Bacteria 782
936 Ga0207706_10000200 3300025933 Bacteria 65947
937 Ga0207706_10001222 3300025933 Bacteria 25958
938 Ga0207706_10002146 3300025933 Bacteria 19290
939 Ga0207706_10003464 3300025933 Bacteria 15067
940 Ga0207706_10005186 3300025933 Bacteria 12161
941 Ga0207706_10005358 3300025933 Bacteria 11954
942 Ga0207706_10011841 3300025933 Bacteria 7943
943 Ga0207706_10013081 3300025933 Bacteria 7551
944 Ga0207706_10025753 3300025933 Bacteria 5270
945 Ga0207706_10027039 3300025933 Bacteria 5131
946 Ga0207706_10029548 3300025933 Bacteria 4892
947 Ga0207706_10044491 3300025933 Bacteria 3935
948 Ga0207706_10102974 3300025933 Bacteria 2512
949 Ga0207706_10106713 3300025933 Bacteria 2465
950 Ga0207706_10191372 3300025933 Bacteria 1796
951 Ga0207706_10210630 3300025933 Bacteria 1704
952 Ga0207706_10345193 3300025933 Bacteria 1294
953 Ga0207706_10460582 3300025933 Bacteria 1099
954 Ga0207706_10532055 3300025933 Bacteria 1013
955 Ga0207686_10000250 3300025934 Bacteria 40936
956 Ga0207709_10000051 3300025935 Bacteria 227968
957 Ga0207709_10054256 3300025935 Bacteria 2470
958 Ga0207709_10228127 3300025935 Bacteria 1347
959 Ga0207670_10276799 3300025936 Bacteria 1306
960 Ga0207670_11300588 3300025936 Bacteria 616
961 Ga0207669_10016697 3300025937 Bacteria 3739
962 Ga0207669_10021940 3300025937 Bacteria 3382
963 Ga0207669_10080151 3300025937 Bacteria 2087
964 Ga0207669_10099897 3300025937 Bacteria 1915
965 Ga0207669_10745317 3300025937 Bacteria 808
966 Ga0207704_10000001 3300025938 Bacteria 716296
967 Ga0207704_10022119 3300025938 Bacteria 3400
968 Ga0207665_10034710 3300025939 Bacteria 3346
969 Ga0207665_10162768 3300025939 Bacteria 1606
970 Ga0207691_10001218 3300025940 Bacteria 25659
971 Ga0207691_10008630 3300025940 Bacteria 9781
972 Ga0207691_10021031 3300025940 Bacteria 6165
973 Ga0207691_10023515 3300025940 Bacteria 5802
974 Ga0207691_10023869 3300025940 Bacteria 5756
975 Ga0207691_10026738 3300025940 Bacteria 5415
976 Ga0207691_10045778 3300025940 Bacteria 4021
977 Ga0207691_10062806 3300025940 Bacteria 3369
978 Ga0207691_10070664 3300025940 Bacteria 3152
979 Ga0207691_10077272 3300025940 Bacteria 2999
980 Ga0207691_10087746 3300025940 Bacteria 2791
981 Ga0207691_10144387 3300025940 Bacteria 2096
982 Ga0207711_10000046 3300025941 Bacteria 153238
983 Ga0207711_10001359 3300025941 Bacteria 23095
984 Ga0207711_10011835 3300025941 Bacteria 7249
985 Ga0207711_10014539 3300025941 Bacteria 6542
986 Ga0207711_10023973 3300025941 Bacteria 5107
987 Ga0207711_10079964 3300025941 Bacteria 2854
988 Ga0207711_10153559 3300025941 Bacteria 2079
989 Ga0207711_10153692 3300025941 Bacteria 2078
990 Ga0207711_10172536 3300025941 Bacteria 1963
991 Ga0207711_10194608 3300025941 Bacteria 1849
992 Ga0207711_10633837 3300025941 Bacteria 997
993 Ga0207711_10645216 3300025941 Bacteria 988
994 Ga0207711_10686441 3300025941 Bacteria 955
995 Ga0207711_10714592 3300025941 Bacteria 934
996 Ga0207711_10764633 3300025941 Bacteria 900
997 Ga0207711_10839013 3300025941 Bacteria 855
998 Ga0207711_10926324 3300025941 Bacteria 810
999 Ga0207711_11022571 3300025941 Bacteria 766
1000 Ga0207689_10000059 3300025942 Bacteria 85713
1001 Ga0207689_10041099 3300025942 Bacteria 3827
1002 Ga0207689_10106217 3300025942 Bacteria 2307
1003 Ga0207689_10148023 3300025942 Bacteria 1935
1004 Ga0207689_10259147 3300025942 Bacteria 1438
1005 Ga0207689_10453948 3300025942 Bacteria 1071
1006 Ga0207661_10002690 3300025944 Bacteria 12221
1007 Ga0207661_10004991 3300025944 Bacteria 9302
1008 Ga0207661_10009695 3300025944 Bacteria 6913
1009 Ga0207661_10024494 3300025944 Bacteria 4575
1010 Ga0207661_10262111 3300025944 Bacteria 1540
1011 Ga0207661_10535594 3300025944 Bacteria 1072
1012 Ga0207661_10953525 3300025944 Bacteria 790
1013 Ga0207679_10000150 3300025945 Bacteria 57426
1014 Ga0207679_10000770 3300025945 Bacteria 20960
1015 Ga0207679_10002544 3300025945 Bacteria 11241
1016 Ga0207679_10015929 3300025945 Bacteria 4983
1017 Ga0207679_10017952 3300025945 Bacteria 4729
1018 Ga0207679_10019171 3300025945 Bacteria 4593
1019 Ga0207679_10028275 3300025945 Bacteria 3888
1020 Ga0207679_10055102 3300025945 Bacteria 2930
1021 Ga0207679_10067113 3300025945 Bacteria 2690
1022 Ga0207679_10073330 3300025945 Bacteria 2589
1023 Ga0207679_10112458 3300025945 Bacteria 2152
1024 Ga0207679_10135896 3300025945 Bacteria 1980
1025 Ga0207679_10229891 3300025945 Bacteria 1565
1026 Ga0207679_10402780 3300025945 Bacteria 1204
1027 Ga0207679_10438068 3300025945 Bacteria 1157
1028 Ga0207679_10501480 3300025945 Bacteria 1083
1029 Ga0207667_10000024 3300025949 Bacteria 355874
1030 Ga0207667_10000443 3300025949 Bacteria 55591
1031 Ga0207667_10010791 3300025949 Bacteria 10656
1032 Ga0207667_10034487 3300025949 Bacteria 5433
1033 Ga0207667_10121975 3300025949 Bacteria 2686
1034 Ga0207667_10214036 3300025949 Bacteria 1975
1035 Ga0207667_10439215 3300025949 Bacteria 1327
1036 Ga0207667_10454466 3300025949 Bacteria 1301
1037 Ga0207667_10512171 3300025949 Bacteria 1216
1038 Ga0207667_10682929 3300025949 Bacteria 1030
1039 Ga0207667_10707358 3300025949 Bacteria 1009
1040 Ga0207667_10908785 3300025949 Bacteria 872
1041 Ga0207667_10981631 3300025949 Bacteria 833
1042 Ga0207651_10000006 3300025960 Bacteria 227893
1043 Ga0207651_10037168 3300025960 Bacteria 3187
1044 Ga0207651_10052767 3300025960 Bacteria 2774
1045 Ga0207651_10123936 3300025960 Bacteria 1965
1046 Ga0207651_10174879 3300025960 Bacteria 1697
1047 Ga0207651_10294979 3300025960 Bacteria 1346
1048 Ga0207651_10552004 3300025960 Bacteria 1002
1049 Ga0207651_10708392 3300025960 Bacteria 887
1050 Ga0207712_10036409 3300025961 Bacteria 3351
1051 Ga0207712_10085989 3300025961 Bacteria 2303
1052 Ga0207712_10171238 3300025961 Bacteria 1697
1053 Ga0207712_10241372 3300025961 Bacteria 1455
1054 Ga0207712_10485690 3300025961 Bacteria 1053
1055 Ga0207668_10001946 3300025972 Bacteria 12101
1056 Ga0207668_10008900 3300025972 Bacteria 6004
1057 Ga0207668_10013614 3300025972 Bacteria 5016
1058 Ga0207668_10070700 3300025972 Bacteria 2490
1059 Ga0207668_10383349 3300025972 Bacteria 1184
1060 Ga0207640_10000031 3300025981 Bacteria 120815
1061 Ga0207640_10016924 3300025981 Bacteria 4253
1062 Ga0207640_10020066 3300025981 Bacteria 3962
1063 Ga0207640_10020592 3300025981 Bacteria 3918
1064 Ga0207640_10026879 3300025981 Bacteria 3500
1065 Ga0207640_10033556 3300025981 Bacteria 3195
1066 Ga0207640_10044084 3300025981 Bacteria 2856
1067 Ga0207640_10104946 3300025981 Bacteria 1990
1068 Ga0207640_10226405 3300025981 Bacteria 1435
1069 Ga0207640_10724188 3300025981 Bacteria 855
1070 Ga0207658_10000134 3300025986 Bacteria 78342
1071 Ga0207658_10004243 3300025986 Bacteria 9985
1072 Ga0207658_10018376 3300025986 Bacteria 4828
1073 Ga0207658_10023296 3300025986 Bacteria 4321
1074 Ga0207658_10063150 3300025986 Bacteria 2775
1075 Ga0207658_10080192 3300025986 Bacteria 2499
1076 Ga0207658_10103995 3300025986 Bacteria 2230
1077 Ga0207658_10271802 3300025986 Bacteria 1449
1078 Ga0207658_10272129 3300025986 Bacteria 1448
1079 Ga0207658_10290978 3300025986 Bacteria 1404
1080 Ga0207658_10304769 3300025986 Bacteria 1373
1081 Ga0207658_10349958 3300025986 Bacteria 1286
1082 Ga0207658_10429464 3300025986 Bacteria 1166
1083 Ga0207658_10549069 3300025986 Bacteria 1034
1084 Ga0207658_10566711 3300025986 Bacteria 1017
1085 Ga0207658_10697442 3300025986 Bacteria 917
1086 Ga0207677_10000251 3300026023 Bacteria 41529
1087 Ga0207677_10005778 3300026023 Bacteria 6728
1088 Ga0207677_10601566 3300026023 Bacteria 965
1089 Ga0207677_10978926 3300026023 Bacteria 766
1090 Ga0207703_10009065 3300026035 Bacteria 7834
1091 Ga0207703_10009181 3300026035 Bacteria 7782
1092 Ga0207703_10024963 3300026035 Bacteria 4702
1093 Ga0207703_10041280 3300026035 Bacteria 3695
1094 Ga0207703_10059343 3300026035 Bacteria 3125
1095 Ga0207703_10073031 3300026035 Bacteria 2837
1096 Ga0207703_10584336 3300026035 Bacteria 1056
1097 Ga0207703_10779211 3300026035 Bacteria 912
1098 Ga0207703_10784047 3300026035 Bacteria 909
1099 Ga0207639_10000282 3300026041 Bacteria 36549
1100 Ga0207639_10000575 3300026041 Bacteria 25298
1101 Ga0207639_10027682 3300026041 Bacteria 4132
1102 Ga0207639_10031444 3300026041 Bacteria 3901
1103 Ga0207639_10032569 3300026041 Bacteria 3838
1104 Ga0207639_10045948 3300026041 Bacteria 3292
1105 Ga0207639_10151554 3300026041 Bacteria 1942
1106 Ga0207639_10245838 3300026041 Bacteria 1558
1107 Ga0207639_10251801 3300026041 Bacteria 1540
1108 Ga0207639_10541173 3300026041 Bacteria 1068
1109 Ga0207639_11258667 3300026041 Bacteria 694
1110 Ga0207678_10003605 3300026067 Bacteria 13913
1111 Ga0207678_10004354 3300026067 Bacteria 12714
1112 Ga0207678_10006321 3300026067 Bacteria 10520
1113 Ga0207678_10008434 3300026067 Bacteria 9087
1114 Ga0207678_10015228 3300026067 Bacteria 6765
1115 Ga0207678_10019411 3300026067 Bacteria 5971
1116 Ga0207678_10019471 3300026067 Bacteria 5962
1117 Ga0207678_10075382 3300026067 Bacteria 2890
1118 Ga0207678_10088118 3300026067 Bacteria 2653
1119 Ga0207678_10134110 3300026067 Bacteria 2113
1120 Ga0207678_10136381 3300026067 Bacteria 2094
1121 Ga0207678_10215697 3300026067 Bacteria 1642
1122 Ga0207678_10961603 3300026067 Bacteria 756
1123 Ga0207708_10042389 3300026075 Bacteria 3469
1124 Ga0207702_10001027 3300026078 Bacteria 28669
1125 Ga0207702_10008778 3300026078 Bacteria 8519
1126 Ga0207702_10009483 3300026078 Bacteria 8177
1127 Ga0207702_10012444 3300026078 Bacteria 7083
1128 Ga0207702_10063818 3300026078 Bacteria 3151
1129 Ga0207702_10071072 3300026078 Bacteria 2995
1130 Ga0207702_10083247 3300026078 Bacteria 2783
1131 Ga0207702_10125638 3300026078 Bacteria 2302
1132 Ga0207702_10137929 3300026078 Bacteria 2203
1133 Ga0207702_10167222 3300026078 Bacteria 2013
1134 Ga0207702_10559625 3300026078 Bacteria 1119
1135 Ga0207702_10813533 3300026078 Bacteria 924
1136 Ga0207702_11208300 3300026078 Bacteria 750
1137 Ga0207641_10000035 3300026088 Bacteria 214358
1138 Ga0207641_10001076 3300026088 Bacteria 27468
1139 Ga0207641_10001374 3300026088 Bacteria 24044
1140 Ga0207641_10100610 3300026088 Bacteria 2546
1141 Ga0207641_10102051 3300026088 Bacteria 2529
1142 Ga0207641_10164596 3300026088 Bacteria 2019
1143 Ga0207641_10489630 3300026088 Bacteria 1193
1144 Ga0207641_11078037 3300026088 Bacteria 801
1145 Ga0207648_10000022 3300026089 Bacteria 137000
1146 Ga0207648_10000962 3300026089 Bacteria 32576
1147 Ga0207648_10008840 3300026089 Bacteria 9701
1148 Ga0207648_10023114 3300026089 Bacteria 5576
1149 Ga0207648_10026647 3300026089 Bacteria 5135
1150 Ga0207648_10117453 3300026089 Bacteria 2338
1151 Ga0207676_10000877 3300026095 Bacteria 23341
1152 Ga0207676_10001543 3300026095 Bacteria 17000
1153 Ga0207676_10002762 3300026095 Bacteria 12482
1154 Ga0207676_10004032 3300026095 Bacteria 10370
1155 Ga0207676_10006804 3300026095 Bacteria 8092
1156 Ga0207676_10022917 3300026095 Bacteria 4598
1157 Ga0207676_10025058 3300026095 Bacteria 4423
1158 Ga0207676_10035492 3300026095 Bacteria 3785
1159 Ga0207676_10042890 3300026095 Bacteria 3480
1160 Ga0207676_10051592 3300026095 Bacteria 3212
1161 Ga0207676_10091484 3300026095 Bacteria 2499
1162 Ga0207676_10329517 3300026095 Bacteria 1404
1163 Ga0207676_10451739 3300026095 Bacteria 1211
1164 Ga0207676_10596446 3300026095 Bacteria 1060
1165 Ga0207676_11072046 3300026095 Bacteria 796
1166 Ga0207674_10000626 3300026116 Bacteria 46240
1167 Ga0207674_10002709 3300026116 Bacteria 22117
1168 Ga0207674_10003891 3300026116 Bacteria 18169
1169 Ga0207674_10004574 3300026116 Bacteria 16615
1170 Ga0207674_10014610 3300026116 Bacteria 8661
1171 Ga0207674_10014655 3300026116 Bacteria 8645
1172 Ga0207674_10018505 3300026116 Bacteria 7570
1173 Ga0207674_10118469 3300026116 Bacteria 2618
1174 Ga0207674_10140594 3300026116 Bacteria 2373
1175 Ga0207674_10276407 3300026116 Bacteria 1627
1176 Ga0207674_10432365 3300026116 Bacteria 1272
1177 Ga0207674_10840513 3300026116 Bacteria 885
1178 Ga0207674_10998101 3300026116 Bacteria 806
1179 Ga0207675_100004741 3300026118 Bacteria 13094
1180 Ga0207675_100144422 3300026118 Bacteria 2262
1181 Ga0207675_100412772 3300026118 Bacteria 1332
1182 Ga0207675_100457587 3300026118 Bacteria 1265
1183 Ga0207675_101938532 3300026118 Bacteria 607
1184 Ga0207683_10007210 3300026121 Bacteria 9532
1185 Ga0207683_10008207 3300026121 Bacteria 8936
1186 Ga0207683_10012533 3300026121 Bacteria 7233
1187 Ga0207683_10013946 3300026121 Bacteria 6853
1188 Ga0207683_10046990 3300026121 Bacteria 3780
1189 Ga0207683_10113918 3300026121 Bacteria 2422
1190 Ga0207683_10147550 3300026121 Bacteria 2122
1191 Ga0207683_10339599 3300026121 Bacteria 1377
1192 Ga0207683_10545430 3300026121 Bacteria 1072
1193 Ga0207683_10939899 3300026121 Bacteria 803
1194 Ga0207698_10000784 3300026142 Bacteria 18494
1195 Ga0207698_10001209 3300026142 Bacteria 15067
1196 Ga0207698_10001509 3300026142 Bacteria 13549
1197 Ga0207698_10002457 3300026142 Bacteria 10985
1198 Ga0207698_10002616 3300026142 Bacteria 10706
1199 Ga0207698_10002793 3300026142 Bacteria 10426
1200 Ga0207698_10004547 3300026142 Bacteria 8469
1201 Ga0207698_10071505 3300026142 Bacteria 2753
1202 Ga0207698_10090625 3300026142 Bacteria 2501
1203 Ga0207698_10094504 3300026142 Bacteria 2458
1204 Ga0207698_10147919 3300026142 Bacteria 2034
1205 Ga0207698_10216841 3300026142 Bacteria 1726
1206 Ga0207698_10348405 3300026142 Bacteria 1398
1207 Ga0207698_10458251 3300026142 Bacteria 1232
1208 Ga0207698_11067809 3300026142 Bacteria 819
1209 Ga0207698_11369345 3300026142 Bacteria 722
1210 Ga0207698_11567164 3300026142 Bacteria 674
1211 Ga0209179_1030098 3300027512 Bacteria 1108
1212 Ga0209983_1016920 3300027665 Bacteria 1507
1213 Ga0209974_10003541 3300027876 Bacteria 5617
1214 Ga0207428_10112847 3300027907 Bacteria 2090
1215 Ga0268266_10000015 3300028379 Bacteria 630629
1216 Ga0268266_10003194 3300028379 Bacteria 16586
1217 Ga0268266_10018087 3300028379 Bacteria 6007
1218 Ga0268266_10023069 3300028379 Bacteria 5297
1219 Ga0268266_10042675 3300028379 Bacteria 3875
1220 Ga0268266_10049886 3300028379 Bacteria 3590
1221 Ga0268265_10008043 3300028380 Bacteria 7122
1222 Ga0268265_10012902 3300028380 Bacteria 5671
1223 Ga0268265_10023795 3300028380 Bacteria 4323
1224 Ga0268265_10036557 3300028380 Bacteria 3598
1225 Ga0268265_10096004 3300028380 Bacteria 2381
1226 Ga0268265_10150652 3300028380 Bacteria 1961
1227 Ga0268265_10228952 3300028380 Bacteria 1632
1228 Ga0268264_10000018 3300028381 Bacteria 495324
1229 Ga0268264_10000087 3300028381 Bacteria 236696
1230 Ga0268264_10001241 3300028381 Bacteria 24400
1231 Ga0268264_10158431 3300028381 Bacteria 2037
1232 Ga0268264_10248568 3300028381 Bacteria 1651
1233 Ga0268264_10545656 3300028381 Bacteria 1136
1234 Ga0268264_10667140 3300028381 Bacteria 1030
1235 Ga0265336_10016496 3300028666 Bacteria 2415
1236 Ga0265338_10406279 3300028800 Bacteria 970
1237 Ga0265338_10571673 3300028800 Bacteria 789
1238 Ga0316177_1034854 3300030731 Bacteria 2433
1239 Ga0316178_1176232 3300030735 Bacteria 1031
1240 Ga0316180_1026671 3300030736 Bacteria 805
1241 Ga0316183_1140839 3300030742 Bacteria 2005
1242 Ga0316182_1048881 3300030745 Bacteria 1794
1243 Ga0265340_10058884 3300031247 Bacteria 1843
1244 Ga0265331_10101222 3300031250 Bacteria 1325
1245 Ga0265327_10042152 3300031251 Bacteria 2453
1246 Ga0265327_10298839 3300031251 Bacteria 709
1247 Ga0307408_100034539 3300031548 Bacteria 3542
1248 Ga0307408_100075500 3300031548 Bacteria 2504
1249 Ga0307408_100144449 3300031548 Bacteria 1871
1250 Ga0307408_100157141 3300031548 Bacteria 1802
1251 Ga0307408_100178942 3300031548 Bacteria 1699
1252 Ga0307408_100203972 3300031548 Bacteria 1602
1253 Ga0307405_10016567 3300031731 Bacteria 4021
1254 Ga0307405_10123398 3300031731 Bacteria 1776
1255 Ga0307405_10146543 3300031731 Bacteria 1654
1256 Ga0307405_10291578 3300031731 Bacteria 1233
1257 Ga0307405_10558119 3300031731 Bacteria 928
1258 Ga0307405_10650900 3300031731 Bacteria 866
1259 Ga0307413_10013083 3300031824 Bacteria 4155
1260 Ga0307413_10046833 3300031824 Bacteria 2574
1261 Ga0307413_10188165 3300031824 Bacteria 1479
1262 Ga0307413_10359636 3300031824 Bacteria 1126
1263 Ga0307413_10423367 3300031824 Bacteria 1049
1264 Ga0307410_10013134 3300031852 Bacteria 4819
1265 Ga0307410_10047038 3300031852 Bacteria 2881
1266 Ga0307410_10075670 3300031852 Bacteria 2347
1267 Ga0307410_10076674 3300031852 Bacteria 2334
1268 Ga0307410_10084543 3300031852 Bacteria 2237
1269 Ga0307410_10122812 3300031852 Bacteria 1896
1270 Ga0307410_10130494 3300031852 Bacteria 1845
1271 Ga0307410_10169074 3300031852 Bacteria 1645
1272 Ga0307410_10179322 3300031852 Bacteria 1603
1273 Ga0307410_10319935 3300031852 Bacteria 1230
1274 Ga0307410_10326431 3300031852 Bacteria 1219
1275 Ga0307410_10361099 3300031852 Bacteria 1163
1276 Ga0307410_10593774 3300031852 Bacteria 923
1277 Ga0307410_10725689 3300031852 Bacteria 839
1278 Ga0307410_10760841 3300031852 Bacteria 821
1279 Ga0307410_11270514 3300031852 Bacteria 643
1280 Ga0307406_10008314 3300031901 Bacteria 5783
1281 Ga0307406_10016505 3300031901 Bacteria 4293
1282 Ga0307406_10046189 3300031901 Bacteria 2739
1283 Ga0307406_10062825 3300031901 Bacteria 2403
1284 Ga0307406_10077068 3300031901 Bacteria 2204
1285 Ga0307406_10157467 3300031901 Bacteria 1628
1286 Ga0307406_10159559 3300031901 Bacteria 1619
1287 Ga0307406_10253408 3300031901 Bacteria 1327
1288 Ga0307406_10414336 3300031901 Bacteria 1071
1289 Ga0307406_10719403 3300031901 Bacteria 835
1290 Ga0307407_10007691 3300031903 Bacteria 4895
1291 Ga0307407_10009223 3300031903 Bacteria 4583
1292 Ga0307407_10060090 3300031903 Bacteria 2216
1293 Ga0307407_10067383 3300031903 Bacteria 2115
1294 Ga0307407_10070513 3300031903 Bacteria 2078
1295 Ga0307407_10134658 3300031903 Bacteria 1586
1296 Ga0307407_10153130 3300031903 Bacteria 1500
1297 Ga0307407_10213119 3300031903 Bacteria 1301
1298 Ga0307407_10286768 3300031903 Bacteria 1142
1299 Ga0307412_10000784 3300031911 Bacteria 18342
1300 Ga0307412_10005704 3300031911 Bacteria 6999
1301 Ga0307412_10006182 3300031911 Bacteria 6750
1302 Ga0307412_10068023 3300031911 Bacteria 2420
1303 Ga0307412_10143231 3300031911 Bacteria 1753
1304 Ga0307412_10211245 3300031911 Bacteria 1481
1305 Ga0307412_10245116 3300031911 Bacteria 1388
1306 Ga0307412_10396417 3300031911 Bacteria 1122
1307 Ga0307412_10506155 3300031911 Bacteria 1006
1308 Ga0307409_100001300 3300031995 Bacteria 12107
1309 Ga0307409_100006591 3300031995 Bacteria 6845
1310 Ga0307409_100023819 3300031995 Bacteria 4252
1311 Ga0307409_100097436 3300031995 Bacteria 2429
1312 Ga0307409_100138407 3300031995 Bacteria 2093
1313 Ga0307409_100143861 3300031995 Bacteria 2059
1314 Ga0307409_100170219 3300031995 Bacteria 1916
1315 Ga0307409_100190630 3300031995 Bacteria 1824
1316 Ga0307409_100419608 3300031995 Bacteria 1283
1317 Ga0307409_100562968 3300031995 Bacteria 1121
1318 Ga0307409_100577539 3300031995 Bacteria 1107
1319 Ga0307409_100642156 3300031995 Bacteria 1054
1320 Ga0307409_100666949 3300031995 Bacteria 1036
1321 Ga0307409_100672202 3300031995 Bacteria 1032
1322 Ga0307409_100699277 3300031995 Bacteria 1013
1323 Ga0307409_100736531 3300031995 Bacteria 988
1324 Ga0307416_100056819 3300032002 Bacteria 3161
1325 Ga0307416_100079575 3300032002 Bacteria 2762
1326 Ga0307416_100098450 3300032002 Bacteria 2537
1327 Ga0307416_100116234 3300032002 Bacteria 2371
1328 Ga0307416_100135357 3300032002 Bacteria 2227
1329 Ga0307416_100546253 3300032002 Bacteria 1231
1330 Ga0307416_100636870 3300032002 Bacteria 1150
1331 Ga0307416_100670015 3300032002 Bacteria 1124
1332 Ga0307416_100909703 3300032002 Bacteria 980
1333 Ga0307416_102180961 3300032002 Bacteria 655
1334 Ga0307414_10005744 3300032004 Bacteria 6854
1335 Ga0307414_10041008 3300032004 Bacteria 3131
1336 Ga0307414_10047269 3300032004 Bacteria 2960
1337 Ga0307414_10055433 3300032004 Bacteria 2775
1338 Ga0307414_10067288 3300032004 Bacteria 2565
1339 Ga0307414_10131338 3300032004 Bacteria 1944
1340 Ga0307414_10147298 3300032004 Bacteria 1852
1341 Ga0307414_10241436 3300032004 Bacteria 1496
1342 Ga0307414_10262431 3300032004 Bacteria 1442
1343 Ga0307414_10263571 3300032004 Bacteria 1439
1344 Ga0307414_10365160 3300032004 Bacteria 1243
1345 Ga0307414_10413780 3300032004 Bacteria 1174
1346 Ga0307414_10502380 3300032004 Bacteria 1073
1347 Ga0307414_10654107 3300032004 Bacteria 948
1348 Ga0307414_10819557 3300032004 Bacteria 849
1349 Ga0307414_11107083 3300032004 Bacteria 731
1350 Ga0307414_11252491 3300032004 Bacteria 687
1351 Ga0307411_10001141 3300032005 Bacteria 10410
1352 Ga0307411_10023904 3300032005 Bacteria 3631
