F495997

General Info

Members Datasets Scaffolds Average Seq Length
1895 1216 3790 82

Family's Representative Sequence

Representative Sequence 3300041410|Ga0439461_0081342|Ga0439461_0081342_362_649
Length 95
Sequence MAEKGSHSGATVPAAEPNPVGDLSFEKALAELEEIVGKLERGDVPLAESIAFYERGEALKKHCETLLKAAEDRIEKIRLDRNGKPQGVEPLDAEQ

Samples

Sample ID Description Type Environment
1 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
5 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
6 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
7 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
8 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
9 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
10 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
11 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
12 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
13 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
14 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
15 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
16 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
17 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
18 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
19 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
20 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
21 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
22 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
23 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
46 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
49 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
50 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
51 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
52 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
53 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
54 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
55 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
56 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
57 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
58 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
60 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
61 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
62 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
63 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
64 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
65 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
66 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
67 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
68 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
69 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
70 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
71 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
72 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
73 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
74 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
75 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
76 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
77 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
78 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
79 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
80 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
81 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
82 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
83 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
84 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
85 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
86 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
87 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
88 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
89 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
90 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
91 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
92 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
95 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
96 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
97 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
98 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
101 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
102 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
103 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
105 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
106 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
107 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
109 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
110 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
111 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
113 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
114 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
115 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
153 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
154 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
155 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
156 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
160 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
161 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
162 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
163 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
164 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
165 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
166 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
167 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
168 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
169 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
170 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
171 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
172 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
173 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
174 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
175 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
176 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
177 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
178 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
179 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
180 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
181 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
182 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
183 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
184 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
185 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
186 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
187 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
188 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
189 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
190 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
191 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
192 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
193 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
194 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
195 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
196 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
197 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
198 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
199 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
200 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
201 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
202 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
203 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
204 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
205 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
206 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
207 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
208 3300041497 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaT Metatranscriptome Unclassified
209 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
210 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
211 3300041502 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaT Metatranscriptome Unclassified
212 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
213 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
214 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
215 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
216 3300041510 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaT Metatranscriptome Unclassified
217 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
218 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
219 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
220 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
221 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
222 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
223 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
224 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
225 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
226 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
227 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
228 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
229 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
230 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
231 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
232 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
233 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
234 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
235 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
236 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
237 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
238 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
239 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
240 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
241 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
242 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
243 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
244 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
245 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
246 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
247 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
248 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
249 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
250 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
251 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
252 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
253 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
254 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
255 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
256 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
257 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
258 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
259 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
260 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
261 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
262 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
263 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
264 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
265 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
266 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
267 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
268 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
269 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
270 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
271 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
272 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
273 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
274 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
275 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
276 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
277 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
278 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
279 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
280 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
281 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
282 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
283 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
284 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
285 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
286 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
287 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
288 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
289 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
290 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
291 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
292 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
293 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
294 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
295 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
296 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
297 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
298 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
299 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
300 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
301 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
302 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
303 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
304 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
305 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
306 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
307 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
308 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
309 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
310 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
311 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
312 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
313 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
314 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
315 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
316 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
317 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
318 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
319 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
320 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
321 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
322 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
323 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
324 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
325 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
326 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
327 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
328 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
329 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
330 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
331 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
332 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
333 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
334 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
335 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
336 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
337 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
338 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
339 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
340 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
341 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
342 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
343 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
344 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
345 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
346 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
347 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
348 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
349 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
350 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
351 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
352 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
353 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
354 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
355 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
356 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
357 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
358 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
359 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
360 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
361 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
362 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
363 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
364 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
365 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
366 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
367 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
368 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
369 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
370 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
371 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
372 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
373 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
374 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
375 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
376 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
377 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
378 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
379 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
380 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
381 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
382 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
383 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
384 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
385 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
386 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
387 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
388 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
389 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
390 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
391 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
392 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
393 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
394 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
395 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
396 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
397 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
398 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
399 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
400 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
401 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
402 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
403 2512875024
404 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
405 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
406 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
407 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
408 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
409 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
410 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
411 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
412 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
413 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
414 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
415 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
416 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
417 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
418 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
419 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
420 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
421 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
422 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
423 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
424 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
425 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
426 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
427 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
428 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
429 2516143018 Ensifer sp. BR816 Isolate Nodule
430 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
431 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
432 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
433 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
434 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
435 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
436 2519899620 Rhizobium sp. Pop5 Isolate Nodule
437 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
438 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
439 2534681786 Brucella suis 92/29 Isolate Unclassified
440 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
441 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
442 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
443 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
444 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
445 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
446 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
447 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
448 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
449 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
450 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
451 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
452 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
453 2558860983 Allorhizobium undicola ATCC 700741 Isolate Rhizoplane
454 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
455 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
456 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
457 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
458 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
459 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
460 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
461 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
462 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
463 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
464 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
465 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
466 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
467 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
468 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
469 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
470 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
471 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
472 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
473 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
474 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
475 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
476 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
477 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
478 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
479 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
480 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
481 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
482 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
483 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
484 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
485 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
486 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
487 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
488 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
489 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
490 2643221550 Mesorhizobium sp. Root552 Isolate Unclassified
491 2643221551 Mesorhizobium sp. Root1471 Isolate Unclassified
492 2643221555 Mesorhizobium sp. Root554 Isolate Unclassified
493 2643221557 Ensifer sp. Root558 Isolate Unclassified
494 2643221558 Rhizobium sp. Root149 Isolate Unclassified
495 2643221564 Mesorhizobium sp. Root157 Isolate Unclassified
496 2643221568 Rhizobium sp. Root564 Isolate Unclassified
497 2643221580 Devosia sp. Root635 Isolate Unclassified
498 2643221582 Rhizobium sp. Root651 Isolate Unclassified
499 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
500 2643221599 Rhizobium sp. Root708 Isolate Unclassified
501 2643221610 Ensifer sp. Root74 Isolate Unclassified
502 2643221618 Ensifer sp. Root231 Isolate Unclassified
503 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
504 2643221626 Ensifer sp. Root31 Isolate Unclassified
505 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
506 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
507 2643221655 Ensifer sp. Root1252 Isolate Unclassified
508 2643221659 Ensifer sp. Root127 Isolate Unclassified
509 2643221668 Ensifer sp. Root423 Isolate Unclassified
510 2643221674 Devosia sp. Root436 Isolate Unclassified
511 2643221675 Ensifer sp. Root1298 Isolate Unclassified
512 2643221680 Ensifer sp. Root1312 Isolate Unclassified
513 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
514 2643221693 Rhizobium sp. Root491 Isolate Unclassified
515 2643221698 Ensifer sp. Root142 Isolate Unclassified
516 2643221712 Ensifer sp. Root258 Isolate Unclassified
517 2643221719 Rhizobium sp. Root274 Isolate Unclassified
518 2643221723 Ensifer sp. Root278 Isolate Unclassified
519 2643221726 Ensifer sp. Root954 Isolate Unclassified
520 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
521 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
522 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
523 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
524 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
525 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
526 2718217882 Rhizobium sp. N741 Isolate Nodule
527 2718217927 Rhizobium sp. N324 Isolate Nodule
528 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
529 2718218009 Rhizobium sp. N561 Isolate Nodule
530 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
531 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
532 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
533 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
534 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
535 2718218363 Rhizobium sp. N113 Isolate Nodule
536 2718218365 Rhizobium sp. N731 Isolate Nodule
537 2718218366 Rhizobium sp. N621 Isolate Nodule
538 2718218423 Rhizobium sp. N941 Isolate Nodule
539 2721755514 Rhizobium sp. N6212 Isolate Nodule
540 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
541 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
542 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
543 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
544 2721755809 Rhizobium sp. N541 Isolate Nodule
545 2721755810 Rhizobium sp. N871 Isolate Nodule
546 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
547 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
548 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
549 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
550 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
551 2728369365 Rhizobium sp. N1341 Isolate Nodule
552 2728369397 Rhizobium sp. N1314 Isolate Nodule
553 2738541293 Rhizobium sp. GV031 Isolate Unclassified
554 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
555 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
556 2738543024 Aminobacter sp. AP02 Isolate Unclassified
557 2751185800 Brucella pituitosa AA2 Isolate Unclassified
558 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
559 2757320392 Phyllobacterium leguminum ORS 1419 Isolate Nodule
560 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
561 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
562 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
563 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
564 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
565 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
566 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
567 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
568 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
569 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
570 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
571 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
572 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
573 2791355256 Rhizobium sp. M10 Isolate Nodule
574 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
575 2791355260 Rhizobium sp. L9 Isolate Nodule
576 2791355262 Rhizobium sp. M1 Isolate Nodule
577 2791355264 Rhizobium sp. S9 Isolate Nodule
578 2791355265 Rhizobium sp. H4 Isolate Nodule
579 2791355266 Rhizobium sp. L43 Isolate Nodule
580 2791355267 Rhizobium sp. L18 Isolate Nodule
581 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
582 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
583 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
584 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
585 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
586 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
587 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
588 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
589 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
590 2802429633 Rhizobium anhuiense J3 Isolate Nodule
591 2802429634 Rhizobium anhuiense S10 Isolate Nodule
592 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
593 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
594 2802429637 Rhizobium anhuiense C15 Isolate Nodule
595 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
596 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
597 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
598 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
599 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
600 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
601 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
602 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
603 2838048938 Rhizobium pisi 27/80 Isolate Nodule
604 2838061910 Rhizobium phaseoli L15 Isolate Nodule
605 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
606 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
607 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
608 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
609 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
610 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
611 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
612 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
613 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
614 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
615 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
616 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
617 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
618 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
619 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
620 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
621 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
622 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
623 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
624 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
625 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
626 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
627 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
628 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
629 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
630 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
631 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
632 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
633 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
634 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
635 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
636 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
637 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
638 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
639 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
640 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
641 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
642 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
643 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
644 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
645 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
646 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
647 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
648 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
649 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
650 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
651 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
652 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
653 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
654 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
655 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
656 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
657 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
658 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
659 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
660 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
661 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
662 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
663 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
664 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
665 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
666 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
667 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
668 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
669 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
670 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
671 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
672 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
673 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
674 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
675 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
676 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
677 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
678 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
679 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
680 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
681 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
682 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
683 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
684 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
685 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
686 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
687 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
688 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
689 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
690 2844163670 Ensifer sp. 1H6 Isolate Unclassified
691 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
692 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
693 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
694 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
695 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
696 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
697 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
698 2854911287 Brucella lupini LUP21 Isolate Unclassified
699 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
700 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
701 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
702 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
703 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
704 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
705 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
706 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
707 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
708 2856349417 Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 Isolate Nodule
709 2856356410 Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 Isolate Nodule
710 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
711 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
712 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
713 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
714 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
715 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
716 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
717 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
718 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
719 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
720 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
721 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
722 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
723 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
724 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
725 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
726 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
727 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
728 2871444079 Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 Isolate Nodule
729 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
730 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
731 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
732 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
733 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
734 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
735 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
736 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
737 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
738 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
739 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
740 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
741 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
742 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
743 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
744 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
745 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
746 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
747 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
748 2876377896 Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 Isolate Nodule
749 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
750 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
751 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
752 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
753 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
754 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
755 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
756 2878730984 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 Isolate Nodule
757 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
758 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
759 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
760 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
761 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
762 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
763 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
764 2878788777 Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 Isolate Nodule
765 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
766 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
767 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
768 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
769 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
770 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
771 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
772 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
773 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
774 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
775 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
776 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
777 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
778 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
779 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
780 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
781 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
782 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
783 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
784 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
785 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
786 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
787 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
788 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
789 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
790 2903513507 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 Isolate Nodule
791 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
792 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
793 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
794 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
795 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
796 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
797 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
798 2906354277 Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 Isolate Nodule
799 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
800 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
801 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
802 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
803 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
804 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
805 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
806 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
807 2906427513 Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 Isolate Nodule
808 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
809 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
810 2915650412 Ochrobactrum sp. CM-21-5 Isolate Rhizosphere
811 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
812 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
813 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
814 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
815 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
816 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
817 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
818 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
819 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
820 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
821 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
822 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
823 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
824 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
825 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
826 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
827 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
828 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
829 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
830 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
831 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
832 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
833 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
834 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
835 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
836 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
837 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
838 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
839 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
840 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
841 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
842 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
843 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
844 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
845 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
846 2922178524 Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 Isolate Nodule
847 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
848 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
849 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
850 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
851 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
852 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
853 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
854 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
855 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
856 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
857 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
858 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
859 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
860 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
861 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
862 2924710171 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 Isolate Nodule
863 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
864 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
865 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
866 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
867 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
868 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
869 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
870 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
871 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
872 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
873 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
874 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
875 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
876 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
877 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
878 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
879 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
880 2933599457 Rhizobium phaseoli M3 Isolate Nodule
881 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
882 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
883 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
884 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
885 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
886 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
887 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
888 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
889 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
890 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
891 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
892 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
893 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
894 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
895 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
896 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
897 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
898 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
899 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
900 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
901 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
902 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
903 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
904 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
905 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
906 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
907 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
908 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
909 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
910 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
911 2937868953 Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 Isolate Nodule
912 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
913 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
914 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
915 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
916 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
917 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
918 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
919 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
920 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
921 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
922 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
923 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
924 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
925 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
926 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
927 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
928 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
929 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
930 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
931 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
932 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
933 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
934 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
935 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
936 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
937 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
938 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
939 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
940 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
941 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
942 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
943 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
944 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
945 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
946 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
947 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
948 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
949 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
950 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
951 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
952 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
953 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
954 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
955 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
956 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
957 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
958 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
959 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
960 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
961 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
962 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
963 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
964 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
965 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
966 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
967 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
968 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
969 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
970 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
971 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
972 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
973 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
974 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
975 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
976 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
977 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
978 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
979 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
980 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
981 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
982 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
983 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
984 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
985 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
986 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
987 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
988 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
989 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
990 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
991 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
992 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
993 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
994 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
995 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
996 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
997 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
998 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
999 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
1000 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
1001 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
1002 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
1003 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
1004 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
1005 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
1006 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
1007 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
1008 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
1009 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
1010 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
1011 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
1012 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
1013 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
1014 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
1015 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
1016 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
1017 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
1018 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
1019 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
1020 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
1021 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
1022 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
1023 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
1024 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
1025 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
1026 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
1027 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
1028 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
1029 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
1030 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
1031 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
1032 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
1033 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
1034 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
1035 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
1036 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
1037 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
1038 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
1039 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
1040 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
1041 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
1042 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
1043 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
1044 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
1045 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
1046 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
1047 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
1048 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
1049 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
1050 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
1051 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
1052 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
1053 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
1054 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
1055 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
1056 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
1057 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
1058 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
1059 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
1060 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
1061 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
1062 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
1063 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
1064 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
1065 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
1066 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
1067 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
1068 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
1069 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
1070 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
1071 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
1072 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
1073 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
1074 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
1075 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
1076 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
1077 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
1078 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
1079 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
1080 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
1081 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
1082 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
1083 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
1084 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
1085 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
1086 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
1087 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
1088 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
1089 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
1090 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
1091 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
1092 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
1093 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
1094 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
1095 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
1096 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
1097 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
1098 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
1099 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
1100 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
1101 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
1102 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
1103 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
1104 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
1105 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
1106 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
1107 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule
1108 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
1109 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
1110 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
1111 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
1112 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
1113 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
1114 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
1115 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
1116 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
1117 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
1118 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
1119 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
1120 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
1121 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
1122 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
1123 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
1124 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
1125 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
1126 2996336353 Mesorhizobium sp. YM1C-6-2 Isolate Unclassified
1127 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
1128 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
1129 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
1130 2996887358 Rhizobium sp. R711 Isolate Nodule
1131 2996893221 Rhizobium sp. R635 Isolate Nodule
1132 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
1133 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
1134 3004167301 Mesorhizobium loti 582 Isolate Unclassified
1135 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
1136 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
1137 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
1138 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
1139 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
1140 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
1141 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
1142 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
1143 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
1144 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
1145 3004289098 Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 Isolate Nodule
1146 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
1147 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
1148 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
1149 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
1150 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
1151 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
1152 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
1153 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
1154 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
1155 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
1156 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
1157 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
1158 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
1159 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
1160 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
1161 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
1162 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
1163 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
1164 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
1165 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
1166 8004395343 Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 Isolate Nodule
1167 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
1168 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
1169 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
1170 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
1171 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
1172 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
1173 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
1174 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
1175 8005258706 Rhizobium sp. R693 Isolate Nodule
1176 8005275841 Rhizobium sp. N4311 Isolate Nodule
1177 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
1178 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
1179 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
1180 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
1181 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
1182 8005321885 Rhizobium sp. R72 Isolate Nodule
1183 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
1184 8005395548 Rhizobium sp. R339 Isolate Nodule
1185 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
1186 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
1187 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
1188 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
1189 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
1190 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
1191 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
1192 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
1193 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
1194 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
1195 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
1196 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
1197 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
1198 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
1199 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
1200 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
1201 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
1202 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
1203 8018176218 Rhizobium sp. N122 Isolate Nodule
1204 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
1205 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
1206 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
1207 8024501048 Rhizobium sp. H4 Isolate Nodule
1208 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
1209 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
1210 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
1211 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule
1212 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
1213 8056382006 Rhizobium croatiense 13T Isolate Nodule
1214 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere
1215 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
1216 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 55.2
Metatranscriptomes 0.69
Isolates 44.12

Biome Distribution

Category Percentage (%)
Aerial Root 0.26
Bulb 0
Endosphere 11.5
Nodule 34.67
Rhizoplane 3.01
Rhizosphere 36.78
Stem 0
Stem Tuber 0
Unclassified 0.05

