F496002

General Info

Members Datasets Scaffolds Average Seq Length
1896 982 3792 428

Family's Representative Sequence

Representative Sequence 3300026067|Ga0207678_10020313|Ga0207678_100203135
Length 514
Sequence VPNEVAMEKMRRYVREIAGSKHEILREDDRYRAQRAGSQIPTKDWRCPLPLKRIVCCLVAWILLMNVPEPKGKAIMTTITATADSARKPIYQSLFVQVLAALLLGIVIGMAAPEFAVGLKIFSDAFLKLISMIVAPIVFCVVVHGIAGAGDLKKVGRVGVKALIYFEVMTTIALVVGLLLAYLFGPGHGMNIDPSTLDAKALNTYSDNAHKLQGGGIGSFLLNIIPSTSFDALSRNDVLQVLFFAILFGTGLALVGGEKGEKINALIDAVSTVLFRVMGLIVRVAPLGVLGAVAYTVGKYGVGSLKQLLSLVALFYVSLAIFVLXXXXGVMALAGLNILKFLAYLREELTIVLATASSDAVLPQIMRKLEALGVKKSVVGLVIPTGYSFNLDAFSIYLTLAVVFIAQATNTPLSFGDLLLVLGVSLITSKGAHGVPGSAIVILAATLNAVPSIPAIGLVLVLSVDWFIGMARALGNLIGNCVATVVIAAWEGDLDRDKARRVLDGAELVDVTAG