1353 Ga0307411_10027430 3300032005 Bacteria 3446
1354 Ga0307411_10033553 3300032005 Bacteria 3184
1355 Ga0307411_10050531 3300032005 Bacteria 2708
1356 Ga0307411_10085249 3300032005 Bacteria 2187
1357 Ga0307411_10093411 3300032005 Bacteria 2106
1358 Ga0307411_10100749 3300032005 Bacteria 2042
1359 Ga0307411_10126697 3300032005 Bacteria 1858
1360 Ga0307411_10132238 3300032005 Bacteria 1825
1361 Ga0307411_10142758 3300032005 Bacteria 1767
1362 Ga0307411_10269171 3300032005 Bacteria 1350
1363 Ga0307411_10294967 3300032005 Bacteria 1297
1364 Ga0307411_10552656 3300032005 Bacteria 982
1365 Ga0307411_10639460 3300032005 Bacteria 919
1366 Ga0307411_10690011 3300032005 Bacteria 888
1367 Ga0307411_11213753 3300032005 Bacteria 684
1368 Ga0307415_100038795 3300032126 Bacteria 3142
1369 Ga0307415_100082114 3300032126 Bacteria 2304
1370 Ga0307415_100089957 3300032126 Bacteria 2219
1371 Ga0307415_100102706 3300032126 Bacteria 2101
1372 Ga0307415_100118717 3300032126 Bacteria 1978
1373 Ga0307415_100149106 3300032126 Bacteria 1797
1374 Ga0307415_100161413 3300032126 Bacteria 1737
1375 Ga0307415_100183256 3300032126 Bacteria 1645
1376 Ga0307415_100218232 3300032126 Bacteria 1527
1377 Ga0307415_100532170 3300032126 Bacteria 1034
1378 Ga0307415_100552396 3300032126 Bacteria 1016
1379 Ga0373930_0011102 3300034816 Bacteria 1622
1380 Ga0373950_0015507 3300034818 Bacteria 1293
1381 Ga0373934_0027537 3300035086 Bacteria 2209
1382 Ga0373953_0018270 3300035117 Bacteria 2592
1383 Ga0373954_0079316 3300035118 Bacteria 1567
1384 Ga0373956_0053239 3300035119 Bacteria 1822
1385 Ga0373943_0003454 3300035170 Bacteria 7189
1386 Ga0373943_0040194 3300035170 Bacteria 2258
1387 Ga0373955_0009254 3300035172 Bacteria 4612
1388 Ga0373961_0236741 3300035241 Bacteria 656
1389 Ga0373931_0131860 3300035691 Bacteria 1439
1390 Ga0373931_0133606 3300035691 Bacteria 1431
1391 Ga0373931_0223633 3300035691 Bacteria 1134
1392 Ga0373931_0382790 3300035691 Bacteria 887
1393 Ga0373935_0005654 3300035692 Bacteria 7376
1394 Ga0373935_0466176 3300035692 Bacteria 914
1395 Ga0373933_0006583 3300035724 Bacteria 6331
1396 Ga0373933_0022433 3300035724 Bacteria 3595
1397 Ga0373947_0033024 3300035725 Bacteria 3053
1398 Ga0373937_0012573 3300036401 Bacteria 7447
1399 Ga0373937_0041576 3300036401 Bacteria 4192
1400 Ga0373937_0279501 3300036401 Bacteria 1576
1401 Ga0373925_0173866 3300037068 Bacteria 1701
1402 Ga0395899_0000469 3300037312 Bacteria 45619
1403 Ga0395899_0002068 3300037312 Bacteria 16507
1404 Ga0395899_0003741 3300037312 Bacteria 12019
1405 Ga0395899_0004956 3300037312 Bacteria 10359
1406 Ga0395899_0005191 3300037312 Bacteria 10133
1407 Ga0395899_0006375 3300037312 Bacteria 9137
1408 Ga0395899_0015973 3300037312 Bacteria 5725
1409 Ga0395899_0024588 3300037312 Bacteria 4553
1410 Ga0395899_0028892 3300037312 Bacteria 4172
1411 Ga0395899_0035898 3300037312 Bacteria 3720
1412 Ga0395899_0047941 3300037312 Bacteria 3179
1413 Ga0395899_0160337 3300037312 Bacteria 1589
1414 Ga0395899_0161512 3300037312 Bacteria 1582
1415 Ga0395899_0176311 3300037312 Bacteria 1503
1416 Ga0395899_0197949 3300037312 Bacteria 1403
1417 Ga0395899_0227249 3300037312 Bacteria 1290
1418 Ga0395899_0241006 3300037312 Bacteria 1244
1419 Ga0395899_0450880 3300037312 Bacteria 842
1420 Ga0395899_0461771 3300037312 Bacteria 830
1421 Ga0395900_0000036 3300037418 Bacteria 250619
1422 Ga0395900_0000693 3300037418 Bacteria 44924
1423 Ga0395900_0001457 3300037418 Bacteria 28209
1424 Ga0395900_0002121 3300037418 Bacteria 22192
1425 Ga0395900_0002327 3300037418 Bacteria 21033
1426 Ga0395900_0006747 3300037418 Bacteria 11913
1427 Ga0395900_0011164 3300037418 Bacteria 9184
1428 Ga0395900_0020419 3300037418 Bacteria 6762
1429 Ga0395900_0026392 3300037418 Bacteria 5947
1430 Ga0395900_0036154 3300037418 Bacteria 5089
1431 Ga0395900_0048624 3300037418 Bacteria 4369
1432 Ga0395900_0058883 3300037418 Bacteria 3955
1433 Ga0395900_0059487 3300037418 Bacteria 3933
1434 Ga0395900_0059845 3300037418 Bacteria 3921
1435 Ga0395900_0061831 3300037418 Bacteria 3849
1436 Ga0395900_0116531 3300037418 Bacteria 2741
1437 Ga0395900_0149258 3300037418 Bacteria 2389
1438 Ga0395900_0150092 3300037418 Bacteria 2381
1439 Ga0395900_0177962 3300037418 Bacteria 2163
1440 Ga0395900_0206815 3300037418 Bacteria 1983
1441 Ga0395900_0215573 3300037418 Bacteria 1937
1442 Ga0395900_0216856 3300037418 Bacteria 1931
1443 Ga0395900_0234487 3300037418 Bacteria 1844
1444 Ga0395900_0234882 3300037418 Bacteria 1842
1445 Ga0395900_0263949 3300037418 Bacteria 1718
1446 Ga0395900_0266646 3300037418 Bacteria 1708
1447 Ga0395900_0275785 3300037418 Bacteria 1675
1448 Ga0395900_0276660 3300037418 Bacteria 1672
1449 Ga0395900_0290281 3300037418 Bacteria 1624
1450 Ga0395900_0344415 3300037418 Bacteria 1465
1451 Ga0395900_0359972 3300037418 Bacteria 1426
1452 Ga0395900_0392680 3300037418 Bacteria 1353
1453 Ga0395900_0407677 3300037418 Bacteria 1322
1454 Ga0395900_0461747 3300037418 Bacteria 1224
1455 Ga0395900_0519943 3300037418 Bacteria 1138
1456 Ga0395900_0931636 3300037418 Bacteria 791
1457 Ga0395900_0972368 3300037418 Bacteria 770
1458 Ga0395900_1065345 3300037418 Bacteria 726
1459 Ga0395898_0000219 3300037466 Bacteria 146838
1460 Ga0395898_0003150 3300037466 Bacteria 18629
1461 Ga0395898_0003602 3300037466 Bacteria 17250
1462 Ga0395898_0010611 3300037466 Bacteria 9620
1463 Ga0395898_0042883 3300037466 Bacteria 4461
1464 Ga0395898_0065293 3300037466 Bacteria 3528
1465 Ga0395898_0065741 3300037466 Bacteria 3515
1466 Ga0395898_0092374 3300037466 Bacteria 2910
1467 Ga0395898_0100607 3300037466 Bacteria 2776
1468 Ga0395898_0112545 3300037466 Bacteria 2608
1469 Ga0395898_0116804 3300037466 Bacteria 2556
1470 Ga0395898_0138163 3300037466 Bacteria 2333
1471 Ga0395898_0170968 3300037466 Bacteria 2077
1472 Ga0395898_0196202 3300037466 Bacteria 1928
1473 Ga0395898_0202971 3300037466 Bacteria 1892
1474 Ga0395898_0216371 3300037466 Bacteria 1827
1475 Ga0395898_0310290 3300037466 Bacteria 1505
1476 Ga0395898_0348663 3300037466 Bacteria 1412
1477 Ga0395898_0597293 3300037466 Bacteria 1046
1478 Ga0395898_1110246 3300037466 Bacteria 724
1479 Ga0395905_0000092 3300037471 Bacteria 149300
1480 Ga0395905_0000094 3300037471 Bacteria 147776
1481 Ga0395905_0000852 3300037471 Bacteria 39836
1482 Ga0395905_0003007 3300037471 Bacteria 18277
1483 Ga0395905_0007093 3300037471 Bacteria 11200
1484 Ga0395905_0011950 3300037471 Bacteria 8371
1485 Ga0395905_0014631 3300037471 Bacteria 7484
1486 Ga0395905_0017317 3300037471 Bacteria 6841
1487 Ga0395905_0021609 3300037471 Bacteria 6086
1488 Ga0395905_0032265 3300037471 Bacteria 4926
1489 Ga0395905_0034468 3300037471 Bacteria 4753
1490 Ga0395905_0036907 3300037471 Bacteria 4590
1491 Ga0395905_0037996 3300037471 Bacteria 4516
1492 Ga0395905_0038567 3300037471 Bacteria 4483
1493 Ga0395905_0039077 3300037471 Bacteria 4452
1494 Ga0395905_0047385 3300037471 Bacteria 4028
1495 Ga0395905_0059180 3300037471 Bacteria 3582
1496 Ga0395905_0062392 3300037471 Bacteria 3486
1497 Ga0395905_0066187 3300037471 Bacteria 3384
1498 Ga0395905_0087199 3300037471 Bacteria 2926
1499 Ga0395905_0088709 3300037471 Bacteria 2898
1500 Ga0395905_0097478 3300037471 Bacteria 2760
1501 Ga0395905_0108785 3300037471 Bacteria 2602
1502 Ga0395905_0116334 3300037471 Bacteria 2513
1503 Ga0395905_0129896 3300037471 Bacteria 2369
1504 Ga0395905_0130821 3300037471 Bacteria 2360
1505 Ga0395905_0132474 3300037471 Bacteria 2344
1506 Ga0395905_0142021 3300037471 Bacteria 2258
1507 Ga0395905_0149727 3300037471 Bacteria 2196
1508 Ga0395905_0154193 3300037471 Bacteria 2161
1509 Ga0395905_0164157 3300037471 Bacteria 2087
1510 Ga0395905_0194440 3300037471 Bacteria 1902
1511 Ga0395905_0197669 3300037471 Bacteria 1885
1512 Ga0395905_0208700 3300037471 Bacteria 1830
1513 Ga0395905_0259195 3300037471 Bacteria 1623
1514 Ga0395905_0296655 3300037471 Bacteria 1503
1515 Ga0395905_0423806 3300037471 Bacteria 1227
1516 Ga0395905_0830465 3300037471 Bacteria 827
1517 Ga0395905_0854417 3300037471 Bacteria 813
1518 Ga0395905_0855814 3300037471 Bacteria 812
1519 Ga0395905_1108082 3300037471 Bacteria 695
1520 Ga0436364_0056487 3300037853 Bacteria 996
1521 Ga0436364_0735745 3300037853 Bacteria 1040
1522 Ga0395901_0000036 3300038443 Bacteria 214274
1523 Ga0395901_0000188 3300038443 Bacteria 78908
1524 Ga0395901_0000507 3300038443 Bacteria 45109
1525 Ga0395901_0001734 3300038443 Bacteria 22531
1526 Ga0395901_0001916 3300038443 Bacteria 21422
1527 Ga0395901_0003296 3300038443 Bacteria 16247
1528 Ga0395901_0011544 3300038443 Bacteria 8952
1529 Ga0395901_0017460 3300038443 Bacteria 7323
1530 Ga0395901_0021978 3300038443 Bacteria 6539
1531 Ga0395901_0024326 3300038443 Bacteria 6215
1532 Ga0395901_0027300 3300038443 Bacteria 5865
1533 Ga0395901_0042159 3300038443 Bacteria 4731
1534 Ga0395901_0055006 3300038443 Bacteria 4138
1535 Ga0395901_0070874 3300038443 Bacteria 3631
1536 Ga0395901_0079261 3300038443 Bacteria 3429
1537 Ga0395901_0096722 3300038443 Bacteria 3094
1538 Ga0395901_0105852 3300038443 Bacteria 2952
1539 Ga0395901_0108122 3300038443 Bacteria 2919
1540 Ga0395901_0123748 3300038443 Bacteria 2717
1541 Ga0395901_0138329 3300038443 Bacteria 2559
1542 Ga0395901_0143962 3300038443 Bacteria 2505
1543 Ga0395901_0152863 3300038443 Bacteria 2424
1544 Ga0395901_0164909 3300038443 Bacteria 2326
1545 Ga0395901_0224228 3300038443 Bacteria 1964
1546 Ga0395901_0236823 3300038443 Bacteria 1905
1547 Ga0395901_0268044 3300038443 Bacteria 1776
1548 Ga0395901_0299974 3300038443 Bacteria 1666
1549 Ga0395901_0330308 3300038443 Bacteria 1576
1550 Ga0395901_0333571 3300038443 Bacteria 1567
1551 Ga0395901_0545669 3300038443 Bacteria 1175
1552 Ga0395901_0633764 3300038443 Bacteria 1074
1553 Ga0395901_0670201 3300038443 Bacteria 1038
1554 Ga0395901_0670871 3300038443 Bacteria 1037
1555 Ga0395901_0953692 3300038443 Bacteria 836
1556 Ga0395901_1007518 3300038443 Bacteria 808
1557 Ga0400486_21947 3300038742 Bacteria 3725
1558 Ga0400487_65498 3300039110 Bacteria 1952
1559 Ga0436365_0063278 3300039437 Bacteria 881
1560 Ga0436365_0597532 3300039437 Bacteria 734
1561 Ga0436365_1179331 3300039437 Bacteria 1791
1562 Ga0436360_0750991 3300039438 Bacteria 1216
1563 Ga0436361_0466531 3300039447 Bacteria 5851
1564 Ga0436361_0496637 3300039447 Bacteria 797
1565 Ga0436363_0624562 3300039450 Bacteria 1256
1566 Ga0436362_0323225 3300039453 Bacteria 667
1567 Ga0436362_0485515 3300039453 Bacteria 976
1568 Ga0436362_0702648 3300039453 Bacteria 6618
1569 Ga0439436_0016696 3300041404 Bacteria 2201
1570 Ga0439461_0000003 3300041410 Bacteria 37335
1571 Ga0439466_0106679 3300041411 Bacteria 870
1572 Ga0439442_019414 3300042002 Bacteria 1406
1573 Ga0439445_0012475 3300042004 Bacteria 2043
1574 Ga0439448_0005749 3300042005 Bacteria 3542
1575 Ga0439448_0006674 3300042005 Bacteria 3325
1576 Ga0439432_001354 3300042006 Bacteria 9268
1577 Ga0439432_158026 3300042006 Bacteria 664
1578 Ga0439450_066802 3300042008 Bacteria 877
1579 Ga0439455_0003470 3300042012 Bacteria 3016
1580 Ga0439455_0005390 3300042012 Bacteria 2596
1581 Ga0439462_0000690 3300042015 Bacteria 6884
1582 Ga0450923_025338 3300042125 Bacteria 1182
1583 Ga0439458_0001045 3300042157 Bacteria 7059
1584 Ga0439434_0002192 3300042435 Bacteria 5668
1585 Ga0439464_0040518 3300042439 Bacteria 1327
1586 Ga0466969_0158624 3300044656 Bacteria 1040
1587 Ga0466969_0171710 3300044656 Bacteria 994
1588 Ga0466972_0003425 3300044658 Bacteria 7871
1589 Ga0466972_0025780 3300044658 Bacteria 2913
1590 Ga0466972_0081179 3300044658 Bacteria 1544
1591 Ga0466972_0202027 3300044658 Bacteria 931
1592 Ga0466965_0006208 3300044683 Bacteria 5406
1593 Ga0466966_0020701 3300044684 Bacteria 4323
1594 Ga0466966_0059459 3300044684 Bacteria 2413
1595 Ga0466966_0076988 3300044684 Bacteria 2082
1596 Ga0466966_0182216 3300044684 Bacteria 1274
1597 Ga0466966_0284141 3300044684 Bacteria 995
1598 Ga0466966_0492347 3300044684 Bacteria 737
1599 Ga0466961_0005906 3300044693 Bacteria 7759
1600 Ga0466961_0041598 3300044693 Bacteria 2946
1601 Ga0466961_0071333 3300044693 Bacteria 2204
1602 Ga0466961_0137456 3300044693 Bacteria 1531
1603 Ga0466961_0517088 3300044693 Bacteria 720
1604 Ga0466963_0011929 3300044694 Bacteria 5307
1605 Ga0466963_0013728 3300044694 Bacteria 4982
1606 Ga0466963_0016767 3300044694 Bacteria 4558
1607 Ga0466963_0021242 3300044694 Bacteria 4093
1608 Ga0466963_0067560 3300044694 Bacteria 2399
1609 Ga0466963_0074568 3300044694 Bacteria 2288
1610 Ga0466963_0078713 3300044694 Bacteria 2229
1611 Ga0466963_0152993 3300044694 Bacteria 1602
1612 Ga0466963_0250757 3300044694 Bacteria 1242
1613 Ga0466963_0517000 3300044694 Bacteria 843
1614 Ga0466964_0005754 3300044706 Bacteria 4616
1615 Ga0466971_0006997 3300044719 Bacteria 4909
1616 Ga0466971_0007284 3300044719 Bacteria 4817
1617 Ga0466971_0012362 3300044719 Bacteria 3739
1618 Ga0466971_0052568 3300044719 Bacteria 1835
1619 Ga0466971_0140775 3300044719 Bacteria 1123
1620 Ga0466968_0057185 3300044735 Bacteria 1676
1621 Ga0466968_0223395 3300044735 Bacteria 888
1622 Ga0466957_0001958 3300044842 Bacteria 10946
1623 Ga0466957_0013431 3300044842 Bacteria 4750
1624 Ga0466957_0051968 3300044842 Bacteria 2494
1625 Ga0466957_0055123 3300044842 Bacteria 2429
1626 Ga0466957_0060366 3300044842 Bacteria 2325
1627 Ga0466957_0133870 3300044842 Bacteria 1591
1628 Ga0466957_0240669 3300044842 Bacteria 1201
1629 Ga0466957_0380649 3300044842 Bacteria 962
1630 Ga0466957_0964756 3300044842 Bacteria 611
1631 Ga0466960_0171142 3300044901 Bacteria 1172
1632 Ga0466959_0033136 3300045049 Bacteria 3821
1633 Ga0466959_0083918 3300045049 Bacteria 2293
1634 Ga0466959_0104528 3300045049 Bacteria 2026
1635 Ga0466959_0327357 3300045049 Bacteria 1047
1636 Ga0466958_0002377 3300045836 Bacteria 9413
1637 Ga0466958_0004434 3300045836 Bacteria 7410
1638 Ga0466958_0015271 3300045836 Bacteria 4397
1639 Ga0466958_0214034 3300045836 Bacteria 1228
1640 Ga0466958_0215791 3300045836 Bacteria 1223
1641 Ga0466967_0000246 3300045976 Bacteria 23831
1642 Ga0466967_0008265 3300045976 Bacteria 7603
1643 Ga0466967_0012949 3300045976 Bacteria 6416
1644 Ga0466967_0022533 3300045976 Bacteria 5142
1645 Ga0466967_0072801 3300045976 Bacteria 3081
1646 Ga0466967_0147647 3300045976 Bacteria 2194
1647 Ga0466967_0163685 3300045976 Bacteria 2089
1648 Ga0466967_0169807 3300045976 Bacteria 2051
1649 Ga0466967_0210404 3300045976 Bacteria 1844
1650 Ga0466967_0345804 3300045976 Bacteria 1439
1651 Ga0466967_0362026 3300045976 Bacteria 1406
1652 Ga0466967_0484151 3300045976 Bacteria 1212
1653 Ga0466967_0547131 3300045976 Bacteria 1139
1654 Ga0466967_0663079 3300045976 Bacteria 1032
1655 Ga0466967_1372139 3300045976 Bacteria 704
1656 Ga0466967_1386552 3300045976 Bacteria 700
1657 Ga0466967_1526447 3300045976 Bacteria 665
1658 Ga0495582_0524604 3300046473 Bacteria 685
1659 Ga0495585_0178703 3300046492 Bacteria 1092
1660 Ga0495596_0001536 3300046500 Bacteria 13177
1661 Ga0495607_0188581 3300046501 Bacteria 1028
1662 Ga0495583_0002337 3300046506 Bacteria 16476
1663 Ga0495606_0016302 3300046507 Bacteria 5673
1664 Ga0495606_0025801 3300046507 Bacteria 4200
1665 Ga0495606_0120227 3300046507 Bacteria 1573
1666 Ga0495606_0208160 3300046507 Bacteria 1110
1667 Ga0495620_0253093 3300046515 Bacteria 671
1668 Ga0495643_0309484 3300046522 Bacteria 717
1669 Ga0495648_0029401 3300046524 Bacteria 3648
1670 Ga0495663_0012158 3300046525 Bacteria 2398
1671 Ga0495663_0063679 3300046525 Bacteria 1163
1672 Ga0495642_0288822 3300046528 Bacteria 718
1673 Ga0495640_0123372 3300046533 Bacteria 1682
1674 Ga0495598_0019323 3300046537 Bacteria 1785
1675 Ga0495598_0020362 3300046537 Bacteria 1750
1676 Ga0495621_0000006 3300046539 Bacteria 44306
1677 Ga0495621_0021282 3300046539 Bacteria 2137
1678 Ga0495621_0024628 3300046539 Bacteria 2012
1679 Ga0495633_0005427 3300046558 Bacteria 7798
1680 Ga0495633_0247820 3300046558 Bacteria 813
1681 Ga0495668_0012996 3300046616 Bacteria 4927
1682 Ga0495635_0562677 3300046663 Bacteria 747
1683 Ga0495659_0208772 3300046664 Bacteria 803
1684 Ga0495661_0065493 3300046665 Bacteria 2141
1685 Ga0495647_0196676 3300046681 Bacteria 883
1686 Ga0495669_0000046 3300046684 Bacteria 83405
1687 Ga0495669_0000899 3300046684 Bacteria 12508
1688 Ga0495669_0011898 3300046684 Bacteria 3700
1689 Ga0495669_0027982 3300046684 Bacteria 2466
1690 Ga0495669_0028082 3300046684 Bacteria 2462
1691 Ga0495669_0062618 3300046684 Bacteria 1686
1692 Ga0495669_0095832 3300046684 Bacteria 1374
1693 Ga0495669_0157825 3300046684 Bacteria 1076
1694 Ga0495669_0159378 3300046684 Bacteria 1071
1695 Ga0495669_0200617 3300046684 Bacteria 953
1696 Ga0495669_0260916 3300046684 Bacteria 832
1697 Ga0495670_0000226 3300046691 Bacteria 25540
1698 Ga0495670_0005650 3300046691 Bacteria 6131
1699 Ga0495670_0006081 3300046691 Bacteria 5919
1700 Ga0495670_0041836 3300046691 Bacteria 2287
1701 Ga0495670_0053070 3300046691 Bacteria 2030
1702 Ga0495670_0098993 3300046691 Bacteria 1500
1703 Ga0495670_0108046 3300046691 Bacteria 1438
1704 Ga0495649_0266924 3300046694 Bacteria 876
1705 Ga0495672_0158392 3300047320 Bacteria 1167
1706 Ga0495680_0119035 3300047322 Bacteria 1951
1707 Ga0495683_0203206 3300047323 Bacteria 892
1708 Ga0495687_092986 3300047443 Bacteria 1150
1709 Ga0495677_0017955 3300047445 Bacteria 2565
1710 Ga0495677_0091079 3300047445 Bacteria 1149
1711 Ga0495677_0114134 3300047445 Bacteria 1028
1712 Ga0495677_0168893 3300047445 Bacteria 846
1713 Ga0495677_0204866 3300047445 Bacteria 767
1714 Ga0495673_0093939 3300047469 Bacteria 1222
1715 Ga0495686_0000057 3300047472 Bacteria 250088
1716 Ga0495686_0000477 3300047472 Bacteria 59619
1717 Ga0495686_0003829 3300047472 Bacteria 12749
1718 Ga0495686_0015096 3300047472 Bacteria 5290
1719 Ga0495686_0059205 3300047472 Bacteria 2385
1720 Ga0495686_0402191 3300047472 Bacteria 735
1721 Ga0495602_0074155 3300048088 Bacteria 2893
1722 Ga0495602_0231169 3300048088 Bacteria 1389
1723 Ga0496100_0008472 3300048903 Bacteria 5735
1724 Ga0496100_0797301 3300048903 Bacteria 740
1725 Ga0496100_0949546 3300048903 Bacteria 676
1726 Ga0496101_0053369 3300048904 Bacteria 2916
1727 Ga0496101_0072754 3300048904 Bacteria 2524
1728 Ga0496101_0194276 3300048904 Bacteria 1567
1729 Ga0496101_0204288 3300048904 Bacteria 1528
1730 Ga0496101_0220811 3300048904 Bacteria 1471
1731 Ga0496102_0307846 3300048905 Bacteria 1493
1732 Ga0496102_0579528 3300048905 Bacteria 1045
1733 Ga0496102_0919246 3300048905 Bacteria 796
1734 Ga0496103_0430726 3300048906 Bacteria 846
1735 Ga0496103_0470787 3300048906 Bacteria 805
1736 Ga0496104_0059119 3300048907 Bacteria 3629
1737 Ga0496105_0897980 3300048908 Bacteria 668
1738 Ga0496106_0049308 3300048909 Bacteria 3172
1739 Ga0496107_0015522 3300048910 Bacteria 5341
1740 Ga0496107_0033455 3300048910 Bacteria 3678
1741 Ga0496107_0061440 3300048910 Bacteria 2720
1742 Ga0496107_0075703 3300048910 Bacteria 2450
1743 Ga0496107_0125732 3300048910 Bacteria 1891
1744 Ga0496107_0282031 3300048910 Bacteria 1236
1745 Ga0496107_0313081 3300048910 Bacteria 1168
1746 Ga0496108_0004204 3300048911 Bacteria 11598
1747 Ga0496108_0198110 3300048911 Bacteria 1742
1748 Ga0496108_0398180 3300048911 Bacteria 1202
1749 Ga0496108_0536487 3300048911 Bacteria 1021
1750 Ga0496109_0008646 3300048912 Bacteria 8666
1751 Ga0496109_0110625 3300048912 Bacteria 2554
1752 Ga0496109_0130712 3300048912 Bacteria 2343
1753 Ga0496109_0159208 3300048912 Bacteria 2115
1754 Ga0496109_0293959 3300048912 Bacteria 1531
1755 Ga0496109_0380326 3300048912 Bacteria 1334
1756 Ga0496109_0679792 3300048912 Bacteria 967
1757 Ga0496109_1454673 3300048912 Bacteria 620
1758 Ga0496110_0001264 3300048913 Bacteria 18084
1759 Ga0496110_0001911 3300048913 Bacteria 15417
1760 Ga0496110_0084190 3300048913 Bacteria 2838
1761 Ga0496110_0151178 3300048913 Bacteria 2102
1762 Ga0496110_0233856 3300048913 Bacteria 1672
1763 Ga0496111_0018746 3300048914 Bacteria 4796
1764 Ga0496111_0062548 3300048914 Bacteria 2699
1765 Ga0496111_0081579 3300048914 Bacteria 2361
1766 Ga0496111_0094371 3300048914 Bacteria 2194
1767 Ga0496111_0188372 3300048914 Bacteria 1534
1768 Ga0496111_0189369 3300048914 Bacteria 1529
1769 Ga0496111_0299648 3300048914 Bacteria 1192
1770 Ga0496112_0001065 3300048915 Bacteria 20255
1771 Ga0496112_0028311 3300048915 Bacteria 5407
1772 Ga0496112_0103424 3300048915 Bacteria 2818
1773 Ga0496112_0248126 3300048915 Bacteria 1732
1774 Ga0496112_0427729 3300048915 Bacteria 1262
1775 Ga0496112_0489690 3300048915 Bacteria 1166
1776 Ga0496112_0623980 3300048915 Bacteria 1009
1777 Ga0496112_0680649 3300048915 Bacteria 957
1778 Ga0496112_0884991 3300048915 Bacteria 815