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0439461_0081342 3300041410 Bacteria 765
2 JGI24740J21852_10001649 3300001979 Bacteria 10237
3 JGI24740J21852_10003294 3300001979 Bacteria 7121
4 JGI24739J22299_10003614 3300001989 Bacteria 5907
5 JGI25156J39149_1026077 3300002705 Bacteria 931
6 JGI25162J39368_1000278 3300002737 Bacteria 48633
7 JGI25162J39368_1000363 3300002737 Bacteria 38689
8 JGI25157J39369_1000925 3300002741 Bacteria 13939
9 JGI25165J46597_1000016 3300003214 Bacteria 377866
10 JGI25165J46597_1000482 3300003214 Bacteria 38683
11 JGI25165J46597_1000763 3300003214 Bacteria 24679
12 JGI25165J46597_1004441 3300003214 Bacteria 3010
13 JGI25153J46596_10023370 3300003215 Bacteria 2256
14 JGI25153J46596_10068444 3300003215 Bacteria 930
15 JGI25153J46596_10122704 3300003215 Bacteria 583
16 rootL2_10038546 3300003322 Bacteria 9502
17 Ga0006562J51391_1090130 3300003578 Bacteria 990
18 Ga0055527_1020747 3300003760 Bacteria 687
19 Ga0055542_1000506 3300003762 Bacteria 35494
20 Ga0055529_1004414 3300003763 Bacteria 2144
21 Ga0055536_1014530 3300003781 Bacteria 2755
22 Ga0055530_10031649 3300003791 Bacteria 1386
23 Ga0058692_1025727 3300003856 Bacteria 1166
24 Ga0070658_10161215 3300005327 Bacteria 1881
25 Ga0070676_10355929 3300005328 Bacteria 1008
26 Ga0070670_100000542 3300005331 Bacteria 30025
27 Ga0068869_100065459 3300005334 Bacteria 2675
28 Ga0070666_10588056 3300005335 Bacteria 812
29 Ga0068868_101146359 3300005338 Bacteria 717
30 Ga0070660_101565633 3300005339 Bacteria 561
31 Ga0070668_101154477 3300005347 Bacteria 701
32 Ga0070668_101554127 3300005347 Bacteria 605
33 Ga0070669_100616968 3300005353 Bacteria 910
34 Ga0070669_100717857 3300005353 Bacteria 845
35 Ga0070674_100514974 3300005356 Bacteria 998
36 Ga0070674_101138277 3300005356 Bacteria 690
37 Ga0070667_100237451 3300005367 Bacteria 1627
38 Ga0070667_100639747 3300005367 Bacteria 982
39 Ga0070711_100995142 3300005439 Bacteria 719
40 Ga0070663_100029286 3300005455 Bacteria 3760
41 Ga0070663_100034165 3300005455 Bacteria 3520
42 Ga0070663_100383884 3300005455 Bacteria 1145
43 Ga0070663_100465922 3300005455 Bacteria 1044
44 Ga0070663_100520087 3300005455 Bacteria 991
45 Ga0070678_101837343 3300005456 Bacteria 572
46 Ga0068867_100672839 3300005459 Bacteria 910
47 Ga0068867_101705317 3300005459 Bacteria 591
48 Ga0070685_11422156 3300005466 Bacteria 533
49 Ga0068853_100077035 3300005539 Bacteria 2913
50 Ga0068853_101333663 3300005539 Bacteria 694
51 Ga0070672_100716986 3300005543 Bacteria 876
52 Ga0070665_100015274 3300005548 Bacteria 7708
53 Ga0070665_100035023 3300005548 Bacteria 5050
54 Ga0070665_100056705 3300005548 Bacteria 3928
55 Ga0070665_100145190 3300005548 Bacteria 2376
56 Ga0070665_100251090 3300005548 Bacteria 1770
57 Ga0070665_100531685 3300005548 Bacteria 1187
58 Ga0068855_100604111 3300005563 Bacteria 1183
59 Ga0070664_100462412 3300005564 Bacteria 1166
60 Ga0070664_100810058 3300005564 Bacteria 876
61 Ga0068857_100732518 3300005577 Bacteria 941
62 Ga0068857_100770004 3300005577 Bacteria 917
63 Ga0068854_101236761 3300005578 Bacteria 670
64 Ga0068856_100041646 3300005614 Bacteria 4515
65 Ga0068856_101184334 3300005614 Bacteria 781
66 Ga0068852_100299909 3300005616 Bacteria 1555
67 Ga0068852_101267902 3300005616 Bacteria 758
68 Ga0068852_101280030 3300005616 Bacteria 755
69 Ga0068859_100424258 3300005617 Bacteria 1426
70 Ga0068864_101083016 3300005618 Bacteria 797
71 Ga0068861_101269437 3300005719 Bacteria 715
72 Ga0068861_101589650 3300005719 Bacteria 644
73 Ga0068851_10205365 3300005834 Bacteria 1101
74 Ga0068870_11133897 3300005840 Bacteria 564
75 Ga0068858_101777632 3300005842 Bacteria 609
76 Ga0075365_10005564 3300006038 Bacteria 6810
77 Ga0075365_10006421 3300006038 Bacteria 6469
78 Ga0075365_10007602 3300006038 Bacteria 6087
79 Ga0075365_10020307 3300006038 Bacteria 4116
80 Ga0075365_10055095 3300006038 Bacteria 2638
81 Ga0075365_10057653 3300006038 Bacteria 2584
82 Ga0075365_10205649 3300006038 Bacteria 1380
83 Ga0075365_11137543 3300006038 Bacteria 549
84 Ga0075365_11345760 3300006038 Bacteria 501
85 Ga0075368_10065351 3300006042 Bacteria 1461
86 Ga0075368_10074390 3300006042 Bacteria 1376
87 Ga0075368_10106527 3300006042 Bacteria 1154
88 Ga0075363_100004357 3300006048 Bacteria 6173
89 Ga0075363_100199609 3300006048 Bacteria 1142
90 Ga0075363_100372138 3300006048 Bacteria 837
91 Ga0075363_100405121 3300006048 Bacteria 802
92 Ga0075363_100709983 3300006048 Bacteria 608
93 Ga0075364_10001664 3300006051 Bacteria 12197
94 Ga0075364_10012398 3300006051 Bacteria 5213
95 Ga0075364_10151768 3300006051 Bacteria 1561
96 Ga0075364_10207200 3300006051 Bacteria 1329
97 Ga0075364_10342890 3300006051 Bacteria 1018
98 Ga0075364_10386475 3300006051 Bacteria 955
99 Ga0075364_10888780 3300006051 Bacteria 607
100 Ga0075362_10163190 3300006177 Bacteria 1074
101 Ga0075362_10184030 3300006177 Bacteria 1013
102 Ga0075362_10466979 3300006177 Bacteria 642
103 Ga0075362_10672801 3300006177 Bacteria 539
104 Ga0075367_10019537 3300006178 Bacteria 3758
105 Ga0075367_10093193 3300006178 Bacteria 1834
106 Ga0075367_10094853 3300006178 Bacteria 1819
107 Ga0075367_10344319 3300006178 Bacteria 940
108 Ga0075367_10354997 3300006178 Bacteria 925
109 Ga0075369_10025148 3300006186 Bacteria 2473
110 Ga0075369_10033787 3300006186 Bacteria 2169
111 Ga0075369_10080566 3300006186 Bacteria 1443
112 Ga0075369_10301319 3300006186 Bacteria 748
113 Ga0075369_10377451 3300006186 Bacteria 667
114 Ga0075366_10056873 3300006195 Bacteria 2324
115 Ga0075366_10471156 3300006195 Bacteria 775
116 Ga0075366_10493876 3300006195 Bacteria 756
117 Ga0075370_10111047 3300006353 Bacteria 1592
118 Ga0075370_10233513 3300006353 Bacteria 1088
119 Ga0075370_10251865 3300006353 Bacteria 1047
120 Ga0068865_100876807 3300006881 Bacteria 779
121 Ga0068865_101061443 3300006881 Bacteria 712
122 Ga0097620_100424287 3300006931 Bacteria 1426
123 Ga0079104_1000210 3300006946 Bacteria 81817
124 Ga0099826_10001594 3300006948 Bacteria 13827
125 Ga0099826_10081419 3300006948 Bacteria 2014
126 Ga0105244_10258398 3300009036 Bacteria 811
127 Ga0105240_10000027 3300009093 Bacteria 348486
128 Ga0105240_10127601 3300009093 Bacteria 3055
129 Ga0105240_11516710 3300009093 Bacteria 702
130 Ga0105240_11559486 3300009093 Bacteria 692
131 Ga0105245_10293682 3300009098 Bacteria 1593
132 Ga0105243_10063806 3300009148 Bacteria 2953
133 Ga0105243_10307762 3300009148 Bacteria 1438
134 Ga0105243_11108989 3300009148 Bacteria 800
135 Ga0105243_11681073 3300009148 Bacteria 663
136 Ga0105241_10120911 3300009174 Bacteria 2109
137 Ga0105241_10968846 3300009174 Bacteria 794
138 Ga0105242_11496793 3300009176 Bacteria 705
139 Ga0105248_10281260 3300009177 Bacteria 1873
140 Ga0105248_12428068 3300009177 Bacteria 597
141 Ga0105237_10001405 3300009545 Bacteria 31816
142 Ga0105237_10449321 3300009545 Bacteria 1295
143 Ga0105237_12164001 3300009545 Bacteria 566
144 Ga0105238_10008113 3300009551 Bacteria 10502
145 Ga0105238_11018246 3300009551 Bacteria 849
146 Ga0105249_11296445 3300009553 Bacteria 800
147 Ga0105239_10001129 3300010375 Bacteria 36802
148 Ga0105239_10112886 3300010375 Bacteria 3013
149 Ga0105239_10163718 3300010375 Bacteria 2486
150 Ga0105239_10806547 3300010375 Bacteria 1076
151 Ga0105239_10849761 3300010375 Bacteria 1047
152 Ga0105246_10144933 3300011119 Bacteria 1791
153 Ga0105246_10599155 3300011119 Bacteria 952
154 Ga0157373_10051042 3300013100 Bacteria 2945
155 Ga0157373_10273009 3300013100 Bacteria 1197
156 Ga0157373_10898400 3300013100 Bacteria 657
157 Ga0157371_10000058 3300013102 Bacteria 171756
158 Ga0157371_10414142 3300013102 Bacteria 987
159 Ga0157370_10000030 3300013104 Bacteria 145571
160 Ga0157370_10000048 3300013104 Bacteria 124683
161 Ga0157370_10309900 3300013104 Bacteria 1457
162 Ga0157370_11060221 3300013104 Bacteria 733
163 Ga0157369_10114120 3300013105 Bacteria 2869
164 Ga0157369_10200791 3300013105 Bacteria 2093
165 Ga0157369_10488514 3300013105 Bacteria 1274
166 Ga0157369_12301647 3300013105 Bacteria 546
167 Ga0157374_10055710 3300013296 Bacteria 3691
168 Ga0157378_10557231 3300013297 Bacteria 1152
169 Ga0157378_12097835 3300013297 Bacteria 616
170 Ga0163162_11447015 3300013306 Bacteria 782
171 Ga0163162_12878128 3300013306 Bacteria 554
172 Ga0157372_10238857 3300013307 Bacteria 2108
173 Ga0157372_12098963 3300013307 Bacteria 649
174 Ga0157372_12247742 3300013307 Bacteria 626
175 Ga0157372_12514226 3300013307 Bacteria 591
176 Ga0157375_12628797 3300013308 Bacteria 602
177 Ga0163163_10400149 3300014325 Bacteria 1431
178 Ga0163163_12803286 3300014325 Bacteria 544
179 Ga0157380_12663344 3300014326 Bacteria 566
180 Ga0157380_13552771 3300014326 Bacteria 500
181 Ga0182008_10801153 3300014497 Bacteria 547
182 Ga0157379_10648532 3300014968 Bacteria 988
183 Ga0157376_10925410 3300014969 Bacteria 891
184 Ga0182006_1032114 3300015261 Bacteria 2112
185 Ga0182007_10000937 3300015262 Bacteria 16064
186 Ga0182007_10180117 3300015262 Bacteria 730
187 Ga0182005_1001754 3300015265 Bacteria 8342
188 Ga0163161_10154383 3300017792 Bacteria 1747
189 Ga0163161_10521117 3300017792 Bacteria 971
190 Ga0163161_10821902 3300017792 Bacteria 782
191 Ga0163161_11168759 3300017792 Bacteria 664
192 Ga0209436_100002 3300025208 Bacteria 222172
193 Ga0209672_107513 3300025228 Bacteria 1675
194 Ga0209563_116425 3300025230 Bacteria 910
195 Ga0209437_100036 3300025233 Bacteria 469153
196 Ga0209437_100086 3300025233 Bacteria 254578
197 Ga0209437_101879 3300025233 Bacteria 4417
198 Ga0207425_1000497 3300025245 Bacteria 24648
199 Ga0207425_1000964 3300025245 Bacteria 13525
200 Ga0207425_1001743 3300025245 Bacteria 8522
201 Ga0207425_1018014 3300025245 Bacteria 1540
202 Ga0207425_1022198 3300025245 Bacteria 1339
203 Ga0209646_1009547 3300025246 Bacteria 1538
204 Ga0209646_1010395 3300025246 Bacteria 1459
205 Ga0209026_1000005 3300025250 Bacteria 731387
206 Ga0209026_1027869 3300025250 Bacteria 845
207 Ga0209677_100516 3300025253 Bacteria 21521
208 Ga0209148_1000057 3300025254 Bacteria 360463
209 Ga0209759_1000385 3300025256 Bacteria 55125
210 Ga0209759_1054245 3300025256 Bacteria 598
211 Ga0209129_1000299 3300025258 Bacteria 46326
212 Ga0209129_1000709 3300025258 Bacteria 21549
213 Ga0209129_1001153 3300025258 Bacteria 15295
214 Ga0209129_1014007 3300025258 Bacteria 1729
215 Ga0209233_1000056 3300025261 Bacteria 438104
216 Ga0209233_1000068 3300025261 Bacteria 377969
217 Ga0209233_1000110 3300025261 Bacteria 260825
218 Ga0209233_1000298 3300025261 Bacteria 61008
219 Ga0209233_1008316 3300025261 Bacteria 3220
220 Ga0209455_1000231 3300025272 Bacteria 70607
221 Ga0209673_1000015 3300025273 Bacteria 530618
222 Ga0209673_1000091 3300025273 Bacteria 201875
223 Ga0209673_1001285 3300025273 Bacteria 25734
224 Ga0209673_1004117 3300025273 Bacteria 7981
225 Ga0209673_1006917 3300025273 Bacteria 5365
226 Ga0209673_1009198 3300025273 Bacteria 4309
227 Ga0209673_1039870 3300025273 Bacteria 1350
228 Ga0209673_1041356 3300025273 Bacteria 1309
229 Ga0209673_1045813 3300025273 Bacteria 1198
230 Ga0209130_1000015 3300025284 Bacteria 409631
231 Ga0209675_1038679 3300025291 Bacteria 1061
232 Ga0209675_1101141 3300025291 Bacteria 509
233 Ga0209676_1004595 3300025292 Bacteria 7621
234 Ga0209676_1030615 3300025292 Bacteria 1643
235 Ga0209025_1000489 3300025294 Bacteria 76167
236 Ga0209025_1000575 3300025294 Bacteria 66684
237 Ga0209025_1000664 3300025294 Bacteria 59562
238 Ga0209025_1000880 3300025294 Bacteria 47017
239 Ga0209025_1001375 3300025294 Bacteria 32637
240 Ga0209025_1006816 3300025294 Bacteria 8721
241 Ga0209025_1008378 3300025294 Bacteria 7451
242 Ga0209025_1073133 3300025294 Bacteria 1204
243 Ga0209564_1000398 3300025295 Bacteria 77724
244 Ga0209564_1003162 3300025295 Bacteria 11595
245 Ga0209564_1003865 3300025295 Bacteria 9650
246 Ga0209564_1007416 3300025295 Bacteria 5672
247 Ga0209564_1025090 3300025295 Bacteria 2017
248 Ga0209564_1072326 3300025295 Bacteria 710
249 Ga0209758_1000191 3300025297 Bacteria 136984
250 Ga0209758_1000549 3300025297 Bacteria 59562
251 Ga0209758_1000740 3300025297 Bacteria 47623
252 Ga0209758_1001295 3300025297 Bacteria 30719
253 Ga0209758_1003493 3300025297 Bacteria 14220
254 Ga0209758_1008829 3300025297 Bacteria 6416
255 Ga0209758_1009452 3300025297 Bacteria 6060
256 Ga0209758_1011162 3300025297 Bacteria 5244
257 Ga0209758_1039731 3300025297 Bacteria 1785
258 Ga0209758_1068582 3300025297 Bacteria 1128
259 Ga0209758_1074851 3300025297 Bacteria 1049
260 Ga0209758_1150194 3300025297 Bacteria 592
261 Ga0209050_1007611 3300025298 Bacteria 6016
262 Ga0209050_1030544 3300025298 Bacteria 1699
263 Ga0209256_1000782 3300025299 Bacteria 41037
264 Ga0209256_1000870 3300025299 Bacteria 37394
265 Ga0209256_1004446 3300025299 Bacteria 8796
266 Ga0209256_1008522 3300025299 Bacteria 4732
267 Ga0209256_1015754 3300025299 Bacteria 2624
268 Ga0209256_1016037 3300025299 Bacteria 2579
269 Ga0209256_1027289 3300025299 Bacteria 1629
270 Ga0209256_1040305 3300025299 Bacteria 1194
271 Ga0207426_1000063 3300025302 Bacteria 358920
272 Ga0207426_1000144 3300025302 Bacteria 191590
273 Ga0209051_1000205 3300025303 Bacteria 104781
274 Ga0209051_1002129 3300025303 Bacteria 14756
275 Ga0209051_1011156 3300025303 Bacteria 4464
276 Ga0209051_1015619 3300025303 Bacteria 3482
277 Ga0209051_1017670 3300025303 Bacteria 3181
278 Ga0209051_1026675 3300025303 Bacteria 2322
279 Ga0209051_1032202 3300025303 Bacteria 2004
280 Ga0209051_1108751 3300025303 Bacteria 728
281 Ga0209051_1110261 3300025303 Bacteria 720
282 Ga0209257_1001929 3300025304 Bacteria 22391
283 Ga0209257_1002628 3300025304 Bacteria 17336
284 Ga0209257_1070451 3300025304 Bacteria 923
285 Ga0209257_1129683 3300025304 Bacteria 579
286 Ga0207656_10195458 3300025321 Bacteria 975
287 Ga0207656_10380165 3300025321 Bacteria 708
288 Ga0207680_11094397 3300025903 Bacteria 570
289 Ga0207647_10006448 3300025904 Bacteria 8527
290 Ga0207647_10077385 3300025904 Bacteria 1999
291 Ga0207647_10155866 3300025904 Bacteria 1333
292 Ga0207645_10909860 3300025907 Bacteria 597
293 Ga0207705_10070741 3300025909 Bacteria 2529
294 Ga0207695_10000024 3300025913 Bacteria 632311
295 Ga0207695_10366587 3300025913 Bacteria 1327
296 Ga0207695_10945719 3300025913 Bacteria 741
297 Ga0207695_11718650 3300025913 Bacteria 508
298 Ga0207671_10000463 3300025914 Bacteria 55685
299 Ga0207671_10015211 3300025914 Bacteria 6041
300 Ga0207671_10276453 3300025914 Bacteria 1324
301 Ga0207671_11285150 3300025914 Bacteria 570
302 Ga0207663_11723536 3300025916 Bacteria 504
303 Ga0207657_10203975 3300025919 Bacteria 1589
304 Ga0207649_10455919 3300025920 Bacteria 966
305 Ga0207652_10888298 3300025921 Bacteria 788
306 Ga0207681_10377280 3300025923 Bacteria 1141
307 Ga0207681_10639558 3300025923 Bacteria 881
308 Ga0207681_10711683 3300025923 Bacteria 835
309 Ga0207694_10018997 3300025924 Bacteria 5195
310 Ga0207694_10240910 3300025924 Bacteria 1478
311 Ga0207694_11640581 3300025924 Bacteria 542
312 Ga0207650_10000769 3300025925 Bacteria 24619
313 Ga0207659_10950269 3300025926 Bacteria 739
314 Ga0207644_10398494 3300025931 Bacteria 1125
315 Ga0207690_10431796 3300025932 Bacteria 1056
316 Ga0207690_10664750 3300025932 Bacteria 854
317 Ga0207706_11432050 3300025933 Bacteria 566
318 Ga0207709_10644508 3300025935 Bacteria 843
319 Ga0207709_11090711 3300025935 Bacteria 655
320 Ga0207669_10050329 3300025937 Bacteria 2490
321 Ga0207669_10352598 3300025937 Bacteria 1137
322 Ga0207704_10806892 3300025938 Bacteria 784
323 Ga0207689_10342562 3300025942 Bacteria 1242
324 Ga0207679_10962245 3300025945 Bacteria 782
325 Ga0207679_11703304 3300025945 Bacteria 577
326 Ga0207667_10489091 3300025949 Bacteria 1249
327 Ga0207667_12131576 3300025949 Bacteria 519
328 Ga0207712_10719349 3300025961 Bacteria 873
329 Ga0207668_12009136 3300025972 Bacteria 521
330 Ga0207640_10226181 3300025981 Bacteria 1436
331 Ga0207640_10700049 3300025981 Bacteria 868
332 Ga0207640_11452399 3300025981 Bacteria 615
333 Ga0207658_11387414 3300025986 Bacteria 643
334 Ga0207639_10329243 3300026041 Bacteria 1359
335 Ga0207639_11224586 3300026041 Bacteria 704
336 Ga0207639_11285331 3300026041 Bacteria 687
337 Ga0207678_10013093 3300026067 Bacteria 7277
338 Ga0207678_10083963 3300026067 Bacteria 2724
339 Ga0207678_10177504 3300026067 Bacteria 1819
340 Ga0207678_10316533 3300026067 Bacteria 1342
341 Ga0207702_10247204 3300026078 Bacteria 1674
342 Ga0207702_10351434 3300026078 Bacteria 1411
343 Ga0207648_10317020 3300026089 Bacteria 1401
344 Ga0207648_12208582 3300026089 Bacteria 511
345 Ga0207674_10564715 3300026116 Bacteria 1099
346 Ga0207674_10709128 3300026116 Bacteria 971
347 Ga0207675_100477378 3300026118 Bacteria 1239
348 Ga0207675_101496019 3300026118 Bacteria 696
349 Ga0207683_10242281 3300026121 Bacteria 1645
350 Ga0207698_10271072 3300026142 Bacteria 1565
351 Ga0207698_10536083 3300026142 Bacteria 1145
352 Ga0207698_10556522 3300026142 Bacteria 1125
353 Ga0207698_10895130 3300026142 Bacteria 894
354 Ga0209281_1000253 3300027111 Bacteria 105600
355 Ga0209371_1000009 3300027312 Bacteria 963030
356 Ga0209371_1001069 3300027312 Bacteria 20494
357 Ga0209371_1002375 3300027312 Bacteria 10648
358 Ga0209371_1003235 3300027312 Bacteria 8124
359 Ga0209371_1003293 3300027312 Bacteria 8001
360 Ga0209282_1001731 3300027666 Bacteria 12202
361 Ga0209282_1063989 3300027666 Bacteria 2036
362 Ga0209813_10005656 3300027866 Bacteria 3046
363 Ga0209813_10108062 3300027866 Bacteria 955
364 Ga0209974_10196937 3300027876 Bacteria 743
365 Ga0268266_10014176 3300028379 Bacteria 6857
366 Ga0268266_10023667 3300028379 Bacteria 5228
367 Ga0268266_10062041 3300028379 Bacteria 3225
368 Ga0268266_10114793 3300028379 Bacteria 2390
369 Ga0268266_10164952 3300028379 Bacteria 2006
370 Ga0268266_10166885 3300028379 Bacteria 1995
371 Ga0268266_10473910 3300028379 Bacteria 1193
372 Ga0268266_10524725 3300028379 Bacteria 1133
373 Ga0268266_11499031 3300028379 Bacteria 650
374 Ga0268266_11902557 3300028379 Bacteria 569
375 Ga0268265_10784221 3300028380 Bacteria 928
376 Ga0265318_10324581 3300028577 Bacteria 562
377 Ga0307517_10452060 3300028786 Bacteria 665
378 Ga0307517_10675331 3300028786 Bacteria 500
379 Ga0307515_10021929 3300028794 Bacteria 11293
380 Ga0307515_10070907 3300028794 Bacteria 4733
381 Ga0307515_10411495 3300028794 Bacteria 975
382 Ga0307515_10846263 3300028794 Bacteria 541
383 Ga0268256_1000010 3300030500 Bacteria 963034
384 Ga0268256_1000882 3300030500 Bacteria 20778
385 Ga0268256_1002814 3300030500 Bacteria 8429
386 Ga0316181_1173512 3300030744 Bacteria 1633
387 Ga0265330_10084337 3300031235 Bacteria 1367
388 Ga0265330_10140414 3300031235 Bacteria 1027
389 Ga0265332_10358175 3300031238 Bacteria 602
390 Ga0265332_10431597 3300031238 Bacteria 544
391 Ga0265328_10137184 3300031239 Bacteria 917
392 Ga0265325_10273526 3300031241 Bacteria 759
393 Ga0265340_10001720 3300031247 Bacteria 12552
394 Ga0265339_10003158 3300031249 Bacteria 11595
395 Ga0265331_10030864 3300031250 Bacteria 2666
396 Ga0265316_10117489 3300031344 Bacteria 2010
397 Ga0307513_10030733 3300031456 Bacteria 6097
398 Ga0307513_10144751 3300031456 Bacteria 2297
399 Ga0307513_10176889 3300031456 Bacteria 2003
400 Ga0307408_101132568 3300031548 Bacteria 727
401 Ga0307408_101237350 3300031548 Bacteria 698
402 Ga0265313_10000031 3300031595 Bacteria 128981
403 Ga0265313_10066914 3300031595 Bacteria 1664
404 Ga0265313_10108065 3300031595 Bacteria 1226
405 Ga0265314_10058931 3300031711 Bacteria 2629
406 Ga0265314_10073222 3300031711 Bacteria 2285
407 Ga0265314_10362352 3300031711 Bacteria 794
408 Ga0265342_10003919 3300031712 Bacteria 11953
409 Ga0307405_10018493 3300031731 Bacteria 3845
410 Ga0307413_10233069 3300031824 Bacteria 1354
411 Ga0307410_10730546 3300031852 Bacteria 837
412 Ga0307410_11370799 3300031852 Bacteria 620
413 Ga0307406_10013413 3300031901 Bacteria 4694
414 Ga0307406_10529317 3300031901 Bacteria 961
415 Ga0307407_10949997 3300031903 Bacteria 662
416 Ga0307412_10001068 3300031911 Bacteria 15676
417 Ga0307412_10120664 3300031911 Bacteria 1887
418 Ga0307412_11058723 3300031911 Bacteria 720
419 Ga0307412_11333875 3300031911 Bacteria 647
420 Ga0307409_100962028 3300031995 Bacteria 870
421 Ga0307409_101318193 3300031995 Bacteria 747
422 Ga0307409_102002246 3300031995 Bacteria 609
423 Ga0307414_10027440 3300032004 Bacteria 3680
424 Ga0307414_10098381 3300032004 Bacteria 2195
425 Ga0307414_11109488 3300032004 Bacteria 731
426 Ga0307510_10497424 3300033180 Bacteria 662
427 Ga0373928_0081139 3300035084 Bacteria 818
428 Ga0373927_0360763 3300035695 Bacteria 958
429 Ga0395899_0000030 3300037312 Bacteria 329063
430 Ga0395899_0106022 3300037312 Bacteria 2024
431 Ga0395899_0268722 3300037312 Bacteria 1164
432 Ga0395900_0000023 3300037418 Bacteria 336048
433 Ga0395900_0058442 3300037418 Bacteria 3970
434 Ga0395900_0158369 3300037418 Bacteria 2311
435 Ga0395900_0774610 3300037418 Bacteria 889
436 Ga0395900_1512061 3300037418 Bacteria 583
437 Ga0395898_0000038 3300037466 Bacteria 329063
438 Ga0395905_0000021 3300037471 Bacteria 329054