1779 Ga0496112_0943288 3300048915 Bacteria 784
1780 Ga0496113_0001345 3300048916 Bacteria 13596
1781 Ga0496113_0022966 3300048916 Bacteria 4420
1782 Ga0496113_0135969 3300048916 Bacteria 1931
1783 Ga0496113_0139252 3300048916 Bacteria 1908
1784 Ga0496114_0005688 3300048917 Bacteria 9776
1785 Ga0496114_0007769 3300048917 Bacteria 8486
1786 Ga0496115_0005046 3300048918 Bacteria 9593
1787 Ga0496115_0096225 3300048918 Bacteria 2424
1788 Ga0496116_0038519 3300048919 Bacteria 3318
1789 Ga0496117_0008375 3300048920 Bacteria 9833
1790 Ga0496117_0017437 3300048920 Bacteria 5995
1791 Ga0496117_0031114 3300048920 Bacteria 4081
1792 Ga0496117_0031968 3300048920 Bacteria 4009
1793 Ga0496117_0039799 3300048920 Bacteria 3465
1794 Ga0496118_0001203 3300048921 Bacteria 39844
1795 Ga0496118_0031114 3300048921 Bacteria 4433
1796 Ga0496118_0033311 3300048921 Bacteria 4229
1797 Ga0496118_0037602 3300048921 Bacteria 3893
1798 Ga0496118_0091238 3300048921 Bacteria 2096
1799 Ga0496119_0070474 3300048922 Bacteria 2050
1800 Ga0496121_0006378 3300048924 Bacteria 14686
1801 Ga0496121_0057655 3300048924 Bacteria 3217
1802 Ga0496121_0124737 3300048924 Bacteria 1938
1803 Ga0496121_0206765 3300048924 Bacteria 1394
1804 Ga0496121_0235644 3300048924 Bacteria 1279
1805 Ga0496121_0502104 3300048924 Bacteria 770
1806 Ga0496122_0004742 3300048925 Bacteria 16663
1807 Ga0496122_0005520 3300048925 Bacteria 15019
1808 Ga0496122_0022141 3300048925 Bacteria 5660
1809 Ga0496122_0026975 3300048925 Bacteria 4929
1810 Ga0496123_0000643 3300048926 Bacteria 58206
1811 Ga0496123_0011709 3300048926 Bacteria 7566
1812 Ga0496123_0060819 3300048926 Bacteria 2432
1813 Ga0496123_0064353 3300048926 Bacteria 2337
1814 Ga0496123_0068512 3300048926 Bacteria 2234
1815 Ga0496124_0001391 3300048927 Bacteria 36283
1816 Ga0496124_0002938 3300048927 Bacteria 21440
1817 Ga0496124_0011317 3300048927 Bacteria 8928
1818 Ga0496124_0015121 3300048927 Bacteria 7418
1819 Ga0496124_0021788 3300048927 Bacteria 5894
1820 Ga0496124_0026490 3300048927 Bacteria 5226
1821 Ga0496124_0071149 3300048927 Bacteria 2884
1822 Ga0496124_0168069 3300048927 Bacteria 1702
1823 Ga0496125_0000898 3300048928 Bacteria 47075
1824 Ga0495682_0012661 3300049460 Bacteria 3229
1825 Ga0501290_006143 3300049513 Bacteria 1502
1826 Ga0501290_006879 3300049513 Bacteria 1425
1827 Ga0501033_0114789 3300049570 Bacteria 1957
1828 Ga0501033_0200204 3300049570 Bacteria 1427
1829 Ga0501037_0037820 3300049573 Bacteria 3558
1830 Ga0501043_0150855 3300049579 Bacteria 1819
1831 Ga0501047_0126065 3300049581 Bacteria 2441
1832 Ga0501067_0000593 3300049583 Bacteria 19485
1833 Ga0501068_0187276 3300049584 Bacteria 1310
1834 Ga0501069_0162809 3300049585 Unclassified 1285
1835 Ga0501070_0031707 3300049586 Bacteria 4428
1836 Ga0501070_0104743 3300049586 Bacteria 2339
1837 Ga0501073_0072305 3300049589 Bacteria 2402
1838 Ga0501076_0183921 3300049592 Bacteria 1704
1839 Ga0501077_0085510 3300049593 Bacteria 1999
1840 Ga0501202_051701 3300049652 Bacteria 912
1841 Ga0501202_098890 3300049652 Bacteria 708
1842 Ga0501211_002878 3300049658 Bacteria 1799
1843 Ga0501217_019640 3300049661 Bacteria 1580
1844 Ga0501217_063064 3300049661 Bacteria 994
1845 Ga0501223_014019 3300049663 Bacteria 1592
1846 Ga0501235_003753 3300049669 Bacteria 3281
1847 Ga0501249_020995 3300049679 Bacteria 1424
1848 Ga0501255_019040 3300049684 Bacteria 872
1849 Ga0501257_000315 3300049686 Bacteria 9388
1850 Ga0501221_093272 3300049704 Bacteria 739
1851 Ga0501225_0007843 3300049705 Bacteria 3082
1852 Ga0501225_0017020 3300049705 Bacteria 2019
1853 Ga0501225_0055558 3300049705 Bacteria 1108
1854 Ga0501225_0083567 3300049705 Bacteria 919
1855 Ga0501245_007672 3300049708 Bacteria 1528
1856 Ga0501080_0023627 3300049742 Bacteria 5696
1857 Ga0501080_0128166 3300049742 Bacteria 2349
1858 Ga0501080_0513335 3300049742 Bacteria 1070
1859 Ga0501083_0081812 3300049744 Bacteria 2140
1860 Ga0501268_077855 3300049765 Bacteria 680
1861 Ga0501270_003504 3300049767 Bacteria 1699
1862 Ga0501274_013464 3300049771 Bacteria 785
1863 Ga0501280_006942 3300049776 Bacteria 1589
1864 Ga0501204_022273 3300049850 Bacteria 835
1865 nmdc:mga0k408_346952_c1 3300050493 Bacteria 885
1866 nmdc:mga07m45_21215_c1 3300050496 Bacteria 3534
1867 nmdc:mga06r32_6024_c1 3300050510 Bacteria 5695
1868 nmdc:mga08y16_430641_c1 3300050511 Bacteria 1347
1869 nmdc:mga08y16_48536_c1 3300050511 Bacteria 4443
1870 nmdc:mga0n895_170448_c1 3300050512 Bacteria 2208
1871 nmdc:mga0n895_56477_c1 3300050512 Bacteria 3867
1872 nmdc:mga0rr50_708594_c1 3300050513 Bacteria 859
1873 nmdc:mga08x19_625014_c1 3300050514 Bacteria 763
1874 Ga0495612_0157865 3300053078 Bacteria 989
1875 Ga0495619_0025919 3300053085 Bacteria 3769
1876 Ga0495619_0394056 3300053085 Bacteria 956
1877 Ga0500643_001561 3300053087 Bacteria 12975
1878 Ga0500566_0036302 3300053094 Bacteria 2860
1879 Ga0500641_0091562 3300053096 Bacteria 1298
1880 Ga0500572_005240 3300053111 Bacteria 2934
1881 Ga0500595_001850 3300053119 Bacteria 10948
1882 Ga0500658_0005731 3300053134 Bacteria 4625
1883 Ga0500577_0046724 3300053142 Bacteria 1606
1884 Ga0500637_0000317 3300053178 Bacteria 18056
1885 Ga0501084_0035925 3300054114 Bacteria 4141
1886 Ga0501084_0107819 3300054114 Unclassified 2340
1887 Ga0501084_0471972 3300054114 Bacteria 1060
1888 Ga0587090_011437 3300059510 Bacteria 1248
1889 Ga0501082_0198787 3300060353 Bacteria 1744
1890 Ga0466962_0005527 3300061719 Bacteria 6072
1891 Ga0466962_0006392 3300061719 Bacteria 5656
1892 Ga0466962_0011492 3300061719 Bacteria 4263
1893 Ga0466962_0024525 3300061719 Bacteria 2897
1894 Ga0466962_0209331 3300061719 Bacteria 954

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005468 Ga0070707_100493072 Ga0070707_1004930722 175
2 3300013105 Ga0157369_11642270 Ga0157369_116422701 179
3 3300005530 Ga0070679_101365447 Ga0070679_1013654471 181
4 3300028800 Ga0265338_10406279 Ga0265338_104062792 181
5 3300028800 Ga0265338_10571673 Ga0265338_105716731 181
6 3300005435 Ga0070714_100481438 Ga0070714_1004814381 185
7 3300025929 Ga0207664_11180072 Ga0207664_111800721 185
8 3300028666 Ga0265336_10016496 Ga0265336_100164964 185
9 iso_pu_bacteria 2935959822 2935965655 185
10 3300037471 Ga0395905_0108785 Ga0395905_0108785_104_673 187
11 3300053111 Ga0500572_005240 Ga0500572_005240_672_1259 187
12 3300053178 Ga0500637_0000317 Ga0500637_0000317_16746_17339 187
13 3300001989 JGI24739J22299_10005463 JGI24739J22299_100054632 188
14 3300001989 JGI24739J22299_10126294 JGI24739J22299_101262941 188
15 3300001990 JGI24737J22298_10002400 JGI24737J22298_100024007 188
16 3300001990 JGI24737J22298_10003448 JGI24737J22298_100034487 188
17 3300001990 JGI24737J22298_10019311 JGI24737J22298_100193112 188
18 3300001991 JGI24743J22301_10013975 JGI24743J22301_100139751 188
19 3300001991 JGI24743J22301_10015365 JGI24743J22301_100153652 188
20 3300002067 JGI24735J21928_10003315 JGI24735J21928_100033153 188
21 3300002067 JGI24735J21928_10006419 JGI24735J21928_100064192 188
22 3300002067 JGI24735J21928_10012916 JGI24735J21928_100129162 188
23 3300002067 JGI24735J21928_10014582 JGI24735J21928_100145823 188
24 3300002067 JGI24735J21928_10014595 JGI24735J21928_100145952 188
25 3300002067 JGI24735J21928_10019585 JGI24735J21928_100195853 188
26 3300002067 JGI24735J21928_10021602 JGI24735J21928_100216022 188
27 3300002067 JGI24735J21928_10127769 JGI24735J21928_101277691 188
28 3300002075 JGI24738J21930_10001329 JGI24738J21930_100013293 188
29 3300002077 JGI24744J21845_10002153 JGI24744J21845_100021533 188
30 3300002239 JGI24034J26672_10020287 JGI24034J26672_100202872 188
31 3300003214 JGI25165J46597_1000173 JGI25165J46597_100017381 188
32 3300003322 rootL2_10006415 rootL2_100064152 188
33 3300003322 rootL2_10032995 rootL2_100329952 188
34 3300003763 Ga0055529_1010275 Ga0055529_10102751 188
35 3300005327 Ga0070658_10000774 Ga0070658_100007748 188
36 3300005327 Ga0070658_10000967 Ga0070658_1000096713 188
37 3300005327 Ga0070658_10135781 Ga0070658_101357812 188
38 3300005328 Ga0070676_10000711 Ga0070676_1000071115 188
39 3300005328 Ga0070676_10307875 Ga0070676_103078751 188
40 3300005334 Ga0068869_100001660 Ga0068869_10000166013 188
41 3300005338 Ga0068868_100001759 Ga0068868_10000175911 188
42 3300005339 Ga0070660_100000692 Ga0070660_10000069210 188
43 3300005339 Ga0070660_100013544 Ga0070660_1000135443 188
44 3300005339 Ga0070660_100091521 Ga0070660_1000915212 188
45 3300005339 Ga0070660_100355589 Ga0070660_1003555892 188
46 3300005339 Ga0070660_100947572 Ga0070660_1009475721 188
47 3300005354 Ga0070675_100004718 Ga0070675_1000047182 188
48 3300005355 Ga0070671_100016777 Ga0070671_10001677710 188
49 3300005355 Ga0070671_100194385 Ga0070671_1001943852 188
50 3300005356 Ga0070674_100006636 Ga0070674_1000066362 188
51 3300005364 Ga0070673_100000013 Ga0070673_10000001315 188
52 3300005364 Ga0070673_100505136 Ga0070673_1005051361 188
53 3300005455 Ga0070663_100026996 Ga0070663_1000269964 188
54 3300005455 Ga0070663_100311799 Ga0070663_1003117992 188
55 3300005457 Ga0070662_100018411 Ga0070662_1000184112 188
56 3300005457 Ga0070662_100088187 Ga0070662_1000881872 188
57 3300005457 Ga0070662_100783936 Ga0070662_1007839361 188
58 3300005459 Ga0068867_100000009 Ga0068867_100000009111 188
59 3300005530 Ga0070679_100474623 Ga0070679_1004746232 188
60 3300005530 Ga0070679_100750377 Ga0070679_1007503772 188
61 3300005539 Ga0068853_100020622 Ga0068853_1000206225 188
62 3300005539 Ga0068853_100487219 Ga0068853_1004872192 188
63 3300005539 Ga0068853_100622598 Ga0068853_1006225982 188
64 3300005547 Ga0070693_100178327 Ga0070693_1001783271 188
65 3300005563 Ga0068855_100000040 Ga0068855_10000004013 188
66 3300005563 Ga0068855_100200167 Ga0068855_1002001672 188
67 3300005563 Ga0068855_101383833 Ga0068855_1013838331 188
68 3300005578 Ga0068854_100004295 Ga0068854_10000429510 188
69 3300005614 Ga0068856_100112829 Ga0068856_1001128293 188
70 3300005614 Ga0068856_100452031 Ga0068856_1004520311 188
71 3300005614 Ga0068856_100503944 Ga0068856_1005039442 188
72 3300005616 Ga0068852_100001899 Ga0068852_10000189919 188
73 3300005616 Ga0068852_100217005 Ga0068852_1002170053 188
74 3300005841 Ga0068863_100855858 Ga0068863_1008558581 188
75 3300006195 Ga0075366_10064061 Ga0075366_100640613 188
76 3300006237 Ga0097621_100187887 Ga0097621_1001878873 188
77 3300006353 Ga0075370_10031389 Ga0075370_100313894 188
78 3300006358 Ga0068871_100019956 Ga0068871_1000199565 188
79 3300006881 Ga0068865_100001251 Ga0068865_1000012512 188
80 3300009098 Ga0105245_10002910 Ga0105245_1000291015 188
81 3300009148 Ga0105243_10000032 Ga0105243_1000003215 188
82 3300009176 Ga0105242_10000166 Ga0105242_1000016637 188
83 3300009545 Ga0105237_10216369 Ga0105237_102163692 188
84 3300009551 Ga0105238_10064076 Ga0105238_100640763 188
85 3300010375 Ga0105239_10021649 Ga0105239_100216496 188
86 3300011119 Ga0105246_10019315 Ga0105246_100193153 188
87 3300013100 Ga0157373_10031034 Ga0157373_100310342 188
88 3300013100 Ga0157373_10046311 Ga0157373_100463112 188
89 3300013102 Ga0157371_10463962 Ga0157371_104639622 188
90 3300013104 Ga0157370_10001083 Ga0157370_1000108310 188
91 3300013105 Ga0157369_10176214 Ga0157369_101762142 188
92 3300013105 Ga0157369_10564455 Ga0157369_105644552 188
93 3300013296 Ga0157374_10130761 Ga0157374_101307612 188
94 3300013307 Ga0157372_10045649 Ga0157372_100456496 188
95 3300013307 Ga0157372_10049005 Ga0157372_100490054 188
96 3300013307 Ga0157372_10105563 Ga0157372_101055632 188
97 3300013307 Ga0157372_10168632 Ga0157372_101686324 188
98 3300013307 Ga0157372_10326096 Ga0157372_103260962 188
99 3300013307 Ga0157372_10906662 Ga0157372_109066622 188
100 3300013308 Ga0157375_10000242 Ga0157375_1000024215 188
101 3300014325 Ga0163163_11812168 Ga0163163_118121681 188
102 3300014745 Ga0157377_10261689 Ga0157377_102616892 188
103 3300014969 Ga0157376_10000111 Ga0157376_1000011111 188
104 3300017792 Ga0163161_10279017 Ga0163161_102790172 188
105 3300025231 Ga0207427_103453 Ga0207427_1034534 188
106 3300025254 Ga0209148_1000160 Ga0209148_10001607 188
107 3300025261 Ga0209233_1000003 Ga0209233_10000031270 188
108 3300025272 Ga0209455_1002677 Ga0209455_10026777 188
109 3300025321 Ga0207656_10079865 Ga0207656_100798652 188
110 3300025903 Ga0207680_10025304 Ga0207680_100253043 188
111 3300025904 Ga0207647_10007345 Ga0207647_100073453 188
112 3300025904 Ga0207647_10036120 Ga0207647_100361202 188
113 3300025904 Ga0207647_10049354 Ga0207647_100493542 188
114 3300025907 Ga0207645_10283397 Ga0207645_102833971 188
115 3300025909 Ga0207705_10000046 Ga0207705_1000004612 188
116 3300025909 Ga0207705_10000875 Ga0207705_1000087513 188
117 3300025909 Ga0207705_10003289 Ga0207705_100032892 188
118 3300025909 Ga0207705_10232853 Ga0207705_102328532 188
119 3300025913 Ga0207695_10842540 Ga0207695_108425402 188
120 3300025914 Ga0207671_10122863 Ga0207671_101228632 188
121 3300025919 Ga0207657_10001940 Ga0207657_1000194010 188
122 3300025919 Ga0207657_10016275 Ga0207657_100162757 188
123 3300025919 Ga0207657_10020079 Ga0207657_100200798 188
124 3300025919 Ga0207657_10096187 Ga0207657_100961872 188
125 3300025919 Ga0207657_10235370 Ga0207657_102353702 188
126 3300025924 Ga0207694_10038489 Ga0207694_100384893 188
127 3300025924 Ga0207694_10065760 Ga0207694_100657603 188
128 3300025926 Ga0207659_10041598 Ga0207659_100415984 188
129 3300025931 Ga0207644_10032919 Ga0207644_100329193 188
130 3300025931 Ga0207644_10061230 Ga0207644_100612301 188
131 3300025932 Ga0207690_10185485 Ga0207690_101854852 188
132 3300025932 Ga0207690_10793085 Ga0207690_107930852 188
133 3300025933 Ga0207706_10025753 Ga0207706_100257535 188
134 3300025933 Ga0207706_10044491 Ga0207706_100444912 188
135 3300025933 Ga0207706_10106713 Ga0207706_101067132 188
136 3300025934 Ga0207686_10000250 Ga0207686_1000025029 188
137 3300025935 Ga0207709_10000051 Ga0207709_10000051225 188
138 3300025938 Ga0207704_10000001 Ga0207704_1000000115 188
139 3300025940 Ga0207691_10144387 Ga0207691_101443872 188
140 3300025942 Ga0207689_10000059 Ga0207689_1000005963 188
141 3300025949 Ga0207667_10000024 Ga0207667_1000002424 188
142 3300025949 Ga0207667_10512171 Ga0207667_105121711 188
143 3300025949 Ga0207667_10707358 Ga0207667_107073582 188
144 3300025949 Ga0207667_10981631 Ga0207667_109816311 188
145 3300025960 Ga0207651_10000006 Ga0207651_10000006224 188
146 3300025981 Ga0207640_10000031 Ga0207640_1000003113 188
147 3300025981 Ga0207640_10226405 Ga0207640_102264052 188
148 3300026023 Ga0207677_10000251 Ga0207677_1000025127 188
149 3300026041 Ga0207639_10151554 Ga0207639_101515542 188
150 3300026041 Ga0207639_10541173 Ga0207639_105411732 188
151 3300026067 Ga0207678_10003605 Ga0207678_100036054 188
152 3300026067 Ga0207678_10134110 Ga0207678_101341102 188
153 3300026078 Ga0207702_10071072 Ga0207702_100710722 188
154 3300026078 Ga0207702_10813533 Ga0207702_108135331 188
155 3300026089 Ga0207648_10000022 Ga0207648_10000022114 188
156 3300026116 Ga0207674_10998101 Ga0207674_109981011 188
157 3300026121 Ga0207683_10013946 Ga0207683_100139468 188
158 3300026142 Ga0207698_10001209 Ga0207698_1000120920 188
159 3300026142 Ga0207698_10090625 Ga0207698_100906255 188
160 3300031548 Ga0307408_100178942 Ga0307408_1001789422 188
161 3300031901 Ga0307406_10016505 Ga0307406_100165052 188
162 3300031911 Ga0307412_10396417 Ga0307412_103964172 188
163 3300031995 Ga0307409_100562968 Ga0307409_1005629682 188
164 3300032002 Ga0307416_100098450 Ga0307416_1000984502 188
165 3300032002 Ga0307416_102180961 Ga0307416_1021809611 188
166 3300032004 Ga0307414_11107083 Ga0307414_111070831 188
167 3300035691 Ga0373931_0223633 Ga0373931_0223633_476_1042 188
168 3300037312 Ga0395899_0006375 Ga0395899_0006375_2389_2955 188
169 3300037418 Ga0395900_0407677 Ga0395900_0407677_147_713 188
170 3300037466 Ga0395898_1110246 Ga0395898_1110246_111_677 188
171 3300037471 Ga0395905_0066187 Ga0395905_0066187_1173_1790 188
172 3300037471 Ga0395905_0194440 Ga0395905_0194440_1234_1800 188
173 3300038443 Ga0395901_0055006 Ga0395901_0055006_3047_3613 188
174 3300042005 Ga0439448_0005749 Ga0439448_0005749_2516_3082 188
175 3300042005 Ga0439448_0006674 Ga0439448_0006674_2438_3004 188
176 3300042008 Ga0439450_066802 Ga0439450_066802_21_587 188
177 3300042012 Ga0439455_0003470 Ga0439455_0003470_635_1201 188
178 3300042012 Ga0439455_0005390 Ga0439455_0005390_92_658 188
179 3300042157 Ga0439458_0001045 Ga0439458_0001045_2533_3099 188
180 3300044658 Ga0466972_0003425 Ga0466972_0003425_7133_7699 188
181 3300044683 Ga0466965_0006208 Ga0466965_0006208_4413_4979 188
182 3300044684 Ga0466966_0492347 Ga0466966_0492347_72_638 188
183 3300044693 Ga0466961_0005906 Ga0466961_0005906_3151_3717 188
184 3300044694 Ga0466963_0013728 Ga0466963_0013728_125_691 188
185 3300044706 Ga0466964_0005754 Ga0466964_0005754_325_891 188
186 3300044719 Ga0466971_0006997 Ga0466971_0006997_1351_1917 188
187 3300044735 Ga0466968_0223395 Ga0466968_0223395_60_626 188
188 3300044842 Ga0466957_0013431 Ga0466957_0013431_78_644 188
189 3300044842 Ga0466957_0964756 Ga0466957_0964756_16_582 188
190 3300045049 Ga0466959_0033136 Ga0466959_0033136_2039_2605 188
191 3300045836 Ga0466958_0015271 Ga0466958_0015271_538_1104 188
192 3300045836 Ga0466958_0214034 Ga0466958_0214034_75_641 188
193 3300045976 Ga0466967_0210404 Ga0466967_0210404_737_1303 188
194 3300045976 Ga0466967_0547131 Ga0466967_0547131_337_903 188
195 3300045976 Ga0466967_1386552 Ga0466967_1386552_37_618 188
196 3300046507 Ga0495606_0208160 Ga0495606_0208160_451_1017 188
197 3300046694 Ga0495649_0266924 Ga0495649_0266924_137_703 188
198 3300047323 Ga0495683_0203206 Ga0495683_0203206_206_772 188
199 3300047443 Ga0495687_092986 Ga0495687_092986_45_611 188
200 3300048908 Ga0496105_0897980 Ga0496105_0897980_33_599 188
201 3300048918 Ga0496115_0005046 Ga0496115_0005046_7063_7671 188
202 3300048920 Ga0496117_0031968 Ga0496117_0031968_1202_1813 188
203 3300048921 Ga0496118_0031114 Ga0496118_0031114_800_1411 188
204 3300048921 Ga0496118_0033311 Ga0496118_0033311_1993_2604 188
205 3300048924 Ga0496121_0206765 Ga0496121_0206765_52_663 188
206 3300048924 Ga0496121_0502104 Ga0496121_0502104_59_670 188
207 3300048925 Ga0496122_0026975 Ga0496122_0026975_2264_2875 188
208 3300048926 Ga0496123_0011709 Ga0496123_0011709_274_885 188
209 3300050493 nmdc:mga0k408_346952_c1 nmdc:mga0k408_346952_c1_131_697 188
210 3300050496 nmdc:mga07m45_21215_c1 nmdc:mga07m45_21215_c1_478_1044 188
211 3300053142 Ga0500577_0046724 Ga0500577_0046724_606_1172 188
212 3300061719 Ga0466962_0005527 Ga0466962_0005527_3055_3621 188
213 3300000043 ARcpr5yngRDRAFT_c003288 ARcpr5yngRDRAFT_0032882 189
214 3300001915 JGI24741J21665_1001659 JGI24741J21665_10016595 189
215 3300001915 JGI24741J21665_1040782 JGI24741J21665_10407821 189
216 3300001978 JGI24747J21853_1002986 JGI24747J21853_10029862 189
217 3300001979 JGI24740J21852_10002705 JGI24740J21852_100027058 189
218 3300001979 JGI24740J21852_10004469 JGI24740J21852_100044695 189
219 3300001989 JGI24739J22299_10007970 JGI24739J22299_100079705 189
220 3300001989 JGI24739J22299_10038262 JGI24739J22299_100382622 189
221 3300001990 JGI24737J22298_10000770 JGI24737J22298_100007708 189
222 3300001990 JGI24737J22298_10002874 JGI24737J22298_100028746 189
223 3300001990 JGI24737J22298_10013246 JGI24737J22298_100132462 189
224 3300002067 JGI24735J21928_10009097 JGI24735J21928_100090973 189
225 3300002067 JGI24735J21928_10009599 JGI24735J21928_100095993 189
226 3300002067 JGI24735J21928_10016361 JGI24735J21928_100163611 189
227 3300002075 JGI24738J21930_10004706 JGI24738J21930_100047064 189
228 3300002075 JGI24738J21930_10095422 JGI24738J21930_100954221 189
229 3300002076 JGI24749J21850_1002330 JGI24749J21850_10023304 189
230 3300002774 JGI25150J39212_1008610 JGI25150J39212_10086102 189
231 3300003215 JGI25153J46596_10000028 JGI25153J46596_1000002898 189
232 3300003215 JGI25153J46596_10014361 JGI25153J46596_100143612 189
233 3300003773 Ga0055537_1000888 Ga0055537_10008889 189
234 3300003775 Ga0055524_1000656 Ga0055524_100065618 189
235 3300003791 Ga0055530_10010618 Ga0055530_100106183 189
236 3300003791 Ga0055530_10012009 Ga0055530_100120094 189
237 3300003791 Ga0055530_10027289 Ga0055530_100272892 189
238 3300003792 Ga0055540_1004107 Ga0055540_10041074 189
239 3300003794 Ga0055531_10015136 Ga0055531_100151363 189
240 3300003794 Ga0055531_10032939 Ga0055531_100329392 189
241 3300005290 Ga0065712_10068360 Ga0065712_100683605 189
242 3300005290 Ga0065712_10241370 Ga0065712_102413701 189
243 3300005290 Ga0065712_10331206 Ga0065712_103312061 189
244 3300005290 Ga0065712_10430474 Ga0065712_104304741 189
245 3300005293 Ga0065715_10002750 Ga0065715_100027504 189
246 3300005293 Ga0065715_10208429 Ga0065715_102084292 189
247 3300005295 Ga0065707_10606122 Ga0065707_106061221 189
248 3300005327 Ga0070658_10000183 Ga0070658_1000018343 189
249 3300005327 Ga0070658_10003948 Ga0070658_1000394811 189
250 3300005327 Ga0070658_10013926 Ga0070658_100139262 189
251 3300005327 Ga0070658_10036947 Ga0070658_100369473 189
252 3300005327 Ga0070658_10323621 Ga0070658_103236211 189
253 3300005327 Ga0070658_10495619 Ga0070658_104956192 189
254 3300005327 Ga0070658_10797609 Ga0070658_107976091 189
255 3300005328 Ga0070676_10002711 Ga0070676_100027116 189
256 3300005328 Ga0070676_10036515 Ga0070676_100365152 189
257 3300005329 Ga0070683_100009410 Ga0070683_1000094102 189
258 3300005329 Ga0070683_100013936 Ga0070683_1000139363 189
259 3300005329 Ga0070683_100024621 Ga0070683_1000246214 189
260 3300005329 Ga0070683_100036108 Ga0070683_1000361082 189
261 3300005329 Ga0070683_100419202 Ga0070683_1004192021 189
262 3300005330 Ga0070690_100398122 Ga0070690_1003981222 189
263 3300005331 Ga0070670_100000716 Ga0070670_10000071617 189
264 3300005331 Ga0070670_100000968 Ga0070670_1000009686 189
265 3300005331 Ga0070670_100007965 Ga0070670_1000079653 189
266 3300005331 Ga0070670_100018969 Ga0070670_1000189695 189
267 3300005331 Ga0070670_100041634 Ga0070670_1000416342 189
268 3300005331 Ga0070670_100047859 Ga0070670_1000478593 189
269 3300005331 Ga0070670_100583006 Ga0070670_1005830062 189
270 3300005331 Ga0070670_100685515 Ga0070670_1006855151 189
271 3300005331 Ga0070670_101332002 Ga0070670_1013320021 189
272 3300005333 Ga0070677_10002901 Ga0070677_100029014 189
273 3300005333 Ga0070677_10015185 Ga0070677_100151854 189
274 3300005333 Ga0070677_10032066 Ga0070677_100320662 189
275 3300005333 Ga0070677_10058710 Ga0070677_100587102 189
276 3300005334 Ga0068869_100213227 Ga0068869_1002132272 189
277 3300005335 Ga0070666_10000849 Ga0070666_1000084912 189
278 3300005335 Ga0070666_10025296 Ga0070666_100252963 189
279 3300005335 Ga0070666_10029463 Ga0070666_100294632 189
280 3300005335 Ga0070666_10476800 Ga0070666_104768002 189
281 3300005336 Ga0070680_100000385 Ga0070680_1000003853 189
282 3300005336 Ga0070680_100005976 Ga0070680_1000059764 189
283 3300005336 Ga0070680_100021639 Ga0070680_1000216393 189
284 3300005336 Ga0070680_100038994 Ga0070680_1000389941 189
285 3300005336 Ga0070680_100093855 Ga0070680_1000938552 189
286 3300005336 Ga0070680_100158342 Ga0070680_1001583422 189
287 3300005336 Ga0070680_100269885 Ga0070680_1002698851 189
288 3300005336 Ga0070680_100602965 Ga0070680_1006029652 189
289 3300005337 Ga0070682_100008091 Ga0070682_1000080913 189
290 3300005338 Ga0068868_100010535 Ga0068868_1000105355 189
291 3300005338 Ga0068868_100031093 Ga0068868_1000310933 189
292 3300005338 Ga0068868_100701948 Ga0068868_1007019481 189
293 3300005339 Ga0070660_100000536 Ga0070660_10000053623 189
294 3300005339 Ga0070660_100022506 Ga0070660_1000225063 189
295 3300005339 Ga0070660_100036128 Ga0070660_1000361282 189
296 3300005339 Ga0070660_100056487 Ga0070660_1000564873 189
297 3300005339 Ga0070660_100065030 Ga0070660_1000650302 189
298 3300005339 Ga0070660_100071313 Ga0070660_1000713132 189
299 3300005339 Ga0070660_100110598 Ga0070660_1001105982 189
300 3300005339 Ga0070660_100115645 Ga0070660_1001156452 189
301 3300005339 Ga0070660_100241202 Ga0070660_1002412022 189
302 3300005339 Ga0070660_100245551 Ga0070660_1002455512 189
303 3300005339 Ga0070660_100334922 Ga0070660_1003349222 189
304 3300005339 Ga0070660_100409199 Ga0070660_1004091991 189
305 3300005339 Ga0070660_100490219 Ga0070660_1004902191 189
306 3300005341 Ga0070691_10005850 Ga0070691_100058504 189
307 3300005343 Ga0070687_100050942 Ga0070687_1000509422 189
308 3300005343 Ga0070687_100132264 Ga0070687_1001322642 189
309 3300005344 Ga0070661_100000682 Ga0070661_10000068210 189
310 3300005344 Ga0070661_100004481 Ga0070661_1000044818 189
311 3300005344 Ga0070661_100011672 Ga0070661_1000116723 189
312 3300005344 Ga0070661_100018506 Ga0070661_1000185064 189
313 3300005344 Ga0070661_100023317 Ga0070661_1000233172 189
314 3300005344 Ga0070661_100031251 Ga0070661_1000312512 189
315 3300005344 Ga0070661_100035425 Ga0070661_1000354252 189
316 3300005344 Ga0070661_100071006 Ga0070661_1000710062 189
317 3300005344 Ga0070661_100086292 Ga0070661_1000862923 189
318 3300005344 Ga0070661_100125863 Ga0070661_1001258632 189
319 3300005344 Ga0070661_100134928 Ga0070661_1001349282 189
320 3300005344 Ga0070661_100341724 Ga0070661_1003417241 189
321 3300005344 Ga0070661_100625944 Ga0070661_1006259441 189
322 3300005345 Ga0070692_10002543 Ga0070692_100025433 189
323 3300005345 Ga0070692_10055556 Ga0070692_100555563 189
324 3300005345 Ga0070692_10069554 Ga0070692_100695542 189
325 3300005345 Ga0070692_10103580 Ga0070692_101035802 189
326 3300005345 Ga0070692_10171488 Ga0070692_101714882 189
327 3300005345 Ga0070692_10608348 Ga0070692_106083482 189
328 3300005347 Ga0070668_100001032 Ga0070668_10000103210 189
329 3300005347 Ga0070668_100026256 Ga0070668_1000262562 189
330 3300005347 Ga0070668_100042128 Ga0070668_1000421282 189
331 3300005347 Ga0070668_100045957 Ga0070668_1000459573 189
332 3300005347 Ga0070668_100107975 Ga0070668_1001079752 189
333 3300005347 Ga0070668_100332947 Ga0070668_1003329472 189
334 3300005347 Ga0070668_100982910 Ga0070668_1009829101 189
335 3300005347 Ga0070668_101420593 Ga0070668_1014205931 189
336 3300005353 Ga0070669_100048848 Ga0070669_1000488482 189
337 3300005353 Ga0070669_100120388 Ga0070669_1001203882 189
338 3300005353 Ga0070669_100275436 Ga0070669_1002754362 189
339 3300005354 Ga0070675_100000229 Ga0070675_10000022917 189
340 3300005354 Ga0070675_100000245 Ga0070675_10000024529 189
341 3300005354 Ga0070675_100035763 Ga0070675_1000357632 189
342 3300005355 Ga0070671_100000407 Ga0070671_10000040716 189
343 3300005355 Ga0070671_100002662 Ga0070671_1000026622 189
344 3300005355 Ga0070671_100010693 Ga0070671_1000106936 189
345 3300005355 Ga0070671_100017120 Ga0070671_1000171202 189
346 3300005355 Ga0070671_100025494 Ga0070671_1000254942 189
347 3300005355 Ga0070671_100064434 Ga0070671_1000644343 189
348 3300005355 Ga0070671_100066831 Ga0070671_1000668312 189
349 3300005355 Ga0070671_100069989 Ga0070671_1000699892 189
350 3300005355 Ga0070671_100100056 Ga0070671_1001000562 189
351 3300005355 Ga0070671_100219842 Ga0070671_1002198421 189
352 3300005355 Ga0070671_100227748 Ga0070671_1002277482 189
353 3300005355 Ga0070671_100236246 Ga0070671_1002362462 189
354 3300005355 Ga0070671_100273270 Ga0070671_1002732701 189
355 3300005355 Ga0070671_100561234 Ga0070671_1005612342 189
356 3300005355 Ga0070671_100963714 Ga0070671_1009637141 189
357 3300005356 Ga0070674_100002839 Ga0070674_1000028392 189
358 3300005356 Ga0070674_100003998 Ga0070674_1000039983 189
359 3300005356 Ga0070674_100071806 Ga0070674_1000718062 189
360 3300005356 Ga0070674_100076288 Ga0070674_1000762883 189
361 3300005356 Ga0070674_100259067 Ga0070674_1002590672 189
362 3300005356 Ga0070674_100286189 Ga0070674_1002861892 189
363 3300005364 Ga0070673_100030052 Ga0070673_1000300524 189
364 3300005364 Ga0070673_100033990 Ga0070673_1000339902 189
365 3300005364 Ga0070673_100115526 Ga0070673_1001155262 189
366 3300005364 Ga0070673_100134501 Ga0070673_1001345012 189
367 3300005364 Ga0070673_100247681 Ga0070673_1002476812 189
368 3300005364 Ga0070673_100435440 Ga0070673_1004354402 189
369 3300005364 Ga0070673_100537286 Ga0070673_1005372862 189
370 3300005364 Ga0070673_100697977 Ga0070673_1006979772 189
371 3300005364 Ga0070673_100711826 Ga0070673_1007118262 189
372 3300005364 Ga0070673_100733533 Ga0070673_1007335332 189
373 3300005366 Ga0070659_100000683 Ga0070659_1000006832 189
374 3300005366 Ga0070659_100027322 Ga0070659_1000273224 189
375 3300005366 Ga0070659_100035680 Ga0070659_1000356805 189
376 3300005366 Ga0070659_100051806 Ga0070659_1000518063 189
377 3300005366 Ga0070659_100083672 Ga0070659_1000836722 189
378 3300005366 Ga0070659_100160221 Ga0070659_1001602212 189
379 3300005366 Ga0070659_100332046 Ga0070659_1003320461 189
380 3300005366 Ga0070659_100365114 Ga0070659_1003651142 189
381 3300005366 Ga0070659_100530505 Ga0070659_1005305052 189
382 3300005366 Ga0070659_100966510 Ga0070659_1009665101 189
383 3300005367 Ga0070667_100000016 Ga0070667_10000001649 189
384 3300005367 Ga0070667_100003558 Ga0070667_1000035586 189
385 3300005367 Ga0070667_100005475 Ga0070667_1000054752 189
386 3300005367 Ga0070667_100005510 Ga0070667_1000055107 189
387 3300005367 Ga0070667_100006422 Ga0070667_10000642210 189
388 3300005367 Ga0070667_100012781 Ga0070667_1000127816 189
389 3300005367 Ga0070667_100021279 Ga0070667_1000212795 189
390 3300005367 Ga0070667_100035304 Ga0070667_1000353045 189
391 3300005367 Ga0070667_100036361 Ga0070667_1000363613 189
392 3300005367 Ga0070667_100092392 Ga0070667_1000923923 189
393 3300005367 Ga0070667_100092405 Ga0070667_1000924054 189
394 3300005367 Ga0070667_100099952 Ga0070667_1000999522 189
395 3300005367 Ga0070667_100146907 Ga0070667_1001469072 189
396 3300005367 Ga0070667_100167583 Ga0070667_1001675831 189
397 3300005367 Ga0070667_100214936 Ga0070667_1002149362 189
398 3300005367 Ga0070667_100255572 Ga0070667_1002555723 189
399 3300005367 Ga0070667_100817040 Ga0070667_1008170401 189
400 3300005434 Ga0070709_10027245 Ga0070709_100272451 189
401 3300005434 Ga0070709_10037839 Ga0070709_100378391 189
402 3300005434 Ga0070709_10061510 Ga0070709_100615102 189
403 3300005435 Ga0070714_100013844 Ga0070714_1000138442 189
404 3300005435 Ga0070714_100017921 Ga0070714_1000179212 189
405 3300005435 Ga0070714_100059247 Ga0070714_1000592472 189
406 3300005435 Ga0070714_100115651 Ga0070714_1001156512 189
407 3300005435 Ga0070714_100354751 Ga0070714_1003547512 189
408 3300005436 Ga0070713_100032306 Ga0070713_1000323063 189
409 3300005436 Ga0070713_100046967 Ga0070713_1000469672 189
410 3300005436 Ga0070713_100249655 Ga0070713_1002496552 189
411 3300005436 Ga0070713_100280346 Ga0070713_1002803461 189
412 3300005436 Ga0070713_100457739 Ga0070713_1004577392 189
413 3300005437 Ga0070710_10002630 Ga0070710_1000263010 189
414 3300005437 Ga0070710_10414725 Ga0070710_104147252 189
415 3300005439 Ga0070711_100101618 Ga0070711_1001016182 189
416 3300005441 Ga0070700_100036553 Ga0070700_1000365532 189
417 3300005445 Ga0070708_100202369 Ga0070708_1002023693 189
418 3300005455 Ga0070663_100002889 Ga0070663_1000028893 189
419 3300005455 Ga0070663_100003431 Ga0070663_1000034318 189
420 3300005455 Ga0070663_100010382 Ga0070663_1000103822 189
421 3300005455 Ga0070663_100020955 Ga0070663_1000209553 189
422 3300005455 Ga0070663_100054289 Ga0070663_1000542892 189
423 3300005455 Ga0070663_100057221 Ga0070663_1000572212 189
424 3300005455 Ga0070663_100060586 Ga0070663_1000605862 189
425 3300005455 Ga0070663_100067013 Ga0070663_1000670132 189
426 3300005455 Ga0070663_100106713 Ga0070663_1001067132 189
427 3300005455 Ga0070663_100125694 Ga0070663_1001256943 189
428 3300005455 Ga0070663_100528783 Ga0070663_1005287832 189
429 3300005455 Ga0070663_100586431 Ga0070663_1005864312 189
430 3300005456 Ga0070678_100001779 Ga0070678_10000177910 189
431 3300005456 Ga0070678_100003165 Ga0070678_1000031658 189
432 3300005456 Ga0070678_100024305 Ga0070678_1000243051 189
433 3300005456 Ga0070678_100061906 Ga0070678_1000619063 189
434 3300005456 Ga0070678_100089819 Ga0070678_1000898193 189
435 3300005456 Ga0070678_100345086 Ga0070678_1003450862 189
436 3300005457 Ga0070662_100001032 Ga0070662_1000010322 189
437 3300005457 Ga0070662_100001340 Ga0070662_1000013408 189
438 3300005457 Ga0070662_100002309 Ga0070662_1000023094 189
439 3300005457 Ga0070662_100002550 Ga0070662_10000255010 189
440 3300005457 Ga0070662_100015381 Ga0070662_1000153816 189
441 3300005457 Ga0070662_100031773 Ga0070662_1000317732 189
442 3300005457 Ga0070662_100084537 Ga0070662_1000845371 189
443 3300005457 Ga0070662_100221265 Ga0070662_1002212652 189
444 3300005457 Ga0070662_100258741 Ga0070662_1002587412 189
445 3300005457 Ga0070662_100725694 Ga0070662_1007256941 189
446 3300005457 Ga0070662_100938116 Ga0070662_1009381161 189
447 3300005458 Ga0070681_10042114 Ga0070681_100421142 189
448 3300005458 Ga0070681_10050076 Ga0070681_100500763 189
449 3300005458 Ga0070681_10176284 Ga0070681_101762842 189
450 3300005458 Ga0070681_10245937 Ga0070681_102459372 189
451 3300005458 Ga0070681_10394153 Ga0070681_103941532 189
452 3300005458 Ga0070681_10413469 Ga0070681_104134692 189
453 3300005459 Ga0068867_100002596 Ga0068867_10000259611 189
454 3300005459 Ga0068867_100011890 Ga0068867_1000118905 189
455 3300005459 Ga0068867_100029067 Ga0068867_1000290672 189
456 3300005468 Ga0070707_100115765 Ga0070707_1001157651 189
457 3300005471 Ga0070698_100002776 Ga0070698_1000027764 189
458 3300005471 Ga0070698_100163676 Ga0070698_1001636762 189
459 3300005471 Ga0070698_100757718 Ga0070698_1007577182 189
460 3300005518 Ga0070699_100443062 Ga0070699_1004430621 189
461 3300005530 Ga0070679_100015604 Ga0070679_1000156043 189
462 3300005530 Ga0070679_100062481 Ga0070679_1000624812 189
463 3300005530 Ga0070679_100078716 Ga0070679_1000787162 189
464 3300005530 Ga0070679_100160360 Ga0070679_1001603602 189
465 3300005530 Ga0070679_100192949 Ga0070679_1001929492 189
466 3300005530 Ga0070679_100268766 Ga0070679_1002687662 189
467 3300005530 Ga0070679_100558051 Ga0070679_1005580512 189
468 3300005530 Ga0070679_100575586 Ga0070679_1005755862 189
469 3300005530 Ga0070679_100872075 Ga0070679_1008720751 189
470 3300005530 Ga0070679_101008731 Ga0070679_1010087312 189
471 3300005535 Ga0070684_100001781 Ga0070684_1000017812 189
472 3300005535 Ga0070684_100064441 Ga0070684_1000644412 189
473 3300005535 Ga0070684_100073894 Ga0070684_1000738943 189
474 3300005535 Ga0070684_100253809 Ga0070684_1002538092 189
475 3300005535 Ga0070684_100717243 Ga0070684_1007172432 189
476 3300005535 Ga0070684_100721904 Ga0070684_1007219042 189
477 3300005539 Ga0068853_100007843 Ga0068853_1000078438 189
478 3300005539 Ga0068853_100031692 Ga0068853_1000316923 189
479 3300005539 Ga0068853_100036855 Ga0068853_1000368554 189
480 3300005539 Ga0068853_100049338 Ga0068853_1000493384 189
481 3300005539 Ga0068853_100067678 Ga0068853_1000676782 189
482 3300005539 Ga0068853_100169378 Ga0068853_1001693782 189
483 3300005539 Ga0068853_100279131 Ga0068853_1002791312 189
484 3300005539 Ga0068853_100406751 Ga0068853_1004067512 189
485 3300005539 Ga0068853_100696796 Ga0068853_1006967962 189
486 3300005543 Ga0070672_100003890 Ga0070672_1000038902 189
487 3300005543 Ga0070672_100041996 Ga0070672_1000419963 189
488 3300005543 Ga0070672_100062289 Ga0070672_1000622892 189
489 3300005543 Ga0070672_100063546 Ga0070672_1000635464 189
490 3300005543 Ga0070672_100069994 Ga0070672_1000699941 189
491 3300005543 Ga0070672_100174392 Ga0070672_1001743922 189
492 3300005543 Ga0070672_100365105 Ga0070672_1003651052 189
493 3300005544 Ga0070686_100224933 Ga0070686_1002249332 189
494 3300005545 Ga0070695_100238134 Ga0070695_1002381341 189
495 3300005546 Ga0070696_100231254 Ga0070696_1002312542 189
496 3300005547 Ga0070693_100001146 Ga0070693_1000011468 189
497 3300005547 Ga0070693_100066081 Ga0070693_1000660812 189
498 3300005547 Ga0070693_100099272 Ga0070693_1000992722 189
499 3300005547 Ga0070693_100256687 Ga0070693_1002566872 189
500 3300005548 Ga0070665_100003564 Ga0070665_10000356413 189
501 3300005548 Ga0070665_100017144 Ga0070665_1000171443 189
502 3300005548 Ga0070665_100023457 Ga0070665_1000234576 189
503 3300005548 Ga0070665_100025738 Ga0070665_1000257384 189
504 3300005548 Ga0070665_100029212 Ga0070665_1000292126 189
505 3300005548 Ga0070665_100148204 Ga0070665_1001482042 189
506 3300005548 Ga0070665_100481396 Ga0070665_1004813962 189
507 3300005548 Ga0070665_101008973 Ga0070665_1010089732 189
508 3300005548 Ga0070665_101193253 Ga0070665_1011932531 189
509 3300005563 Ga0068855_100004727 Ga0068855_10000472710 189
510 3300005563 Ga0068855_100013283 Ga0068855_1000132833 189
511 3300005563 Ga0068855_100033034 Ga0068855_1000330345 189
512 3300005563 Ga0068855_100033251 Ga0068855_1000332513 189
513 3300005563 Ga0068855_100136587 Ga0068855_1001365872 189
514 3300005563 Ga0068855_100234573 Ga0068855_1002345732 189
515 3300005563 Ga0068855_100255065 Ga0068855_1002550652 189
516 3300005563 Ga0068855_100422656 Ga0068855_1004226562 189
517 3300005563 Ga0068855_100544742 Ga0068855_1005447421 189
518 3300005563 Ga0068855_100688596 Ga0068855_1006885962 189
519 3300005563 Ga0068855_100781498 Ga0068855_1007814982 189
520 3300005564 Ga0070664_100000247 Ga0070664_10000024732 189
521 3300005564 Ga0070664_100001349 Ga0070664_1000013499 189
522 3300005564 Ga0070664_100002842 Ga0070664_10000284211 189
523 3300005564 Ga0070664_100009084 Ga0070664_1000090845 189
524 3300005564 Ga0070664_100010096 Ga0070664_1000100966 189
525 3300005564 Ga0070664_100011650 Ga0070664_1000116505 189
526 3300005564 Ga0070664_100012567 Ga0070664_1000125676 189
527 3300005564 Ga0070664_100012690 Ga0070664_1000126907 189
528 3300005564 Ga0070664_100024820 Ga0070664_1000248206 189
529 3300005564 Ga0070664_100038751 Ga0070664_1000387512 189
530 3300005564 Ga0070664_100039188 Ga0070664_1000391885 189
531 3300005564 Ga0070664_100065825 Ga0070664_1000658251 189
532 3300005564 Ga0070664_100240859 Ga0070664_1002408592 189
533 3300005564 Ga0070664_100276072 Ga0070664_1002760722 189
534 3300005564 Ga0070664_100302862 Ga0070664_1003028622 189
535 3300005577 Ga0068857_100004827 Ga0068857_1000048275 189
536 3300005577 Ga0068857_100028808 Ga0068857_1000288084 189
537 3300005577 Ga0068857_100093641 Ga0068857_1000936414 189
538 3300005577 Ga0068857_100114801 Ga0068857_1001148012 189
539 3300005577 Ga0068857_100245843 Ga0068857_1002458431 189
540 3300005577 Ga0068857_100301801 Ga0068857_1003018012 189
541 3300005577 Ga0068857_100484889 Ga0068857_1004848892 189
542 3300005577 Ga0068857_100932098 Ga0068857_1009320982 189
543 3300005578 Ga0068854_100005287 Ga0068854_1000052876 189
544 3300005578 Ga0068854_100008596 Ga0068854_1000085963 189
545 3300005578 Ga0068854_100011168 Ga0068854_1000111684 189
546 3300005578 Ga0068854_100015912 Ga0068854_1000159124 189
547 3300005578 Ga0068854_100041198 Ga0068854_1000411983 189
548 3300005578 Ga0068854_100067194 Ga0068854_1000671942 189
549 3300005578 Ga0068854_100077547 Ga0068854_1000775473 189
550 3300005578 Ga0068854_100534538 Ga0068854_1005345382 189
551 3300005578 Ga0068854_100577923 Ga0068854_1005779231 189
552 3300005614 Ga0068856_100000213 Ga0068856_10000021343 189
553 3300005614 Ga0068856_100036691 Ga0068856_1000366912 189
554 3300005614 Ga0068856_100051792 Ga0068856_1000517923 189
555 3300005614 Ga0068856_100072241 Ga0068856_1000722412 189
556 3300005614 Ga0068856_100245553 Ga0068856_1002455532 189
557 3300005614 Ga0068856_100276924 Ga0068856_1002769242 189
558 3300005614 Ga0068856_100327059 Ga0068856_1003270592 189
559 3300005614 Ga0068856_100342318 Ga0068856_1003423182 189
560 3300005615 Ga0070702_100291567 Ga0070702_1002915672 189
561 3300005616 Ga0068852_100001218 Ga0068852_1000012182 189
562 3300005616 Ga0068852_100002661 Ga0068852_10000266111 189
563 3300005616 Ga0068852_100003585 Ga0068852_1000035858 189
564 3300005616 Ga0068852_100006724 Ga0068852_1000067246 189
565 3300005616 Ga0068852_100023778 Ga0068852_1000237782 189
566 3300005616 Ga0068852_100041821 Ga0068852_1000418214 189
567 3300005616 Ga0068852_100079368 Ga0068852_1000793683 189
568 3300005616 Ga0068852_100112812 Ga0068852_1001128123 189
569 3300005616 Ga0068852_100132036 Ga0068852_1001320362 189
570 3300005616 Ga0068852_100178483 Ga0068852_1001784832 189
571 3300005616 Ga0068852_100223148 Ga0068852_1002231482 189
572 3300005616 Ga0068852_100269579 Ga0068852_1002695792 189
573 3300005616 Ga0068852_100418991 Ga0068852_1004189912 189
574 3300005616 Ga0068852_100480502 Ga0068852_1004805022 189
575 3300005617 Ga0068859_100002199 Ga0068859_10000219924 189
576 3300005617 Ga0068859_100025518 Ga0068859_1000255182 189
577 3300005617 Ga0068859_100026116 Ga0068859_1000261162 189
578 3300005617 Ga0068859_100026638 Ga0068859_1000266384 189
579 3300005617 Ga0068859_100094906 Ga0068859_1000949062 189
580 3300005617 Ga0068859_100278717 Ga0068859_1002787172 189
581 3300005617 Ga0068859_101276808 Ga0068859_1012768082 189
582 3300005618 Ga0068864_100000287 Ga0068864_10000028731 189
583 3300005618 Ga0068864_100000901 Ga0068864_1000009019 189
584 3300005618 Ga0068864_100026990 Ga0068864_1000269902 189
585 3300005618 Ga0068864_100037478 Ga0068864_1000374781 189
586 3300005618 Ga0068864_100039736 Ga0068864_1000397364 189