439 Ga0395905_0125889 3300037471 Bacteria 2409
440 Ga0395905_0536337 3300037471 Bacteria 1071
441 Ga0395905_0609768 3300037471 Bacteria 993
442 Ga0395905_1535107 3300037471 Bacteria 570
443 Ga0395901_0000018 3300038443 Bacteria 336048
444 Ga0395901_0058576 3300038443 Bacteria 4006
445 Ga0395901_0103943 3300038443 Bacteria 2981
446 Ga0395901_0175290 3300038443 Bacteria 2249
447 Ga0395901_0340216 3300038443 Bacteria 1550
448 Ga0395901_0453567 3300038443 Bacteria 1311
449 Ga0395901_0645856 3300038443 Bacteria 1062
450 Ga0439465_0077162 3300041413 Bacteria 1124
451 Ga0439465_0323672 3300041413 Bacteria 579
452 Ga0451787_630305 3300041441 Bacteria 692
453 Ga0451789_0334998 3300041443 Bacteria 541
454 Ga0451789_0552177 3300041443 Bacteria 800
455 Ga0451789_0713384 3300041443 Bacteria 589
456 Ga0451791_0542230 3300041451 Bacteria 925
457 Ga0451791_0912269 3300041451 Bacteria 1287
458 Ga0451791_1458927 3300041451 Bacteria 613
459 Ga0451797_0736426 3300041453 Bacteria 772
460 Ga0451795_0678915 3300041456 Bacteria 564
461 Ga0451795_1578517 3300041456 Bacteria 657
462 Ga0451798_0969565 3300041458 Bacteria 1003
463 Ga0451800_1407261 3300041459 Bacteria 560
464 Ga0451802_0303084 3300041460 Bacteria 774
465 Ga0451802_0577518 3300041460 Bacteria 1056
466 Ga0451804_0833409 3300041463 Bacteria 778
467 Ga0451807_0980318 3300041486 Bacteria 1026
468 Ga0451807_2543517 3300041486 Bacteria 546
469 Ga0451833_0494853 3300041491 Bacteria 2153
470 Ga0451833_0813260 3300041491 Bacteria 623
471 Ga0451835_0066844 3300041492 Bacteria 2899
472 Ga0451837_1015094 3300041494 Bacteria 967
473 Ga0451837_1029000 3300041494 Bacteria 519
474 Ga0451839_0240019 3300041496 Bacteria 541
475 Ga0451839_0443790 3300041496 Bacteria 927
476 Ga0451840_04288 3300041497 Bacteria 711
477 Ga0451841_0124507 3300041498 Bacteria 1258
478 Ga0451841_0661765 3300041498 Bacteria 535
479 Ga0451841_0873574 3300041498 Bacteria 553
480 Ga0451841_1088819 3300041498 Bacteria 569
481 Ga0451841_1369678 3300041498 Bacteria 863
482 Ga0451845_0049804 3300041501 Bacteria 959
483 Ga0451845_0217625 3300041501 Bacteria 894
484 Ga0451846_37121 3300041502 Bacteria 1699
485 Ga0451847_0232892 3300041503 Bacteria 2989
486 Ga0451847_0618665 3300041503 Bacteria 692
487 Ga0451849_0255757 3300041505 Bacteria 1218
488 Ga0451851_0663672 3300041507 Bacteria 1645
489 Ga0451843_0488388 3300041509 Bacteria 825
490 Ga0451843_0632080 3300041509 Bacteria 518
491 Ga0451854_26707 3300041510 Bacteria 685
492 Ga0451855_0284419 3300041511 Bacteria 531
493 Ga0451855_0675896 3300041511 Bacteria 714
494 Ga0451853_0768765 3300041512 Bacteria 610
495 Ga0451853_1699743 3300041512 Bacteria 3873
496 Ga0451853_1713722 3300041512 Bacteria 823
497 Ga0451853_2497085 3300041512 Bacteria 774
498 Ga0439433_0051131 3300041999 Bacteria 975
499 Ga0439455_0053007 3300042012 Bacteria 1063
500 Ga0439458_0037362 3300042157 Bacteria 1171
501 Ga0466972_0084268 3300044658 Bacteria 1511
502 Ga0466972_0185179 3300044658 Bacteria 976
503 Ga0466982_0381123 3300044672 Bacteria 771
504 Ga0466965_0101817 3300044683 Bacteria 1469
505 Ga0466966_0187683 3300044684 Bacteria 1253
506 Ga0466963_0016998 3300044694 Bacteria 4531
507 Ga0466968_0224887 3300044735 Bacteria 885
508 Ga0466968_0497191 3300044735 Bacteria 607
509 Ga0466970_0002877 3300044765 Bacteria 8330
510 Ga0466970_0147823 3300044765 Bacteria 1297
511 Ga0466970_0259479 3300044765 Bacteria 975
512 Ga0466957_0877535 3300044842 Bacteria 640
513 Ga0466957_1385315 3300044842 Bacteria 512
514 Ga0466960_0035323 3300044901 Bacteria 2335
515 Ga0466960_0103800 3300044901 Bacteria 1468
516 Ga0466967_1905305 3300045976 Bacteria 591
517 Ga0495592_0119685 3300046454 Bacteria 1854
518 Ga0495603_0758315 3300046455 Bacteria 554
519 Ga0495629_0242262 3300046459 Bacteria 1241
520 Ga0495638_0016112 3300046460 Bacteria 5008
521 Ga0495638_0025041 3300046460 Bacteria 3883
522 Ga0495638_0029964 3300046460 Bacteria 3507
523 Ga0495638_0103097 3300046460 Bacteria 1704
524 Ga0495651_0893008 3300046462 Bacteria 544
525 Ga0495650_0071590 3300046471 Bacteria 1359
526 Ga0495605_0173843 3300046474 Bacteria 950
527 Ga0495605_0333756 3300046474 Bacteria 638
528 Ga0495662_0018760 3300046476 Bacteria 3349
529 Ga0495606_0000735 3300046507 Bacteria 50674
530 Ga0495606_0044990 3300046507 Bacteria 2930
531 Ga0495606_0063678 3300046507 Bacteria 2350
532 Ga0495606_0504711 3300046507 Bacteria 610
533 Ga0495610_0084325 3300046512 Bacteria 1452
534 Ga0495610_0094912 3300046512 Bacteria 1345
535 Ga0495616_0093707 3300046513 Bacteria 1418
536 Ga0495620_0087011 3300046515 Bacteria 1257
537 Ga0495620_0134860 3300046515 Bacteria 967
538 Ga0495632_0012233 3300046519 Bacteria 4956
539 Ga0495637_0158284 3300046520 Bacteria 851
540 Ga0495643_0074504 3300046522 Bacteria 1777
541 Ga0495643_0074568 3300046522 Bacteria 1776
542 Ga0495648_0215852 3300046524 Bacteria 950
543 Ga0495652_0234020 3300046529 Bacteria 1372
544 Ga0495654_0000043 3300046530 Bacteria 161913
545 Ga0495654_0200613 3300046530 Bacteria 854
546 Ga0495587_0063967 3300046536 Bacteria 2150
547 Ga0495622_0036088 3300046557 Bacteria 2306
548 Ga0495633_0045766 3300046558 Bacteria 2071
549 Ga0495668_0063807 3300046616 Bacteria 2028
550 Ga0495668_0122061 3300046616 Bacteria 1425
551 Ga0495668_0296087 3300046616 Bacteria 887
552 Ga0495625_0808252 3300046660 Bacteria 545
553 Ga0495635_0311194 3300046663 Bacteria 1055
554 Ga0495661_0386551 3300046665 Bacteria 683
555 Ga0495588_0003015 3300046674 Bacteria 7286
556 Ga0495588_0301055 3300046674 Bacteria 844
557 Ga0495658_0546382 3300046683 Bacteria 742
558 Ga0495624_0049268 3300046690 Bacteria 2672
559 Ga0495670_0543763 3300046691 Bacteria 632
560 Ga0495670_0755454 3300046691 Bacteria 530
561 Ga0495671_0323637 3300046692 Bacteria 740
562 Ga0495589_0261691 3300046794 Bacteria 807
563 Ga0495600_0053444 3300046809 Bacteria 2638
564 Ga0495660_0021222 3300046810 Bacteria 3720
565 Ga0495660_0215507 3300046810 Bacteria 908
566 Ga0495604_0009543 3300047317 Bacteria 7675
567 Ga0495604_0325048 3300047317 Bacteria 1027
568 Ga0495676_0960145 3300047321 Bacteria 546
569 Ga0495683_0315420 3300047323 Bacteria 668
570 Ga0495687_023965 3300047443 Bacteria 2909
571 Ga0495681_0003362 3300047470 Bacteria 11135
572 Ga0495681_0092965 3300047470 Bacteria 1329
573 Ga0495686_0000709 3300047472 Bacteria 44909
574 Ga0495686_0103693 3300047472 Bacteria 1713
575 Ga0495686_0167559 3300047472 Bacteria 1279
576 Ga0495686_0243916 3300047472 Bacteria 1012
577 Ga0495593_0497962 3300047673 Bacteria 611
578 Ga0495602_0930874 3300048088 Bacteria 577
579 Ga0495626_0031952 3300048091 Bacteria 2531
580 Ga0495626_0225721 3300048091 Bacteria 759
581 Ga0496100_0311443 3300048903 Bacteria 1180
582 Ga0496100_0372130 3300048903 Bacteria 1084
583 Ga0496101_0125770 3300048904 Bacteria 1942
584 Ga0496101_1127847 3300048904 Bacteria 615
585 Ga0496102_0299171 3300048905 Bacteria 1516
586 Ga0496102_0374504 3300048905 Bacteria 1340
587 Ga0496102_0503831 3300048905 Bacteria 1133
588 Ga0496103_0264109 3300048906 Bacteria 1107
589 Ga0496104_0248254 3300048907 Bacteria 1692
590 Ga0496104_0312083 3300048907 Bacteria 1485
591 Ga0496104_1195132 3300048907 Bacteria 664
592 Ga0496105_0016247 3300048908 Bacteria 5939
593 Ga0496105_0157140 3300048908 Bacteria 1867
594 Ga0496105_1176656 3300048908 Bacteria 566
595 Ga0496106_0401840 3300048909 Bacteria 1101
596 Ga0496106_1016309 3300048909 Bacteria 652
597 Ga0496106_1476044 3300048909 Bacteria 524
598 Ga0496107_1077057 3300048910 Bacteria 581
599 Ga0496108_1017684 3300048911 Bacteria 707
600 Ga0496109_0614249 3300048912 Bacteria 1024
601 Ga0496110_0483643 3300048913 Bacteria 1128
602 Ga0496111_0000097 3300048914 Bacteria 37708
603 Ga0496111_1089379 3300048914 Bacteria 570
604 Ga0496112_0072895 3300048915 Bacteria 3395
605 Ga0496113_0250177 3300048916 Bacteria 1415
606 Ga0496113_0367194 3300048916 Bacteria 1155
607 Ga0496114_0050639 3300048917 Bacteria 3457
608 Ga0496114_0313336 3300048917 Bacteria 1386
609 Ga0496114_1283502 3300048917 Bacteria 619
610 Ga0496115_0143554 3300048918 Bacteria 1969
611 Ga0496116_0012346 3300048919 Bacteria 6983
612 Ga0496116_0016654 3300048919 Bacteria 5741
613 Ga0496116_0020240 3300048919 Bacteria 5060
614 Ga0496116_0038239 3300048919 Bacteria 3335
615 Ga0496116_0041166 3300048919 Bacteria 3173
616 Ga0496116_0096288 3300048919 Bacteria 1783
617 Ga0496117_0000002 3300048920 Bacteria 2483758
618 Ga0496117_0001662 3300048920 Bacteria 31159
619 Ga0496117_0061369 3300048920 Bacteria 2585
620 Ga0496117_0180646 3300048920 Bacteria 1213
621 Ga0496117_0282055 3300048920 Bacteria 889
622 Ga0496117_0356189 3300048920 Bacteria 754
623 Ga0496117_0484344 3300048920 Bacteria 604
624 Ga0496118_0000483 3300048921 Bacteria 66119
625 Ga0496118_0001307 3300048921 Bacteria 37899
626 Ga0496118_0046984 3300048921 Bacteria 3352
627 Ga0496118_0057184 3300048921 Bacteria 2926
628 Ga0496118_0156649 3300048921 Bacteria 1415
629 Ga0496118_0488489 3300048921 Bacteria 615
630 Ga0496119_0000793 3300048922 Bacteria 42302
631 Ga0496119_0021529 3300048922 Bacteria 4655
632 Ga0496119_0040196 3300048922 Bacteria 2995
633 Ga0496119_0049458 3300048922 Bacteria 2599
634 Ga0496119_0062890 3300048922 Bacteria 2210
635 Ga0496119_0106946 3300048922 Bacteria 1560
636 Ga0496119_0121938 3300048922 Bacteria 1431
637 Ga0496119_0159805 3300048922 Bacteria 1199
638 Ga0496119_0175979 3300048922 Bacteria 1126
639 Ga0496120_0000971 3300048923 Bacteria 39060
640 Ga0496120_0001519 3300048923 Bacteria 27337
641 Ga0496120_0006732 3300048923 Bacteria 8735
642 Ga0496120_0029419 3300048923 Bacteria 3354
643 Ga0496120_0058737 3300048923 Bacteria 2159
644 Ga0496120_0170718 3300048923 Bacteria 1076
645 Ga0496120_0175959 3300048923 Bacteria 1055
646 Ga0496121_0002165 3300048924 Bacteria 30743
647 Ga0496121_0003328 3300048924 Bacteria 23071
648 Ga0496121_0018159 3300048924 Bacteria 7111
649 Ga0496121_0018464 3300048924 Bacteria 7031
650 Ga0496121_0106965 3300048924 Bacteria 2143
651 Ga0496121_0128304 3300048924 Bacteria 1903
652 Ga0496121_0128400 3300048924 Bacteria 1902
653 Ga0496121_0257140 3300048924 Bacteria 1208
654 Ga0496121_0498693 3300048924 Bacteria 773
655 Ga0496121_0659646 3300048924 Bacteria 636
656 Ga0496122_0000001 3300048925 Bacteria 1827766
657 Ga0496122_0000009 3300048925 Bacteria 584024
658 Ga0496122_0004617 3300048925 Bacteria 16949
659 Ga0496122_0007697 3300048925 Bacteria 11876
660 Ga0496122_0018033 3300048925 Bacteria 6547
661 Ga0496122_0055160 3300048925 Bacteria 2976
662 Ga0496122_0070469 3300048925 Bacteria 2497
663 Ga0496122_0126634 3300048925 Bacteria 1633
664 Ga0496122_0223934 3300048925 Bacteria 1076
665 Ga0496123_0000001 3300048926 Bacteria 1831497
666 Ga0496123_0000020 3300048926 Bacteria 388748
667 Ga0496123_0004746 3300048926 Bacteria 14067
668 Ga0496123_0022781 3300048926 Bacteria 4815
669 Ga0496123_0059465 3300048926 Bacteria 2470
670 Ga0496123_0060632 3300048926 Bacteria 2438
671 Ga0496123_0146268 3300048926 Bacteria 1283
672 Ga0496123_0153249 3300048926 Bacteria 1240
673 Ga0496123_0168671 3300048926 Bacteria 1157
674 Ga0496124_0000262 3300048927 Bacteria 101572
675 Ga0496124_0013622 3300048927 Bacteria 7927
676 Ga0496124_0018393 3300048927 Bacteria 6545
677 Ga0496124_0021865 3300048927 Bacteria 5885
678 Ga0496124_0028404 3300048927 Bacteria 5004
679 Ga0496124_0035585 3300048927 Bacteria 4355
680 Ga0496124_0042095 3300048927 Bacteria 3934
681 Ga0496124_0138325 3300048927 Bacteria 1925
682 Ga0496124_0203036 3300048927 Bacteria 1506
683 Ga0496124_0215445 3300048927 Bacteria 1449
684 Ga0496124_0218964 3300048927 Bacteria 1433
685 Ga0496124_0343240 3300048927 Bacteria 1059
686 Ga0496124_0347364 3300048927 Bacteria 1051
687 Ga0496124_0380611 3300048927 Bacteria 987
688 Ga0496124_0553485 3300048927 Bacteria 759
689 Ga0496124_0784483 3300048927 Bacteria 592
690 Ga0496125_0016520 3300048928 Bacteria 7083
691 Ga0496125_0046342 3300048928 Bacteria 3648
692 Ga0496125_0046902 3300048928 Bacteria 3620
693 Ga0496125_0062822 3300048928 Bacteria 2966
694 Ga0496125_0063587 3300048928 Bacteria 2941
695 Ga0496125_0135151 3300048928 Bacteria 1726
696 Ga0496125_0161367 3300048928 Bacteria 1522
697 Ga0496125_0496428 3300048928 Bacteria 688
698 Ga0496125_0671866 3300048928 Bacteria 554
699 Ga0496126_0317543 3300048929 Bacteria 1281
700 Ga0496126_0318276 3300048929 Bacteria 1279
701 Ga0496126_0342461 3300048929 Bacteria 1224
702 Ga0496126_0843656 3300048929 Bacteria 699
703 Ga0496126_0974907 3300048929 Bacteria 638
704 Ga0495678_107005 3300049459 Bacteria 960
705 Ga0501031_0000015 3300049568 Bacteria 113809
706 Ga0501031_0119719 3300049568 Bacteria 1720
707 Ga0501031_0517321 3300049568 Bacteria 769
708 Ga0501031_0692584 3300049568 Bacteria 654
709 Ga0501031_0714479 3300049568 Bacteria 643
710 Ga0501032_0000008 3300049569 Bacteria 240313
711 Ga0501032_0000060 3300049569 Bacteria 95279
712 Ga0501032_0005294 3300049569 Bacteria 9595
713 Ga0501032_0062601 3300049569 Bacteria 2493
714 Ga0501032_0140503 3300049569 Bacteria 1590
715 Ga0501032_0169666 3300049569 Bacteria 1431
716 Ga0501032_0245670 3300049569 Bacteria 1162
717 Ga0501032_0303820 3300049569 Bacteria 1031
718 Ga0501032_0351425 3300049569 Bacteria 950
719 Ga0501032_0483529 3300049569 Bacteria 792
720 Ga0501032_0518761 3300049569 Bacteria 761
721 Ga0501032_0519842 3300049569 Bacteria 760
722 Ga0501032_0618040 3300049569 Bacteria 689
723 Ga0501032_0654267 3300049569 Bacteria 667
724 Ga0501033_0000012 3300049570 Bacteria 241599
725 Ga0501033_0001335 3300049570 Bacteria 21910
726 Ga0501033_0002298 3300049570 Bacteria 16318
727 Ga0501033_0004893 3300049570 Bacteria 10660
728 Ga0501033_0009206 3300049570 Bacteria 7605
729 Ga0501033_0011407 3300049570 Bacteria 6801
730 Ga0501033_0039843 3300049570 Bacteria 3509
731 Ga0501033_0071653 3300049570 Bacteria 2545
732 Ga0501033_0125926 3300049570 Bacteria 1857
733 Ga0501033_0160697 3300049570 Bacteria 1617
734 Ga0501033_0205759 3300049570 Bacteria 1404
735 Ga0501033_0226167 3300049570 Bacteria 1330
736 Ga0501033_1017243 3300049570 Bacteria 553
737 Ga0501034_0000035 3300049571 Bacteria 241623
738 Ga0501034_0000262 3300049571 Bacteria 95293
739 Ga0501034_0005192 3300049571 Bacteria 14287
740 Ga0501034_0035832 3300049571 Bacteria 5030
741 Ga0501034_0041503 3300049571 Bacteria 4655
742 Ga0501034_0047586 3300049571 Bacteria 4330
743 Ga0501034_0053596 3300049571 Bacteria 4061
744 Ga0501034_0075365 3300049571 Bacteria 3381
745 Ga0501034_0176533 3300049571 Bacteria 2102
746 Ga0501034_0178113 3300049571 Bacteria 2091
747 Ga0501034_0230965 3300049571 Bacteria 1799
748 Ga0501034_0400793 3300049571 Bacteria 1295
749 Ga0501034_0573933 3300049571 Bacteria 1035
750 Ga0501034_0707760 3300049571 Bacteria 905
751 Ga0501034_0713588 3300049571 Bacteria 900
752 Ga0501034_0735890 3300049571 Bacteria 882
753 Ga0501034_0919355 3300049571 Bacteria 762
754 Ga0501034_1125919 3300049571 Bacteria 665
755 Ga0501034_1696878 3300049571 Bacteria 504
756 Ga0501036_0000006 3300049572 Bacteria 241623
757 Ga0501036_0002494 3300049572 Bacteria 14439
758 Ga0501036_0014052 3300049572 Bacteria 6654
759 Ga0501036_0084183 3300049572 Bacteria 2689
760 Ga0501036_0087995 3300049572 Bacteria 2625
761 Ga0501036_0345354 3300049572 Bacteria 1243
762 Ga0501036_0395321 3300049572 Bacteria 1153
763 Ga0501036_0460052 3300049572 Bacteria 1060
764 Ga0501036_0797724 3300049572 Bacteria 778
765 Ga0501036_1035941 3300049572 Bacteria 671
766 Ga0501036_1292805 3300049572 Bacteria 593
767 Ga0501036_1344330 3300049572 Bacteria 580
768 Ga0501036_1347433 3300049572 Bacteria 579
769 Ga0501036_1398730 3300049572 Bacteria 567
770 Ga0501037_0000076 3300049573 Bacteria 92049
771 Ga0501037_0000123 3300049573 Bacteria 72229
772 Ga0501037_0001856 3300049573 Bacteria 15330
773 Ga0501037_0312402 3300049573 Bacteria 1089
774 Ga0501037_0575074 3300049573 Bacteria 758
775 Ga0501037_0593144 3300049573 Bacteria 744
776 Ga0501037_0732344 3300049573 Bacteria 656
777 Ga0501037_0805133 3300049573 Bacteria 620
778 Ga0501038_0000007 3300049574 Bacteria 210775
779 Ga0501038_0000051 3300049574 Bacteria 95293
780 Ga0501038_0087718 3300049574 Bacteria 2613
781 Ga0501038_0096036 3300049574 Bacteria 2475
782 Ga0501038_0116778 3300049574 Bacteria 2205
783 Ga0501038_0204620 3300049574 Bacteria 1582
784 Ga0501038_0217572 3300049574 Bacteria 1525
785 Ga0501038_0432277 3300049574 Bacteria 1014
786 Ga0501039_0000012 3300049575 Bacteria 241623
787 Ga0501039_0000051 3300049575 Bacteria 95293
788 Ga0501039_0514244 3300049575 Bacteria 940
789 Ga0501039_0887801 3300049575 Bacteria 694
790 Ga0501039_1442547 3300049575 Bacteria 529
791 Ga0501040_0413511 3300049576 Bacteria 969
792 Ga0501040_0584237 3300049576 Bacteria 807
793 Ga0501041_0142084 3300049577 Bacteria 1497
794 Ga0501041_0477563 3300049577 Bacteria 792
795 Ga0501042_0430481 3300049578 Bacteria 956
796 Ga0501042_0463082 3300049578 Bacteria 920
797 Ga0501043_0000039 3300049579 Bacteria 119155
798 Ga0501043_0001221 3300049579 Bacteria 22654
799 Ga0501043_0004079 3300049579 Bacteria 11929
800 Ga0501043_0071995 3300049579 Bacteria 2715
801 Ga0501043_0180657 3300049579 Bacteria 1644
802 Ga0501043_0240560 3300049579 Bacteria 1396
803 Ga0501043_0266109 3300049579 Bacteria 1317
804 Ga0501043_0561275 3300049579 Bacteria 847
805 Ga0501043_0579306 3300049579 Bacteria 831
806 Ga0501043_0585171 3300049579 Bacteria 826
807 Ga0501046_0033384 3300049580 Bacteria 4158
808 Ga0501046_0041285 3300049580 Bacteria 3682
809 Ga0501046_0273409 3300049580 Bacteria 1239
810 Ga0501046_0484995 3300049580 Bacteria 886
811 Ga0501046_0602561 3300049580 Bacteria 779
812 Ga0501046_0872871 3300049580 Bacteria 628
813 Ga0501047_0018952 3300049581 Bacteria 6600
814 Ga0501047_0028848 3300049581 Bacteria 5353
815 Ga0501047_0043627 3300049581 Bacteria 4332
816 Ga0501047_0171121 3300049581 Bacteria 2041
817 Ga0501047_0181297 3300049581 Bacteria 1972
818 Ga0501047_0223820 3300049581 Bacteria 1737
819 Ga0501047_0276540 3300049581 Bacteria 1524
820 Ga0501047_0558304 3300049581 Bacteria 969
821 Ga0501047_0606904 3300049581 Bacteria 915
822 Ga0501047_0755214 3300049581 Bacteria 788
823 Ga0501047_1324975 3300049581 Bacteria 534
824 Ga0501048_0114792 3300049582 Bacteria 1902
825 Ga0501048_0468454 3300049582 Bacteria 903
826 Ga0501048_0798085 3300049582 Bacteria 678
827 Ga0501048_1106488 3300049582 Bacteria 570
828 Ga0501067_0001509 3300049583 Bacteria 12669
829 Ga0501067_0001738 3300049583 Bacteria 11977
830 Ga0501067_0016339 3300049583 Bacteria 4101
831 Ga0501067_0159244 3300049583 Bacteria 1257
832 Ga0501067_0174514 3300049583 Bacteria 1197
833 Ga0501067_0381726 3300049583 Bacteria 786
834 Ga0501067_0667933 3300049583 Bacteria 584
835 Ga0501067_0808456 3300049583 Bacteria 528
836 Ga0501067_0831227 3300049583 Bacteria 520
837 Ga0501068_0048418 3300049584 Bacteria 2566
838 Ga0501068_0148823 3300049584 Bacteria 1471
839 Ga0501068_0308850 3300049584 Bacteria 1013
840 Ga0501068_0340889 3300049584 Bacteria 962
841 Ga0501068_0739856 3300049584 Bacteria 644
842 Ga0501068_0961222 3300049584 Bacteria 563
843 Ga0501068_1150301 3300049584 Bacteria 514
844 Ga0501069_0000022 3300049585 Bacteria 119155
845 Ga0501069_0006194 3300049585 Bacteria 6251
846 Ga0501069_0072434 3300049585 Bacteria 1932
847 Ga0501069_0137771 3300049585 Bacteria 1399
848 Ga0501069_0176429 3300049585 Bacteria 1234
849 Ga0501069_0251701 3300049585 Bacteria 1030
850 Ga0501069_0335430 3300049585 Bacteria 890
851 Ga0501069_0336682 3300049585 Bacteria 888
852 Ga0501070_0000080 3300049586 Bacteria 81734
853 Ga0501070_0000562 3300049586 Bacteria 33858
854 Ga0501070_0004244 3300049586 Bacteria 12320
855 Ga0501070_0030179 3300049586 Bacteria 4543
856 Ga0501070_0045996 3300049586 Bacteria 3629
857 Ga0501070_0046391 3300049586 Bacteria 3613
858 Ga0501070_0081078 3300049586 Bacteria 2684
859 Ga0501070_0157273 3300049586 Bacteria 1874
860 Ga0501070_0166512 3300049586 Bacteria 1816
861 Ga0501070_0302943 3300049586 Bacteria 1302
862 Ga0501070_0502250 3300049586 Bacteria 974
863 Ga0501070_1394106 3300049586 Bacteria 533
864 Ga0501071_0110183 3300049587 Bacteria 2034
865 Ga0501071_0230530 3300049587 Bacteria 1395
866 Ga0501071_0260562 3300049587 Bacteria 1310
867 Ga0501071_0481021 3300049587 Bacteria 952
868 Ga0501071_1053896 3300049587 Bacteria 628
869 Ga0501072_0318595 3300049588 Bacteria 1236
870 Ga0501072_0326554 3300049588 Bacteria 1219
871 Ga0501072_0574746 3300049588 Bacteria 889
872 Ga0501072_0648765 3300049588 Bacteria 831
873 Ga0501072_0802529 3300049588 Bacteria 737
874 Ga0501072_1409936 3300049588 Bacteria 539
875 Ga0501073_0023019 3300049589 Bacteria 4480
876 Ga0501073_0031362 3300049589 Bacteria 3792
877 Ga0501073_0052349 3300049589 Bacteria 2859
878 Ga0501073_0074515 3300049589 Bacteria 2363
879 Ga0501073_0082068 3300049589 Bacteria 2242
880 Ga0501073_0087086 3300049589 Bacteria 2172
881 Ga0501073_0122571 3300049589 Bacteria 1802
882 Ga0501073_0246234 3300049589 Bacteria 1234
883 Ga0501073_0525809 3300049589 Bacteria 817
884 Ga0501073_0579512 3300049589 Bacteria 775