587 3300005618 Ga0068864_100042247 Ga0068864_1000422471 189
588 3300005618 Ga0068864_100053069 Ga0068864_1000530692 189
589 3300005618 Ga0068864_100093737 Ga0068864_1000937372 189
590 3300005618 Ga0068864_100136984 Ga0068864_1001369841 189
591 3300005618 Ga0068864_100287410 Ga0068864_1002874102 189
592 3300005618 Ga0068864_100335393 Ga0068864_1003353932 189
593 3300005618 Ga0068864_101097047 Ga0068864_1010970471 189
594 3300005719 Ga0068861_100005527 Ga0068861_1000055276 189
595 3300005719 Ga0068861_100028462 Ga0068861_1000284623 189
596 3300005719 Ga0068861_100381294 Ga0068861_1003812942 189
597 3300005834 Ga0068851_10002865 Ga0068851_100028656 189
598 3300005834 Ga0068851_10102504 Ga0068851_101025042 189
599 3300005834 Ga0068851_10187786 Ga0068851_101877862 189
600 3300005834 Ga0068851_10193756 Ga0068851_101937562 189
601 3300005834 Ga0068851_10332904 Ga0068851_103329042 189
602 3300005834 Ga0068851_10344346 Ga0068851_103443462 189
603 3300005840 Ga0068870_10109624 Ga0068870_101096241 189
604 3300005840 Ga0068870_10705261 Ga0068870_107052611 189
605 3300005841 Ga0068863_100000116 Ga0068863_10000011641 189
606 3300005841 Ga0068863_100002674 Ga0068863_1000026742 189
607 3300005841 Ga0068863_100014396 Ga0068863_1000143965 189
608 3300005841 Ga0068863_100026576 Ga0068863_1000265762 189
609 3300005841 Ga0068863_100045217 Ga0068863_1000452175 189
610 3300005841 Ga0068863_100076737 Ga0068863_1000767372 189
611 3300005841 Ga0068863_100081192 Ga0068863_1000811923 189
612 3300005841 Ga0068863_100140721 Ga0068863_1001407213 189
613 3300005842 Ga0068858_100001510 Ga0068858_1000015108 189
614 3300005842 Ga0068858_100034185 Ga0068858_1000341855 189
615 3300005842 Ga0068858_100055495 Ga0068858_1000554953 189
616 3300005842 Ga0068858_100115813 Ga0068858_1001158132 189
617 3300005842 Ga0068858_100124042 Ga0068858_1001240422 189
618 3300005842 Ga0068858_100154341 Ga0068858_1001543412 189
619 3300005842 Ga0068858_100229060 Ga0068858_1002290602 189
620 3300005842 Ga0068858_100367898 Ga0068858_1003678982 189
621 3300005842 Ga0068858_100430960 Ga0068858_1004309602 189
622 3300005843 Ga0068860_100000192 Ga0068860_10000019282 189
623 3300005843 Ga0068860_100000361 Ga0068860_10000036149 189
624 3300005843 Ga0068860_100002208 Ga0068860_1000022083 189
625 3300005843 Ga0068860_100038196 Ga0068860_1000381966 189
626 3300005843 Ga0068860_100090168 Ga0068860_1000901682 189
627 3300005843 Ga0068860_100273262 Ga0068860_1002732621 189
628 3300005843 Ga0068860_100574396 Ga0068860_1005743962 189
629 3300005843 Ga0068860_100707965 Ga0068860_1007079651 189
630 3300005844 Ga0068862_100001874 Ga0068862_1000018749 189
631 3300005844 Ga0068862_100032827 Ga0068862_1000328272 189
632 3300005844 Ga0068862_100175792 Ga0068862_1001757921 189
633 3300005844 Ga0068862_100325247 Ga0068862_1003252472 189
634 3300005844 Ga0068862_100758696 Ga0068862_1007586961 189
635 3300005844 Ga0068862_100765025 Ga0068862_1007650252 189
636 3300005937 Ga0081455_10417199 Ga0081455_104171992 189
637 3300005983 Ga0081540_1005349 Ga0081540_10053497 189
638 3300005985 Ga0081539_10011568 Ga0081539_100115684 189
639 3300005985 Ga0081539_10109299 Ga0081539_101092991 189
640 3300006028 Ga0070717_10000240 Ga0070717_100002407 189
641 3300006028 Ga0070717_10023468 Ga0070717_100234683 189
642 3300006028 Ga0070717_10126828 Ga0070717_101268282 189
643 3300006173 Ga0070716_100013250 Ga0070716_1000132503 189
644 3300006173 Ga0070716_100184426 Ga0070716_1001844262 189
645 3300006175 Ga0070712_100011282 Ga0070712_1000112824 189
646 3300006175 Ga0070712_100021257 Ga0070712_1000212573 189
647 3300006175 Ga0070712_100022155 Ga0070712_1000221552 189
648 3300006175 Ga0070712_100087135 Ga0070712_1000871352 189
649 3300006175 Ga0070712_100948395 Ga0070712_1009483952 189
650 3300006237 Ga0097621_100037355 Ga0097621_1000373553 189
651 3300006237 Ga0097621_100055585 Ga0097621_1000555851 189
652 3300006237 Ga0097621_100124103 Ga0097621_1001241033 189
653 3300006237 Ga0097621_100154435 Ga0097621_1001544353 189
654 3300006237 Ga0097621_100228280 Ga0097621_1002282802 189
655 3300006237 Ga0097621_101263686 Ga0097621_1012636861 189
656 3300006358 Ga0068871_100033132 Ga0068871_1000331324 189
657 3300006358 Ga0068871_100034208 Ga0068871_1000342082 189
658 3300006358 Ga0068871_100055299 Ga0068871_1000552994 189
659 3300006358 Ga0068871_100237621 Ga0068871_1002376211 189
660 3300006358 Ga0068871_100524105 Ga0068871_1005241051 189
661 3300006358 Ga0068871_100526070 Ga0068871_1005260702 189
662 3300006358 Ga0068871_100609412 Ga0068871_1006094121 189
663 3300006847 Ga0075431_100038488 Ga0075431_1000384884 189
664 3300006881 Ga0068865_100021693 Ga0068865_1000216933 189
665 3300006881 Ga0068865_100076819 Ga0068865_1000768193 189
666 3300006931 Ga0097620_100002199 Ga0097620_1000021993 189
667 3300006931 Ga0097620_100025518 Ga0097620_1000255182 189
668 3300006931 Ga0097620_100026116 Ga0097620_1000261162 189
669 3300006931 Ga0097620_100026637 Ga0097620_1000266374 189
670 3300006931 Ga0097620_100094903 Ga0097620_1000949032 189
671 3300006931 Ga0097620_100278716 Ga0097620_1002787162 189
672 3300006931 Ga0097620_101277361 Ga0097620_1012773611 189
673 3300007788 Ga0099795_10087037 Ga0099795_100870372 189
674 3300007788 Ga0099795_10270610 Ga0099795_102706102 189
675 3300009011 Ga0105251_10034715 Ga0105251_100347152 189
676 3300009093 Ga0105240_10017486 Ga0105240_100174866 189
677 3300009093 Ga0105240_10019972 Ga0105240_100199722 189
678 3300009093 Ga0105240_10070485 Ga0105240_100704853 189
679 3300009093 Ga0105240_10666109 Ga0105240_106661092 189
680 3300009094 Ga0111539_10092291 Ga0111539_100922914 189
681 3300009094 Ga0111539_10756359 Ga0111539_107563592 189
682 3300009098 Ga0105245_10094564 Ga0105245_100945642 189
683 3300009098 Ga0105245_10287679 Ga0105245_102876792 189
684 3300009101 Ga0105247_10114224 Ga0105247_101142242 189
685 3300009101 Ga0105247_10168599 Ga0105247_101685992 189
686 3300009174 Ga0105241_10035069 Ga0105241_100350694 189
687 3300009174 Ga0105241_10055386 Ga0105241_100553862 189
688 3300009176 Ga0105242_10395908 Ga0105242_103959082 189
689 3300009177 Ga0105248_10001704 Ga0105248_1000170422 189
690 3300009177 Ga0105248_10003197 Ga0105248_100031972 189
691 3300009177 Ga0105248_10015961 Ga0105248_100159614 189
692 3300009177 Ga0105248_10028113 Ga0105248_100281133 189
693 3300009177 Ga0105248_10028918 Ga0105248_100289183 189
694 3300009177 Ga0105248_10031829 Ga0105248_100318292 189
695 3300009177 Ga0105248_10056805 Ga0105248_100568055 189
696 3300009177 Ga0105248_10119410 Ga0105248_101194104 189
697 3300009177 Ga0105248_10140409 Ga0105248_101404092 189
698 3300009177 Ga0105248_10141637 Ga0105248_101416373 189
699 3300009177 Ga0105248_10152178 Ga0105248_101521782 189
700 3300009177 Ga0105248_10156577 Ga0105248_101565772 189
701 3300009177 Ga0105248_10243737 Ga0105248_102437372 189
702 3300009177 Ga0105248_10271955 Ga0105248_102719552 189
703 3300009177 Ga0105248_10439121 Ga0105248_104391212 189
704 3300009177 Ga0105248_10529776 Ga0105248_105297762 189
705 3300009177 Ga0105248_10743979 Ga0105248_107439792 189
706 3300009177 Ga0105248_11881106 Ga0105248_118811061 189
707 3300009545 Ga0105237_10008286 Ga0105237_100082867 189
708 3300009545 Ga0105237_10009240 Ga0105237_100092407 189
709 3300009545 Ga0105237_10113509 Ga0105237_101135092 189
710 3300009545 Ga0105237_10814795 Ga0105237_108147952 189
711 3300009551 Ga0105238_10030456 Ga0105238_100304562 189
712 3300009551 Ga0105238_10050979 Ga0105238_100509793 189
713 3300009551 Ga0105238_10075225 Ga0105238_100752251 189
714 3300009551 Ga0105238_10221692 Ga0105238_102216922 189
715 3300009551 Ga0105238_10293566 Ga0105238_102935661 189
716 3300009553 Ga0105249_10037814 Ga0105249_100378142 189
717 3300009553 Ga0105249_10038017 Ga0105249_100380172 189
718 3300009553 Ga0105249_10077081 Ga0105249_100770812 189
719 3300009553 Ga0105249_10145242 Ga0105249_101452422 189
720 3300009553 Ga0105249_10580957 Ga0105249_105809572 189
721 3300010159 Ga0099796_10001572 Ga0099796_100015724 189
722 3300010375 Ga0105239_10843823 Ga0105239_108438232 189
723 3300011119 Ga0105246_10139223 Ga0105246_101392232 189
724 3300011119 Ga0105246_10192927 Ga0105246_101929272 189
725 3300011119 Ga0105246_10299790 Ga0105246_102997901 189
726 3300012512 Ga0157327_1000746 Ga0157327_10007463 189
727 3300013100 Ga0157373_10011869 Ga0157373_100118693 189
728 3300013100 Ga0157373_10013077 Ga0157373_100130772 189
729 3300013100 Ga0157373_10031958 Ga0157373_100319582 189
730 3300013100 Ga0157373_10038390 Ga0157373_100383903 189
731 3300013100 Ga0157373_10059340 Ga0157373_100593403 189
732 3300013100 Ga0157373_10085625 Ga0157373_100856252 189
733 3300013100 Ga0157373_10147084 Ga0157373_101470842 189
734 3300013100 Ga0157373_10150017 Ga0157373_101500171 189
735 3300013100 Ga0157373_10246134 Ga0157373_102461341 189
736 3300013100 Ga0157373_10499679 Ga0157373_104996792 189
737 3300013100 Ga0157373_10621537 Ga0157373_106215372 189
738 3300013102 Ga0157371_10005349 Ga0157371_100053498 189
739 3300013102 Ga0157371_10029159 Ga0157371_100291593 189
740 3300013102 Ga0157371_10034479 Ga0157371_100344793 189
741 3300013102 Ga0157371_10039907 Ga0157371_100399074 189
742 3300013102 Ga0157371_10057552 Ga0157371_100575523 189
743 3300013102 Ga0157371_10061900 Ga0157371_100619002 189
744 3300013102 Ga0157371_10064540 Ga0157371_100645403 189
745 3300013102 Ga0157371_10121309 Ga0157371_101213093 189
746 3300013102 Ga0157371_10471384 Ga0157371_104713842 189
747 3300013104 Ga0157370_10000244 Ga0157370_100002446 189
748 3300013104 Ga0157370_10011398 Ga0157370_100113986 189
749 3300013104 Ga0157370_10030415 Ga0157370_100304154 189
750 3300013104 Ga0157370_10041713 Ga0157370_100417133 189
751 3300013104 Ga0157370_10043463 Ga0157370_100434633 189
752 3300013104 Ga0157370_10191834 Ga0157370_101918342 189
753 3300013104 Ga0157370_10275766 Ga0157370_102757662 189
754 3300013104 Ga0157370_10284189 Ga0157370_102841892 189
755 3300013104 Ga0157370_10358355 Ga0157370_103583552 189
756 3300013104 Ga0157370_10452931 Ga0157370_104529312 189
757 3300013104 Ga0157370_10762566 Ga0157370_107625661 189
758 3300013105 Ga0157369_10001746 Ga0157369_100017463 189
759 3300013105 Ga0157369_10044629 Ga0157369_100446295 189
760 3300013105 Ga0157369_10117020 Ga0157369_101170202 189
761 3300013105 Ga0157369_10143786 Ga0157369_101437863 189
762 3300013105 Ga0157369_10189290 Ga0157369_101892902 189
763 3300013105 Ga0157369_10324532 Ga0157369_103245322 189
764 3300013105 Ga0157369_10432262 Ga0157369_104322622 189
765 3300013105 Ga0157369_10768989 Ga0157369_107689891 189
766 3300013105 Ga0157369_10832431 Ga0157369_108324312 189
767 3300013296 Ga0157374_10047999 Ga0157374_100479992 189
768 3300013296 Ga0157374_10606243 Ga0157374_106062432 189
769 3300013296 Ga0157374_10701798 Ga0157374_107017982 189
770 3300013297 Ga0157378_10088959 Ga0157378_100889592 189
771 3300013297 Ga0157378_10565473 Ga0157378_105654732 189
772 3300013306 Ga0163162_10013856 Ga0163162_100138562 189
773 3300013306 Ga0163162_10020524 Ga0163162_100205242 189
774 3300013306 Ga0163162_10033509 Ga0163162_100335092 189
775 3300013306 Ga0163162_10103769 Ga0163162_101037692 189
776 3300013306 Ga0163162_10446377 Ga0163162_104463772 189
777 3300013306 Ga0163162_10891250 Ga0163162_108912501 189
778 3300013307 Ga0157372_10005230 Ga0157372_1000523012 189
779 3300013307 Ga0157372_10026595 Ga0157372_100265953 189
780 3300013307 Ga0157372_10063253 Ga0157372_100632533 189
781 3300013307 Ga0157372_10244023 Ga0157372_102440231 189
782 3300013307 Ga0157372_10256889 Ga0157372_102568892 189
783 3300013307 Ga0157372_10262837 Ga0157372_102628372 189
784 3300013307 Ga0157372_10446460 Ga0157372_104464602 189
785 3300013307 Ga0157372_10512492 Ga0157372_105124922 189
786 3300013308 Ga0157375_10028201 Ga0157375_100282012 189
787 3300013308 Ga0157375_10049398 Ga0157375_100493982 189
788 3300013308 Ga0157375_10220751 Ga0157375_102207513 189
789 3300013308 Ga0157375_10434722 Ga0157375_104347221 189
790 3300013308 Ga0157375_10539692 Ga0157375_105396921 189
791 3300013308 Ga0157375_10831854 Ga0157375_108318541 189
792 3300014325 Ga0163163_10000178 Ga0163163_1000017833 189
793 3300014325 Ga0163163_10000390 Ga0163163_1000039024 189
794 3300014325 Ga0163163_10055744 Ga0163163_100557444 189
795 3300014325 Ga0163163_10184873 Ga0163163_101848732 189
796 3300014325 Ga0163163_10244341 Ga0163163_102443412 189
797 3300014325 Ga0163163_10299834 Ga0163163_102998343 189
798 3300014325 Ga0163163_10621242 Ga0163163_106212421 189
799 3300014326 Ga0157380_10000410 Ga0157380_1000041018 189
800 3300014326 Ga0157380_10012073 Ga0157380_100120734 189
801 3300014326 Ga0157380_10208258 Ga0157380_102082582 189
802 3300014326 Ga0157380_10247207 Ga0157380_102472072 189
803 3300014497 Ga0182008_10260550 Ga0182008_102605502 189
804 3300014968 Ga0157379_10005922 Ga0157379_100059226 189
805 3300014968 Ga0157379_10018886 Ga0157379_100188866 189
806 3300014969 Ga0157376_10156822 Ga0157376_101568221 189
807 3300014969 Ga0157376_10186610 Ga0157376_101866102 189
808 3300017792 Ga0163161_10009987 Ga0163161_100099875 189
809 3300020082 Ga0206353_10917309 Ga0206353_109173093 189
810 3300021358 Ga0213873_10118579 Ga0213873_101185791 189
811 3300021361 Ga0213872_10029901 Ga0213872_100299012 189
812 3300021377 Ga0213874_10227671 Ga0213874_102276711 189
813 3300024227 Ga0228598_1016554 Ga0228598_10165542 189
814 3300025245 Ga0207425_1000005 Ga0207425_100000598 189
815 3300025258 Ga0209129_1002161 Ga0209129_10021619 189
816 3300025263 Ga0209565_1000030 Ga0209565_1000030215 189
817 3300025291 Ga0209675_1011958 Ga0209675_10119582 189
818 3300025292 Ga0209676_1004013 Ga0209676_10040133 189
819 3300025292 Ga0209676_1030113 Ga0209676_10301133 189
820 3300025295 Ga0209564_1036811 Ga0209564_10368112 189
821 3300025297 Ga0209758_1000002 Ga0209758_10000021246 189
822 3300025297 Ga0209758_1004865 Ga0209758_10048657 189
823 3300025298 Ga0209050_1000005 Ga0209050_1000005160 189
824 3300025298 Ga0209050_1000215 Ga0209050_100021587 189
825 3300025298 Ga0209050_1003122 Ga0209050_100312211 189
826 3300025298 Ga0209050_1017531 Ga0209050_10175313 189
827 3300025298 Ga0209050_1045561 Ga0209050_10455611 189
828 3300025299 Ga0209256_1000046 Ga0209256_100004670 189
829 3300025303 Ga0209051_1000153 Ga0209051_1000153126 189
830 3300025304 Ga0209257_1000533 Ga0209257_10005338 189
831 3300025304 Ga0209257_1002082 Ga0209257_10020825 189
832 3300025304 Ga0209257_1002135 Ga0209257_100213518 189
833 3300025304 Ga0209257_1003806 Ga0209257_10038068 189
834 3300025315 Ga0207697_10000376 Ga0207697_1000037624 189
835 3300025315 Ga0207697_10015553 Ga0207697_100155534 189
836 3300025315 Ga0207697_10016755 Ga0207697_100167554 189
837 3300025315 Ga0207697_10107015 Ga0207697_101070152 189
838 3300025321 Ga0207656_10013039 Ga0207656_100130394 189
839 3300025321 Ga0207656_10073171 Ga0207656_100731712 189
840 3300025321 Ga0207656_10423765 Ga0207656_104237651 189
841 3300025735 Ga0207713_1033004 Ga0207713_10330042 189
842 3300025893 Ga0207682_10001851 Ga0207682_100018514 189
843 3300025893 Ga0207682_10006247 Ga0207682_100062472 189
844 3300025893 Ga0207682_10059456 Ga0207682_100594562 189
845 3300025898 Ga0207692_10063424 Ga0207692_100634242 189
846 3300025899 Ga0207642_10004223 Ga0207642_100042232 189
847 3300025900 Ga0207710_10216717 Ga0207710_102167171 189
848 3300025901 Ga0207688_10007140 Ga0207688_100071404 189
849 3300025901 Ga0207688_10024467 Ga0207688_100244673 189
850 3300025901 Ga0207688_10264658 Ga0207688_102646581 189
851 3300025901 Ga0207688_10274268 Ga0207688_102742682 189
852 3300025903 Ga0207680_10001140 Ga0207680_1000114010 189
853 3300025903 Ga0207680_10023859 Ga0207680_100238593 189
854 3300025903 Ga0207680_10024044 Ga0207680_100240442 189
855 3300025903 Ga0207680_10113025 Ga0207680_101130253 189
856 3300025903 Ga0207680_10208136 Ga0207680_102081361 189
857 3300025903 Ga0207680_10221967 Ga0207680_102219671 189
858 3300025903 Ga0207680_10298320 Ga0207680_102983201 189
859 3300025903 Ga0207680_10713396 Ga0207680_107133961 189
860 3300025903 Ga0207680_10759113 Ga0207680_107591131 189
861 3300025904 Ga0207647_10001105 Ga0207647_100011052 189
862 3300025904 Ga0207647_10004841 Ga0207647_100048416 189
863 3300025904 Ga0207647_10024667 Ga0207647_100246675 189
864 3300025904 Ga0207647_10046411 Ga0207647_100464112 189
865 3300025904 Ga0207647_10066001 Ga0207647_100660012 189
866 3300025904 Ga0207647_10067407 Ga0207647_100674072 189
867 3300025904 Ga0207647_10179060 Ga0207647_101790602 189
868 3300025906 Ga0207699_10156387 Ga0207699_101563872 189
869 3300025906 Ga0207699_10377806 Ga0207699_103778062 189
870 3300025907 Ga0207645_10003719 Ga0207645_100037198 189
871 3300025907 Ga0207645_10003851 Ga0207645_100038517 189
872 3300025907 Ga0207645_10030468 Ga0207645_100304684 189
873 3300025907 Ga0207645_10051413 Ga0207645_100514132 189
874 3300025907 Ga0207645_10101642 Ga0207645_101016423 189
875 3300025907 Ga0207645_10239238 Ga0207645_102392382 189
876 3300025908 Ga0207643_10024604 Ga0207643_100246042 189
877 3300025908 Ga0207643_10075342 Ga0207643_100753423 189
878 3300025909 Ga0207705_10000234 Ga0207705_1000023443 189
879 3300025909 Ga0207705_10009392 Ga0207705_100093927 189
880 3300025909 Ga0207705_10013013 Ga0207705_100130136 189
881 3300025909 Ga0207705_10018421 Ga0207705_100184215 189
882 3300025909 Ga0207705_10018597 Ga0207705_100185973 189
883 3300025909 Ga0207705_10027512 Ga0207705_100275125 189
884 3300025909 Ga0207705_10041691 Ga0207705_100416913 189
885 3300025909 Ga0207705_10045860 Ga0207705_100458602 189
886 3300025909 Ga0207705_10046483 Ga0207705_100464833 189
887 3300025909 Ga0207705_10057582 Ga0207705_100575821 189
888 3300025909 Ga0207705_10092924 Ga0207705_100929242 189
889 3300025909 Ga0207705_10154067 Ga0207705_101540671 189
890 3300025909 Ga0207705_10203441 Ga0207705_102034412 189
891 3300025909 Ga0207705_10408005 Ga0207705_104080052 189
892 3300025909 Ga0207705_10446996 Ga0207705_104469961 189
893 3300025909 Ga0207705_10451057 Ga0207705_104510572 189
894 3300025909 Ga0207705_10594827 Ga0207705_105948272 189
895 3300025911 Ga0207654_10208931 Ga0207654_102089312 189
896 3300025912 Ga0207707_10042593 Ga0207707_100425931 189
897 3300025912 Ga0207707_10131857 Ga0207707_101318572 189
898 3300025912 Ga0207707_10719118 Ga0207707_107191181 189
899 3300025912 Ga0207707_10913563 Ga0207707_109135631 189
900 3300025912 Ga0207707_11106322 Ga0207707_111063221 189
901 3300025913 Ga0207695_10040341 Ga0207695_100403413 189
902 3300025913 Ga0207695_10086730 Ga0207695_100867303 189
903 3300025914 Ga0207671_10012843 Ga0207671_100128437 189
904 3300025915 Ga0207693_10003200 Ga0207693_1000320011 189
905 3300025915 Ga0207693_10021799 Ga0207693_100217993 189
906 3300025915 Ga0207693_10028351 Ga0207693_100283513 189
907 3300025915 Ga0207693_10325435 Ga0207693_103254352 189
908 3300025915 Ga0207693_10861201 Ga0207693_108612011 189
909 3300025916 Ga0207663_10080726 Ga0207663_100807262 189
910 3300025917 Ga0207660_10000492 Ga0207660_1000049213 189
911 3300025917 Ga0207660_10012979 Ga0207660_100129794 189
912 3300025917 Ga0207660_10031025 Ga0207660_100310254 189
913 3300025917 Ga0207660_10113640 Ga0207660_101136402 189
914 3300025917 Ga0207660_10361597 Ga0207660_103615972 189
915 3300025917 Ga0207660_10455795 Ga0207660_104557951 189
916 3300025917 Ga0207660_10778038 Ga0207660_107780381 189
917 3300025918 Ga0207662_10024402 Ga0207662_100244024 189
918 3300025918 Ga0207662_10128664 Ga0207662_101286643 189
919 3300025919 Ga0207657_10000857 Ga0207657_1000085728 189
920 3300025919 Ga0207657_10001592 Ga0207657_100015922 189
921 3300025919 Ga0207657_10003097 Ga0207657_100030974 189
922 3300025919 Ga0207657_10011322 Ga0207657_100113226 189
923 3300025919 Ga0207657_10011380 Ga0207657_100113804 189
924 3300025919 Ga0207657_10019009 Ga0207657_100190092 189
925 3300025919 Ga0207657_10021121 Ga0207657_100211212 189
926 3300025919 Ga0207657_10028058 Ga0207657_100280583 189
927 3300025919 Ga0207657_10034901 Ga0207657_100349013 189
928 3300025919 Ga0207657_10037889 Ga0207657_100378892 189
929 3300025919 Ga0207657_10039693 Ga0207657_100396932 189
930 3300025919 Ga0207657_10046549 Ga0207657_100465493 189
931 3300025919 Ga0207657_10055690 Ga0207657_100556902 189
932 3300025919 Ga0207657_10056013 Ga0207657_100560133 189
933 3300025919 Ga0207657_10094097 Ga0207657_100940973 189
934 3300025919 Ga0207657_10211971 Ga0207657_102119712 189
935 3300025919 Ga0207657_10288975 Ga0207657_102889752 189
936 3300025920 Ga0207649_10000159 Ga0207649_1000015916 189
937 3300025920 Ga0207649_10004703 Ga0207649_100047034 189
938 3300025920 Ga0207649_10005977 Ga0207649_100059775 189
939 3300025920 Ga0207649_10019715 Ga0207649_100197154 189
940 3300025920 Ga0207649_10023490 Ga0207649_100234905 189
941 3300025920 Ga0207649_10047608 Ga0207649_100476082 189
942 3300025920 Ga0207649_10054101 Ga0207649_100541013 189
943 3300025920 Ga0207649_10096199 Ga0207649_100961992 189
944 3300025920 Ga0207649_10144606 Ga0207649_101446061 189
945 3300025920 Ga0207649_10154368 Ga0207649_101543682 189
946 3300025920 Ga0207649_10209760 Ga0207649_102097601 189
947 3300025920 Ga0207649_10389664 Ga0207649_103896642 189
948 3300025920 Ga0207649_10751134 Ga0207649_107511342 189
949 3300025921 Ga0207652_10028036 Ga0207652_100280364 189
950 3300025921 Ga0207652_10058145 Ga0207652_100581453 189
951 3300025921 Ga0207652_10079593 Ga0207652_100795933 189
952 3300025921 Ga0207652_10094813 Ga0207652_100948132 189
953 3300025921 Ga0207652_10115046 Ga0207652_101150462 189
954 3300025921 Ga0207652_10168317 Ga0207652_101683172 189
955 3300025921 Ga0207652_10172329 Ga0207652_101723292 189
956 3300025921 Ga0207652_10374786 Ga0207652_103747861 189
957 3300025921 Ga0207652_10401409 Ga0207652_104014092 189
958 3300025921 Ga0207652_10733458 Ga0207652_107334581 189
959 3300025923 Ga0207681_10023209 Ga0207681_100232094 189
960 3300025923 Ga0207681_10102647 Ga0207681_101026472 189
961 3300025923 Ga0207681_10151895 Ga0207681_101518952 189
962 3300025923 Ga0207681_10280532 Ga0207681_102805323 189
963 3300025923 Ga0207681_10282054 Ga0207681_102820542 189
964 3300025923 Ga0207681_10328898 Ga0207681_103288982 189
965 3300025923 Ga0207681_10895302 Ga0207681_108953021 189
966 3300025924 Ga0207694_10001409 Ga0207694_1000140924 189
967 3300025924 Ga0207694_10030298 Ga0207694_100302985 189
968 3300025924 Ga0207694_10780632 Ga0207694_107806321 189
969 3300025925 Ga0207650_10002087 Ga0207650_1000208712 189
970 3300025925 Ga0207650_10003374 Ga0207650_100033745 189
971 3300025925 Ga0207650_10004763 Ga0207650_100047638 189
972 3300025925 Ga0207650_10033612 Ga0207650_100336124 189
973 3300025925 Ga0207650_10105923 Ga0207650_101059232 189
974 3300025925 Ga0207650_10186764 Ga0207650_101867642 189
975 3300025925 Ga0207650_10349312 Ga0207650_103493121 189
976 3300025925 Ga0207650_10390522 Ga0207650_103905221 189
977 3300025925 Ga0207650_10392531 Ga0207650_103925312 189
978 3300025925 Ga0207650_10545478 Ga0207650_105454782 189
979 3300025925 Ga0207650_10695574 Ga0207650_106955742 189
980 3300025926 Ga0207659_10008958 Ga0207659_100089585 189
981 3300025926 Ga0207659_10014098 Ga0207659_100140983 189
982 3300025926 Ga0207659_10128986 Ga0207659_101289862 189
983 3300025926 Ga0207659_10369834 Ga0207659_103698342 189
984 3300025926 Ga0207659_11006109 Ga0207659_110061091 189
985 3300025928 Ga0207700_10009000 Ga0207700_100090004 189
986 3300025928 Ga0207700_10022357 Ga0207700_100223572 189
987 3300025928 Ga0207700_10340670 Ga0207700_103406702 189
988 3300025929 Ga0207664_10026728 Ga0207664_100267282 189
989 3300025929 Ga0207664_10159013 Ga0207664_101590132 189
990 3300025929 Ga0207664_10345403 Ga0207664_103454032 189
991 3300025931 Ga0207644_10000465 Ga0207644_1000046522 189
992 3300025931 Ga0207644_10005285 Ga0207644_100052858 189
993 3300025931 Ga0207644_10021902 Ga0207644_100219024 189
994 3300025931 Ga0207644_10023007 Ga0207644_100230075 189
995 3300025931 Ga0207644_10023365 Ga0207644_100233652 189
996 3300025931 Ga0207644_10039343 Ga0207644_100393434 189
997 3300025931 Ga0207644_10055142 Ga0207644_100551423 189
998 3300025931 Ga0207644_10055275 Ga0207644_100552754 189
999 3300025931 Ga0207644_10065330 Ga0207644_100653302 189
1000 3300025931 Ga0207644_10074396 Ga0207644_100743962 189
1001 3300025931 Ga0207644_10090721 Ga0207644_100907212 189
1002 3300025931 Ga0207644_10163468 Ga0207644_101634682 189
1003 3300025931 Ga0207644_10328977 Ga0207644_103289772 189
1004 3300025931 Ga0207644_10409556 Ga0207644_104095561 189
1005 3300025931 Ga0207644_10600853 Ga0207644_106008531 189
1006 3300025931 Ga0207644_10657754 Ga0207644_106577542 189
1007 3300025931 Ga0207644_10841092 Ga0207644_108410921 189
1008 3300025931 Ga0207644_10957885 Ga0207644_109578851 189
1009 3300025932 Ga0207690_10000120 Ga0207690_1000012045 189
1010 3300025932 Ga0207690_10007579 Ga0207690_100075793 189
1011 3300025932 Ga0207690_10014478 Ga0207690_100144783 189
1012 3300025932 Ga0207690_10018292 Ga0207690_100182924 189
1013 3300025932 Ga0207690_10041170 Ga0207690_100411704 189
1014 3300025932 Ga0207690_10048006 Ga0207690_100480062 189
1015 3300025932 Ga0207690_10123657 Ga0207690_101236571 189
1016 3300025932 Ga0207690_10135436 Ga0207690_101354362 189
1017 3300025932 Ga0207690_10159768 Ga0207690_101597682 189
1018 3300025932 Ga0207690_10160086 Ga0207690_101600861 189
1019 3300025932 Ga0207690_10184571 Ga0207690_101845712 189
1020 3300025932 Ga0207690_10220036 Ga0207690_102200362 189
1021 3300025932 Ga0207690_10272133 Ga0207690_102721332 189
1022 3300025932 Ga0207690_10300336 Ga0207690_103003362 189
1023 3300025933 Ga0207706_10000200 Ga0207706_1000020043 189
1024 3300025933 Ga0207706_10001222 Ga0207706_1000122218 189
1025 3300025933 Ga0207706_10002146 Ga0207706_1000214615 189
1026 3300025933 Ga0207706_10003464 Ga0207706_100034649 189
1027 3300025933 Ga0207706_10005186 Ga0207706_100051864 189
1028 3300025933 Ga0207706_10005358 Ga0207706_1000535811 189
1029 3300025933 Ga0207706_10011841 Ga0207706_100118416 189
1030 3300025933 Ga0207706_10013081 Ga0207706_100130813 189
1031 3300025933 Ga0207706_10027039 Ga0207706_100270396 189
1032 3300025933 Ga0207706_10029548 Ga0207706_100295482 189
1033 3300025933 Ga0207706_10102974 Ga0207706_101029742 189
1034 3300025933 Ga0207706_10191372 Ga0207706_101913722 189
1035 3300025933 Ga0207706_10210630 Ga0207706_102106303 189
1036 3300025933 Ga0207706_10345193 Ga0207706_103451932 189
1037 3300025933 Ga0207706_10460582 Ga0207706_104605822 189
1038 3300025933 Ga0207706_10532055 Ga0207706_105320552 189
1039 3300025935 Ga0207709_10054256 Ga0207709_100542562 189
1040 3300025935 Ga0207709_10228127 Ga0207709_102281272 189
1041 3300025936 Ga0207670_10276799 Ga0207670_102767992 189
1042 3300025936 Ga0207670_11300588 Ga0207670_113005881 189
1043 3300025937 Ga0207669_10016697 Ga0207669_100166973 189
1044 3300025937 Ga0207669_10021940 Ga0207669_100219403 189
1045 3300025937 Ga0207669_10080151 Ga0207669_100801512 189
1046 3300025937 Ga0207669_10099897 Ga0207669_100998971 189
1047 3300025937 Ga0207669_10745317 Ga0207669_107453171 189
1048 3300025938 Ga0207704_10022119 Ga0207704_100221192 189
1049 3300025939 Ga0207665_10034710 Ga0207665_100347104 189
1050 3300025939 Ga0207665_10162768 Ga0207665_101627683 189
1051 3300025940 Ga0207691_10001218 Ga0207691_1000121824 189
1052 3300025940 Ga0207691_10008630 Ga0207691_100086302 189
1053 3300025940 Ga0207691_10021031 Ga0207691_100210314 189
1054 3300025940 Ga0207691_10023515 Ga0207691_100235152 189
1055 3300025940 Ga0207691_10023869 Ga0207691_100238696 189
1056 3300025940 Ga0207691_10026738 Ga0207691_100267386 189
1057 3300025940 Ga0207691_10045778 Ga0207691_100457783 189
1058 3300025940 Ga0207691_10062806 Ga0207691_100628064 189
1059 3300025940 Ga0207691_10070664 Ga0207691_100706642 189
1060 3300025940 Ga0207691_10077272 Ga0207691_100772722 189
1061 3300025940 Ga0207691_10087746 Ga0207691_100877463 189
1062 3300025941 Ga0207711_10000046 Ga0207711_10000046147 189
1063 3300025941 Ga0207711_10001359 Ga0207711_100013595 189
1064 3300025941 Ga0207711_10011835 Ga0207711_100118352 189
1065 3300025941 Ga0207711_10014539 Ga0207711_100145392 189
1066 3300025941 Ga0207711_10023973 Ga0207711_100239732 189
1067 3300025941 Ga0207711_10079964 Ga0207711_100799642 189
1068 3300025941 Ga0207711_10153559 Ga0207711_101535593 189
1069 3300025941 Ga0207711_10153692 Ga0207711_101536922 189
1070 3300025941 Ga0207711_10172536 Ga0207711_101725362 189
1071 3300025941 Ga0207711_10194608 Ga0207711_101946083 189
1072 3300025941 Ga0207711_10633837 Ga0207711_106338371 189
1073 3300025941 Ga0207711_10645216 Ga0207711_106452162 189
1074 3300025941 Ga0207711_10686441 Ga0207711_106864412 189
1075 3300025941 Ga0207711_10714592 Ga0207711_107145921 189
1076 3300025941 Ga0207711_10764633 Ga0207711_107646332 189
1077 3300025941 Ga0207711_10839013 Ga0207711_108390132 189
1078 3300025941 Ga0207711_10926324 Ga0207711_109263242 189
1079 3300025941 Ga0207711_11022571 Ga0207711_110225711 189
1080 3300025942 Ga0207689_10041099 Ga0207689_100410992 189
1081 3300025942 Ga0207689_10106217 Ga0207689_101062173 189
1082 3300025942 Ga0207689_10148023 Ga0207689_101480232 189
1083 3300025942 Ga0207689_10259147 Ga0207689_102591472 189
1084 3300025942 Ga0207689_10453948 Ga0207689_104539482 189
1085 3300025944 Ga0207661_10002690 Ga0207661_100026902 189
1086 3300025944 Ga0207661_10004991 Ga0207661_100049912 189
1087 3300025944 Ga0207661_10009695 Ga0207661_100096953 189
1088 3300025944 Ga0207661_10024494 Ga0207661_100244942 189
1089 3300025944 Ga0207661_10262111 Ga0207661_102621112 189
1090 3300025944 Ga0207661_10535594 Ga0207661_105355942 189
1091 3300025944 Ga0207661_10953525 Ga0207661_109535251 189
1092 3300025945 Ga0207679_10000150 Ga0207679_1000015061 189
1093 3300025945 Ga0207679_10000770 Ga0207679_1000077019 189
1094 3300025945 Ga0207679_10002544 Ga0207679_1000254410 189
1095 3300025945 Ga0207679_10015929 Ga0207679_100159293 189
1096 3300025945 Ga0207679_10017952 Ga0207679_100179524 189
1097 3300025945 Ga0207679_10019171 Ga0207679_100191712 189
1098 3300025945 Ga0207679_10028275 Ga0207679_100282754 189
1099 3300025945 Ga0207679_10055102 Ga0207679_100551023 189
1100 3300025945 Ga0207679_10067113 Ga0207679_100671131 189
1101 3300025945 Ga0207679_10073330 Ga0207679_100733303 189
1102 3300025945 Ga0207679_10112458 Ga0207679_101124583 189
1103 3300025945 Ga0207679_10135896 Ga0207679_101358963 189
1104 3300025945 Ga0207679_10229891 Ga0207679_102298912 189
1105 3300025945 Ga0207679_10402780 Ga0207679_104027801 189
1106 3300025945 Ga0207679_10438068 Ga0207679_104380682 189
1107 3300025945 Ga0207679_10501480 Ga0207679_105014802 189
1108 3300025949 Ga0207667_10000443 Ga0207667_1000044357 189
1109 3300025949 Ga0207667_10010791 Ga0207667_100107915 189
1110 3300025949 Ga0207667_10034487 Ga0207667_100344873 189
1111 3300025949 Ga0207667_10121975 Ga0207667_101219753 189
1112 3300025949 Ga0207667_10214036 Ga0207667_102140362 189
1113 3300025949 Ga0207667_10439215 Ga0207667_104392152 189
1114 3300025949 Ga0207667_10454466 Ga0207667_104544662 189
1115 3300025949 Ga0207667_10682929 Ga0207667_106829292 189
1116 3300025949 Ga0207667_10908785 Ga0207667_109087851 189
1117 3300025960 Ga0207651_10037168 Ga0207651_100371683 189
1118 3300025960 Ga0207651_10052767 Ga0207651_100527672 189
1119 3300025960 Ga0207651_10123936 Ga0207651_101239362 189
1120 3300025960 Ga0207651_10174879 Ga0207651_101748792 189
1121 3300025960 Ga0207651_10294979 Ga0207651_102949792 189
1122 3300025960 Ga0207651_10552004 Ga0207651_105520041 189
1123 3300025960 Ga0207651_10708392 Ga0207651_107083921 189
1124 3300025961 Ga0207712_10036409 Ga0207712_100364093 189
1125 3300025961 Ga0207712_10085989 Ga0207712_100859893 189
1126 3300025961 Ga0207712_10171238 Ga0207712_101712382 189
1127 3300025961 Ga0207712_10241372 Ga0207712_102413722 189
1128 3300025961 Ga0207712_10485690 Ga0207712_104856902 189
1129 3300025972 Ga0207668_10001946 Ga0207668_100019465 189
1130 3300025972 Ga0207668_10008900 Ga0207668_100089005 189
1131 3300025972 Ga0207668_10013614 Ga0207668_100136145 189
1132 3300025972 Ga0207668_10070700 Ga0207668_100707002 189
1133 3300025972 Ga0207668_10383349 Ga0207668_103833492 189
1134 3300025981 Ga0207640_10016924 Ga0207640_100169243 189
1135 3300025981 Ga0207640_10020066 Ga0207640_100200664 189
1136 3300025981 Ga0207640_10020592 Ga0207640_100205924 189
1137 3300025981 Ga0207640_10026879 Ga0207640_100268793 189
1138 3300025981 Ga0207640_10033556 Ga0207640_100335562 189
1139 3300025981 Ga0207640_10044084 Ga0207640_100440842 189
1140 3300025981 Ga0207640_10104946 Ga0207640_101049463 189
1141 3300025981 Ga0207640_10724188 Ga0207640_107241882 189
1142 3300025986 Ga0207658_10000134 Ga0207658_1000013448 189
1143 3300025986 Ga0207658_10004243 Ga0207658_100042435 189
1144 3300025986 Ga0207658_10018376 Ga0207658_100183762 189
1145 3300025986 Ga0207658_10023296 Ga0207658_100232963 189
1146 3300025986 Ga0207658_10063150 Ga0207658_100631502 189
1147 3300025986 Ga0207658_10080192 Ga0207658_100801923 189
1148 3300025986 Ga0207658_10103995 Ga0207658_101039952 189
1149 3300025986 Ga0207658_10271802 Ga0207658_102718023 189
1150 3300025986 Ga0207658_10272129 Ga0207658_102721293 189
1151 3300025986 Ga0207658_10290978 Ga0207658_102909783 189
1152 3300025986 Ga0207658_10304769 Ga0207658_103047692 189
1153 3300025986 Ga0207658_10349958 Ga0207658_103499582 189
1154 3300025986 Ga0207658_10429464 Ga0207658_104294641 189
1155 3300025986 Ga0207658_10549069 Ga0207658_105490692 189
1156 3300025986 Ga0207658_10566711 Ga0207658_105667112 189
1157 3300025986 Ga0207658_10697442 Ga0207658_106974421 189
1158 3300026023 Ga0207677_10005778 Ga0207677_100057785 189
1159 3300026023 Ga0207677_10601566 Ga0207677_106015662 189
1160 3300026023 Ga0207677_10978926 Ga0207677_109789261 189
1161 3300026035 Ga0207703_10009065 Ga0207703_100090652 189
1162 3300026035 Ga0207703_10009181 Ga0207703_100091816 189
1163 3300026035 Ga0207703_10024963 Ga0207703_100249631 189
1164 3300026035 Ga0207703_10041280 Ga0207703_100412802 189
1165 3300026035 Ga0207703_10059343 Ga0207703_100593432 189
1166 3300026035 Ga0207703_10073031 Ga0207703_100730311 189
1167 3300026035 Ga0207703_10584336 Ga0207703_105843362 189
1168 3300026035 Ga0207703_10779211 Ga0207703_107792112 189
1169 3300026035 Ga0207703_10784047 Ga0207703_107840471 189
1170 3300026041 Ga0207639_10000282 Ga0207639_1000028222 189
1171 3300026041 Ga0207639_10000575 Ga0207639_1000057512 189
1172 3300026041 Ga0207639_10027682 Ga0207639_100276824 189
1173 3300026041 Ga0207639_10031444 Ga0207639_100314443 189
1174 3300026041 Ga0207639_10032569 Ga0207639_100325692 189
1175 3300026041 Ga0207639_10045948 Ga0207639_100459482 189
1176 3300026041 Ga0207639_10245838 Ga0207639_102458382 189
1177 3300026041 Ga0207639_10251801 Ga0207639_102518012 189
1178 3300026041 Ga0207639_11258667 Ga0207639_112586671 189
1179 3300026067 Ga0207678_10004354 Ga0207678_100043546 189
1180 3300026067 Ga0207678_10006321 Ga0207678_100063217 189
1181 3300026067 Ga0207678_10008434 Ga0207678_100084342 189
1182 3300026067 Ga0207678_10015228 Ga0207678_100152283 189
1183 3300026067 Ga0207678_10019411 Ga0207678_100194117 189
1184 3300026067 Ga0207678_10019471 Ga0207678_100194712 189
1185 3300026067 Ga0207678_10075382 Ga0207678_100753822 189
1186 3300026067 Ga0207678_10088118 Ga0207678_100881182 189
1187 3300026067 Ga0207678_10136381 Ga0207678_101363812 189
1188 3300026067 Ga0207678_10215697 Ga0207678_102156972 189
1189 3300026067 Ga0207678_10961603 Ga0207678_109616031 189
1190 3300026075 Ga0207708_10042389 Ga0207708_100423893 189
1191 3300026078 Ga0207702_10001027 Ga0207702_100010276 189
1192 3300026078 Ga0207702_10008778 Ga0207702_100087782 189
1193 3300026078 Ga0207702_10009483 Ga0207702_100094833 189
1194 3300026078 Ga0207702_10012444 Ga0207702_100124447 189
1195 3300026078 Ga0207702_10063818 Ga0207702_100638182 189
1196 3300026078 Ga0207702_10083247 Ga0207702_100832472 189
1197 3300026078 Ga0207702_10125638 Ga0207702_101256382 189
1198 3300026078 Ga0207702_10137929 Ga0207702_101379292 189
1199 3300026078 Ga0207702_10167222 Ga0207702_101672223 189
1200 3300026078 Ga0207702_10559625 Ga0207702_105596252 189
1201 3300026078 Ga0207702_11208300 Ga0207702_112083001 189
1202 3300026088 Ga0207641_10000035 Ga0207641_1000003541 189
1203 3300026088 Ga0207641_10001076 Ga0207641_1000107626 189
1204 3300026088 Ga0207641_10001374 Ga0207641_1000137425 189
1205 3300026088 Ga0207641_10100610 Ga0207641_101006102 189
1206 3300026088 Ga0207641_10102051 Ga0207641_101020512 189
1207 3300026088 Ga0207641_10164596 Ga0207641_101645962 189
1208 3300026088 Ga0207641_10489630 Ga0207641_104896301 189
1209 3300026088 Ga0207641_11078037 Ga0207641_110780371 189
1210 3300026089 Ga0207648_10000962 Ga0207648_100009627 189
1211 3300026089 Ga0207648_10008840 Ga0207648_100088405 189
1212 3300026089 Ga0207648_10023114 Ga0207648_100231146 189
1213 3300026089 Ga0207648_10026647 Ga0207648_100266474 189
1214 3300026089 Ga0207648_10117453 Ga0207648_101174532 189
1215 3300026095 Ga0207676_10000877 Ga0207676_100008779 189
1216 3300026095 Ga0207676_10001543 Ga0207676_1000154320 189
1217 3300026095 Ga0207676_10002762 Ga0207676_100027628 189
1218 3300026095 Ga0207676_10004032 Ga0207676_100040324 189
1219 3300026095 Ga0207676_10006804 Ga0207676_100068047 189
1220 3300026095 Ga0207676_10022917 Ga0207676_100229176 189
1221 3300026095 Ga0207676_10025058 Ga0207676_100250585 189
1222 3300026095 Ga0207676_10035492 Ga0207676_100354922 189
1223 3300026095 Ga0207676_10042890 Ga0207676_100428904 189
1224 3300026095 Ga0207676_10051592 Ga0207676_100515923 189
1225 3300026095 Ga0207676_10091484 Ga0207676_100914842 189
1226 3300026095 Ga0207676_10329517 Ga0207676_103295172 189
1227 3300026095 Ga0207676_10451739 Ga0207676_104517392 189
1228 3300026095 Ga0207676_10596446 Ga0207676_105964462 189
1229 3300026095 Ga0207676_11072046 Ga0207676_110720461 189
1230 3300026116 Ga0207674_10000626 Ga0207674_1000062631 189
1231 3300026116 Ga0207674_10002709 Ga0207674_100027093 189
1232 3300026116 Ga0207674_10003891 Ga0207674_1000389116 189
1233 3300026116 Ga0207674_10004574 Ga0207674_1000457416 189
1234 3300026116 Ga0207674_10014610 Ga0207674_100146108 189
1235 3300026116 Ga0207674_10014655 Ga0207674_100146558 189
1236 3300026116 Ga0207674_10018505 Ga0207674_100185056 189
1237 3300026116 Ga0207674_10118469 Ga0207674_101184693 189
1238 3300026116 Ga0207674_10140594 Ga0207674_101405942 189
1239 3300026116 Ga0207674_10276407 Ga0207674_102764072 189
1240 3300026116 Ga0207674_10432365 Ga0207674_104323652 189
1241 3300026116 Ga0207674_10840513 Ga0207674_108405132 189
1242 3300026118 Ga0207675_100004741 Ga0207675_1000047414 189
1243 3300026118 Ga0207675_100144422 Ga0207675_1001444223 189
1244 3300026118 Ga0207675_100412772 Ga0207675_1004127722 189
1245 3300026118 Ga0207675_100457587 Ga0207675_1004575872 189
1246 3300026118 Ga0207675_101938532 Ga0207675_1019385321 189
1247 3300026121 Ga0207683_10007210 Ga0207683_100072102 189
1248 3300026121 Ga0207683_10008207 Ga0207683_100082072 189
1249 3300026121 Ga0207683_10012533 Ga0207683_100125335 189
1250 3300026121 Ga0207683_10046990 Ga0207683_100469904 189
1251 3300026121 Ga0207683_10113918 Ga0207683_101139183 189
1252 3300026121 Ga0207683_10147550 Ga0207683_101475503 189
1253 3300026121 Ga0207683_10339599 Ga0207683_103395992 189
1254 3300026121 Ga0207683_10545430 Ga0207683_105454301 189
1255 3300026121 Ga0207683_10939899 Ga0207683_109398991 189
1256 3300026142 Ga0207698_10000784 Ga0207698_100007847 189
1257 3300026142 Ga0207698_10001509 Ga0207698_100015098 189
1258 3300026142 Ga0207698_10002457 Ga0207698_100024578 189
1259 3300026142 Ga0207698_10002616 Ga0207698_100026166 189
1260 3300026142 Ga0207698_10002793 Ga0207698_100027934 189
1261 3300026142 Ga0207698_10004547 Ga0207698_100045476 189
1262 3300026142 Ga0207698_10071505 Ga0207698_100715053 189
1263 3300026142 Ga0207698_10094504 Ga0207698_100945042 189
1264 3300026142 Ga0207698_10147919 Ga0207698_101479191 189
1265 3300026142 Ga0207698_10216841 Ga0207698_102168412 189
1266 3300026142 Ga0207698_10348405 Ga0207698_103484052 189
1267 3300026142 Ga0207698_10458251 Ga0207698_104582512 189
1268 3300026142 Ga0207698_11067809 Ga0207698_110678091 189
1269 3300026142 Ga0207698_11369345 Ga0207698_113693451 189
1270 3300026142 Ga0207698_11567164 Ga0207698_115671641 189
1271 3300027512 Ga0209179_1030098 Ga0209179_10300982 189
1272 3300027665 Ga0209983_1016920 Ga0209983_10169202 189
1273 3300027876 Ga0209974_10003541 Ga0209974_100035416 189
1274 3300027907 Ga0207428_10112847 Ga0207428_101128472 189
1275 3300028379 Ga0268266_10000015 Ga0268266_10000015110 189
1276 3300028379 Ga0268266_10003194 Ga0268266_100031948 189
1277 3300028379 Ga0268266_10018087 Ga0268266_100180876 189
1278 3300028379 Ga0268266_10023069 Ga0268266_100230692 189
1279 3300028379 Ga0268266_10042675 Ga0268266_100426752 189
1280 3300028379 Ga0268266_10049886 Ga0268266_100498864 189
1281 3300028380 Ga0268265_10008043 Ga0268265_100080436 189
1282 3300028380 Ga0268265_10012902 Ga0268265_100129027 189
1283 3300028380 Ga0268265_10023795 Ga0268265_100237952 189