885 Ga0501073_0855415 3300049589 Bacteria 627
886 Ga0501073_1258770 3300049589 Bacteria 507
887 Ga0501074_0000046 3300049590 Bacteria 57165
888 Ga0501074_0056084 3300049590 Bacteria 2839
889 Ga0501074_0087731 3300049590 Bacteria 2228
890 Ga0501074_0141115 3300049590 Bacteria 1723
891 Ga0501074_0182400 3300049590 Bacteria 1497
892 Ga0501074_0234146 3300049590 Bacteria 1307
893 Ga0501074_0615986 3300049590 Bacteria 767
894 Ga0501074_1012789 3300049590 Bacteria 584
895 Ga0501076_0034752 3300049592 Bacteria 3942
896 Ga0501076_0332177 3300049592 Bacteria 1247
897 Ga0501076_1663813 3300049592 Bacteria 524
898 Ga0501076_1672620 3300049592 Bacteria 522
899 Ga0501077_0311404 3300049593 Bacteria 1003
900 Ga0501077_0388743 3300049593 Bacteria 891
901 Ga0501225_0369512 3300049705 Bacteria 500
902 Ga0501079_0744629 3300049741 Bacteria 771
903 Ga0501080_0001756 3300049742 Bacteria 18596
904 Ga0501080_0020842 3300049742 Bacteria 6067
905 Ga0501080_0030986 3300049742 Bacteria 4983
906 Ga0501080_0032812 3300049742 Bacteria 4844
907 Ga0501080_0050611 3300049742 Bacteria 3866
908 Ga0501080_0053538 3300049742 Bacteria 3758
909 Ga0501080_0062992 3300049742 Bacteria 3451
910 Ga0501080_0342621 3300049742 Bacteria 1350
911 Ga0501080_0529119 3300049742 Bacteria 1051
912 Ga0501080_0538698 3300049742 Bacteria 1041
913 Ga0501080_1276783 3300049742 Bacteria 629
914 Ga0501080_1509509 3300049742 Bacteria 571
915 Ga0501080_1767376 3300049742 Bacteria 520
916 Ga0501081_0378547 3300049743 Bacteria 1046
917 Ga0501083_0000050 3300049744 Bacteria 86199
918 Ga0501083_0013991 3300049744 Bacteria 5606
919 Ga0501083_0022537 3300049744 Bacteria 4370
920 Ga0501083_0033084 3300049744 Bacteria 3541
921 Ga0501083_0162557 3300049744 Bacteria 1460
922 Ga0501083_0221946 3300049744 Bacteria 1231
923 Ga0501083_0233950 3300049744 Bacteria 1196
924 Ga0501083_1052838 3300049744 Bacteria 529
925 Ga0501241_134614 3300049758 Bacteria 559
926 Ga0501035_0000035 3300049822 Bacteria 166916
927 Ga0501035_0000119 3300049822 Bacteria 95271
928 Ga0501035_0000318 3300049822 Bacteria 55751
929 Ga0501035_0002603 3300049822 Bacteria 17619
930 Ga0501035_0006643 3300049822 Bacteria 10826
931 Ga0501035_0006842 3300049822 Bacteria 10654
932 Ga0501035_0030753 3300049822 Bacteria 4894
933 Ga0501035_0044748 3300049822 Bacteria 3984
934 Ga0501035_0060854 3300049822 Bacteria 3361
935 Ga0501035_0089369 3300049822 Bacteria 2713
936 Ga0501035_0183242 3300049822 Bacteria 1803
937 Ga0501035_0317249 3300049822 Bacteria 1310
938 Ga0501035_0376832 3300049822 Bacteria 1184
939 Ga0501035_0464000 3300049822 Bacteria 1046
940 Ga0501035_0518159 3300049822 Bacteria 980
941 Ga0501035_0727242 3300049822 Bacteria 798
942 Ga0501035_0781081 3300049822 Bacteria 764
943 Ga0501044_0000015 3300049823 Bacteria 241623
944 Ga0501044_0000147 3300049823 Bacteria 86591
945 Ga0501044_0015094 3300049823 Bacteria 8323
946 Ga0501044_0016473 3300049823 Bacteria 7933
947 Ga0501044_0022765 3300049823 Bacteria 6672
948 Ga0501044_0048598 3300049823 Bacteria 4381
949 Ga0501044_0059166 3300049823 Bacteria 3927
950 Ga0501044_0060367 3300049823 Bacteria 3883
951 Ga0501044_0065007 3300049823 Bacteria 3721
952 Ga0501044_0168979 3300049823 Bacteria 2159
953 Ga0501044_0215889 3300049823 Bacteria 1870
954 Ga0501044_0223957 3300049823 Bacteria 1830
955 Ga0501044_0472744 3300049823 Bacteria 1157
956 Ga0501044_0604555 3300049823 Bacteria 989
957 Ga0501044_0788141 3300049823 Bacteria 830
958 Ga0501044_0950525 3300049823 Bacteria 732
959 Ga0501044_1365369 3300049823 Bacteria 574
960 Ga0501045_1432295 3300049824 Bacteria 501
961 nmdc:mga03683_286146_c1 3300050489 Bacteria 771
962 nmdc:mga03n38_10345_c1 3300050490 Bacteria 3427
963 nmdc:mga03n38_246070_c1 3300050490 Bacteria 943
964 nmdc:mga03n38_258240_c1 3300050490 Bacteria 923
965 nmdc:mga03n38_555724_c1 3300050490 Bacteria 650
966 nmdc:mga03n38_56903_c1 3300050490 Bacteria 1767
967 nmdc:mga03n38_904636_c1 3300050490 Bacteria 519
968 nmdc:mga00v17_1009016_c1 3300050491 Bacteria 524
969 nmdc:mga00v17_127891_c1 3300050491 Bacteria 1622
970 nmdc:mga00v17_173_c1 3300050491 Bacteria 26281
971 nmdc:mga00v17_324681_c1 3300050491 Bacteria 1000
972 nmdc:mga00v17_47178_c1 3300050491 Bacteria 2609
973 nmdc:mga00v17_9111_c1 3300050491 Bacteria 5358
974 nmdc:mga0yw44_10523_c1 3300050492 Bacteria 4730
975 nmdc:mga0yw44_108180_c1 3300050492 Bacteria 1779
976 nmdc:mga0yw44_11446_c1 3300050492 Bacteria 4581
977 nmdc:mga0yw44_15055_c1 3300050492 Bacteria 4130
978 nmdc:mga0yw44_441_c1 3300050492 Bacteria 14578
979 nmdc:mga0yw44_49350_c1 3300050492 Bacteria 2540
980 nmdc:mga0yw44_593236_c1 3300050492 Bacteria 753
981 nmdc:mga0yw44_86562_c1 3300050492 Bacteria 1974
982 nmdc:mga0k408_60341_c1 3300050493 Bacteria 2204
983 nmdc:mga06z11_106684_c1 3300050494 Bacteria 1545
984 nmdc:mga06z11_170701_c1 3300050494 Bacteria 1249
985 nmdc:mga06z11_314813_c1 3300050494 Bacteria 933
986 nmdc:mga06z11_49090_c1 3300050494 Bacteria 2151
987 nmdc:mga06z11_562869_c1 3300050494 Bacteria 692
988 nmdc:mga06z11_774575_c1 3300050494 Bacteria 585
989 nmdc:mga06z11_93770_c1 3300050494 Bacteria 1635
990 nmdc:mga04h51_21783_c1 3300050495 Bacteria 1932
991 nmdc:mga04h51_36355_c1 3300050495 Bacteria 1584
992 nmdc:mga04h51_424249_c1 3300050495 Bacteria 560
993 nmdc:mga07m45_104373_c1 3300050496 Bacteria 1259
994 nmdc:mga07m45_42166_c1 3300050496 Bacteria 2558
995 nmdc:mga07m45_657958_c1 3300050496 Bacteria 604
996 nmdc:mga0sz30_101285_c1 3300050516 Bacteria 1258
997 nmdc:mga0sz30_130474_c1 3300050516 Bacteria 1107
998 nmdc:mga0sz30_41607_c1 3300050516 Bacteria 1932
999 nmdc:mga0sz30_8230_c1 3300050516 Bacteria 3931
1000 Ga0495601_0101045 3300053077 Bacteria 1863
1001 Ga0495601_0185127 3300053077 Bacteria 1361
1002 Ga0500610_0111205 3300053079 Bacteria 1408
1003 Ga0495655_0032364 3300053083 Bacteria 1279
1004 Ga0495619_1097743 3300053085 Bacteria 529
1005 Ga0500578_0134836 3300053086 Bacteria 1546
1006 Ga0500643_016656 3300053087 Bacteria 2484
1007 Ga0500560_100384 3300053107 Bacteria 969
1008 Ga0500569_041638 3300053109 Bacteria 1348
1009 Ga0500572_016012 3300053111 Bacteria 1901
1010 Ga0500595_069476 3300053119 Bacteria 1048
1011 Ga0500608_148426 3300053122 Bacteria 1031
1012 Ga0500618_000665 3300053125 Bacteria 20266
1013 Ga0500618_067148 3300053125 Bacteria 805
1014 Ga0500642_0488237 3300053130 Bacteria 522
1015 Ga0500658_0019888 3300053134 Bacteria 2530
1016 Ga0500561_0001611 3300053137 Bacteria 3692
1017 Ga0500568_0041884 3300053139 Bacteria 1838
1018 Ga0500590_021794 3300053148 Bacteria 3324
1019 Ga0500604_0117344 3300053151 Bacteria 888
1020 Ga0500616_0000777 3300053153 Bacteria 36725
1021 Ga0500616_0079595 3300053153 Bacteria 1649
1022 Ga0500616_0119437 3300053153 Bacteria 1261
1023 Ga0500616_0127568 3300053153 Bacteria 1206
1024 Ga0500620_004286 3300053155 Bacteria 3171
1025 Ga0500622_0003948 3300053156 Bacteria 9580
1026 Ga0500624_000965 3300053157 Bacteria 5901
1027 Ga0500624_015562 3300053157 Bacteria 1165
1028 Ga0500627_0085258 3300053158 Bacteria 1410
1029 Ga0500627_0309192 3300053158 Bacteria 688
1030 Ga0500627_0348032 3300053158 Bacteria 640
1031 Ga0500627_0475487 3300053158 Bacteria 523
1032 Ga0500634_0005719 3300053161 Bacteria 5940
1033 Ga0500636_0000023 3300053177 Bacteria 89900
1034 Ga0500611_196163 3300053727 Bacteria 570
1035 Ga0501084_0086089 3300054114 Bacteria 2638
1036 Ga0501084_0361044 3300054114 Bacteria 1227
1037 Ga0501084_0365840 3300054114 Bacteria 1218
1038 Ga0501084_1077465 3300054114 Unclassified 675
1039 Ga0501084_1400998 3300054114 Bacteria 585
1040 Ga0501084_1457859 3300054114 Bacteria 573
1041 Ga0587066_149156 3300059490 Bacteria 578
1042 Ga0587080_174070 3300059503 Bacteria 512
1043 Ga0587083_0077706 3300059505 Bacteria 784
1044 Ga0587088_010459 3300059508 Bacteria 1360
1045 Ga0587090_064526 3300059510 Bacteria 702
1046 Ga0587115_104422 3300059626 Bacteria 529
1047 Ga0587067_048822 3300059640 Bacteria 849
1048 Ga0587076_191865 3300059645 Bacteria 521
1049 Ga0587107_101336 3300059652 Bacteria 570
1050 Ga0501082_0125020 3300060353 Bacteria 2230
1051 Ga0501082_0176976 3300060353 Bacteria 1855
1052 Ga0501082_0182207 3300060353 Bacteria 1827
1053 Ga0501082_0260814 3300060353 Bacteria 1507
1054 Ga0501082_0371961 3300060353 Bacteria 1247
1055 Ga0501082_0812562 3300060353 Bacteria 818
1056 Ga0501082_1039389 3300060353 Bacteria 716
1057 Ga0501082_1706734 3300060353 Bacteria 549
1058 Ga0501082_1824147 3300060353 Bacteria 530
1059 Ga0466962_0215714 3300061719 Bacteria 939
1060 2503203686 2503198000 Bacteria 6884444
1061 2509107283 2508501122 Bacteria 6292184
1062 2509113951 2508501123 Bacteria 6283661
1063 2509141084 2508501127 Bacteria 7037543
1064 2509370833 2509276018 Bacteria 6910194
1065 2509388228 2509276021 Bacteria 7634384
1066 2509398050 2509276022 Bacteria 6200534
1067 2509443803 2509276033 Bacteria 7180565
1068 2510131665 2510065019 Bacteria 6903379
1069 2510304965 2510065057 Bacteria 6649661
1070 2510316622 2510065059 Bacteria 6847884
1071 2510897962 2510461076 Bacteria 8618824
1072 2511137398 2510917022 Bacteria 6504556
1073 2511170424 2510917026 Bacteria 7046020
1074 2511183629 2510917028 Bacteria 6185411
1075 2511196144 2510917030 Bacteria 7460662
1076 2511390657 2511231027 Bacteria 5013807
1077 2511500759 2511231052 Bacteria 6974333
1078 2512532173 2512047086 Bacteria 6850303
1079 2512929503 2512875016 Bacteria 6529530
1080 2512964296 2512875024 Bacteria 7195110
1081 2512972490 2512875026 Bacteria 6861065
1082 2513571242 2513237084 Bacteria 7231967
1083 2513579218 2513237085 Bacteria 7695351
1084 2513584952 2513237086 Bacteria 7265287
1085 2513598718 2513237088 Bacteria 6927906
1086 2513605513 2513237089 Bacteria 6553624
1087 2513608113 2513237090 Bacteria 7096802
1088 2513616751 2513237091 Bacteria 6900273
1089 2513632336 2513237093 Bacteria 7545552
1090 2513711661 2513237103 Bacteria 7647401
1091 2513880835 2513237140 Bacteria 7076289
1092 2513903829 2513237143 Bacteria 6664116
1093 2513984899 2513237156 Bacteria 6402557
1094 2513999937 2513237159 Bacteria 6810126
1095 2514007488 2513237160 Bacteria 6650282
1096 2514020836 2513237162 Bacteria 7468464
1097 2514033954 2513237164 Bacteria 7563725
1098 2514421018 2513237305 Bacteria 7293571
1099 2514591482 2513237351 Bacteria 6968952
1100 2515110590 2515075009 Bacteria 7288508
1101 2515607889 2515154107 Bacteria 6795637
1102 2515639030 2515154113 Bacteria 7807172
1103 2515647018 2515154114 Bacteria 7848616
1104 2515661520 2515154116 Bacteria 7552979
1105 2515742910 2515154134 Bacteria 7220242
1106 2516208631 2516143018 Bacteria 6951533
1107 2516892030 2516653046 Bacteria 6989037
1108 2517039287 2516653077 Bacteria 7555578
1109 2517079530 2516653085 Bacteria 7346596
1110 2517093481 2517093000 Bacteria 7412387
1111 2517405176 2517287029 Bacteria 6905599
1112 2517568845 2517487022 Bacteria 7227575
1113 2520379959 2519899620 Bacteria 6499161
1114 2524450083 2524023207 Bacteria 6813453
1115 2524457690 2524023209 Bacteria 6679728
1116 2535484195 2534681786 Bacteria 3308809
1117 2535515265 2534681796 Bacteria 7146037
1118 2537874402 2537561587 Bacteria 5425293
1119 2551680164 2551306084 Bacteria 8942552
1120 2551684260 2551306085 Bacteria 7347181
1121 2551694093 2551306086 Bacteria 6843938
1122 2551698405 2551306087 Bacteria 7351905
1123 2551714557 2551306089 Bacteria 7162724
1124 2551720758 2551306090 Bacteria 7953713
1125 2551727590 2551306091 Bacteria 7086830
1126 2551735499 2551306092 Bacteria 6992595
1127 2551741321 2551306093 Bacteria 7064773
1128 2554246773 2554235003 Bacteria 5877155
1129 2559294000 2558860242 Bacteria 5568029
1130 2561467263 2558860983 Bacteria 4133860
1131 2585204046 2582581294 Bacteria 6626667
1132 2585225689 2582581298 Bacteria 7315509
1133 2585257010 2582581304 Bacteria 5831370
1134 2585266581 2582581306 Bacteria 6450535
1135 2585275267 2582581307 Bacteria 6597605
1136 2585281989 2582581308 Bacteria 7413247
1137 2585325808 2582581315 Bacteria 7318924
1138 2585329976 2582581316 Bacteria 7774528
1139 2585403903 2582581867 Bacteria 7184437
1140 2585528482 2585427526 Bacteria 7258840
1141 2585536360 2585427527 Bacteria 7273426
1142 2585539876 2585427528 Bacteria 6842387
1143 2585548036 2585427529 Bacteria 7395659
1144 2585554233 2585427530 Bacteria 7383882
1145 2585560290 2585427531 Bacteria 6992870
1146 2585824396 2585427590 Bacteria 6824633
1147 2585837857 2585427593 Bacteria 7141551
1148 2585844449 2585427594 Bacteria 6180594
1149 2585901442 2585427608 Bacteria 6544331
1150 2585905526 2585427609 Bacteria 6667127
1151 2585994657 2585427633 Bacteria 6413184
1152 2585999141 2585427634 Bacteria 6455027
1153 2587979359 2585428125 Bacteria 6662905
1154 2588515079 2588253730 Bacteria 6881675
1155 2597815791 2597489875 Bacteria 7010078
1156 2599333211 2599185156 Bacteria 5403036
1157 2599603676 2599185210 Bacteria 5624189
1158 2599719386 2599185236 Bacteria 6875203
1159 2599938650 2599185301 Bacteria 6161860
1160 2600191632 2599185352 Bacteria 7228948
1161 2601609023 2600255279 Bacteria 5605316
1162 2601745798 2600255308 Bacteria 5611129
1163 2616295849 2615840624 Bacteria 6557588
1164 2616306152 2615840626 Bacteria 7921970
1165 2616553591 2615840698 Bacteria 7319877
1166 2617382642 2617270742 Bacteria 6808054
1167 2643773951 2643221550 Bacteria 4619371
1168 2643774681 2643221551 Bacteria 3750538
1169 2643793126 2643221555 Bacteria 3749717
1170 2643807513 2643221557 Bacteria 7184309
1171 2643810371 2643221558 Bacteria 5460675
1172 2643838500 2643221564 Bacteria 4193379
1173 2643856205 2643221568 Bacteria 5187270
1174 2643909630 2643221580 Bacteria 3816678
1175 2643921009 2643221582 Bacteria 5804683
1176 2643989148 2643221595 Bacteria 6565519
1177 2644007519 2643221599 Bacteria 6292121
1178 2644069924 2643221610 Bacteria 7480339
1179 2644109307 2643221618 Bacteria 7717186
1180 2644132650 2643221623 Bacteria 5239945
1181 2644151828 2643221626 Bacteria 8069654
1182 2644152345 2643221627 Bacteria 6761570
1183 2644297343 2643221653 Bacteria 4569637
1184 2644311962 2643221655 Bacteria 7722067
1185 2644330236 2643221659 Bacteria 7890716
1186 2644380896 2643221668 Bacteria 7306521
1187 2644413686 2643221674 Bacteria 3919126
1188 2644414800 2643221675 Bacteria 7473456
1189 2644448457 2643221680 Bacteria 7473610
1190 2644497270 2643221689 Bacteria 6042950
1191 2644519085 2643221693 Bacteria 5513853
1192 2644543011 2643221698 Bacteria 7756764
1193 2644617760 2643221712 Bacteria 7729434
1194 2644655596 2643221719 Bacteria 4568197
1195 2644673854 2643221723 Bacteria 7095460
1196 2644689236 2643221726 Bacteria 7455827
1197 2657682065 2657244999 Bacteria 5946535
1198 2671112541 2667528174 Bacteria 6435400
1199 2688600448 2687453392 Bacteria 6880454
1200 2692317080 2690316117 Bacteria 6800650
1201 2694632612 2693429783 Bacteria 7019804
1202 2694639659 2693429784 Bacteria 7241525
1203 2719179746 2718217882 Bacteria 6556348
1204 2719384360 2718217927 Bacteria 6972593
1205 2719664097 2718217997 Bacteria 6740740
1206 2719730416 2718218009 Bacteria 6478651
1207 2720490516 2718218199 Bacteria 6740745
1208 2720611896 2718218232 Bacteria 6720332
1209 2720618750 2718218233 Bacteria 6662049
1210 2720630150 2718218235 Bacteria 6630699
1211 2720773845 2718218269 Bacteria 6906114
1212 2721145839 2718218363 Bacteria 6524337
1213 2721157375 2718218365 Bacteria 6274507
1214 2721162718 2718218366 Bacteria 6425255
1215 2721398074 2718218423 Bacteria 6438183
1216 2722838888 2721755514 Bacteria 6424414
1217 2723025515 2721755556 Bacteria 6745503
1218 2723559100 2721755684 Bacteria 6859907
1219 2723565705 2721755685 Bacteria 6704835
1220 2723577722 2721755686 Bacteria 7343952
1221 2724036884 2721755809 Bacteria 6438790
1222 2724043172 2721755810 Bacteria 6479005
1223 2724088452 2721755819 Bacteria 6906405
1224 2724102970 2721755822 Bacteria 6726041
1225 2724108833 2721755823 Bacteria 6752556
1226 2725950930 2724679232 Bacteria 7646494
1227 2730106451 2728369352 Bacteria 6745171
1228 2730162983 2728369365 Bacteria 6555560
1229 2730297007 2728369397 Bacteria 6274511
1230 2738802375 2738541293 Bacteria 7065685
1231 2738945782 2738541317 Bacteria 5340176
1232 2739034733 2738541333 Bacteria 7106503
1233 2739308665 2738543024 Bacteria 5603683
1234 2753358782 2751185800 Bacteria 5467370
1235 2756672995 2756170246 Bacteria 7451806
1236 2757569442 2757320392 Bacteria 3737298
1237 2758641014 2758568016 Bacteria 5645291
1238 2766065049 2765235942 Bacteria 7445910
1239 2770194887 2767802442 Bacteria 5747986
1240 2776272331 2775506902 Bacteria 6208009
1241 2776284270 2775506904 Bacteria 5954060
1242 2776912341 2775507049 Bacteria 6284736
1243 2778174344 2775507266 Bacteria 7392367
1244 2792583919 2791355082 Bacteria 5973319
1245 2792622283 2791355091 Bacteria 6135441
1246 2792628151 2791355092 Bacteria 6248105
1247 2792638592 2791355094 Bacteria 7011481
1248 2792753107 2791355123 Bacteria 8049106
1249 2793283684 2791355253 Bacteria 5171699
1250 2793295036 2791355256 Bacteria 6798008
1251 2793315245 2791355259 Bacteria 7254731
1252 2793320105 2791355260 Bacteria 6598818
1253 2793332612 2791355262 Bacteria 6774204
1254 2793350605 2791355264 Bacteria 6429314
1255 2793353201 2791355265 Bacteria 6539969
1256 2793361001 2791355266 Bacteria 7116587
1257 2793364863 2791355267 Bacteria 7222458
1258 2802717486 2802428858 Bacteria 6636079
1259 2802723585 2802428859 Bacteria 6667919
1260 2802730965 2802428860 Bacteria 6525526
1261 2802735971 2802428861 Bacteria 6534206
1262 2802743820 2802428862 Bacteria 6633353
1263 2802752963 2802428863 Bacteria 6410669
1264 2804751083 2802429268 Bacteria 6094027
1265 2805927400 2802429605 Bacteria 6875453
1266 2805936438 2802429606 Bacteria 6346811
1267 2806044032 2802429633 Bacteria 7341974
1268 2806052150 2802429634 Bacteria 7083200
1269 2806058451 2802429635 Bacteria 7650140
1270 2806066949 2802429636 Bacteria 7597525
1271 2806074692 2802429637 Bacteria 7067217
1272 2808986224 2808606387 Bacteria 5697198
1273 2819556354 2818991439 Bacteria 6907412
1274 2819608229 2818991448 Bacteria 6772224
1275 2819639581 2818991453 Bacteria 7181617
1276 2821123812 2821123053 Bacteria 7836056
1277 2838021808 2838016132 Bacteria 6577831
1278 2838026495 2838022645 Bacteria 6494267
1279 2838029122 2838029111 Bacteria 6603031
1280 2838054577 2838048938 Bacteria 6044578
1281 2838067533 2838061910 Bacteria 6794874
1282 2838074074 2838068647 Bacteria 6208656
1283 2838076164 2838074704 Bacteria 6785777
1284 2838673248 2838668709 Bacteria 6671819
1285 2838677081 2838675328 Bacteria 4909118
1286 2838680778 2838680041 Bacteria 6545511
1287 2838692566 2838686498 Bacteria 7807632
1288 2838695189 2838694306 Bacteria 6853137
1289 2838704050 2838701080 Bacteria 6669771
1290 2838708565 2838707686 Bacteria 6619912
1291 2838715968 2838714209 Bacteria 5525906
1292 2838720230 2838719591 Bacteria 5523910
1293 2838726721 2838724970 Bacteria 4908691
1294 2838732638 2838729681 Bacteria 7400765
1295 2838739158 2838736955 Bacteria 5760694
1296 2838745533 2838742623 Bacteria 7396178
1297 2840764973 2840764183 Bacteria 6358399
1298 2841735091 2841734538 Bacteria 6784580
1299 2841843056 2841840854 Bacteria 5761912
1300 2841847164 2841846520 Bacteria 5345850
1301 2841855177 2841851746 Bacteria 7532261
1302 2841860303 2841859092 Bacteria 5436171
1303 2841866625 2841864319 Bacteria 6742987
1304 2842080201 2842077413 Bacteria 6508645
1305 2842112390 2842110456 Bacteria 7656360
1306 2842120820 2842118031 Bacteria 7033875
1307 2842126806 2842124991 Bacteria 5346824
1308 2842131974 2842130223 Bacteria 4909145
1309 2842142838 2842140634 Bacteria 5759631
1310 2842148158 2842146304 Bacteria 5957337
1311 2842152856 2842152218 Bacteria 4908957
1312 2842161793 2842156927 Bacteria 6894975
1313 2842169168 2842163707 Bacteria 6916235
1314 2842172213 2842170452 Bacteria 5525737
1315 2842176475 2842175837 Bacteria 4908771
1316 2842185410 2842180545 Bacteria 6888678
1317 2842189077 2842187318 Bacteria 5524014
1318 2842193087 2842192696 Bacteria 6147454
1319 2842203173 2842198810 Bacteria 6608673
1320 2842206751 2842205361 Bacteria 6340321
1321 2842213390 2842211629 Bacteria 5523832
1322 2842218610 2842217011 Bacteria 7497767
1323 2842224992 2842224351 Bacteria 5524473
1324 2842233348 2842229732 Bacteria 7475766
1325 2842237977 2842237096 Bacteria 6620661
1326 2842248648 2842243621 Bacteria 7421798
1327 2842253224 2842250916 Bacteria 6579627
1328 2842261791 2842257432 Bacteria 7401195
1329 2842267261 2842264693 Bacteria 6472963
1330 2842277145 2842271015 Bacteria 7807131
1331 2842280556 2842278818 Bacteria 6340002
1332 2842289508 2842285085 Bacteria 6011953
1333 2842293860 2842291075 Bacteria 7076806
1334 2842300695 2842298080 Bacteria 6123127
1335 2842306297 2842304105 Bacteria 7023636
1336 2842315977 2842311132 Bacteria 6616990
1337 2842322331 2842317721 Bacteria 6793725
1338 2842342888 2842341865 Bacteria 7003929
1339 2842358187 2842357229 Bacteria 6485165
1340 2842369516 2842363717 Bacteria 6844742
1341 2842371241 2842370503 Bacteria 7038661
1342 2842380256 2842377471 Bacteria 7140707
1343 2842387328 2842384541 Bacteria 7057858
1344 2842400746 2842395702 Bacteria 6780583
1345 2842406856 2842402390 Bacteria 6681310
1346 2842413647 2842409023 Bacteria 6687331
1347 2842420390 2842415677 Bacteria 6596907
1348 2842427702 2842422224 Bacteria 6239196
1349 2842431487 2842428310 Bacteria 6767288
1350 2842437822 2842434925 Bacteria 6502746
1351 2842444637 2842441272 Bacteria 6769273
1352 2842450391 2842447887 Bacteria 6754142
1353 2842465535 2842462802 Bacteria 6588055
1354 2842472345 2842469257 Bacteria 6752936
1355 2842476448 2842475841 Bacteria 6603183
1356 2842482524 2842482326 Bacteria 7212537
1357 2842495084 2842489311 Bacteria 6620893
1358 2842500993 2842495871 Bacteria 6820686
1359 2842502650 2842502639 Bacteria 6604161
1360 2842509376 2842509118 Bacteria 6850950
1361 2842517088 2842515876 Bacteria 5436280
1362 2842526513 2842521101 Bacteria 6569494
1363 2842873642 2842871566 Bacteria 4827117
1364 2842923518 2842922631 Bacteria 5824079
1365 2844005456 2844002411 Bacteria 7168230
1366 2844015770 2844009547 Bacteria 6728125
1367 2844163676 2844163670 Bacteria 7266046
1368 2844455792 2844454524 Bacteria 7952546
1369 2847417851 2847417321 Bacteria 6913799
1370 2847672114 2847670302 Bacteria 6165597
1371 2847688443 2847686936 Bacteria 6278406
1372 2848992693 2848992105 Bacteria 6810864
1373 2852388697 2852387548 Bacteria 8025568
1374 2854898453 2854896431 Bacteria 5869725
1375 2854914358 2854911287 Bacteria 5582813
1376 2854917771 2854916844 Bacteria 5725939
1377 2855831951 2855825444 Bacteria 6785811
1378 2855840236 2855839649 Bacteria 7135830
1379 2855873245 2855872281 Bacteria 6964271
1380 2856318076 2856314179 Bacteria 6477897
1381 2856326609 2856320880 Bacteria 7263508
1382 2856330882 2856328259 Bacteria 6528202
1383 2856339872 2856334872 Bacteria 7037011
1384 2856346914 2856342000 Bacteria 7176905
1385 2856355626 2856349417 Bacteria 6230045
1386 2856363125 2856356410 Bacteria 6297484
1387 2856365359 2856364286 Bacteria 6939991
1388 2857354789 2857349434 Bacteria 7926032
1389 2857368347 2857367948 Bacteria 6965560
1390 2857524083 2857516855 Bacteria 7787325
1391 2857531374 2857531043 Bacteria 6754041
1392 2858800768 2858800743 Bacteria 6603254
1393 2869168182 2869162929 Bacteria 6399702
1394 2869172289 2869169390 Bacteria 6659796
1395 2869237716 2869234852 Bacteria 6654993
1396 2869247529 2869242130 Bacteria 6609239
1397 2869252136 2869249662 Bacteria 6868783
1398 2869261480 2869256925 Bacteria 6981691
1399 2869270890 2869264136 Bacteria 6880765
1400 2869271783 2869271264 Bacteria 6908218
1401 2869280277 2869278585 Bacteria 7077053
1402 2869289270 2869285874 Bacteria 6901219
1403 2871431338 2871429161 Bacteria 6547891
1404 2871438328 2871435913 Bacteria 6880295
1405 2871445424 2871444079 Bacteria 6423508
1406 2871452275 2871451962 Bacteria 7336357
1407 2871460545 2871459585 Bacteria 6866887
1408 2871467090 2871466892 Bacteria 6923287
1409 2871478079 2871474448 Bacteria 6806570
1410 2871484179 2871481445 Bacteria 6700002
1411 2871492770 2871488783 Bacteria 6929816
1412 2871497365 2871495908 Bacteria 6935695
1413 2874102230 2874102143 Bacteria 6342645
1414 2874111380 2874109183 Bacteria 6517025
1415 2874119809 2874116593 Bacteria 6674494
1416 2874125314 2874123672 Bacteria 7238285
1417 2874134316 2874131515 Bacteria 6820270
1418 2874144385 2874139085 Bacteria 7021506
1419 2874148537 2874146452 Bacteria 7533118
1420 2874156281 2874155637 Bacteria 6724144
1421 2874166705 2874162495 Bacteria 6174670
1422 2874173690 2874168670 Bacteria 8062617
1423 2876366937 2876363079 Bacteria 6544991
1424 2876374408 2876369609 Bacteria 6807521
1425 2876379822 2876377896 Bacteria 6565995
1426 2876388997 2876386047 Bacteria 6698674
1427 2876398903 2876392853 Bacteria 6660880
1428 2876404577 2876399893 Bacteria 6927900
1429 2876409089 2876406927 Bacteria 6191900
1430 2876415316 2876413966 Bacteria 6831344
1431 2876421913 2876420981 Bacteria 6687741
1432 2878037334 2878035449 Bacteria 6555736
1433 2878735390 2878730984 Bacteria 6380721
1434 2878744238 2878738818 Bacteria 7136951
1435 2878747942 2878745973 Bacteria 6867388
1436 2878758651 2878753008 Bacteria 6922523
1437 2878761583 2878760144 Bacteria 6823465
1438 2878768550 2878767105 Bacteria 6898628
1439 2878780933 2878774303 Bacteria 6108671
1440 2878786653 2878781027 Bacteria 6834456
1441 2878792713 2878788777 Bacteria 6567085
1442 2881154043 2881147464 Bacteria 7779814
1443 2881157787 2881155292 Bacteria 6461656
1444 2881163118 2881161766 Bacteria 7127907
1445 2881849181 2881845957 Bacteria 6611900
1446 2881855180 2881853255 Bacteria 6698367
1447 2881862895 2881861095 Bacteria 7128710
1448 2882640016 2882632389 Bacteria 8154593
1449 2882916235 2882912400 Bacteria 6801539
1450 2885312079 2885305155 Bacteria 7348390
1451 2885315842 2885312484 Bacteria 6415165
1452 2885319882 2885318864 Bacteria 6729568
1453 2885329662 2885326080 Bacteria 7134805
1454 2885337386 2885334103 Bacteria 7216818
1455 2885347842 2885342637 Bacteria 7011821
1456 2885350875 2885350715 Bacteria 6787678
1457 2888341823 2888337043 Bacteria 6629336
1458 2888349116 2888343758 Bacteria 6611049
1459 2888351048 2888350351 Bacteria 7372807
1460 2889013438 2889010040 Bacteria 6749192
1461 2889021845 2889016732 Bacteria 6700763
1462 2896385355 2896384573 Bacteria 7700774
1463 2899792368 2899792073 Bacteria 4926588
1464 2899846641 2899845264 Bacteria 5672268
1465 2903453597 2903448605 Bacteria 7357801
1466 2903496498 2903492973 Bacteria 13473544
1467 2903505942 2903492973 Bacteria 13473544
1468 2903514470 2903513507 Bacteria 6344008
1469 2903524804 2903521522 Bacteria 6525694
1470 2903530953 2903528002 Bacteria 6586099
1471 2903542160 2903540706 Bacteria 7062119
1472 2904665435 2904659560 Bacteria 6685615
1473 2906311560 2906308376 Bacteria 6841989
1474 2906323300 2906321335 Bacteria 6579571
1475 2906331606 2906328253 Bacteria 6585166
1476 2906359977 2906354277 Bacteria 6991324
1477 2906364042 2906363423 Bacteria 6856682
1478 2906377007 2906370794 Bacteria 6881062
1479 2906384270 2906378014 Bacteria 6911440
1480 2906387784 2906386501 Bacteria 5977019
1481 2906394987 2906393657 Bacteria 6790866
1482 2906404180 2906401398 Bacteria 6693206
1483 2906409876 2906408224 Bacteria 6162342
1484 2906418113 2906414383 Bacteria 6580790
1485 2906433877 2906427513 Bacteria 6375796
1486 2913297819 2913295892 Bacteria 6333755
1487 2913310535 2913308742 Bacteria 5350706
1488 2915651243 2915650412 Bacteria 4288180
1489 2915982253 2915980308 Bacteria 6624279
1490 2915989099 2915986958 Bacteria 6739310
1491 2915998034 2915993759 Bacteria 7016183
1492 2916001763 2916000859 Bacteria 6865702
1493 2916010635 2916007675 Bacteria 6898660
1494 2916024594 2916021584 Bacteria 6854472
1495 2916028811 2916028427 Bacteria 6748433
1496 2916041571 2916035215 Bacteria 6755766
1497 2916045566 2916041962 Bacteria 6820487
1498 2916051236 2916048683 Bacteria 6543552
1499 2916059615 2916055098 Bacteria 6758838
1500 2916062588 2916061851 Bacteria 6737736
1501 2916071258 2916068649 Bacteria 6943657
1502 2916079837 2916076590 Bacteria 6596108
1503 2919101165 2919100787 Bacteria 7710546
1504 2919116172 2919114240 Bacteria 5700270
1505 2919167028 2919166419 Bacteria 4952238
1506 2919171884 2919171160 Bacteria 6499771
1507 2919408973 2919408235 Bacteria 6149349
1508 2920763148 2920760137 Bacteria 7427611
1509 2920823558 2920822456 Bacteria 6897201
1510 2921201899 2921201388 Bacteria 6926299
1511 2921213619 2921208531 Bacteria 6745326
1512 2921240466 2921237296 Bacteria 6876710
1513 2921250617 2921244191 Bacteria 6568419
1514 2921250752 2921250672 Bacteria 6677771
1515 2921261159 2921257292 Bacteria 6808382
1516 2921268560 2921263974 Bacteria 6864552
1517 2921287191 2921282425 Bacteria 6826397
1518 2921290196 2921289301 Bacteria 7316391
1519 2921303533 2921296804 Bacteria 7176999
1520 2922139018 2922130491 Bacteria 7173936
1521 2922153719 2922151315 Bacteria 6902399
1522 2922164446 2922158528 Bacteria 6573167
1523 2922178406 2922172374 Bacteria 6167644
1524 2922178928 2922178524 Bacteria 6025201
1525 2922187781 2922185730 Bacteria 7113964
1526 2923557371 2923556063 Bacteria 6793593
1527 2924147068 2924144063 Bacteria 6883928
1528 2924151740 2924150972 Bacteria 7169444
1529 2924164812 2924158325 Bacteria 7188855
1530 2924166036 2924165586 Bacteria 7260590
1531 2924177738 2924172951 Bacteria 6749356
1532 2924180468 2924179722 Bacteria 6843264
1533 2924187768 2924186466 Bacteria 6876637
1534 2924198553 2924193448 Bacteria 6955718
1535 2924204535 2924200457 Bacteria 6757188
1536 2924211810 2924207177 Bacteria 6917007
1537 2924218628 2924214083 Bacteria 7080103
1538 2924222825 2924221636 Bacteria 7113495
1539 2924235096 2924228884 Bacteria 6633132
1540 2924712722 2924710171 Bacteria 6752351
1541 2924719863 2924718760 Bacteria 6331356
1542 2924728499 2924726620 Bacteria 6271473
1543 2924738617 2924733363 Bacteria 7574837
1544 2924743207 2924741084 Bacteria 6661321
1545 2924754006 2924748358 Bacteria 6154725
1546 2924755544 2924754689 Bacteria 6774424
1547 2924764308 2924762789 Bacteria 6561353
1548 2924782156 2924776078 Bacteria 7492003
1549 2924788413 2924784321 Bacteria 7416538
1550 2926757126 2926754445 Bacteria 5964435
1551 2926761347 2926760298 Bacteria 5505990
1552 2928526247 2928521798 Bacteria 4960112
1553 2933007501 2933006813 Bacteria 4912075
1554 2933012269 2933011516 Bacteria 5439334
1555 2933573366 2933570622 Bacteria 7023390
1556 2933587719 2933586486 Bacteria 7667493
1557 2933594714 2933594066 Bacteria 5594265
1558 2933604414 2933599457 Bacteria 5858799
1559 2935895712 2935894831 Bacteria 6620579
1560 2935907326 2935901341 Bacteria 7341747
1561 2936368737 2936367885 Bacteria 7324495
1562 2936377186 2936375103 Bacteria 6652732
1563 2936999357 2936996657 Bacteria 6298727
1564 2937007929 2937002841 Bacteria 6934057
1565 2937016057 2937009748 Bacteria 6746052
1566 2937016884 2937016420 Bacteria 6782579
1567 2937027686 2937023124 Bacteria 6815156
1568 2937030071 2937029754 Bacteria 6424026
1569 2937037935 2937036028 Bacteria 6846469
1570 2937044573 2937042894 Bacteria 6741576
1571 2937050527 2937049772 Bacteria 6757901
1572 2937057412 2937056579 Bacteria 7107896
1573 2937064833 2937063883 Bacteria 7199456
1574 2937076068 2937071275 Bacteria 6984483
1575 2937080148 2937078374 Bacteria 6610289
1576 2937085787 2937084907 Bacteria 6618516
1577 2937092713 2937091812 Bacteria 6979387
1578 2937099765 2937098957 Bacteria 7249374
1579 2937107043 2937106411 Bacteria 6947143
1580 2937119647 2937113482 Bacteria 6505872
1581 2937124234 2937119839 Bacteria 6597547
1582 2937130296 2937126314 Bacteria 6771275
1583 2937818620 2937813078 Bacteria 7783518
1584 2937828503 2937822353 Bacteria 7290551
1585 2937838786 2937836603 Bacteria 6811263
1586 2937846537 2937843397 Bacteria 5256375
1587 2937850548 2937848649 Bacteria 6983481
1588 2937868276 2937861824 Bacteria 6660327
1589 2937870950 2937868953 Bacteria 6639878
1590 2937877715 2937877337 Bacteria 7246526
1591 2937895027 2937891427 Bacteria 6357007
1592 2937977787 2937972304 Bacteria 7532020
1593 2937984696 2937980651 Bacteria 6517427
1594 2937996014 2937994558 Bacteria 7036190
1595 2938015897 2938014810 Bacteria 6700592
1596 2941500540 2941499720 Bacteria 7599444
1597 2954014856 2954011201 Bacteria 4762601
1598 2957379013 2957375807 Bacteria 6425588
1599 2957387054 2957382221 Bacteria 6737050
1600 2957393524 2957388812 Bacteria 6778072
1601 2957400025 2957395598 Bacteria 6822399
1602 2957402817 2957402308 Bacteria 6741770
1603 2957413163 2957408893 Bacteria 6558585
1604 2957415741 2957415311 Bacteria 6991633
1605 2957429379 2957422303 Bacteria 7172205
1606 2957436540 2957430029 Bacteria 7022557
1607 2957443859 2957437181 Bacteria 6568994
1608 2957450200 2957443900 Bacteria 6869977
1609 2957455329 2957450854 Bacteria 6765715
1610 2957458396 2957457609 Bacteria 6967680
1611 2957469342 2957464669 Bacteria 6568877
1612 2957471849 2957471148 Bacteria 6797643
1613 2957483874 2957478035 Bacteria 6756658
1614 2957485900 2957484790 Bacteria 6703082
1615 2957494323 2957491536 Bacteria 6695180
1616 2957499047 2957498199 Bacteria 7126688
1617 2957506252 2957505466 Bacteria 7253085
1618 2958036146 2958034702 Bacteria 6989922
1619 2958047570 2958041894 Bacteria 13082850
1620 2958051539 2958041894 Bacteria 13082850
1621 2958066238 2958064165 Bacteria 7158582
1622 2958074474 2958071322 Bacteria 6815895
1623 2958084822 2958084443 Bacteria 7312792
1624 2958096376 2958092219 Bacteria 6861151
1625 2958107201 2958100919 Bacteria 6800575
1626 2958109458 2958108152 Bacteria 6681128
1627 2958115771 2958115193 Bacteria 6923548
1628 2958124117 2958122699 Bacteria 7280457
1629 2958133646 2958130278 Bacteria 6897202
1630 2958143288 2958137437 Bacteria 6050276
1631 2958150232 2958144490 Bacteria 6677056
1632 2958163766 2958158011 Bacteria 6058449
1633 2958166485 2958165035 Bacteria 6906348
1634 2958173055 2958172287 Bacteria 6716688
1635 2958183290 2958179912 Bacteria 6874908
1636 2960585646 2960584000 Bacteria 6864594
1637 2960593764 2960591022 Bacteria 6622873
1638 2960600786 2960597568 Bacteria 6550735
1639 2960604512 2960603979 Bacteria 6898737
1640 2960613943 2960610863 Bacteria 6691244
1641 2960617493 2960617483 Bacteria 6727748
1642 2960628714 2960624210 Bacteria 6875384
1643 2960632927 2960631154 Bacteria 6732508
1644 2960638912 2960637947 Bacteria 7296468
1645 2960646195 2960645483 Bacteria 7211087
1646 2960653871 2960652885 Bacteria 7083688
1647 2960663292 2960660292 Bacteria 7041660
1648 2960672364 2960667422 Bacteria 6763020
1649 2960677662 2960674078 Bacteria 6609048
1650 2960685637 2960680706 Bacteria 6624464
1651 2960690512 2960687367 Bacteria 6535474
1652 2960695653 2960693952 Bacteria 6749742
1653 2961081257 2961077736 Bacteria 7079850
1654 2961120435 2961114664 Bacteria 6680456
1655 2961130225 2961127735 Bacteria 7196641
1656 2961138819 2961136820 Bacteria 6775228
1657 2961164950 2961163497 Bacteria 6901077
1658 2961173154 2961170736 Bacteria 7072258
1659 2961188671 2961183825 Bacteria 6688536
1660 2963649730 2963644680 Bacteria 6530403
1661 2964610919 2964607997 Bacteria 7101408
1662 2964617898 2964615318 Bacteria 6809089
1663 2964622748 2964621998 Bacteria 6834995
1664 2964629565 2964628898 Bacteria 7083044
1665 2964636639 2964636051 Bacteria 7091832
1666 2964647768 2964643177 Bacteria 6820887
1667 2964654475 2964649959 Bacteria 6675118
1668 2964657084 2964656573 Bacteria 7100150
1669 2964670144 2964663802 Bacteria 7019362
1670 2964677639 2964670856 Bacteria 6851364
1671 2964682706 2964678106 Bacteria 6792020
1672 2964685792 2964685014 Bacteria 6839111
1673 2964692796 2964691889 Bacteria 6802758
1674 2964702024 2964698721 Bacteria 6765331
1675 2964710655 2964705432 Bacteria 7114648
1676 2964717026 2964712639 Bacteria 6695970
1677 2964721743 2964719344 Bacteria 7286602
1678 2965019775 2965018300 Bacteria 6883036
1679 2965026358 2965025482 Bacteria 6532201
1680 2965032908 2965032056 Bacteria 6887443
1681 2965045816 2965040258 Bacteria 6855979
1682 2965050641 2965047637 Bacteria 6623551
1683 2965066052 2965062239 Bacteria 7412989
1684 2965092423 2965089291 Bacteria 6866420
1685 2965107682 2965102966 Bacteria 6800987
1686 2965116608 2965110997 Bacteria 6693150
1687 2965126695 2965119406 Bacteria 6956431
1688 2967665915 2967664464 Bacteria 6948836
1689 2967676774 2967671571 Bacteria 7021409
1690 2967679230 2967678726 Bacteria 7264382
1691 2967686211 2967686174 Bacteria 6678622
1692 2967698044 2967693043 Bacteria 6804451
1693 2967702371 2967699805 Bacteria 6854538
1694 2967712364 2967706974 Bacteria 7186053
1695 2967714992 2967714385 Bacteria 7000047
1696 2967724647 2967721400 Bacteria 7073753
1697 2967729818 2967728569 Bacteria 6641507
1698 2967739679 2967735183 Bacteria 6827012
1699 2967747122 2967742019 Bacteria 6794534
1700 2967751922 2967748971 Bacteria 6733771
1701 2967756611 2967755722 Bacteria 6814706
1702 2967764001 2967762386 Bacteria 6923502
1703 2967773267 2967769361 Bacteria 6587838
1704 2967778356 2967775926 Bacteria 6738189
1705 2967998325 2967996073 Bacteria 6787468
1706 2968006249 2968003550 Bacteria 6929263
1707 2968022218 2968016561 Bacteria 7022047
1708 2968086961 2968083720 Bacteria 7351627
1709 2968095596 2968091066 Bacteria 6052692
1710 2968100169 2968097103 Bacteria 6107094
1711 2968116902 2968110612 Bacteria 6814636
1712 2968118628 2968117919 Bacteria 6536078
1713 2968131977 2968128360 Bacteria 6270294
1714 2968146305 2968138860 Bacteria 6605449
1715 2968173350 2968171901 Bacteria 6894245
1716 2970020345 2970019648 Bacteria 7072033
1717 2970032573 2970026789 Bacteria 6785236
1718 2970038935 2970033650 Bacteria 7118744
1719 2970044702 2970040964 Bacteria 6731123
1720 2970048229 2970047711 Bacteria 7088379
1721 2970059360 2970054988 Bacteria 6611507
1722 2970065053 2970061556 Bacteria 7099761
1723 2970074154 2970068827 Bacteria 7123112
1724 2970080875 2970076120 Bacteria 6697332
1725 2970083291 2970082768 Bacteria 6183754
1726 2970093615 2970088815 Bacteria 6933825
1727 2970096411 2970095765 Bacteria 6936963
1728 2970108355 2970102677 Bacteria 6812532
1729 2970112453 2970109326 Bacteria 6863976
1730 2970120848 2970116247 Bacteria 6501857
1731 2970123732 2970122695 Bacteria 6625855
1732 2970134096 2970129317 Bacteria 6806560
1733 2970141459 2970136068 Bacteria 7207982
1734 2970145658 2970143518 Bacteria 6446480
1735 2970154958 2970149975 Bacteria 6779706
1736 2970157076 2970156795 Bacteria 7168044
1737 2970169200 2970164137 Bacteria 6861252
1738 2970175887 2970170962 Bacteria 6876229
1739 2970182526 2970177841 Bacteria 6768001
1740 2970185372 2970184632 Bacteria 7054431
1741 2970197145 2970191845 Bacteria 7032787
1742 2970474808 2970469710 Bacteria 6969209
1743 2970494604 2970489779 Bacteria 6517260
1744 2970505748 2970503327 Bacteria 7099517
1745 2970511729 2970510686 Bacteria 7006402
1746 2970529085 2970524798 Bacteria 6840927
1747 2970535453 2970532167 Bacteria 6553173
1748 2970544508 2970540015 Bacteria 6977556
1749 2970550768 2970547951 Bacteria 6931819
1750 2970556439 2970554993 Bacteria 6814252
1751 2970594875 2970593180 Bacteria 7073582
1752 2970624331 2970619444 Bacteria 6986144
1753 2970633416 2970627176 Bacteria 6680862
1754 2977521641 2977516862 Bacteria 6940108
1755 2977528996 2977523885 Bacteria 6960446
1756 2977537557 2977530762 Bacteria 6951399
1757 2977540575 2977537788 Bacteria 6929320
1758 2977544727 2977544691 Bacteria 6875412
1759 2977558278 2977551784 Bacteria 7125765
1760 2977563832 2977558990 Bacteria 6863948
1761 2977570816 2977565890 Bacteria 6901543
1762 2977577924 2977572785 Bacteria 6763888
1763 2977581705 2977579622 Bacteria 6772100
1764 2977827184 2977821940 Bacteria 6906439
1765 2977832872 2977828996 Bacteria 7007971
1766 2977844584 2977843712 Bacteria 6753583
1767 2977856681 2977851361 Bacteria 6694324
1768 2977860163 2977858184 Bacteria 6215359
1769 2977870374 2977864932 Bacteria 7534097
1770 2977876101 2977872689 Bacteria 7270173
1771 2977900327 2977898635 Bacteria 6675551
1772 2977912740 2977907340 Bacteria 6577984
1773 2977920701 2977915119 Bacteria 6829656
1774 2977927764 2977922695 Bacteria 6956781
1775 2977939827 2977935797 Bacteria 6252826
1776 2977946571 2977942078 Bacteria 7570577
1777 2977956334 2977950692 Bacteria 6893264
1778 2977962359 2977957713 Bacteria 6877875
1779 2977977113 2977971508 Bacteria 7472917
1780 2977989044 2977986579 Bacteria 6581278
1781 2978973443 2978969890 Bacteria 5400756
1782 2979093371 2979089926 Bacteria 5670289
1783 2979099244 2979095461 Bacteria 5669583
1784 2979105342 2979100975 Bacteria 5423623
1785 2979712124 2979710463 Bacteria 6785254
1786 2979743938 2979742915 Bacteria 7301278
1787 2979765211 2979764755 Bacteria 6610066
1788 2979777899 2979772303 Bacteria 6618277
1789 2979782120 2979779861 Bacteria 6219781
1790 2979795710 2979793036 Bacteria 6808957
1791 2979810469 2979808191 Bacteria 7179355
1792 2984512802 2984509177 Bacteria 5274802
1793 2984520835 2984518228 Bacteria 5277463
1794 2984540129 2984537506 Bacteria 5277481
1795 2984591726 2984587000 Bacteria 5263363
1796 2984602322 2984601300 Bacteria 5455244
1797 2987643391 2987636660 Bacteria 8088555
1798 2987651302 2987645492 Bacteria 6117018
1799 2987658543 2987652177 Bacteria 6969023
1800 2987660957 2987659509 Bacteria 6966464
1801 2987672846 2987666974 Bacteria 6509233
1802 2987678188 2987673487 Bacteria 6884027
1803 2989777725 2989776772 Bacteria 4843317
1804 2996313051 2996310559 Bacteria 6357320
1805 2996340030 2996336353 Bacteria 5511628
1806 2996347457 2996341866 Bacteria 6643098
1807 2996354218 2996348954 Bacteria 7239054
1808 2996391834 2996386984 Bacteria 6978667
1809 2996892011 2996887358 Bacteria 5795980
1810 2996893634 2996893221 Bacteria 5823108
1811 3000136854 3000135777 Bacteria 6891109
1812 3002142948 3002141150 Bacteria 5254435
1813 3004171258 3004167301 Bacteria 8330599
1814 3004190007 3004188549 Bacteria 6952365
1815 3004201538 3004195979 Bacteria 6776956
1816 3004206937 3004203850 Bacteria 7307914
1817 3004213853 3004211236 Bacteria 7417683