1284 3300028380 Ga0268265_10036557 Ga0268265_100365572 189
1285 3300028380 Ga0268265_10096004 Ga0268265_100960042 189
1286 3300028380 Ga0268265_10150652 Ga0268265_101506522 189
1287 3300028380 Ga0268265_10228952 Ga0268265_102289522 189
1288 3300028381 Ga0268264_10000018 Ga0268264_1000001816 189
1289 3300028381 Ga0268264_10000087 Ga0268264_1000008748 189
1290 3300028381 Ga0268264_10001241 Ga0268264_1000124113 189
1291 3300028381 Ga0268264_10158431 Ga0268264_101584313 189
1292 3300028381 Ga0268264_10248568 Ga0268264_102485683 189
1293 3300028381 Ga0268264_10545656 Ga0268264_105456562 189
1294 3300028381 Ga0268264_10667140 Ga0268264_106671401 189
1295 3300030731 Ga0316177_1034854 Ga0316177_10348543 189
1296 3300030735 Ga0316178_1176232 Ga0316178_11762322 189
1297 3300030736 Ga0316180_1026671 Ga0316180_10266711 189
1298 3300030742 Ga0316183_1140839 Ga0316183_11408392 189
1299 3300030745 Ga0316182_1048881 Ga0316182_10488813 189
1300 3300031247 Ga0265340_10058884 Ga0265340_100588842 189
1301 3300031250 Ga0265331_10101222 Ga0265331_101012222 189
1302 3300031251 Ga0265327_10042152 Ga0265327_100421523 189
1303 3300031251 Ga0265327_10298839 Ga0265327_102988391 189
1304 3300031548 Ga0307408_100034539 Ga0307408_1000345394 189
1305 3300031548 Ga0307408_100075500 Ga0307408_1000755002 189
1306 3300031548 Ga0307408_100144449 Ga0307408_1001444492 189
1307 3300031548 Ga0307408_100157141 Ga0307408_1001571413 189
1308 3300031548 Ga0307408_100203972 Ga0307408_1002039721 189
1309 3300031731 Ga0307405_10016567 Ga0307405_100165675 189
1310 3300031731 Ga0307405_10123398 Ga0307405_101233983 189
1311 3300031731 Ga0307405_10146543 Ga0307405_101465431 189
1312 3300031731 Ga0307405_10291578 Ga0307405_102915782 189
1313 3300031731 Ga0307405_10558119 Ga0307405_105581191 189
1314 3300031731 Ga0307405_10650900 Ga0307405_106509002 189
1315 3300031824 Ga0307413_10013083 Ga0307413_100130835 189
1316 3300031824 Ga0307413_10046833 Ga0307413_100468331 189
1317 3300031824 Ga0307413_10188165 Ga0307413_101881653 189
1318 3300031824 Ga0307413_10359636 Ga0307413_103596361 189
1319 3300031824 Ga0307413_10423367 Ga0307413_104233671 189
1320 3300031852 Ga0307410_10013134 Ga0307410_100131342 189
1321 3300031852 Ga0307410_10047038 Ga0307410_100470382 189
1322 3300031852 Ga0307410_10075670 Ga0307410_100756702 189
1323 3300031852 Ga0307410_10076674 Ga0307410_100766742 189
1324 3300031852 Ga0307410_10084543 Ga0307410_100845432 189
1325 3300031852 Ga0307410_10122812 Ga0307410_101228122 189
1326 3300031852 Ga0307410_10130494 Ga0307410_101304942 189
1327 3300031852 Ga0307410_10169074 Ga0307410_101690742 189
1328 3300031852 Ga0307410_10179322 Ga0307410_101793223 189
1329 3300031852 Ga0307410_10319935 Ga0307410_103199352 189
1330 3300031852 Ga0307410_10326431 Ga0307410_103264312 189
1331 3300031852 Ga0307410_10361099 Ga0307410_103610992 189
1332 3300031852 Ga0307410_10593774 Ga0307410_105937742 189
1333 3300031852 Ga0307410_10725689 Ga0307410_107256892 189
1334 3300031852 Ga0307410_10760841 Ga0307410_107608411 189
1335 3300031852 Ga0307410_11270514 Ga0307410_112705141 189
1336 3300031901 Ga0307406_10008314 Ga0307406_100083145 189
1337 3300031901 Ga0307406_10046189 Ga0307406_100461893 189
1338 3300031901 Ga0307406_10062825 Ga0307406_100628253 189
1339 3300031901 Ga0307406_10077068 Ga0307406_100770683 189
1340 3300031901 Ga0307406_10157467 Ga0307406_101574673 189
1341 3300031901 Ga0307406_10159559 Ga0307406_101595593 189
1342 3300031901 Ga0307406_10253408 Ga0307406_102534082 189
1343 3300031901 Ga0307406_10414336 Ga0307406_104143362 189
1344 3300031901 Ga0307406_10719403 Ga0307406_107194032 189
1345 3300031903 Ga0307407_10007691 Ga0307407_100076913 189
1346 3300031903 Ga0307407_10009223 Ga0307407_100092234 189
1347 3300031903 Ga0307407_10060090 Ga0307407_100600902 189
1348 3300031903 Ga0307407_10067383 Ga0307407_100673832 189
1349 3300031903 Ga0307407_10070513 Ga0307407_100705132 189
1350 3300031903 Ga0307407_10134658 Ga0307407_101346582 189
1351 3300031903 Ga0307407_10153130 Ga0307407_101531302 189
1352 3300031903 Ga0307407_10213119 Ga0307407_102131192 189
1353 3300031903 Ga0307407_10286768 Ga0307407_102867682 189
1354 3300031911 Ga0307412_10000784 Ga0307412_1000078410 189
1355 3300031911 Ga0307412_10005704 Ga0307412_100057043 189
1356 3300031911 Ga0307412_10006182 Ga0307412_100061824 189
1357 3300031911 Ga0307412_10068023 Ga0307412_100680232 189
1358 3300031911 Ga0307412_10143231 Ga0307412_101432312 189
1359 3300031911 Ga0307412_10211245 Ga0307412_102112452 189
1360 3300031911 Ga0307412_10245116 Ga0307412_102451162 189
1361 3300031911 Ga0307412_10506155 Ga0307412_105061551 189
1362 3300031995 Ga0307409_100001300 Ga0307409_10000130010 189
1363 3300031995 Ga0307409_100006591 Ga0307409_1000065917 189
1364 3300031995 Ga0307409_100023819 Ga0307409_1000238193 189
1365 3300031995 Ga0307409_100097436 Ga0307409_1000974362 189
1366 3300031995 Ga0307409_100138407 Ga0307409_1001384072 189
1367 3300031995 Ga0307409_100143861 Ga0307409_1001438613 189
1368 3300031995 Ga0307409_100170219 Ga0307409_1001702192 189
1369 3300031995 Ga0307409_100190630 Ga0307409_1001906303 189
1370 3300031995 Ga0307409_100419608 Ga0307409_1004196082 189
1371 3300031995 Ga0307409_100577539 Ga0307409_1005775391 189
1372 3300031995 Ga0307409_100642156 Ga0307409_1006421562 189
1373 3300031995 Ga0307409_100666949 Ga0307409_1006669492 189
1374 3300031995 Ga0307409_100672202 Ga0307409_1006722022 189
1375 3300031995 Ga0307409_100699277 Ga0307409_1006992772 189
1376 3300031995 Ga0307409_100736531 Ga0307409_1007365312 189
1377 3300032002 Ga0307416_100056819 Ga0307416_1000568194 189
1378 3300032002 Ga0307416_100079575 Ga0307416_1000795753 189
1379 3300032002 Ga0307416_100116234 Ga0307416_1001162342 189
1380 3300032002 Ga0307416_100135357 Ga0307416_1001353572 189
1381 3300032002 Ga0307416_100546253 Ga0307416_1005462531 189
1382 3300032002 Ga0307416_100636870 Ga0307416_1006368702 189
1383 3300032002 Ga0307416_100670015 Ga0307416_1006700152 189
1384 3300032002 Ga0307416_100909703 Ga0307416_1009097032 189
1385 3300032004 Ga0307414_10005744 Ga0307414_100057443 189
1386 3300032004 Ga0307414_10041008 Ga0307414_100410084 189
1387 3300032004 Ga0307414_10047269 Ga0307414_100472693 189
1388 3300032004 Ga0307414_10055433 Ga0307414_100554332 189
1389 3300032004 Ga0307414_10067288 Ga0307414_100672882 189
1390 3300032004 Ga0307414_10131338 Ga0307414_101313382 189
1391 3300032004 Ga0307414_10147298 Ga0307414_101472981 189
1392 3300032004 Ga0307414_10241436 Ga0307414_102414362 189
1393 3300032004 Ga0307414_10262431 Ga0307414_102624312 189
1394 3300032004 Ga0307414_10263571 Ga0307414_102635712 189
1395 3300032004 Ga0307414_10365160 Ga0307414_103651602 189
1396 3300032004 Ga0307414_10413780 Ga0307414_104137802 189
1397 3300032004 Ga0307414_10502380 Ga0307414_105023802 189
1398 3300032004 Ga0307414_10654107 Ga0307414_106541071 189
1399 3300032004 Ga0307414_10819557 Ga0307414_108195572 189
1400 3300032004 Ga0307414_11252491 Ga0307414_112524911 189
1401 3300032005 Ga0307411_10001141 Ga0307411_100011413 189
1402 3300032005 Ga0307411_10023904 Ga0307411_100239044 189
1403 3300032005 Ga0307411_10027430 Ga0307411_100274304 189
1404 3300032005 Ga0307411_10033553 Ga0307411_100335531 189
1405 3300032005 Ga0307411_10050531 Ga0307411_100505312 189
1406 3300032005 Ga0307411_10085249 Ga0307411_100852492 189
1407 3300032005 Ga0307411_10093411 Ga0307411_100934112 189
1408 3300032005 Ga0307411_10100749 Ga0307411_101007492 189
1409 3300032005 Ga0307411_10126697 Ga0307411_101266972 189
1410 3300032005 Ga0307411_10132238 Ga0307411_101322382 189
1411 3300032005 Ga0307411_10142758 Ga0307411_101427582 189
1412 3300032005 Ga0307411_10269171 Ga0307411_102691712 189
1413 3300032005 Ga0307411_10294967 Ga0307411_102949672 189
1414 3300032005 Ga0307411_10552656 Ga0307411_105526562 189
1415 3300032005 Ga0307411_10639460 Ga0307411_106394602 189
1416 3300032005 Ga0307411_10690011 Ga0307411_106900111 189
1417 3300032005 Ga0307411_11213753 Ga0307411_112137531 189
1418 3300032126 Ga0307415_100038795 Ga0307415_1000387953 189
1419 3300032126 Ga0307415_100082114 Ga0307415_1000821143 189
1420 3300032126 Ga0307415_100089957 Ga0307415_1000899571 189
1421 3300032126 Ga0307415_100102706 Ga0307415_1001027062 189
1422 3300032126 Ga0307415_100118717 Ga0307415_1001187172 189
1423 3300032126 Ga0307415_100149106 Ga0307415_1001491062 189
1424 3300032126 Ga0307415_100161413 Ga0307415_1001614133 189
1425 3300032126 Ga0307415_100183256 Ga0307415_1001832563 189
1426 3300032126 Ga0307415_100218232 Ga0307415_1002182321 189
1427 3300032126 Ga0307415_100532170 Ga0307415_1005321703 189
1428 3300032126 Ga0307415_100552396 Ga0307415_1005523961 189
1429 3300034816 Ga0373930_0011102 Ga0373930_0011102_329_910 189
1430 3300034818 Ga0373950_0015507 Ga0373950_0015507_575_1156 189
1431 3300035086 Ga0373934_0027537 Ga0373934_0027537_1328_1936 189
1432 3300035117 Ga0373953_0018270 Ga0373953_0018270_410_1018 189
1433 3300035118 Ga0373954_0079316 Ga0373954_0079316_736_1317 189
1434 3300035119 Ga0373956_0053239 Ga0373956_0053239_17_598 189
1435 3300035170 Ga0373943_0003454 Ga0373943_0003454_1882_2463 189
1436 3300035170 Ga0373943_0040194 Ga0373943_0040194_1236_1817 189
1437 3300035172 Ga0373955_0009254 Ga0373955_0009254_952_1533 189
1438 3300035241 Ga0373961_0236741 Ga0373961_0236741_58_645 189
1439 3300035691 Ga0373931_0131860 Ga0373931_0131860_435_1022 189
1440 3300035691 Ga0373931_0133606 Ga0373931_0133606_148_729 189
1441 3300035691 Ga0373931_0382790 Ga0373931_0382790_77_658 189
1442 3300035692 Ga0373935_0005654 Ga0373935_0005654_1949_2533 189
1443 3300035692 Ga0373935_0466176 Ga0373935_0466176_170_751 189
1444 3300035724 Ga0373933_0006583 Ga0373933_0006583_5727_6308 189
1445 3300035724 Ga0373933_0022433 Ga0373933_0022433_1280_1888 189
1446 3300035725 Ga0373947_0033024 Ga0373947_0033024_2409_2990 189
1447 3300036401 Ga0373937_0012573 Ga0373937_0012573_288_869 189
1448 3300036401 Ga0373937_0041576 Ga0373937_0041576_2406_3014 189
1449 3300036401 Ga0373937_0279501 Ga0373937_0279501_786_1394 189
1450 3300037068 Ga0373925_0173866 Ga0373925_0173866_452_1033 189
1451 3300037312 Ga0395899_0000469 Ga0395899_0000469_41912_42493 189
1452 3300037312 Ga0395899_0002068 Ga0395899_0002068_14100_14681 189
1453 3300037312 Ga0395899_0003741 Ga0395899_0003741_5494_6075 189
1454 3300037312 Ga0395899_0004956 Ga0395899_0004956_7793_8374 189
1455 3300037312 Ga0395899_0005191 Ga0395899_0005191_4447_5028 189
1456 3300037312 Ga0395899_0015973 Ga0395899_0015973_1046_1627 189
1457 3300037312 Ga0395899_0024588 Ga0395899_0024588_204_785 189
1458 3300037312 Ga0395899_0028892 Ga0395899_0028892_1682_2263 189
1459 3300037312 Ga0395899_0035898 Ga0395899_0035898_2354_2932 189
1460 3300037312 Ga0395899_0047941 Ga0395899_0047941_1242_1826 189
1461 3300037312 Ga0395899_0160337 Ga0395899_0160337_508_1083 189
1462 3300037312 Ga0395899_0161512 Ga0395899_0161512_727_1308 189
1463 3300037312 Ga0395899_0176311 Ga0395899_0176311_389_964 189
1464 3300037312 Ga0395899_0197949 Ga0395899_0197949_810_1391 189
1465 3300037312 Ga0395899_0227249 Ga0395899_0227249_646_1227 189
1466 3300037312 Ga0395899_0241006 Ga0395899_0241006_55_639 189
1467 3300037312 Ga0395899_0450880 Ga0395899_0450880_112_693 189
1468 3300037312 Ga0395899_0461771 Ga0395899_0461771_159_740 189
1469 3300037418 Ga0395900_0000036 Ga0395900_0000036_186214_186795 189
1470 3300037418 Ga0395900_0000693 Ga0395900_0000693_15255_15836 189
1471 3300037418 Ga0395900_0001457 Ga0395900_0001457_5950_6534 189
1472 3300037418 Ga0395900_0002121 Ga0395900_0002121_18082_18663 189
1473 3300037418 Ga0395900_0002327 Ga0395900_0002327_14997_15578 189
1474 3300037418 Ga0395900_0006747 Ga0395900_0006747_10991_11572 189
1475 3300037418 Ga0395900_0011164 Ga0395900_0011164_5945_6526 189
1476 3300037418 Ga0395900_0020419 Ga0395900_0020419_4844_5425 189
1477 3300037418 Ga0395900_0026392 Ga0395900_0026392_751_1332 189
1478 3300037418 Ga0395900_0036154 Ga0395900_0036154_724_1299 189
1479 3300037418 Ga0395900_0048624 Ga0395900_0048624_2466_3047 189
1480 3300037418 Ga0395900_0058883 Ga0395900_0058883_383_964 189
1481 3300037418 Ga0395900_0059487 Ga0395900_0059487_2092_2673 189
1482 3300037418 Ga0395900_0059845 Ga0395900_0059845_750_1331 189
1483 3300037418 Ga0395900_0061831 Ga0395900_0061831_3195_3776 189
1484 3300037418 Ga0395900_0116531 Ga0395900_0116531_1863_2444 189
1485 3300037418 Ga0395900_0149258 Ga0395900_0149258_1657_2235 189
1486 3300037418 Ga0395900_0150092 Ga0395900_0150092_1448_2029 189
1487 3300037418 Ga0395900_0177962 Ga0395900_0177962_156_737 189
1488 3300037418 Ga0395900_0206815 Ga0395900_0206815_714_1289 189
1489 3300037418 Ga0395900_0215573 Ga0395900_0215573_368_949 189
1490 3300037418 Ga0395900_0216856 Ga0395900_0216856_521_1105 189
1491 3300037418 Ga0395900_0234487 Ga0395900_0234487_675_1256 189
1492 3300037418 Ga0395900_0234882 Ga0395900_0234882_801_1382 189
1493 3300037418 Ga0395900_0263949 Ga0395900_0263949_481_1062 189
1494 3300037418 Ga0395900_0266646 Ga0395900_0266646_600_1250 189
1495 3300037418 Ga0395900_0275785 Ga0395900_0275785_743_1324 189
1496 3300037418 Ga0395900_0276660 Ga0395900_0276660_691_1272 189
1497 3300037418 Ga0395900_0290281 Ga0395900_0290281_439_1020 189
1498 3300037418 Ga0395900_0344415 Ga0395900_0344415_223_804 189
1499 3300037418 Ga0395900_0359972 Ga0395900_0359972_237_821 189
1500 3300037418 Ga0395900_0392680 Ga0395900_0392680_724_1305 189
1501 3300037418 Ga0395900_0461747 Ga0395900_0461747_618_1199 189
1502 3300037418 Ga0395900_0519943 Ga0395900_0519943_485_1063 189
1503 3300037418 Ga0395900_0931636 Ga0395900_0931636_107_688 189
1504 3300037418 Ga0395900_0972368 Ga0395900_0972368_176_757 189
1505 3300037418 Ga0395900_1065345 Ga0395900_1065345_81_662 189
1506 3300037466 Ga0395898_0000219 Ga0395898_0000219_131261_131842 189
1507 3300037466 Ga0395898_0003150 Ga0395898_0003150_15255_15836 189
1508 3300037466 Ga0395898_0003602 Ga0395898_0003602_4762_5343 189
1509 3300037466 Ga0395898_0010611 Ga0395898_0010611_929_1510 189
1510 3300037466 Ga0395898_0042883 Ga0395898_0042883_186_767 189
1511 3300037466 Ga0395898_0065293 Ga0395898_0065293_1013_1594 189
1512 3300037466 Ga0395898_0065741 Ga0395898_0065741_61_642 189
1513 3300037466 Ga0395898_0092374 Ga0395898_0092374_1685_2269 189
1514 3300037466 Ga0395898_0100607 Ga0395898_0100607_420_1001 189
1515 3300037466 Ga0395898_0112545 Ga0395898_0112545_1341_1916 189
1516 3300037466 Ga0395898_0116804 Ga0395898_0116804_1366_1941 189
1517 3300037466 Ga0395898_0138163 Ga0395898_0138163_1424_2002 189
1518 3300037466 Ga0395898_0170968 Ga0395898_0170968_456_1040 189
1519 3300037466 Ga0395898_0196202 Ga0395898_0196202_804_1385 189
1520 3300037466 Ga0395898_0202971 Ga0395898_0202971_1076_1657 189
1521 3300037466 Ga0395898_0216371 Ga0395898_0216371_1032_1613 189
1522 3300037466 Ga0395898_0310290 Ga0395898_0310290_233_814 189
1523 3300037466 Ga0395898_0348663 Ga0395898_0348663_811_1386 189
1524 3300037466 Ga0395898_0597293 Ga0395898_0597293_222_800 189
1525 3300037471 Ga0395905_0000092 Ga0395905_0000092_72899_73480 189
1526 3300037471 Ga0395905_0000094 Ga0395905_0000094_132199_132780 189
1527 3300037471 Ga0395905_0000852 Ga0395905_0000852_36981_37562 189
1528 3300037471 Ga0395905_0003007 Ga0395905_0003007_6788_7363 189
1529 3300037471 Ga0395905_0007093 Ga0395905_0007093_7961_8542 189
1530 3300037471 Ga0395905_0011950 Ga0395905_0011950_2931_3512 189
1531 3300037471 Ga0395905_0014631 Ga0395905_0014631_490_1071 189
1532 3300037471 Ga0395905_0017317 Ga0395905_0017317_695_1270 189
1533 3300037471 Ga0395905_0021609 Ga0395905_0021609_1956_2537 189
1534 3300037471 Ga0395905_0032265 Ga0395905_0032265_4010_4591 189
1535 3300037471 Ga0395905_0034468 Ga0395905_0034468_477_1058 189
1536 3300037471 Ga0395905_0036907 Ga0395905_0036907_3660_4241 189
1537 3300037471 Ga0395905_0037996 Ga0395905_0037996_618_1199 189
1538 3300037471 Ga0395905_0038567 Ga0395905_0038567_3101_3682 189
1539 3300037471 Ga0395905_0039077 Ga0395905_0039077_2883_3461 189
1540 3300037471 Ga0395905_0047385 Ga0395905_0047385_2963_3544 189
1541 3300037471 Ga0395905_0059180 Ga0395905_0059180_1866_2447 189
1542 3300037471 Ga0395905_0062392 Ga0395905_0062392_162_743 189
1543 3300037471 Ga0395905_0087199 Ga0395905_0087199_509_1090 189
1544 3300037471 Ga0395905_0088709 Ga0395905_0088709_1749_2327 189
1545 3300037471 Ga0395905_0097478 Ga0395905_0097478_420_1001 189
1546 3300037471 Ga0395905_0116334 Ga0395905_0116334_623_1204 189
1547 3300037471 Ga0395905_0129896 Ga0395905_0129896_215_796 189
1548 3300037471 Ga0395905_0130821 Ga0395905_0130821_88_669 189
1549 3300037471 Ga0395905_0132474 Ga0395905_0132474_332_910 189
1550 3300037471 Ga0395905_0142021 Ga0395905_0142021_321_905 189
1551 3300037471 Ga0395905_0149727 Ga0395905_0149727_727_1308 189
1552 3300037471 Ga0395905_0154193 Ga0395905_0154193_1384_1962 189
1553 3300037471 Ga0395905_0164157 Ga0395905_0164157_525_1106 189
1554 3300037471 Ga0395905_0197669 Ga0395905_0197669_727_1308 189
1555 3300037471 Ga0395905_0208700 Ga0395905_0208700_146_733 189
1556 3300037471 Ga0395905_0259195 Ga0395905_0259195_501_1082 189
1557 3300037471 Ga0395905_0296655 Ga0395905_0296655_572_1150 189
1558 3300037471 Ga0395905_0423806 Ga0395905_0423806_62_643 189
1559 3300037471 Ga0395905_0830465 Ga0395905_0830465_68_649 189
1560 3300037471 Ga0395905_0854417 Ga0395905_0854417_93_674 189
1561 3300037471 Ga0395905_0855814 Ga0395905_0855814_60_632 189
1562 3300037471 Ga0395905_1108082 Ga0395905_1108082_49_630 189
1563 3300037853 Ga0436364_0056487 Ga0436364_0056487_218_787 189
1564 3300037853 Ga0436364_0735745 Ga0436364_0735745_129_710 189
1565 3300038443 Ga0395901_0000036 Ga0395901_0000036_33103_33684 189
1566 3300038443 Ga0395901_0000188 Ga0395901_0000188_48857_49438 189
1567 3300038443 Ga0395901_0000507 Ga0395901_0000507_29088_29669 189
1568 3300038443 Ga0395901_0001734 Ga0395901_0001734_15727_16308 189
1569 3300038443 Ga0395901_0001916 Ga0395901_0001916_15241_15822 189
1570 3300038443 Ga0395901_0003296 Ga0395901_0003296_1997_2581 189
1571 3300038443 Ga0395901_0011544 Ga0395901_0011544_3316_3897 189
1572 3300038443 Ga0395901_0017460 Ga0395901_0017460_2155_2736 189
1573 3300038443 Ga0395901_0021978 Ga0395901_0021978_5517_6098 189
1574 3300038443 Ga0395901_0024326 Ga0395901_0024326_767_1348 189
1575 3300038443 Ga0395901_0027300 Ga0395901_0027300_3991_4572 189
1576 3300038443 Ga0395901_0042159 Ga0395901_0042159_1278_1856 189
1577 3300038443 Ga0395901_0070874 Ga0395901_0070874_2631_3212 189
1578 3300038443 Ga0395901_0079261 Ga0395901_0079261_2387_2968 189
1579 3300038443 Ga0395901_0096722 Ga0395901_0096722_1756_2337 189
1580 3300038443 Ga0395901_0105852 Ga0395901_0105852_1662_2243 189
1581 3300038443 Ga0395901_0108122 Ga0395901_0108122_1730_2314 189
1582 3300038443 Ga0395901_0123748 Ga0395901_0123748_2113_2700 189
1583 3300038443 Ga0395901_0138329 Ga0395901_0138329_17_595 189
1584 3300038443 Ga0395901_0143962 Ga0395901_0143962_695_1270 189
1585 3300038443 Ga0395901_0152863 Ga0395901_0152863_1732_2313 189
1586 3300038443 Ga0395901_0164909 Ga0395901_0164909_1417_1995 189
1587 3300038443 Ga0395901_0224228 Ga0395901_0224228_79_660 189
1588 3300038443 Ga0395901_0236823 Ga0395901_0236823_450_1031 189
1589 3300038443 Ga0395901_0268044 Ga0395901_0268044_979_1554 189
1590 3300038443 Ga0395901_0299974 Ga0395901_0299974_328_909 189
1591 3300038443 Ga0395901_0330308 Ga0395901_0330308_930_1511 189
1592 3300038443 Ga0395901_0333571 Ga0395901_0333571_111_692 189
1593 3300038443 Ga0395901_0545669 Ga0395901_0545669_61_711 189
1594 3300038443 Ga0395901_0633764 Ga0395901_0633764_132_713 189
1595 3300038443 Ga0395901_0670201 Ga0395901_0670201_217_798 189
1596 3300038443 Ga0395901_0670871 Ga0395901_0670871_433_1020 189
1597 3300038443 Ga0395901_0953692 Ga0395901_0953692_144_725 189
1598 3300038443 Ga0395901_1007518 Ga0395901_1007518_42_626 189
1599 3300038742 Ga0400486_21947 Ga0400486_21947_1839_2537 189
1600 3300039110 Ga0400487_65498 Ga0400487_65498_791_1489 189
1601 3300039437 Ga0436365_0063278 Ga0436365_0063278_75_674 189
1602 3300039437 Ga0436365_0597532 Ga0436365_0597532_91_693 189
1603 3300039437 Ga0436365_1179331 Ga0436365_1179331_830_1399 189
1604 3300039438 Ga0436360_0750991 Ga0436360_0750991_155_763 189
1605 3300039447 Ga0436361_0466531 Ga0436361_0466531_3216_3824 189
1606 3300039447 Ga0436361_0496637 Ga0436361_0496637_126_722 189
1607 3300039450 Ga0436363_0624562 Ga0436363_0624562_471_1085 189
1608 3300039453 Ga0436362_0323225 Ga0436362_0323225_27_632 189
1609 3300039453 Ga0436362_0485515 Ga0436362_0485515_218_820 189