1818 3004223444 3004218560 Bacteria 7421728
1819 3004233981 3004232784 Bacteria 6662140
1820 3004246930 3004239961 Bacteria 6892290
1821 3004248269 3004248173 Bacteria 6563236
1822 3004270469 3004268573 Bacteria 7043476
1823 3004280886 3004275668 Bacteria 7114440
1824 3004296085 3004289098 Bacteria 6135450
1825 3004339044 3004334049 Bacteria 8449246
1826 3005411398 3005409236 Bacteria 7188837
1827 3005422637 3005416602 Bacteria 7064308
1828 3005446349 3005445848 Bacteria 6906074
1829 3005453019 3005452660 Bacteria 5889319
1830 637079251 637000159 Bacteria 7596297
1831 639646858 639633055 Bacteria 7751309
1832 643824706 643692032 Bacteria 6891900
1833 648737651 648276728 Bacteria 6968865
1834 649874897 649633066 Bacteria 6690028
1835 650739191 650716007 Bacteria 5573770
1836 8002288102 8002285264 Bacteria 6717907
1837 8003570199 8003570095 Bacteria 5747666
1838 8003992652 8003992118 Bacteria 7266902
1839 8003999976 8003999396 Bacteria 7063185
1840 8004306708 8004300914 Bacteria 6132239
1841 8004319568 8004312739 Bacteria 7444653
1842 8004364529 8004361976 Bacteria 6858373
1843 8004380167 8004374579 Bacteria 6898112
1844 8004391149 8004387939 Bacteria 7049250
1845 8004401152 8004395343 Bacteria 6620908
1846 8004449528 8004445564 Bacteria 6322258
1847 8004635285 8004633249 Bacteria 6723080
1848 8004646047 8004640170 Bacteria 6723001
1849 8004701108 8004695233 Bacteria 6731676
1850 8004704010 8004703790 Bacteria 8006957
1851 8004716520 8004714634 Bacteria 6776161
1852 8004728762 8004727605 Bacteria 6643904
1853 8005247103 8005246636 Bacteria 4933972
1854 8005263666 8005258706 Bacteria 6184835
1855 8005279075 8005275841 Bacteria 6929066
1856 8005283845 8005282627 Bacteria 6675747
1857 8005291896 8005289223 Bacteria 6634003
1858 8005304026 8005301065 Bacteria 6614431
1859 8005308844 8005307578 Bacteria 7395396
1860 8005321826 8005314921 Bacteria 7072929
1861 8005326538 8005321885 Bacteria 5795980
1862 8005377244 8005376324 Bacteria 6590079
1863 8005401870 8005395548 Bacteria 6806915
1864 8005433114 8005430974 Bacteria 6689030
1865 8005461231 8005460587 Bacteria 7157962
1866 8005485969 8005484373 Bacteria 6297373
1867 8005498842 8005497431 Bacteria 6477605
1868 8005543947 8005542996 Bacteria 7077758
1869 8005559274 8005556819 Bacteria 6908598
1870 8005577109 8005570704 Bacteria 6957481
1871 8005620034 8005619151 Bacteria 7030230
1872 8005628634 8005626139 Bacteria 6534237
1873 8005646651 8005645114 Bacteria 6950293
1874 8005660510 8005658619 Bacteria 4500593
1875 8005670253 8005668836 Bacteria 6953162
1876 8005684937 8005682033 Bacteria 6726518
1877 8005690451 8005688590 Bacteria 6610080
1878 8005697991 8005695170 Bacteria 6912330
1879 8018133308 8018127388 Bacteria 7351159
1880 8018151822 8018150411 Bacteria 5549903
1881 8018167897 8018163183 Bacteria 7277977
1882 8018180446 8018176218 Bacteria 6896178
1883 8023684027 8023680758 Bacteria 7729763
1884 8024480485 8024479707 Bacteria 6954785
1885 8024487733 8024486573 Bacteria 6540512
1886 8024502540 8024501048 Bacteria 6427847
1887 8046769809 8046767195 Bacteria 7547379
1888 8049293664 8049293176 Bacteria 6128433
1889 8054461446 8054460903 Bacteria 4872905
1890 8055623431 8055617313 Bacteria 7548464
1891 8056379061 8056375014 Bacteria 7006639
1892 8056386143 8056382006 Bacteria 6408074
1893 8056879285 8056875544 Bacteria 4355797
1894 8057577431 8057575449 Bacteria 7367519
1895 8057881112 8057874678 Bacteria 7494653
1896 Ga0439461_0081342
1897 JGI24740J21852_10001649
1898 JGI24740J21852_10003294
1899 JGI24739J22299_10003614
1900 JGI25156J39149_1026077
1901 JGI25162J39368_1000278
1902 JGI25162J39368_1000363
1903 JGI25157J39369_1000925
1904 JGI25165J46597_1000016
1905 JGI25165J46597_1000482
1906 JGI25165J46597_1000763
1907 JGI25165J46597_1004441
1908 JGI25153J46596_10023370
1909 JGI25153J46596_10068444
1910 JGI25153J46596_10122704
1911 rootL2_10038546
1912 Ga0006562J51391_1090130
1913 Ga0055527_1020747
1914 Ga0055542_1000506
1915 Ga0055529_1004414
1916 Ga0055536_1014530
1917 Ga0055530_10031649
1918 Ga0058692_1025727
1919 Ga0070658_10161215
1920 Ga0070676_10355929
1921 Ga0070670_100000542
1922 Ga0068869_100065459
1923 Ga0070666_10588056
1924 Ga0068868_101146359
1925 Ga0070660_101565633
1926 Ga0070668_101154477
1927 Ga0070668_101554127
1928 Ga0070669_100616968
1929 Ga0070669_100717857
1930 Ga0070674_100514974
1931 Ga0070674_101138277
1932 Ga0070667_100237451
1933 Ga0070667_100639747
1934 Ga0070711_100995142
1935 Ga0070663_100029286
1936 Ga0070663_100034165
1937 Ga0070663_100383884
1938 Ga0070663_100465922
1939 Ga0070663_100520087
1940 Ga0070678_101837343
1941 Ga0068867_100672839
1942 Ga0068867_101705317
1943 Ga0070685_11422156
1944 Ga0068853_100077035
1945 Ga0068853_101333663
1946 Ga0070672_100716986
1947 Ga0070665_100015274
1948 Ga0070665_100035023
1949 Ga0070665_100056705
1950 Ga0070665_100145190
1951 Ga0070665_100251090
1952 Ga0070665_100531685
1953 Ga0068855_100604111
1954 Ga0070664_100462412
1955 Ga0070664_100810058
1956 Ga0068857_100732518
1957 Ga0068857_100770004
1958 Ga0068854_101236761
1959 Ga0068856_100041646
1960 Ga0068856_101184334
1961 Ga0068852_100299909
1962 Ga0068852_101267902
1963 Ga0068852_101280030
1964 Ga0068859_100424258
1965 Ga0068864_101083016
1966 Ga0068861_101269437
1967 Ga0068861_101589650
1968 Ga0068851_10205365
1969 Ga0068870_11133897
1970 Ga0068858_101777632
1971 Ga0075365_10005564
1972 Ga0075365_10006421
1973 Ga0075365_10007602
1974 Ga0075365_10020307
1975 Ga0075365_10055095
1976 Ga0075365_10057653
1977 Ga0075365_10205649
1978 Ga0075365_11137543
1979 Ga0075365_11345760
1980 Ga0075368_10065351
1981 Ga0075368_10074390
1982 Ga0075368_10106527
1983 Ga0075363_100004357
1984 Ga0075363_100199609
1985 Ga0075363_100372138
1986 Ga0075363_100405121
1987 Ga0075363_100709983
1988 Ga0075364_10001664
1989 Ga0075364_10012398
1990 Ga0075364_10151768
1991 Ga0075364_10207200
1992 Ga0075364_10342890
1993 Ga0075364_10386475
1994 Ga0075364_10888780
1995 Ga0075362_10163190
1996 Ga0075362_10184030
1997 Ga0075362_10466979
1998 Ga0075362_10672801
1999 Ga0075367_10019537
2000 Ga0075367_10093193
2001 Ga0075367_10094853
2002 Ga0075367_10344319
2003 Ga0075367_10354997
2004 Ga0075369_10025148
2005 Ga0075369_10033787
2006 Ga0075369_10080566
2007 Ga0075369_10301319
2008 Ga0075369_10377451
2009 Ga0075366_10056873
2010 Ga0075366_10471156
2011 Ga0075366_10493876
2012 Ga0075370_10111047
2013 Ga0075370_10233513
2014 Ga0075370_10251865
2015 Ga0068865_100876807
2016 Ga0068865_101061443
2017 Ga0097620_100424287
2018 Ga0079104_1000210
2019 Ga0099826_10001594
2020 Ga0099826_10081419
2021 Ga0105244_10258398
2022 Ga0105240_10000027
2023 Ga0105240_10127601
2024 Ga0105240_11516710
2025 Ga0105240_11559486
2026 Ga0105245_10293682
2027 Ga0105243_10063806
2028 Ga0105243_10307762
2029 Ga0105243_11108989
2030 Ga0105243_11681073
2031 Ga0105241_10120911
2032 Ga0105241_10968846
2033 Ga0105242_11496793
2034 Ga0105248_10281260
2035 Ga0105248_12428068
2036 Ga0105237_10001405
2037 Ga0105237_10449321
2038 Ga0105237_12164001
2039 Ga0105238_10008113
2040 Ga0105238_11018246
2041 Ga0105249_11296445
2042 Ga0105239_10001129
2043 Ga0105239_10112886
2044 Ga0105239_10163718
2045 Ga0105239_10806547
2046 Ga0105239_10849761
2047 Ga0105246_10144933
2048 Ga0105246_10599155
2049 Ga0157373_10051042
2050 Ga0157373_10273009
2051 Ga0157373_10898400
2052 Ga0157371_10000058
2053 Ga0157371_10414142
2054 Ga0157370_10000030
2055 Ga0157370_10000048
2056 Ga0157370_10309900
2057 Ga0157370_11060221
2058 Ga0157369_10114120
2059 Ga0157369_10200791
2060 Ga0157369_10488514
2061 Ga0157369_12301647
2062 Ga0157374_10055710
2063 Ga0157378_10557231
2064 Ga0157378_12097835
2065 Ga0163162_11447015
2066 Ga0163162_12878128
2067 Ga0157372_10238857
2068 Ga0157372_12098963
2069 Ga0157372_12247742
2070 Ga0157372_12514226
2071 Ga0157375_12628797
2072 Ga0163163_10400149
2073 Ga0163163_12803286
2074 Ga0157380_12663344
2075 Ga0157380_13552771
2076 Ga0182008_10801153
2077 Ga0157379_10648532
2078 Ga0157376_10925410
2079 Ga0182006_1032114
2080 Ga0182007_10000937
2081 Ga0182007_10180117
2082 Ga0182005_1001754
2083 Ga0163161_10154383
2084 Ga0163161_10521117
2085 Ga0163161_10821902
2086 Ga0163161_11168759
2087 Ga0209436_100002
2088 Ga0209672_107513
2089 Ga0209563_116425
2090 Ga0209437_100036
2091 Ga0209437_100086
2092 Ga0209437_101879
2093 Ga0207425_1000497
2094 Ga0207425_1000964
2095 Ga0207425_1001743
2096 Ga0207425_1018014
2097 Ga0207425_1022198
2098 Ga0209646_1009547
2099 Ga0209646_1010395
2100 Ga0209026_1000005
2101 Ga0209026_1027869
2102 Ga0209677_100516
2103 Ga0209148_1000057
2104 Ga0209759_1000385
2105 Ga0209759_1054245
2106 Ga0209129_1000299
2107 Ga0209129_1000709
2108 Ga0209129_1001153
2109 Ga0209129_1014007
2110 Ga0209233_1000056
2111 Ga0209233_1000068
2112 Ga0209233_1000110
2113 Ga0209233_1000298
2114 Ga0209233_1008316
2115 Ga0209455_1000231
2116 Ga0209673_1000015
2117 Ga0209673_1000091
2118 Ga0209673_1001285
2119 Ga0209673_1004117
2120 Ga0209673_1006917
2121 Ga0209673_1009198
2122 Ga0209673_1039870
2123 Ga0209673_1041356
2124 Ga0209673_1045813
2125 Ga0209130_1000015
2126 Ga0209675_1038679
2127 Ga0209675_1101141
2128 Ga0209676_1004595
2129 Ga0209676_1030615
2130 Ga0209025_1000489
2131 Ga0209025_1000575
2132 Ga0209025_1000664
2133 Ga0209025_1000880
2134 Ga0209025_1001375
2135 Ga0209025_1006816
2136 Ga0209025_1008378
2137 Ga0209025_1073133
2138 Ga0209564_1000398
2139 Ga0209564_1003162
2140 Ga0209564_1003865
2141 Ga0209564_1007416
2142 Ga0209564_1025090
2143 Ga0209564_1072326
2144 Ga0209758_1000191
2145 Ga0209758_1000549
2146 Ga0209758_1000740
2147 Ga0209758_1001295
2148 Ga0209758_1003493
2149 Ga0209758_1008829
2150 Ga0209758_1009452
2151 Ga0209758_1011162
2152 Ga0209758_1039731
2153 Ga0209758_1068582
2154 Ga0209758_1074851
2155 Ga0209758_1150194
2156 Ga0209050_1007611
2157 Ga0209050_1030544
2158 Ga0209256_1000782
2159 Ga0209256_1000870
2160 Ga0209256_1004446
2161 Ga0209256_1008522
2162 Ga0209256_1015754
2163 Ga0209256_1016037
2164 Ga0209256_1027289
2165 Ga0209256_1040305
2166 Ga0207426_1000063
2167 Ga0207426_1000144
2168 Ga0209051_1000205
2169 Ga0209051_1002129
2170 Ga0209051_1011156
2171 Ga0209051_1015619
2172 Ga0209051_1017670
2173 Ga0209051_1026675
2174 Ga0209051_1032202
2175 Ga0209051_1108751
2176 Ga0209051_1110261
2177 Ga0209257_1001929
2178 Ga0209257_1002628
2179 Ga0209257_1070451
2180 Ga0209257_1129683
2181 Ga0207656_10195458
2182 Ga0207656_10380165
2183 Ga0207680_11094397
2184 Ga0207647_10006448
2185 Ga0207647_10077385
2186 Ga0207647_10155866
2187 Ga0207645_10909860
2188 Ga0207705_10070741
2189 Ga0207695_10000024
2190 Ga0207695_10366587
2191 Ga0207695_10945719
2192 Ga0207695_11718650
2193 Ga0207671_10000463
2194 Ga0207671_10015211
2195 Ga0207671_10276453
2196 Ga0207671_11285150
2197 Ga0207663_11723536
2198 Ga0207657_10203975
2199 Ga0207649_10455919
2200 Ga0207652_10888298
2201 Ga0207681_10377280
2202 Ga0207681_10639558
2203 Ga0207681_10711683
2204 Ga0207694_10018997
2205 Ga0207694_10240910
2206 Ga0207694_11640581
2207 Ga0207650_10000769
2208 Ga0207659_10950269
2209 Ga0207644_10398494
2210 Ga0207690_10431796
2211 Ga0207690_10664750
2212 Ga0207706_11432050
2213 Ga0207709_10644508
2214 Ga0207709_11090711
2215 Ga0207669_10050329
2216 Ga0207669_10352598
2217 Ga0207704_10806892
2218 Ga0207689_10342562
2219 Ga0207679_10962245
2220 Ga0207679_11703304
2221 Ga0207667_10489091
2222 Ga0207667_12131576
2223 Ga0207712_10719349
2224 Ga0207668_12009136
2225 Ga0207640_10226181
2226 Ga0207640_10700049
2227 Ga0207640_11452399
2228 Ga0207658_11387414
2229 Ga0207639_10329243
2230 Ga0207639_11224586
2231 Ga0207639_11285331
2232 Ga0207678_10013093
2233 Ga0207678_10083963
2234 Ga0207678_10177504
2235 Ga0207678_10316533
2236 Ga0207702_10247204
2237 Ga0207702_10351434
2238 Ga0207648_10317020
2239 Ga0207648_12208582
2240 Ga0207674_10564715
2241 Ga0207674_10709128
2242 Ga0207675_100477378
2243 Ga0207675_101496019
2244 Ga0207683_10242281
2245 Ga0207698_10271072
2246 Ga0207698_10536083
2247 Ga0207698_10556522
2248 Ga0207698_10895130
2249 Ga0209281_1000253
2250 Ga0209371_1000009
2251 Ga0209371_1001069
2252 Ga0209371_1002375
2253 Ga0209371_1003235
2254 Ga0209371_1003293
2255 Ga0209282_1001731
2256 Ga0209282_1063989
2257 Ga0209813_10005656
2258 Ga0209813_10108062
2259 Ga0209974_10196937
2260 Ga0268266_10014176
2261 Ga0268266_10023667
2262 Ga0268266_10062041
2263 Ga0268266_10114793
2264 Ga0268266_10164952
2265 Ga0268266_10166885
2266 Ga0268266_10473910
2267 Ga0268266_10524725
2268 Ga0268266_11499031
2269 Ga0268266_11902557
2270 Ga0268265_10784221
2271 Ga0265318_10324581
2272 Ga0307517_10452060
2273 Ga0307517_10675331
2274 Ga0307515_10021929
2275 Ga0307515_10070907
2276 Ga0307515_10411495
2277 Ga0307515_10846263
2278 Ga0268256_1000010
2279 Ga0268256_1000882
2280 Ga0268256_1002814
2281 Ga0316181_1173512
2282 Ga0265330_10084337
2283 Ga0265330_10140414
2284 Ga0265332_10358175
2285 Ga0265332_10431597
2286 Ga0265328_10137184
2287 Ga0265325_10273526
2288 Ga0265340_10001720
2289 Ga0265339_10003158
2290 Ga0265331_10030864
2291 Ga0265316_10117489
2292 Ga0307513_10030733
2293 Ga0307513_10144751
2294 Ga0307513_10176889
2295 Ga0307408_101132568
2296 Ga0307408_101237350
2297 Ga0265313_10000031
2298 Ga0265313_10066914
2299 Ga0265313_10108065
2300 Ga0265314_10058931
2301 Ga0265314_10073222
2302 Ga0265314_10362352
2303 Ga0265342_10003919
2304 Ga0307405_10018493
2305 Ga0307413_10233069
2306 Ga0307410_10730546
2307 Ga0307410_11370799
2308 Ga0307406_10013413
2309 Ga0307406_10529317
2310 Ga0307407_10949997
2311 Ga0307412_10001068
2312 Ga0307412_10120664
2313 Ga0307412_11058723
2314 Ga0307412_11333875
2315 Ga0307409_100962028
2316 Ga0307409_101318193
2317 Ga0307409_102002246
2318 Ga0307414_10027440
2319 Ga0307414_10098381
2320 Ga0307414_11109488
2321 Ga0307510_10497424
2322 Ga0373928_0081139
2323 Ga0373927_0360763
2324 Ga0395899_0000030
2325 Ga0395899_0106022
2326 Ga0395899_0268722
2327 Ga0395900_0000023
2328 Ga0395900_0058442
2329 Ga0395900_0158369
2330 Ga0395900_0774610
2331 Ga0395900_1512061
2332 Ga0395898_0000038
2333 Ga0395905_0000021
2334 Ga0395905_0125889
2335 Ga0395905_0536337
2336 Ga0395905_0609768
2337 Ga0395905_1535107
2338 Ga0395901_0000018
2339 Ga0395901_0058576
2340 Ga0395901_0103943
2341 Ga0395901_0175290
2342 Ga0395901_0340216
2343 Ga0395901_0453567
2344 Ga0395901_0645856
2345 Ga0439465_0077162
2346 Ga0439465_0323672
2347 Ga0451787_630305
2348 Ga0451789_0334998
2349 Ga0451789_0552177
2350 Ga0451789_0713384
2351 Ga0451791_0542230
2352 Ga0451791_0912269
2353 Ga0451791_1458927
2354 Ga0451797_0736426
2355 Ga0451795_0678915
2356 Ga0451795_1578517
2357 Ga0451798_0969565
2358 Ga0451800_1407261
2359 Ga0451802_0303084
2360 Ga0451802_0577518
2361 Ga0451804_0833409
2362 Ga0451807_0980318
2363 Ga0451807_2543517
2364 Ga0451833_0494853
2365 Ga0451833_0813260
2366 Ga0451835_0066844
2367 Ga0451837_1015094
2368 Ga0451837_1029000
2369 Ga0451839_0240019
2370 Ga0451839_0443790
2371 Ga0451840_04288
2372 Ga0451841_0124507
2373 Ga0451841_0661765
2374 Ga0451841_0873574
2375 Ga0451841_1088819
2376 Ga0451841_1369678
2377 Ga0451845_0049804
2378 Ga0451845_0217625
2379 Ga0451846_37121
2380 Ga0451847_0232892
2381 Ga0451847_0618665
2382 Ga0451849_0255757
2383 Ga0451851_0663672
2384 Ga0451843_0488388
2385 Ga0451843_0632080
2386 Ga0451854_26707
2387 Ga0451855_0284419
2388 Ga0451855_0675896
2389 Ga0451853_0768765
2390 Ga0451853_1699743
2391 Ga0451853_1713722
2392 Ga0451853_2497085
2393 Ga0439433_0051131
2394 Ga0439455_0053007
2395 Ga0439458_0037362
2396 Ga0466972_0084268
2397 Ga0466972_0185179
2398 Ga0466982_0381123
2399 Ga0466965_0101817
2400 Ga0466966_0187683
2401 Ga0466963_0016998
2402 Ga0466968_0224887
2403 Ga0466968_0497191
2404 Ga0466970_0002877
2405 Ga0466970_0147823
2406 Ga0466970_0259479
2407 Ga0466957_0877535
2408 Ga0466957_1385315
2409 Ga0466960_0035323
2410 Ga0466960_0103800
2411 Ga0466967_1905305
2412 Ga0495592_0119685
2413 Ga0495603_0758315
2414 Ga0495629_0242262
2415 Ga0495638_0016112
2416 Ga0495638_0025041
2417 Ga0495638_0029964
2418 Ga0495638_0103097
2419 Ga0495651_0893008
2420 Ga0495650_0071590
2421 Ga0495605_0173843
2422 Ga0495605_0333756
2423 Ga0495662_0018760
2424 Ga0495606_0000735
2425 Ga0495606_0044990
2426 Ga0495606_0063678
2427 Ga0495606_0504711
2428 Ga0495610_0084325
2429 Ga0495610_0094912
2430 Ga0495616_0093707
2431 Ga0495620_0087011
2432 Ga0495620_0134860
2433 Ga0495632_0012233
2434 Ga0495637_0158284
2435 Ga0495643_0074504
2436 Ga0495643_0074568
2437 Ga0495648_0215852
2438 Ga0495652_0234020
2439 Ga0495654_0000043
2440 Ga0495654_0200613
2441 Ga0495587_0063967
2442 Ga0495622_0036088
2443 Ga0495633_0045766
2444 Ga0495668_0063807
2445 Ga0495668_0122061
2446 Ga0495668_0296087
2447 Ga0495625_0808252
2448 Ga0495635_0311194
2449 Ga0495661_0386551
2450 Ga0495588_0003015
2451 Ga0495588_0301055
2452 Ga0495658_0546382
2453 Ga0495624_0049268
2454 Ga0495670_0543763
2455 Ga0495670_0755454
2456 Ga0495671_0323637
2457 Ga0495589_0261691
2458 Ga0495600_0053444
2459 Ga0495660_0021222
2460 Ga0495660_0215507
2461 Ga0495604_0009543
2462 Ga0495604_0325048
2463 Ga0495676_0960145
2464 Ga0495683_0315420
2465 Ga0495687_023965
2466 Ga0495681_0003362
2467 Ga0495681_0092965
2468 Ga0495686_0000709
2469 Ga0495686_0103693
2470 Ga0495686_0167559
2471 Ga0495686_0243916
2472 Ga0495593_0497962
2473 Ga0495602_0930874
2474 Ga0495626_0031952
2475 Ga0495626_0225721
2476 Ga0496100_0311443
2477 Ga0496100_0372130
2478 Ga0496101_0125770
2479 Ga0496101_1127847
2480 Ga0496102_0299171
2481 Ga0496102_0374504
2482 Ga0496102_0503831
2483 Ga0496103_0264109
2484 Ga0496104_0248254
2485 Ga0496104_0312083
2486 Ga0496104_1195132
2487 Ga0496105_0016247
2488 Ga0496105_0157140
2489 Ga0496105_1176656
2490 Ga0496106_0401840
2491 Ga0496106_1016309
2492 Ga0496106_1476044
2493 Ga0496107_1077057
2494 Ga0496108_1017684
2495 Ga0496109_0614249
2496 Ga0496110_0483643
2497 Ga0496111_0000097
2498 Ga0496111_1089379
2499 Ga0496112_0072895
2500 Ga0496113_0250177
2501 Ga0496113_0367194
2502 Ga0496114_0050639
2503 Ga0496114_0313336
2504 Ga0496114_1283502
2505 Ga0496115_0143554
2506 Ga0496116_0012346
2507 Ga0496116_0016654
2508 Ga0496116_0020240
2509 Ga0496116_0038239
2510 Ga0496116_0041166
2511 Ga0496116_0096288
2512 Ga0496117_0000002
2513 Ga0496117_0001662
2514 Ga0496117_0061369
2515 Ga0496117_0180646
2516 Ga0496117_0282055
2517 Ga0496117_0356189
2518 Ga0496117_0484344
2519 Ga0496118_0000483
2520 Ga0496118_0001307
2521 Ga0496118_0046984
2522 Ga0496118_0057184
2523 Ga0496118_0156649
2524 Ga0496118_0488489
2525 Ga0496119_0000793
2526 Ga0496119_0021529
2527 Ga0496119_0040196
2528 Ga0496119_0049458
2529 Ga0496119_0062890
2530 Ga0496119_0106946
2531 Ga0496119_0121938
2532 Ga0496119_0159805
2533 Ga0496119_0175979
2534 Ga0496120_0000971
2535 Ga0496120_0001519
2536 Ga0496120_0006732
2537 Ga0496120_0029419
2538 Ga0496120_0058737
2539 Ga0496120_0170718
2540 Ga0496120_0175959
2541 Ga0496121_0002165
2542 Ga0496121_0003328
2543 Ga0496121_0018159
2544 Ga0496121_0018464
2545 Ga0496121_0106965
2546 Ga0496121_0128304
2547 Ga0496121_0128400
2548 Ga0496121_0257140
2549 Ga0496121_0498693
2550 Ga0496121_0659646
2551 Ga0496122_0000001
2552 Ga0496122_0000009
2553 Ga0496122_0004617
2554 Ga0496122_0007697
2555 Ga0496122_0018033
2556 Ga0496122_0055160
2557 Ga0496122_0070469
2558 Ga0496122_0126634
2559 Ga0496122_0223934
2560 Ga0496123_0000001
2561 Ga0496123_0000020
2562 Ga0496123_0004746
2563 Ga0496123_0022781
2564 Ga0496123_0059465
2565 Ga0496123_0060632
2566 Ga0496123_0146268
2567 Ga0496123_0153249
2568 Ga0496123_0168671
2569 Ga0496124_0000262
2570 Ga0496124_0013622
2571 Ga0496124_0018393
2572 Ga0496124_0021865
2573 Ga0496124_0028404
2574 Ga0496124_0035585
2575 Ga0496124_0042095
2576 Ga0496124_0138325
2577 Ga0496124_0203036
2578 Ga0496124_0215445
2579 Ga0496124_0218964
2580 Ga0496124_0343240
2581 Ga0496124_0347364
2582 Ga0496124_0380611
2583 Ga0496124_0553485
2584 Ga0496124_0784483
2585 Ga0496125_0016520
2586 Ga0496125_0046342
2587 Ga0496125_0046902
2588 Ga0496125_0062822
2589 Ga0496125_0063587
2590 Ga0496125_0135151
2591 Ga0496125_0161367
2592 Ga0496125_0496428
2593 Ga0496125_0671866
2594 Ga0496126_0317543
2595 Ga0496126_0318276
2596 Ga0496126_0342461
2597 Ga0496126_0843656
2598 Ga0496126_0974907
2599 Ga0495678_107005
2600 Ga0501031_0000015
2601 Ga0501031_0119719
2602 Ga0501031_0517321
2603 Ga0501031_0692584
2604 Ga0501031_0714479
2605 Ga0501032_0000008
2606 Ga0501032_0000060
2607 Ga0501032_0005294
2608 Ga0501032_0062601
2609 Ga0501032_0140503
2610 Ga0501032_0169666
2611 Ga0501032_0245670
2612 Ga0501032_0303820
2613 Ga0501032_0351425
2614 Ga0501032_0483529
2615 Ga0501032_0518761
2616 Ga0501032_0519842
2617 Ga0501032_0618040
2618 Ga0501032_0654267
2619 Ga0501033_0000012
2620 Ga0501033_0001335
2621 Ga0501033_0002298
2622 Ga0501033_0004893
2623 Ga0501033_0009206
2624 Ga0501033_0011407
2625 Ga0501033_0039843
2626 Ga0501033_0071653
2627 Ga0501033_0125926
2628 Ga0501033_0160697
2629 Ga0501033_0205759
2630 Ga0501033_0226167
2631 Ga0501033_1017243
2632 Ga0501034_0000035
2633 Ga0501034_0000262
2634 Ga0501034_0005192
2635 Ga0501034_0035832