1610 3300039453 Ga0436362_0702648 Ga0436362_0702648_2219_2824 189
1611 3300041404 Ga0439436_0016696 Ga0439436_0016696_1383_1952 189
1612 3300041410 Ga0439461_0000003 Ga0439461_0000003_4853_5422 189
1613 3300041411 Ga0439466_0106679 Ga0439466_0106679_189_758 189
1614 3300042002 Ga0439442_019414 Ga0439442_019414_549_1118 189
1615 3300042004 Ga0439445_0012475 Ga0439445_0012475_1256_1825 189
1616 3300042006 Ga0439432_001354 Ga0439432_001354_3769_4338 189
1617 3300042006 Ga0439432_158026 Ga0439432_158026_75_653 189
1618 3300042015 Ga0439462_0000690 Ga0439462_0000690_539_1108 189
1619 3300042125 Ga0450923_025338 Ga0450923_025338_190_780 189
1620 3300042435 Ga0439434_0002192 Ga0439434_0002192_1197_1766 189
1621 3300042439 Ga0439464_0040518 Ga0439464_0040518_205_777 189
1622 3300044656 Ga0466969_0158624 Ga0466969_0158624_211_792 189
1623 3300044656 Ga0466969_0171710 Ga0466969_0171710_403_984 189
1624 3300044658 Ga0466972_0025780 Ga0466972_0025780_227_808 189
1625 3300044658 Ga0466972_0081179 Ga0466972_0081179_876_1454 189
1626 3300044658 Ga0466972_0202027 Ga0466972_0202027_336_911 189
1627 3300044684 Ga0466966_0020701 Ga0466966_0020701_848_1429 189
1628 3300044684 Ga0466966_0059459 Ga0466966_0059459_1734_2315 189
1629 3300044684 Ga0466966_0076988 Ga0466966_0076988_724_1299 189
1630 3300044684 Ga0466966_0182216 Ga0466966_0182216_159_737 189
1631 3300044684 Ga0466966_0284141 Ga0466966_0284141_183_764 189
1632 3300044693 Ga0466961_0041598 Ga0466961_0041598_2283_2864 189
1633 3300044693 Ga0466961_0071333 Ga0466961_0071333_1228_1809 189
1634 3300044693 Ga0466961_0137456 Ga0466961_0137456_617_1192 189
1635 3300044693 Ga0466961_0517088 Ga0466961_0517088_16_597 189
1636 3300044694 Ga0466963_0011929 Ga0466963_0011929_1528_2109 189
1637 3300044694 Ga0466963_0016767 Ga0466963_0016767_2432_3013 189
1638 3300044694 Ga0466963_0021242 Ga0466963_0021242_3321_3902 189
1639 3300044694 Ga0466963_0067560 Ga0466963_0067560_240_821 189
1640 3300044694 Ga0466963_0074568 Ga0466963_0074568_243_824 189
1641 3300044694 Ga0466963_0078713 Ga0466963_0078713_1237_1818 189
1642 3300044694 Ga0466963_0152993 Ga0466963_0152993_908_1489 189
1643 3300044694 Ga0466963_0250757 Ga0466963_0250757_261_842 189
1644 3300044694 Ga0466963_0517000 Ga0466963_0517000_226_807 189
1645 3300044719 Ga0466971_0007284 Ga0466971_0007284_3448_4029 189
1646 3300044719 Ga0466971_0012362 Ga0466971_0012362_2888_3469 189
1647 3300044719 Ga0466971_0052568 Ga0466971_0052568_1202_1777 189
1648 3300044719 Ga0466971_0140775 Ga0466971_0140775_420_1001 189
1649 3300044735 Ga0466968_0057185 Ga0466968_0057185_771_1343 189
1650 3300044842 Ga0466957_0001958 Ga0466957_0001958_6208_6789 189
1651 3300044842 Ga0466957_0051968 Ga0466957_0051968_1322_1924 189
1652 3300044842 Ga0466957_0055123 Ga0466957_0055123_1438_2019 189
1653 3300044842 Ga0466957_0060366 Ga0466957_0060366_848_1426 189
1654 3300044842 Ga0466957_0133870 Ga0466957_0133870_814_1395 189
1655 3300044842 Ga0466957_0240669 Ga0466957_0240669_133_714 189
1656 3300044842 Ga0466957_0380649 Ga0466957_0380649_274_855 189
1657 3300044901 Ga0466960_0171142 Ga0466960_0171142_454_1029 189
1658 3300045049 Ga0466959_0083918 Ga0466959_0083918_180_761 189
1659 3300045049 Ga0466959_0104528 Ga0466959_0104528_577_1155 189
1660 3300045049 Ga0466959_0327357 Ga0466959_0327357_65_646 189
1661 3300045836 Ga0466958_0002377 Ga0466958_0002377_6114_6695 189
1662 3300045836 Ga0466958_0004434 Ga0466958_0004434_5049_5630 189
1663 3300045836 Ga0466958_0215791 Ga0466958_0215791_490_1065 189
1664 3300045976 Ga0466967_0000246 Ga0466967_0000246_22790_23392 189
1665 3300045976 Ga0466967_0008265 Ga0466967_0008265_3676_4257 189
1666 3300045976 Ga0466967_0012949 Ga0466967_0012949_2237_2818 189
1667 3300045976 Ga0466967_0022533 Ga0466967_0022533_1745_2326 189
1668 3300045976 Ga0466967_0072801 Ga0466967_0072801_2475_3056 189
1669 3300045976 Ga0466967_0147647 Ga0466967_0147647_528_1109 189
1670 3300045976 Ga0466967_0163685 Ga0466967_0163685_668_1249 189
1671 3300045976 Ga0466967_0169807 Ga0466967_0169807_776_1354 189
1672 3300045976 Ga0466967_0345804 Ga0466967_0345804_760_1338 189
1673 3300045976 Ga0466967_0362026 Ga0466967_0362026_361_942 189
1674 3300045976 Ga0466967_0484151 Ga0466967_0484151_390_971 189
1675 3300045976 Ga0466967_0663079 Ga0466967_0663079_348_929 189
1676 3300045976 Ga0466967_1372139 Ga0466967_1372139_12_593 189
1677 3300045976 Ga0466967_1526447 Ga0466967_1526447_56_637 189
1678 3300046473 Ga0495582_0524604 Ga0495582_0524604_19_600 189
1679 3300046492 Ga0495585_0178703 Ga0495585_0178703_231_803 189
1680 3300046500 Ga0495596_0001536 Ga0495596_0001536_3453_4022 189
1681 3300046501 Ga0495607_0188581 Ga0495607_0188581_373_948 189
1682 3300046506 Ga0495583_0002337 Ga0495583_0002337_7700_8269 189
1683 3300046507 Ga0495606_0016302 Ga0495606_0016302_4013_4582 189
1684 3300046507 Ga0495606_0025801 Ga0495606_0025801_2097_2666 189
1685 3300046507 Ga0495606_0120227 Ga0495606_0120227_835_1404 189
1686 3300046515 Ga0495620_0253093 Ga0495620_0253093_26_607 189
1687 3300046522 Ga0495643_0309484 Ga0495643_0309484_99_671 189
1688 3300046524 Ga0495648_0029401 Ga0495648_0029401_3018_3587 189
1689 3300046525 Ga0495663_0012158 Ga0495663_0012158_1472_2044 189
1690 3300046525 Ga0495663_0063679 Ga0495663_0063679_220_798 189
1691 3300046528 Ga0495642_0288822 Ga0495642_0288822_43_651 189
1692 3300046533 Ga0495640_0123372 Ga0495640_0123372_172_780 189
1693 3300046537 Ga0495598_0019323 Ga0495598_0019323_447_1025 189
1694 3300046537 Ga0495598_0020362 Ga0495598_0020362_184_765 189
1695 3300046539 Ga0495621_0000006 Ga0495621_0000006_4555_5136 189
1696 3300046539 Ga0495621_0021282 Ga0495621_0021282_1381_1953 189
1697 3300046539 Ga0495621_0024628 Ga0495621_0024628_205_807 189
1698 3300046558 Ga0495633_0005427 Ga0495633_0005427_4385_4963 189
1699 3300046558 Ga0495633_0247820 Ga0495633_0247820_93_665 189
1700 3300046616 Ga0495668_0012996 Ga0495668_0012996_4136_4717 189
1701 3300046663 Ga0495635_0562677 Ga0495635_0562677_88_696 189
1702 3300046664 Ga0495659_0208772 Ga0495659_0208772_84_686 189
1703 3300046665 Ga0495661_0065493 Ga0495661_0065493_1331_1900 189
1704 3300046681 Ga0495647_0196676 Ga0495647_0196676_210_791 189
1705 3300046684 Ga0495669_0000046 Ga0495669_0000046_457_1035 189
1706 3300046684 Ga0495669_0000899 Ga0495669_0000899_9538_10119 189
1707 3300046684 Ga0495669_0011898 Ga0495669_0011898_3031_3612 189
1708 3300046684 Ga0495669_0027982 Ga0495669_0027982_564_1145 189
1709 3300046684 Ga0495669_0028082 Ga0495669_0028082_1702_2274 189
1710 3300046684 Ga0495669_0062618 Ga0495669_0062618_694_1272 189
1711 3300046684 Ga0495669_0095832 Ga0495669_0095832_560_1141 189
1712 3300046684 Ga0495669_0157825 Ga0495669_0157825_199_780 189
1713 3300046684 Ga0495669_0159378 Ga0495669_0159378_178_759 189
1714 3300046684 Ga0495669_0200617 Ga0495669_0200617_361_942 189
1715 3300046684 Ga0495669_0260916 Ga0495669_0260916_195_767 189
1716 3300046691 Ga0495670_0000226 Ga0495670_0000226_1178_1759 189
1717 3300046691 Ga0495670_0005650 Ga0495670_0005650_484_1128 189
1718 3300046691 Ga0495670_0006081 Ga0495670_0006081_4944_5522 189
1719 3300046691 Ga0495670_0041836 Ga0495670_0041836_1568_2140 189
1720 3300046691 Ga0495670_0053070 Ga0495670_0053070_976_1554 189
1721 3300046691 Ga0495670_0098993 Ga0495670_0098993_126_728 189
1722 3300046691 Ga0495670_0108046 Ga0495670_0108046_353_931 189
1723 3300047320 Ga0495672_0158392 Ga0495672_0158392_480_1061 189
1724 3300047322 Ga0495680_0119035 Ga0495680_0119035_24_632 189
1725 3300047445 Ga0495677_0017955 Ga0495677_0017955_1115_1687 189
1726 3300047445 Ga0495677_0091079 Ga0495677_0091079_317_898 189
1727 3300047445 Ga0495677_0114134 Ga0495677_0114134_58_642 189
1728 3300047445 Ga0495677_0168893 Ga0495677_0168893_61_639 189
1729 3300047445 Ga0495677_0204866 Ga0495677_0204866_86_664 189
1730 3300047469 Ga0495673_0093939 Ga0495673_0093939_205_774 189
1731 3300047472 Ga0495686_0000057 Ga0495686_0000057_228049_228618 189
1732 3300047472 Ga0495686_0000477 Ga0495686_0000477_53146_53715 189
1733 3300047472 Ga0495686_0003829 Ga0495686_0003829_12106_12675 189
1734 3300047472 Ga0495686_0015096 Ga0495686_0015096_3807_4376 189
1735 3300047472 Ga0495686_0059205 Ga0495686_0059205_1017_1586 189
1736 3300047472 Ga0495686_0402191 Ga0495686_0402191_149_718 189
1737 3300048088 Ga0495602_0074155 Ga0495602_0074155_1520_2101 189
1738 3300048088 Ga0495602_0231169 Ga0495602_0231169_707_1315 189
1739 3300048903 Ga0496100_0008472 Ga0496100_0008472_2168_2749 189
1740 3300048903 Ga0496100_0797301 Ga0496100_0797301_118_699 189
1741 3300048903 Ga0496100_0949546 Ga0496100_0949546_41_622 189
1742 3300048904 Ga0496101_0053369 Ga0496101_0053369_1079_1660 189
1743 3300048904 Ga0496101_0072754 Ga0496101_0072754_1807_2385 189
1744 3300048904 Ga0496101_0194276 Ga0496101_0194276_875_1456 189
1745 3300048904 Ga0496101_0204288 Ga0496101_0204288_184_762 189
1746 3300048904 Ga0496101_0220811 Ga0496101_0220811_597_1172 189
1747 3300048905 Ga0496102_0307846 Ga0496102_0307846_837_1406 189
1748 3300048905 Ga0496102_0579528 Ga0496102_0579528_119_700 189
1749 3300048905 Ga0496102_0919246 Ga0496102_0919246_189_770 189
1750 3300048906 Ga0496103_0430726 Ga0496103_0430726_159_740 189
1751 3300048906 Ga0496103_0470787 Ga0496103_0470787_37_612 189
1752 3300048907 Ga0496104_0059119 Ga0496104_0059119_1039_1620 189
1753 3300048909 Ga0496106_0049308 Ga0496106_0049308_496_1077 189
1754 3300048910 Ga0496107_0015522 Ga0496107_0015522_2595_3173 189
1755 3300048910 Ga0496107_0033455 Ga0496107_0033455_1656_2234 189
1756 3300048910 Ga0496107_0061440 Ga0496107_0061440_1848_2429 189
1757 3300048910 Ga0496107_0075703 Ga0496107_0075703_1818_2396 189
1758 3300048910 Ga0496107_0125732 Ga0496107_0125732_1004_1579 189
1759 3300048910 Ga0496107_0282031 Ga0496107_0282031_618_1199 189
1760 3300048910 Ga0496107_0313081 Ga0496107_0313081_330_911 189
1761 3300048911 Ga0496108_0004204 Ga0496108_0004204_5772_6353 189
1762 3300048911 Ga0496108_0198110 Ga0496108_0198110_1027_1608 189
1763 3300048911 Ga0496108_0398180 Ga0496108_0398180_607_1188 189
1764 3300048911 Ga0496108_0536487 Ga0496108_0536487_362_940 189
1765 3300048912 Ga0496109_0008646 Ga0496109_0008646_5993_6574 189
1766 3300048912 Ga0496109_0110625 Ga0496109_0110625_1859_2437 189
1767 3300048912 Ga0496109_0130712 Ga0496109_0130712_684_1262 189
1768 3300048912 Ga0496109_0159208 Ga0496109_0159208_23_601 189
1769 3300048912 Ga0496109_0293959 Ga0496109_0293959_749_1330 189
1770 3300048912 Ga0496109_0380326 Ga0496109_0380326_11_613 189
1771 3300048912 Ga0496109_0679792 Ga0496109_0679792_267_848 189
1772 3300048912 Ga0496109_1454673 Ga0496109_1454673_24_605 189
1773 3300048913 Ga0496110_0001264 Ga0496110_0001264_6531_7112 189
1774 3300048913 Ga0496110_0001911 Ga0496110_0001911_6208_6777 189
1775 3300048913 Ga0496110_0084190 Ga0496110_0084190_1979_2560 189
1776 3300048913 Ga0496110_0151178 Ga0496110_0151178_307_885 189
1777 3300048913 Ga0496110_0233856 Ga0496110_0233856_74_652 189
1778 3300048914 Ga0496111_0018746 Ga0496111_0018746_4084_4665 189
1779 3300048914 Ga0496111_0062548 Ga0496111_0062548_448_1029 189
1780 3300048914 Ga0496111_0081579 Ga0496111_0081579_646_1215 189
1781 3300048914 Ga0496111_0094371 Ga0496111_0094371_807_1388 189
1782 3300048914 Ga0496111_0188372 Ga0496111_0188372_220_795 189
1783 3300048914 Ga0496111_0189369 Ga0496111_0189369_523_1104 189
1784 3300048914 Ga0496111_0299648 Ga0496111_0299648_497_1075 189
1785 3300048915 Ga0496112_0001065 Ga0496112_0001065_17477_18058 189
1786 3300048915 Ga0496112_0028311 Ga0496112_0028311_1027_1608 189
1787 3300048915 Ga0496112_0103424 Ga0496112_0103424_1342_1923 189
1788 3300048915 Ga0496112_0248126 Ga0496112_0248126_892_1470 189
1789 3300048915 Ga0496112_0427729 Ga0496112_0427729_367_948 189
1790 3300048915 Ga0496112_0489690 Ga0496112_0489690_577_1152 189
1791 3300048915 Ga0496112_0623980 Ga0496112_0623980_271_849 189
1792 3300048915 Ga0496112_0680649 Ga0496112_0680649_38_619 189
1793 3300048915 Ga0496112_0884991 Ga0496112_0884991_113_691 189
1794 3300048915 Ga0496112_0943288 Ga0496112_0943288_25_606 189
1795 3300048916 Ga0496113_0001345 Ga0496113_0001345_12511_13092 189
1796 3300048916 Ga0496113_0022966 Ga0496113_0022966_414_992 189
1797 3300048916 Ga0496113_0135969 Ga0496113_0135969_735_1316 189
1798 3300048916 Ga0496113_0139252 Ga0496113_0139252_1071_1652 189
1799 3300048917 Ga0496114_0005688 Ga0496114_0005688_3669_4250 189
1800 3300048917 Ga0496114_0007769 Ga0496114_0007769_4281_4859 189
1801 3300048918 Ga0496115_0096225 Ga0496115_0096225_142_723 189
1802 3300048919 Ga0496116_0038519 Ga0496116_0038519_40_609 189
1803 3300048920 Ga0496117_0008375 Ga0496117_0008375_3749_4318 189
1804 3300048920 Ga0496117_0017437 Ga0496117_0017437_483_1052 189
1805 3300048920 Ga0496117_0031114 Ga0496117_0031114_1646_2215 189
1806 3300048920 Ga0496117_0039799 Ga0496117_0039799_608_1177 189
1807 3300048921 Ga0496118_0001203 Ga0496118_0001203_17016_17585 189
1808 3300048921 Ga0496118_0037602 Ga0496118_0037602_1341_1910 189
1809 3300048921 Ga0496118_0091238 Ga0496118_0091238_741_1310 189
1810 3300048922 Ga0496119_0070474 Ga0496119_0070474_1181_1750 189
1811 3300048924 Ga0496121_0006378 Ga0496121_0006378_8975_9544 189
1812 3300048924 Ga0496121_0057655 Ga0496121_0057655_118_687 189
1813 3300048924 Ga0496121_0124737 Ga0496121_0124737_56_628 189
1814 3300048924 Ga0496121_0235644 Ga0496121_0235644_20_589 189
1815 3300048925 Ga0496122_0004742 Ga0496122_0004742_8235_8804 189
1816 3300048925 Ga0496122_0005520 Ga0496122_0005520_8265_8834 189
1817 3300048925 Ga0496122_0022141 Ga0496122_0022141_102_671 189
1818 3300048926 Ga0496123_0000643 Ga0496123_0000643_38706_39275 189
1819 3300048926 Ga0496123_0060819 Ga0496123_0060819_450_1019 189
1820 3300048926 Ga0496123_0064353 Ga0496123_0064353_108_677 189
1821 3300048926 Ga0496123_0068512 Ga0496123_0068512_1135_1704 189
1822 3300048927 Ga0496124_0001391 Ga0496124_0001391_27845_28414 189
1823 3300048927 Ga0496124_0002938 Ga0496124_0002938_18507_19076 189
1824 3300048927 Ga0496124_0011317 Ga0496124_0011317_6585_7154 189
1825 3300048927 Ga0496124_0015121 Ga0496124_0015121_4908_5477 189
1826 3300048927 Ga0496124_0021788 Ga0496124_0021788_4589_5158 189
1827 3300048927 Ga0496124_0026490 Ga0496124_0026490_3324_3893 189
1828 3300048927 Ga0496124_0071149 Ga0496124_0071149_1791_2360 189
1829 3300048927 Ga0496124_0168069 Ga0496124_0168069_377_946 189
1830 3300048928 Ga0496125_0000898 Ga0496125_0000898_7156_7725 189
1831 3300049460 Ga0495682_0012661 Ga0495682_0012661_1407_1976 189
1832 3300049513 Ga0501290_006143 Ga0501290_006143_123_695 189
1833 3300049513 Ga0501290_006879 Ga0501290_006879_473_1042 189
1834 3300049570 Ga0501033_0114789 Ga0501033_0114789_1129_1698 189
1835 3300049570 Ga0501033_0200204 Ga0501033_0200204_65_784 189
1836 3300049573 Ga0501037_0037820 Ga0501037_0037820_121_852 189
1837 3300049579 Ga0501043_0150855 Ga0501043_0150855_653_1384 189
1838 3300049581 Ga0501047_0126065 Ga0501047_0126065_902_1471 189
1839 3300049583 Ga0501067_0000593 Ga0501067_0000593_4379_5071 189
1840 3300049584 Ga0501068_0187276 Ga0501068_0187276_110_691 189
1841 3300049585 Ga0501069_0162809 Ga0501069_0162809_301_993 189
1842 3300049586 Ga0501070_0031707 Ga0501070_0031707_435_1016 189
1843 3300049586 Ga0501070_0104743 Ga0501070_0104743_1571_2152 189
1844 3300049589 Ga0501073_0072305 Ga0501073_0072305_677_1369 189
1845 3300049592 Ga0501076_0183921 Ga0501076_0183921_110_802 189
1846 3300049593 Ga0501077_0085510 Ga0501077_0085510_579_1277 189
1847 3300049652 Ga0501202_051701 Ga0501202_051701_61_633 189
1848 3300049652 Ga0501202_098890 Ga0501202_098890_68_649 189
1849 3300049658 Ga0501211_002878 Ga0501211_002878_390_959 189
1850 3300049661 Ga0501217_019640 Ga0501217_019640_516_1097 189
1851 3300049661 Ga0501217_063064 Ga0501217_063064_365_946 189
1852 3300049663 Ga0501223_014019 Ga0501223_014019_263_835 189
1853 3300049669 Ga0501235_003753 Ga0501235_003753_501_1070 189
1854 3300049679 Ga0501249_020995 Ga0501249_020995_485_1066 189
1855 3300049684 Ga0501255_019040 Ga0501255_019040_245_814 189
1856 3300049686 Ga0501257_000315 Ga0501257_000315_1306_1878 189
1857 3300049704 Ga0501221_093272 Ga0501221_093272_121_702 189
1858 3300049705 Ga0501225_0007843 Ga0501225_0007843_2438_3070 189
1859 3300049705 Ga0501225_0017020 Ga0501225_0017020_237_806 189
1860 3300049705 Ga0501225_0055558 Ga0501225_0055558_432_1001 189
1861 3300049705 Ga0501225_0083567 Ga0501225_0083567_158_739 189
1862 3300049708 Ga0501245_007672 Ga0501245_007672_252_821 189
1863 3300049742 Ga0501080_0023627 Ga0501080_0023627_2399_2977 189
1864 3300049742 Ga0501080_0128166 Ga0501080_0128166_1079_1810 189
1865 3300049742 Ga0501080_0513335 Ga0501080_0513335_318_899 189
1866 3300049744 Ga0501083_0081812 Ga0501083_0081812_703_1395 189
1867 3300049765 Ga0501268_077855 Ga0501268_077855_76_645 189
1868 3300049767 Ga0501270_003504 Ga0501270_003504_987_1568 189
1869 3300049771 Ga0501274_013464 Ga0501274_013464_59_628 189
1870 3300049776 Ga0501280_006942 Ga0501280_006942_865_1437 189
1871 3300049850 Ga0501204_022273 Ga0501204_022273_157_738 189
1872 3300050510 nmdc:mga06r32_6024_c1 nmdc:mga06r32_6024_c1_1351_1926 189
1873 3300050511 nmdc:mga08y16_430641_c1 nmdc:mga08y16_430641_c1_557_1132 189
1874 3300050511 nmdc:mga08y16_48536_c1 nmdc:mga08y16_48536_c1_2790_3362 189
1875 3300050512 nmdc:mga0n895_170448_c1 nmdc:mga0n895_170448_c1_1208_1786 189
1876 3300050512 nmdc:mga0n895_56477_c1 nmdc:mga0n895_56477_c1_2710_3291 189
1877 3300050513 nmdc:mga0rr50_708594_c1 nmdc:mga0rr50_708594_c1_263_844 189
1878 3300050514 nmdc:mga08x19_625014_c1 nmdc:mga08x19_625014_c1_20_592 189
1879 3300053078 Ga0495612_0157865 Ga0495612_0157865_300_881 189
1880 3300053085 Ga0495619_0025919 Ga0495619_0025919_2714_3322 189
1881 3300053085 Ga0495619_0394056 Ga0495619_0394056_47_655 189
1882 3300053087 Ga0500643_001561 Ga0500643_001561_5693_6265 189
1883 3300053094 Ga0500566_0036302 Ga0500566_0036302_345_914 189
1884 3300053096 Ga0500641_0091562 Ga0500641_0091562_617_1192 189
1885 3300053119 Ga0500595_001850 Ga0500595_001850_4843_5418 189
1886 3300053134 Ga0500658_0005731 Ga0500658_0005731_3761_4330 189
1887 3300054114 Ga0501084_0035925 Ga0501084_0035925_414_1106 189
1888 3300054114 Ga0501084_0107819 Ga0501084_0107819_515_1204 189
1889 3300054114 Ga0501084_0471972 Ga0501084_0471972_345_1037 189
1890 3300059510 Ga0587090_011437 Ga0587090_011437_453_1034 189
1891 3300060353 Ga0501082_0198787 Ga0501082_0198787_643_1224 189
1892 3300061719 Ga0466962_0006392 Ga0466962_0006392_1878_2459 189
1893 3300061719 Ga0466962_0011492 Ga0466962_0011492_3313_3894 189
1894 3300061719 Ga0466962_0024525 Ga0466962_0024525_2023_2604 189
1895 3300061719 Ga0466962_0209331 Ga0466962_0209331_221_796 189

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01195

Pept_tRNA_hydro

Peptidyl-tRNA hydrolase

47

228

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
4zxp-assembly3.cif.gz_A crystal structure of peptidyl- trna hydrolase from vibrio cholerae 0.9514 1 183
5imb-assembly1.cif.gz_A crystal structure of peptidyl-trna hydrolase mutant-n14d from vibrio cholerae 0.9499 1 183
8axp-assembly1.cif.gz_B neisseria gonorrhoeae peptidyl-trna hydrolase complexed with an xchem hit. 0.9482 2 183
2z2j-assembly1.cif.gz_A crystal structure of peptidyl-trna hydrolase from mycobacterium tuberculosis 0.9481 2 171
4p7b-assembly2.cif.gz_C crystal structure of s. typhimurium peptidyl-trna hydrolase 0.9454 2 183
ID Description Score Start End Superfamily
5ektA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidyl-tRNA hydrolase 0.9374 1 183 3.40.50.1470
af_Q10LI6_46_183_3.40.50.1470 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidyl-tRNA hydrolase 0.9261 2 131 3.40.50.1470
4ylyA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidyl-tRNA hydrolase 0.9156 1 183 3.40.50.1470
4q55B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidyl-tRNA hydrolase 0.9129 2 182 3.40.50.1470
5ektA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidyl-tRNA hydrolase 0.904 1 183 3.40.50.1470
ID Description Score Start End GO Terms
AF-A0A0Q4FF18-F1-model_v4 Peptidyl-tRNA hydrolase (PTH) (EC 3.1.1.29) 1.001 1 187 GO:0004045
GO:0005737
GO:0006412
AF-A0A527ZGE1-F1-model_v4 Peptidyl-tRNA hydrolase 1.001 1 79 GO:0004045
AF-A0A6A5KUW1-F1-model_v4 deleted 1 1 183
AF-A0A7Y9URY0-F1-model_v4 Peptidyl-tRNA hydrolase (PTH) (EC 3.1.1.29) 0.9987 1 188 GO:0004045
GO:0005737
GO:0006412
AF-A0A356FV50-F1-model_v4 Aminoacyl-tRNA hydrolase 0.9987 1 74 GO:0004045

Feature Viewer

pLDDT pTM Quality
96.53 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map