2636 Ga0501034_0041503
2637 Ga0501034_0047586
2638 Ga0501034_0053596
2639 Ga0501034_0075365
2640 Ga0501034_0176533
2641 Ga0501034_0178113
2642 Ga0501034_0230965
2643 Ga0501034_0400793
2644 Ga0501034_0573933
2645 Ga0501034_0707760
2646 Ga0501034_0713588
2647 Ga0501034_0735890
2648 Ga0501034_0919355
2649 Ga0501034_1125919
2650 Ga0501034_1696878
2651 Ga0501036_0000006
2652 Ga0501036_0002494
2653 Ga0501036_0014052
2654 Ga0501036_0084183
2655 Ga0501036_0087995
2656 Ga0501036_0345354
2657 Ga0501036_0395321
2658 Ga0501036_0460052
2659 Ga0501036_0797724
2660 Ga0501036_1035941
2661 Ga0501036_1292805
2662 Ga0501036_1344330
2663 Ga0501036_1347433
2664 Ga0501036_1398730
2665 Ga0501037_0000076
2666 Ga0501037_0000123
2667 Ga0501037_0001856
2668 Ga0501037_0312402
2669 Ga0501037_0575074
2670 Ga0501037_0593144
2671 Ga0501037_0732344
2672 Ga0501037_0805133
2673 Ga0501038_0000007
2674 Ga0501038_0000051
2675 Ga0501038_0087718
2676 Ga0501038_0096036
2677 Ga0501038_0116778
2678 Ga0501038_0204620
2679 Ga0501038_0217572
2680 Ga0501038_0432277
2681 Ga0501039_0000012
2682 Ga0501039_0000051
2683 Ga0501039_0514244
2684 Ga0501039_0887801
2685 Ga0501039_1442547
2686 Ga0501040_0413511
2687 Ga0501040_0584237
2688 Ga0501041_0142084
2689 Ga0501041_0477563
2690 Ga0501042_0430481
2691 Ga0501042_0463082
2692 Ga0501043_0000039
2693 Ga0501043_0001221
2694 Ga0501043_0004079
2695 Ga0501043_0071995
2696 Ga0501043_0180657
2697 Ga0501043_0240560
2698 Ga0501043_0266109
2699 Ga0501043_0561275
2700 Ga0501043_0579306
2701 Ga0501043_0585171
2702 Ga0501046_0033384
2703 Ga0501046_0041285
2704 Ga0501046_0273409
2705 Ga0501046_0484995
2706 Ga0501046_0602561
2707 Ga0501046_0872871
2708 Ga0501047_0018952
2709 Ga0501047_0028848
2710 Ga0501047_0043627
2711 Ga0501047_0171121
2712 Ga0501047_0181297
2713 Ga0501047_0223820
2714 Ga0501047_0276540
2715 Ga0501047_0558304
2716 Ga0501047_0606904
2717 Ga0501047_0755214
2718 Ga0501047_1324975
2719 Ga0501048_0114792
2720 Ga0501048_0468454
2721 Ga0501048_0798085
2722 Ga0501048_1106488
2723 Ga0501067_0001509
2724 Ga0501067_0001738
2725 Ga0501067_0016339
2726 Ga0501067_0159244
2727 Ga0501067_0174514
2728 Ga0501067_0381726
2729 Ga0501067_0667933
2730 Ga0501067_0808456
2731 Ga0501067_0831227
2732 Ga0501068_0048418
2733 Ga0501068_0148823
2734 Ga0501068_0308850
2735 Ga0501068_0340889
2736 Ga0501068_0739856
2737 Ga0501068_0961222
2738 Ga0501068_1150301
2739 Ga0501069_0000022
2740 Ga0501069_0006194
2741 Ga0501069_0072434
2742 Ga0501069_0137771
2743 Ga0501069_0176429
2744 Ga0501069_0251701
2745 Ga0501069_0335430
2746 Ga0501069_0336682
2747 Ga0501070_0000080
2748 Ga0501070_0000562
2749 Ga0501070_0004244
2750 Ga0501070_0030179
2751 Ga0501070_0045996
2752 Ga0501070_0046391
2753 Ga0501070_0081078
2754 Ga0501070_0157273
2755 Ga0501070_0166512
2756 Ga0501070_0302943
2757 Ga0501070_0502250
2758 Ga0501070_1394106
2759 Ga0501071_0110183
2760 Ga0501071_0230530
2761 Ga0501071_0260562
2762 Ga0501071_0481021
2763 Ga0501071_1053896
2764 Ga0501072_0318595
2765 Ga0501072_0326554
2766 Ga0501072_0574746
2767 Ga0501072_0648765
2768 Ga0501072_0802529
2769 Ga0501072_1409936
2770 Ga0501073_0023019
2771 Ga0501073_0031362
2772 Ga0501073_0052349
2773 Ga0501073_0074515
2774 Ga0501073_0082068
2775 Ga0501073_0087086
2776 Ga0501073_0122571
2777 Ga0501073_0246234
2778 Ga0501073_0525809
2779 Ga0501073_0579512
2780 Ga0501073_0855415
2781 Ga0501073_1258770
2782 Ga0501074_0000046
2783 Ga0501074_0056084
2784 Ga0501074_0087731
2785 Ga0501074_0141115
2786 Ga0501074_0182400
2787 Ga0501074_0234146
2788 Ga0501074_0615986
2789 Ga0501074_1012789
2790 Ga0501076_0034752
2791 Ga0501076_0332177
2792 Ga0501076_1663813
2793 Ga0501076_1672620
2794 Ga0501077_0311404
2795 Ga0501077_0388743
2796 Ga0501225_0369512
2797 Ga0501079_0744629
2798 Ga0501080_0001756
2799 Ga0501080_0020842
2800 Ga0501080_0030986
2801 Ga0501080_0032812
2802 Ga0501080_0050611
2803 Ga0501080_0053538
2804 Ga0501080_0062992
2805 Ga0501080_0342621
2806 Ga0501080_0529119
2807 Ga0501080_0538698
2808 Ga0501080_1276783
2809 Ga0501080_1509509
2810 Ga0501080_1767376
2811 Ga0501081_0378547
2812 Ga0501083_0000050
2813 Ga0501083_0013991
2814 Ga0501083_0022537
2815 Ga0501083_0033084
2816 Ga0501083_0162557
2817 Ga0501083_0221946
2818 Ga0501083_0233950
2819 Ga0501083_1052838
2820 Ga0501241_134614
2821 Ga0501035_0000035
2822 Ga0501035_0000119
2823 Ga0501035_0000318
2824 Ga0501035_0002603
2825 Ga0501035_0006643
2826 Ga0501035_0006842
2827 Ga0501035_0030753
2828 Ga0501035_0044748
2829 Ga0501035_0060854
2830 Ga0501035_0089369
2831 Ga0501035_0183242
2832 Ga0501035_0317249
2833 Ga0501035_0376832
2834 Ga0501035_0464000
2835 Ga0501035_0518159
2836 Ga0501035_0727242
2837 Ga0501035_0781081
2838 Ga0501044_0000015
2839 Ga0501044_0000147
2840 Ga0501044_0015094
2841 Ga0501044_0016473
2842 Ga0501044_0022765
2843 Ga0501044_0048598
2844 Ga0501044_0059166
2845 Ga0501044_0060367
2846 Ga0501044_0065007
2847 Ga0501044_0168979
2848 Ga0501044_0215889
2849 Ga0501044_0223957
2850 Ga0501044_0472744
2851 Ga0501044_0604555
2852 Ga0501044_0788141
2853 Ga0501044_0950525
2854 Ga0501044_1365369
2855 Ga0501045_1432295
2856 nmdc:mga03683_286146_c1
2857 nmdc:mga03n38_10345_c1
2858 nmdc:mga03n38_246070_c1
2859 nmdc:mga03n38_258240_c1
2860 nmdc:mga03n38_555724_c1
2861 nmdc:mga03n38_56903_c1
2862 nmdc:mga03n38_904636_c1
2863 nmdc:mga00v17_1009016_c1
2864 nmdc:mga00v17_127891_c1
2865 nmdc:mga00v17_173_c1
2866 nmdc:mga00v17_324681_c1
2867 nmdc:mga00v17_47178_c1
2868 nmdc:mga00v17_9111_c1
2869 nmdc:mga0yw44_10523_c1
2870 nmdc:mga0yw44_108180_c1
2871 nmdc:mga0yw44_11446_c1
2872 nmdc:mga0yw44_15055_c1
2873 nmdc:mga0yw44_441_c1
2874 nmdc:mga0yw44_49350_c1
2875 nmdc:mga0yw44_593236_c1
2876 nmdc:mga0yw44_86562_c1
2877 nmdc:mga0k408_60341_c1
2878 nmdc:mga06z11_106684_c1
2879 nmdc:mga06z11_170701_c1
2880 nmdc:mga06z11_314813_c1
2881 nmdc:mga06z11_49090_c1
2882 nmdc:mga06z11_562869_c1
2883 nmdc:mga06z11_774575_c1
2884 nmdc:mga06z11_93770_c1
2885 nmdc:mga04h51_21783_c1
2886 nmdc:mga04h51_36355_c1
2887 nmdc:mga04h51_424249_c1
2888 nmdc:mga07m45_104373_c1
2889 nmdc:mga07m45_42166_c1
2890 nmdc:mga07m45_657958_c1
2891 nmdc:mga0sz30_101285_c1
2892 nmdc:mga0sz30_130474_c1
2893 nmdc:mga0sz30_41607_c1
2894 nmdc:mga0sz30_8230_c1
2895 Ga0495601_0101045
2896 Ga0495601_0185127
2897 Ga0500610_0111205
2898 Ga0495655_0032364
2899 Ga0495619_1097743
2900 Ga0500578_0134836
2901 Ga0500643_016656
2902 Ga0500560_100384
2903 Ga0500569_041638
2904 Ga0500572_016012
2905 Ga0500595_069476
2906 Ga0500608_148426
2907 Ga0500618_000665
2908 Ga0500618_067148
2909 Ga0500642_0488237
2910 Ga0500658_0019888
2911 Ga0500561_0001611
2912 Ga0500568_0041884
2913 Ga0500590_021794
2914 Ga0500604_0117344
2915 Ga0500616_0000777
2916 Ga0500616_0079595
2917 Ga0500616_0119437
2918 Ga0500616_0127568
2919 Ga0500620_004286
2920 Ga0500622_0003948
2921 Ga0500624_000965
2922 Ga0500624_015562
2923 Ga0500627_0085258
2924 Ga0500627_0309192
2925 Ga0500627_0348032
2926 Ga0500627_0475487
2927 Ga0500634_0005719
2928 Ga0500636_0000023
2929 Ga0500611_196163
2930 Ga0501084_0086089
2931 Ga0501084_0361044
2932 Ga0501084_0365840
2933 Ga0501084_1077465
2934 Ga0501084_1400998
2935 Ga0501084_1457859
2936 Ga0587066_149156
2937 Ga0587080_174070
2938 Ga0587083_0077706
2939 Ga0587088_010459
2940 Ga0587090_064526
2941 Ga0587115_104422
2942 Ga0587067_048822
2943 Ga0587076_191865
2944 Ga0587107_101336
2945 Ga0501082_0125020
2946 Ga0501082_0176976
2947 Ga0501082_0182207
2948 Ga0501082_0260814
2949 Ga0501082_0371961
2950 Ga0501082_0812562
2951 Ga0501082_1039389
2952 Ga0501082_1706734
2953 Ga0501082_1824147
2954 Ga0466962_0215714
2955 2503203686
2956 2509107283
2957 2509113951
2958 2509141084
2959 2509370833
2960 2509388228
2961 2509398050
2962 2509443803
2963 2510131665
2964 2510304965
2965 2510316622
2966 2510897962
2967 2511137398
2968 2511170424
2969 2511183629
2970 2511196144
2971 2511390657
2972 2511500759
2973 2512532173
2974 2512929503
2975 2512964296
2976 2512972490
2977 2513571242
2978 2513579218
2979 2513584952
2980 2513598718
2981 2513605513
2982 2513608113
2983 2513616751
2984 2513632336
2985 2513711661
2986 2513880835
2987 2513903829
2988 2513984899
2989 2513999937
2990 2514007488
2991 2514020836
2992 2514033954
2993 2514421018
2994 2514591482
2995 2515110590
2996 2515607889
2997 2515639030
2998 2515647018
2999 2515661520
3000 2515742910
3001 2516208631
3002 2516892030
3003 2517039287
3004 2517079530
3005 2517093481
3006 2517405176
3007 2517568845
3008 2520379959
3009 2524450083
3010 2524457690
3011 2535484195
3012 2535515265
3013 2537874402
3014 2551680164
3015 2551684260
3016 2551694093
3017 2551698405
3018 2551714557
3019 2551720758
3020 2551727590
3021 2551735499
3022 2551741321
3023 2554246773
3024 2559294000
3025 2561467263
3026 2585204046
3027 2585225689
3028 2585257010
3029 2585266581
3030 2585275267
3031 2585281989
3032 2585325808
3033 2585329976
3034 2585403903
3035 2585528482
3036 2585536360
3037 2585539876
3038 2585548036
3039 2585554233
3040 2585560290
3041 2585824396
3042 2585837857
3043 2585844449
3044 2585901442
3045 2585905526
3046 2585994657
3047 2585999141
3048 2587979359
3049 2588515079
3050 2597815791
3051 2599333211
3052 2599603676
3053 2599719386
3054 2599938650
3055 2600191632
3056 2601609023
3057 2601745798
3058 2616295849
3059 2616306152
3060 2616553591
3061 2617382642
3062 2643773951
3063 2643774681
3064 2643793126
3065 2643807513
3066 2643810371
3067 2643838500
3068 2643856205
3069 2643909630
3070 2643921009
3071 2643989148
3072 2644007519
3073 2644069924
3074 2644109307
3075 2644132650
3076 2644151828
3077 2644152345
3078 2644297343
3079 2644311962
3080 2644330236
3081 2644380896
3082 2644413686
3083 2644414800
3084 2644448457
3085 2644497270
3086 2644519085
3087 2644543011
3088 2644617760
3089 2644655596
3090 2644673854
3091 2644689236
3092 2657682065
3093 2671112541
3094 2688600448
3095 2692317080
3096 2694632612
3097 2694639659
3098 2719179746
3099 2719384360
3100 2719664097
3101 2719730416
3102 2720490516
3103 2720611896
3104 2720618750
3105 2720630150
3106 2720773845
3107 2721145839
3108 2721157375
3109 2721162718
3110 2721398074
3111 2722838888
3112 2723025515
3113 2723559100
3114 2723565705
3115 2723577722
3116 2724036884
3117 2724043172
3118 2724088452
3119 2724102970
3120 2724108833
3121 2725950930
3122 2730106451
3123 2730162983
3124 2730297007
3125 2738802375
3126 2738945782
3127 2739034733
3128 2739308665
3129 2753358782
3130 2756672995
3131 2757569442
3132 2758641014
3133 2766065049
3134 2770194887
3135 2776272331
3136 2776284270
3137 2776912341
3138 2778174344
3139 2792583919
3140 2792622283
3141 2792628151
3142 2792638592
3143 2792753107
3144 2793283684
3145 2793295036
3146 2793315245
3147 2793320105
3148 2793332612
3149 2793350605
3150 2793353201
3151 2793361001
3152 2793364863
3153 2802717486
3154 2802723585
3155 2802730965
3156 2802735971
3157 2802743820
3158 2802752963
3159 2804751083
3160 2805927400
3161 2805936438
3162 2806044032
3163 2806052150
3164 2806058451
3165 2806066949
3166 2806074692
3167 2808986224
3168 2819556354
3169 2819608229
3170 2819639581
3171 2821123812
3172 2838021808
3173 2838026495
3174 2838029122
3175 2838054577
3176 2838067533
3177 2838074074
3178 2838076164
3179 2838673248
3180 2838677081
3181 2838680778
3182 2838692566
3183 2838695189
3184 2838704050
3185 2838708565
3186 2838715968
3187 2838720230
3188 2838726721
3189 2838732638
3190 2838739158
3191 2838745533
3192 2840764973
3193 2841735091
3194 2841843056
3195 2841847164
3196 2841855177
3197 2841860303
3198 2841866625
3199 2842080201
3200 2842112390
3201 2842120820
3202 2842126806
3203 2842131974
3204 2842142838
3205 2842148158
3206 2842152856
3207 2842161793
3208 2842169168
3209 2842172213
3210 2842176475
3211 2842185410
3212 2842189077
3213 2842193087
3214 2842203173
3215 2842206751
3216 2842213390
3217 2842218610
3218 2842224992
3219 2842233348
3220 2842237977
3221 2842248648
3222 2842253224
3223 2842261791
3224 2842267261
3225 2842277145
3226 2842280556
3227 2842289508
3228 2842293860
3229 2842300695
3230 2842306297
3231 2842315977
3232 2842322331
3233 2842342888
3234 2842358187
3235 2842369516
3236 2842371241
3237 2842380256
3238 2842387328
3239 2842400746
3240 2842406856
3241 2842413647
3242 2842420390
3243 2842427702
3244 2842431487
3245 2842437822
3246 2842444637
3247 2842450391
3248 2842465535
3249 2842472345
3250 2842476448
3251 2842482524
3252 2842495084
3253 2842500993
3254 2842502650
3255 2842509376
3256 2842517088
3257 2842526513
3258 2842873642
3259 2842923518
3260 2844005456
3261 2844015770
3262 2844163676
3263 2844455792
3264 2847417851
3265 2847672114
3266 2847688443
3267 2848992693
3268 2852388697
3269 2854898453
3270 2854914358
3271 2854917771
3272 2855831951
3273 2855840236
3274 2855873245
3275 2856318076
3276 2856326609
3277 2856330882
3278 2856339872
3279 2856346914
3280 2856355626
3281 2856363125
3282 2856365359
3283 2857354789
3284 2857368347
3285 2857524083
3286 2857531374
3287 2858800768
3288 2869168182
3289 2869172289
3290 2869237716
3291 2869247529
3292 2869252136
3293 2869261480
3294 2869270890
3295 2869271783
3296 2869280277
3297 2869289270
3298 2871431338
3299 2871438328
3300 2871445424
3301 2871452275
3302 2871460545
3303 2871467090
3304 2871478079
3305 2871484179
3306 2871492770
3307 2871497365
3308 2874102230
3309 2874111380
3310 2874119809
3311 2874125314
3312 2874134316
3313 2874144385
3314 2874148537
3315 2874156281
3316 2874166705
3317 2874173690
3318 2876366937
3319 2876374408
3320 2876379822
3321 2876388997
3322 2876398903
3323 2876404577
3324 2876409089
3325 2876415316
3326 2876421913
3327 2878037334
3328 2878735390
3329 2878744238
3330 2878747942
3331 2878758651
3332 2878761583
3333 2878768550
3334 2878780933
3335 2878786653
3336 2878792713
3337 2881154043
3338 2881157787
3339 2881163118
3340 2881849181
3341 2881855180
3342 2881862895
3343 2882640016
3344 2882916235
3345 2885312079
3346 2885315842
3347 2885319882
3348 2885329662
3349 2885337386
3350 2885347842
3351 2885350875
3352 2888341823
3353 2888349116
3354 2888351048
3355 2889013438
3356 2889021845
3357 2896385355
3358 2899792368
3359 2899846641
3360 2903453597
3361 2903496498
3362 2903505942
3363 2903514470
3364 2903524804
3365 2903530953
3366 2903542160
3367 2904665435
3368 2906311560
3369 2906323300
3370 2906331606
3371 2906359977
3372 2906364042
3373 2906377007
3374 2906384270
3375 2906387784
3376 2906394987
3377 2906404180
3378 2906409876
3379 2906418113
3380 2906433877
3381 2913297819
3382 2913310535
3383 2915651243
3384 2915982253
3385 2915989099
3386 2915998034
3387 2916001763
3388 2916010635
3389 2916024594
3390 2916028811
3391 2916041571
3392 2916045566
3393 2916051236
3394 2916059615
3395 2916062588
3396 2916071258
3397 2916079837
3398 2919101165
3399 2919116172
3400 2919167028
3401 2919171884
3402 2919408973
3403 2920763148
3404 2920823558
3405 2921201899
3406 2921213619
3407 2921240466
3408 2921250617
3409 2921250752
3410 2921261159
3411 2921268560
3412 2921287191
3413 2921290196
3414 2921303533
3415 2922139018
3416 2922153719
3417 2922164446
3418 2922178406
3419 2922178928
3420 2922187781
3421 2923557371
3422 2924147068
3423 2924151740
3424 2924164812
3425 2924166036
3426 2924177738
3427 2924180468
3428 2924187768
3429 2924198553
3430 2924204535
3431 2924211810
3432 2924218628
3433 2924222825
3434 2924235096
3435 2924712722
3436 2924719863
3437 2924728499
3438 2924738617
3439 2924743207
3440 2924754006
3441 2924755544
3442 2924764308
3443 2924782156
3444 2924788413
3445 2926757126
3446 2926761347
3447 2928526247
3448 2933007501
3449 2933012269
3450 2933573366
3451 2933587719
3452 2933594714
3453 2933604414
3454 2935895712
3455 2935907326
3456 2936368737
3457 2936377186
3458 2936999357
3459 2937007929
3460 2937016057
3461 2937016884
3462 2937027686
3463 2937030071
3464 2937037935
3465 2937044573
3466 2937050527
3467 2937057412
3468 2937064833
3469 2937076068
3470 2937080148
3471 2937085787
3472 2937092713
3473 2937099765
3474 2937107043
3475 2937119647
3476 2937124234
3477 2937130296
3478 2937818620
3479 2937828503
3480 2937838786
3481 2937846537
3482 2937850548
3483 2937868276
3484 2937870950
3485 2937877715
3486 2937895027
3487 2937977787
3488 2937984696
3489 2937996014
3490 2938015897
3491 2941500540
3492 2954014856
3493 2957379013
3494 2957387054
3495 2957393524
3496 2957400025
3497 2957402817
3498 2957413163
3499 2957415741
3500 2957429379
3501 2957436540
3502 2957443859
3503 2957450200
3504 2957455329
3505 2957458396
3506 2957469342
3507 2957471849
3508 2957483874
3509 2957485900
3510 2957494323
3511 2957499047
3512 2957506252
3513 2958036146
3514 2958047570
3515 2958051539
3516 2958066238
3517 2958074474
3518 2958084822
3519 2958096376
3520 2958107201
3521 2958109458
3522 2958115771
3523 2958124117
3524 2958133646
3525 2958143288
3526 2958150232
3527 2958163766
3528 2958166485
3529 2958173055
3530 2958183290
3531 2960585646
3532 2960593764
3533 2960600786
3534 2960604512
3535 2960613943
3536 2960617493
3537 2960628714
3538 2960632927
3539 2960638912
3540 2960646195
3541 2960653871
3542 2960663292
3543 2960672364
3544 2960677662
3545 2960685637
3546 2960690512
3547 2960695653
3548 2961081257
3549 2961120435
3550 2961130225
3551 2961138819
3552 2961164950
3553 2961173154
3554 2961188671
3555 2963649730
3556 2964610919
3557 2964617898
3558 2964622748
3559 2964629565
3560 2964636639
3561 2964647768
3562 2964654475
3563 2964657084
3564 2964670144
3565 2964677639
3566 2964682706
3567 2964685792
3568 2964692796
3569 2964702024
3570 2964710655
3571 2964717026
3572 2964721743
3573 2965019775
3574 2965026358
3575 2965032908
3576 2965045816
3577 2965050641
3578 2965066052
3579 2965092423
3580 2965107682
3581 2965116608
3582 2965126695
3583 2967665915
3584 2967676774
3585 2967679230
3586 2967686211
3587 2967698044
3588 2967702371
3589 2967712364
3590 2967714992
3591 2967724647
3592 2967729818
3593 2967739679
3594 2967747122
3595 2967751922
3596 2967756611
3597 2967764001
3598 2967773267
3599 2967778356
3600 2967998325
3601 2968006249
3602 2968022218
3603 2968086961
3604 2968095596
3605 2968100169
3606 2968116902
3607 2968118628
3608 2968131977
3609 2968146305
3610 2968173350
3611 2970020345
3612 2970032573
3613 2970038935
3614 2970044702
3615 2970048229
3616 2970059360
3617 2970065053
3618 2970074154
3619 2970080875
3620 2970083291
3621 2970093615
3622 2970096411
3623 2970108355
3624 2970112453
3625 2970120848
3626 2970123732
3627 2970134096
3628 2970141459
3629 2970145658
3630 2970154958
3631 2970157076
3632 2970169200
3633 2970175887
3634 2970182526
3635 2970185372
3636 2970197145
3637 2970474808
3638 2970494604
3639 2970505748
3640 2970511729
3641 2970529085
3642 2970535453
3643 2970544508
3644 2970550768
3645 2970556439
3646 2970594875
3647 2970624331
3648 2970633416
3649 2977521641
3650 2977528996
3651 2977537557
3652 2977540575
3653 2977544727
3654 2977558278
3655 2977563832
3656 2977570816
3657 2977577924
3658 2977581705
3659 2977827184
3660 2977832872
3661 2977844584
3662 2977856681
3663 2977860163
3664 2977870374
3665 2977876101
3666 2977900327
3667 2977912740
3668 2977920701
3669 2977927764
3670 2977939827
3671 2977946571
3672 2977956334
3673 2977962359
3674 2977977113
3675 2977989044
3676 2978973443
3677 2979093371
3678 2979099244
3679 2979105342
3680 2979712124
3681 2979743938
3682 2979765211
3683 2979777899
3684 2979782120
3685 2979795710
3686 2979810469
3687 2984512802
3688 2984520835
3689 2984540129
3690 2984591726
3691 2984602322
3692 2987643391
3693 2987651302
3694 2987658543
3695 2987660957
3696 2987672846
3697 2987678188
3698 2989777725
3699 2996313051
3700 2996340030
3701 2996347457
3702 2996354218
3703 2996391834
3704 2996892011
3705 2996893634
3706 3000136854
3707 3002142948
3708 3004171258
3709 3004190007
3710 3004201538
3711 3004206937
3712 3004213853
3713 3004223444
3714 3004233981
3715 3004246930
3716 3004248269
3717 3004270469
3718 3004280886
3719 3004296085
3720 3004339044
3721 3005411398
3722 3005422637
3723 3005446349
3724 3005453019
3725 637079251
3726 639646858
3727 643824706
3728 648737651
3729 649874897
3730 650739191
3731 8002288102
3732 8003570199
3733 8003992652
3734 8003999976
3735 8004306708
3736 8004319568
3737 8004364529
3738 8004380167
3739 8004391149
3740 8004401152
3741 8004449528
3742 8004635285
3743 8004646047
3744 8004701108
3745 8004704010
3746 8004716520
3747 8004728762
3748 8005247103
3749 8005263666
3750 8005279075
3751 8005283845
3752 8005291896
3753 8005304026
3754 8005308844
3755 8005321826
3756 8005326538
3757 8005377244
3758 8005401870
3759 8005433114
3760 8005461231
3761 8005485969
3762 8005498842
3763 8005543947
3764 8005559274
3765 8005577109
3766 8005620034
3767 8005628634
3768 8005646651
3769 8005660510
3770 8005670253
3771 8005684937
3772 8005690451
3773 8005697991
3774 8018133308
3775 8018151822
3776 8018167897
3777 8018180446
3778 8023684027
3779 8024480485
3780 8024487733
3781 8024502540
3782 8046769809
3783 8049293664
3784 8054461446
3785 8055623431
3786 8056379061
3787 8056386143
3788 8056879285
3789 8057577431
3790 8057881112

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02609

Exonuc_VII_S

Exonuclease VII small subunit

25

76

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
1vp7-assembly2.cif.gz_C crystal structure of exodeoxyribonuclease vii small subunit (np_881400.1) from bordetella pertussis at 2.40 a resolution 0.9731 13 62
1vp7-assembly1.cif.gz_A crystal structure of exodeoxyribonuclease vii small subunit (np_881400.1) from bordetella pertussis at 2.40 a resolution 0.9637 13 62
1vp7-assembly3.cif.gz_E crystal structure of exodeoxyribonuclease vii small subunit (np_881400.1) from bordetella pertussis at 2.40 a resolution 0.9474 13 62
1vp7-assembly1.cif.gz_B crystal structure of exodeoxyribonuclease vii small subunit (np_881400.1) from bordetella pertussis at 2.40 a resolution 0.9429 13 62
5yma-assembly1.cif.gz_A crystal structure of ribosome assembly factor efg1 0.9014 12 62
ID Description Score Start End Superfamily
af_A0A140UHX3_685_824_1.25.10.10 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant 0.9906 12 52 1.25.10.10
1k8tA03 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.9506 13 59 1.20.140.60
1vp7F00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Exonuclease VII, small subunit 0.915 13 62 1.10.287.1040
af_Q17886_109_298_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.903 15 51 1.25.40.10
af_Q8TF30_78_442_1.20.120.560 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);alix/aip1 in complex with the ypdl late domain 0.892 14 60 1.20.120.560
ID Description Score Start End GO Terms
AF-A0A6P1DN57-F1-model_v4 Exodeoxyribonuclease VII small subunit (EC 3.1.11.6) 0.9922 12 62 GO:0006308
GO:0008855
GO:0009318
AF-A0A2E3SJV2-F1-model_v4 Exodeoxyribonuclease 7 small subunit (EC 3.1.11.6) (Exodeoxyribonuclease VII small subunit) (Exonuclease VII small subunit) 0.9877 9 63 GO:0005829
GO:0006308
GO:0008855
GO:0009318
AF-A0A4Q4R619-F1-model_v4 deleted 0.9873 9 61
AF-A0A142WT84-F1-model_v4 Uncharacterized protein 0.9867 11 62 GO:0006308
GO:0008855
GO:0009318
AF-A0A1F8Q238-F1-model_v4 Exodeoxyribonuclease 7 small subunit (EC 3.1.11.6) (Exodeoxyribonuclease VII small subunit) (Exonuclease VII small subunit) 0.9777 9 63 GO:0005829
GO:0006308
GO:0008855
GO:0009318

Map