Samples

Sample ID Description Type Environment
1 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
3 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
6 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
7 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
8 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
9 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
10 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
11 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
12 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
13 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
14 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
15 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
16 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
17 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
18 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
19 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
20 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
21 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
22 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
23 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
24 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
25 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
26 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
27 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
28 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
29 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
30 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
31 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
32 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
33 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
34 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
35 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
36 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
37 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
38 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
39 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
40 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
41 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
42 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
43 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
44 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
45 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
46 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
47 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
48 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
49 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
50 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
51 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
52 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
53 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
54 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
55 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
56 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
57 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
58 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
59 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
60 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
61 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
62 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
63 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
64 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
65 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
66 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
67 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
68 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
69 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
70 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
71 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
72 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
73 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
74 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
75 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
76 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
77 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
78 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
79 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
80 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
81 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
82 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
83 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
84 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
85 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
86 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
87 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
88 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
89 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
90 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
91 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
92 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
93 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
94 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
95 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
96 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
97 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
98 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
99 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
100 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
101 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
102 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
103 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
104 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
105 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
106 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
107 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
108 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
109 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
110 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
111 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
112 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
113 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
114 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
115 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
116 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
117 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
118 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
119 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
120 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
121 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
122 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
123 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
124 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
125 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
126 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
127 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
128 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
129 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
130 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
131 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
132 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
133 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
134 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
135 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
136 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
137 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
138 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
139 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
140 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
141 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
142 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
143 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
144 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
145 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
146 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
147 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
148 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
149 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
150 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
151 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
152 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
153 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
154 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
155 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
156 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
157 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
158 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
159 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
160 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
161 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
162 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
163 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
164 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
165 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
166 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
167 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
168 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
169 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
170 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
171 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
172 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
217 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
218 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
219 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
220 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
221 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
222 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
223 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
225 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
228 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
229 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
230 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
231 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
232 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
233 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
234 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
235 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
236 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
237 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
238 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
239 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
240 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
241 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
242 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
243 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
244 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
245 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
246 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
247 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
248 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
249 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
250 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
251 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
252 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
253 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
254 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
255 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
256 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
257 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
258 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
259 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
260 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
261 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
262 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
263 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
264 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
265 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
266 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
267 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
268 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
269 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
270 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
271 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
272 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
273 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
274 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
275 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
276 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
277 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
278 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
279 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
280 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
281 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
282 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
283 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
284 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
285 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
286 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
287 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
288 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
289 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
290 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
291 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
292 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
293 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
294 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
295 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
296 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
297 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
298 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
299 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
300 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
301 3300044666 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1E Metagenome Unclassified
302 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
303 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
304 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
305 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
306 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
307 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
308 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
309 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
310 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
311 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
312 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
313 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
314 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
315 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
316 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
317 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
318 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
319 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
320 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
321 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
322 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
323 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
324 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
325 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
326 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
327 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
328 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
329 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
330 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
331 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
332 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
333 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
334 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
335 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
336 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
337 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
338 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
339 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
340 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
341 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
342 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
343 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
344 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
345 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
346 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
347 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
348 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
349 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
350 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
351 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
352 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
353 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
354 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
355 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
356 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
357 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
358 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
359 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
360 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
361 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
362 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
363 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
364 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
365 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
366 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
367 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
368 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
369 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
370 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
371 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
372 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
373 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
374 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
375 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
376 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
377 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
378 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
379 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
380 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
381 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
382 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
383 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
384 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
385 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
386 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
387 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
388 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
389 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
390 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
391 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
392 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
393 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
394 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
395 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
396 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
397 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
398 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
399 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
400 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
401 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
402 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
403 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
404 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
405 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
406 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
407 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
408 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
409 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
410 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
411 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
412 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
413 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
414 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
415 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
416 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
417 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
418 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
419 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
420 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
421 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
422 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
423 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
424 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
425 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
426 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
427 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
428 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
429 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
430 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
431 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
432 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
433 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
434 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
435 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
436 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
437 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
438 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
439 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
440 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
441 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
442 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
443 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
444 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
445 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
446 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
447 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
448 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
449 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
450 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
451 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
452 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
453 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
454 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
455 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
456 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
457 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
458 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
459 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
460 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
461 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
462 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
463 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
464 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
465 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
466 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
467 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
468 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
469 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
470 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
471 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
472 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
473 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
474 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
475 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
476 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
477 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
478 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
479 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
480 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
481 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
482 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
483 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
484 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
485 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
486 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
487 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
488 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
489 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
490 2501025501 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
491 2501025502 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
492 2501025504 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
493 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
494 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
495 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
496 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
497 2510065045 Paraburkholderia sprentiae WSM5005 Isolate Nodule
498 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
499 2510917014 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
500 2510917015 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
501 2511231003 Herbaspirillum sp. CF444 Isolate Rhizosphere
502 2511231004 Pseudomonas sp. GM102 Isolate Nodule
503 2511231006 Pseudomonas sp. GM17 Isolate Nodule
504 2511231007 Pseudomonas sp. GM18 Isolate Nodule
505 2511231011 Pseudomonas sp. GM30 Isolate Nodule
506 2511231012 Pseudomonas sp. GM33 Isolate Nodule
507 2511231015 Pseudomonas sp. GM49 Isolate Nodule
508 2511231016 Pseudomonas sp. GM50 Isolate Nodule
509 2511231017 Pseudomonas sp. GM55 Isolate Nodule
510 2511231018 Pseudomonas sp. GM60 Isolate Nodule
511 2511231019 Pseudomonas sp. GM67 Isolate Nodule
512 2511231020 Pseudomonas sp. GM74 Isolate Nodule
513 2511231021 Pseudomonas sp. GM78 Isolate Nodule
514 2511231022 Pseudomonas sp. GM79 Isolate Nodule
515 2511231023 Pseudomonas sp. GM80 Isolate Nodule
516 2511231024 Pseudomonas sp. GM84 Isolate Nodule
517 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
518 2511231156 Pseudomonas ogarae F113 Isolate Rhizosphere
519 2512047018 Pseudomonas chlororaphis chlororaphis GP72 Isolate Rhizosphere
520 2512047030 Paraburkholderia tuberum STM678 Isolate Nodule
521 2513237082 Paraburkholderia mimosarum STM3621 Isolate Nodule
522 2513237083 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
523 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
524 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
525 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
526 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
527 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
528 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
529 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
530 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
531 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
532 2513237150 Cupriavidus taiwanensis STM6018 Isolate Nodule
533 2513237151 Burkholderia sp. WSM2230 Isolate Nodule
534 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
535 2513237165 Cupriavidus neocaledonicus STM6070 Isolate Nodule
536 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
537 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
538 2515154122 Paraburkholderia atlantica JPY251 Isolate Nodule
539 2515154123 Trinickia symbiotica JPY347 Isolate Nodule
540 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
541 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
542 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
543 2519103095 Burkholderia sp. KJ006 Isolate Nodule
544 2521172590 Herbaspirillum sp. GW103 Isolate Rhizosphere
545 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
546 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
547 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
548 2526164713 Paraburkholderia phenoliruptrix JPY366 Isolate Nodule
549 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
550 2548876994 Herbaspirillum lusitanum P6-12 Isolate Nodule
551 2551306352 Acinetobacter sp. GG2 Isolate Rhizosphere
552 2551306416 Herbaspirillum seropedicae Os34 Isolate Unclassified
553 2554235132 Pseudomonas aeruginosa PGPR2 Isolate Unclassified
554 2554235231 Pseudomonas putida MTCC 5279 Isolate Unclassified
555 2554235341 Pseudomonas protegens CHA0 Isolate Rhizosphere
556 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
557 2582580891 Pseudomonas chlororaphis YL-1 Isolate Unclassified
558 2582581311 Burkholderia sp. WP42 Isolate Rhizosphere
559 2595698237 Methylobacterium sp. UNCCL125 Isolate Unclassified
560 2596583598 Ralstonia sp. UNCCL144 Isolate Unclassified
561 2597489887 Pseudomonas chlororaphis aureofaciens 30-84 Isolate Rhizosphere
562 2597489888 Pseudomonas fluorescens SS101 Isolate Rhizosphere
563 2597489889 Pseudomonas synxantha BG33R Isolate Rhizosphere
564 2599185160 Pseudomonas sp. NFPP25 Isolate Rhizoplane
565 2599185161 Pseudomonas sp. NFPP09 Isolate Rhizoplane
566 2599185162 Pseudomonas sp. NFPP10 Isolate Rhizoplane
567 2599185163 Pseudomonas sp. NFPP12 Isolate Rhizoplane
568 2599185164 Pseudomonas sp. NFPP13 Isolate Rhizoplane
569 2599185165 Pseudomonas sp. NFPP18 Isolate Rhizoplane
570 2599185166 Pseudomonas sp. NFPP08 Isolate Rhizoplane
571 2599185167 Pseudomonas sp. NFPP28 Isolate Rhizoplane
572 2599185168 Pseudomonas sp. NFPP05 Isolate Rhizoplane
573 2599185178 Ralstonia sp. NFACC01 Isolate Rhizoplane
574 2599185179 Pseudomonas sp. NFR09 Isolate Rhizoplane
575 2599185181 Pseudomonas sp. NFPP17 Isolate Rhizoplane
576 2599185182 Pseudomonas sp. NFPP19 Isolate Rhizoplane
577 2599185185 Pseudomonas sp. NFPP07 Isolate Rhizoplane
578 2599185186 Pseudomonas sp. NFPP15 Isolate Rhizoplane
579 2599185188 Pseudomonas sp. NFACC45 Isolate Rhizoplane
580 2599185189 Pseudomonas sp. NFPP02 Isolate Rhizoplane
581 2599185190 Pseudomonas sp. NFPP04 Isolate Rhizoplane
582 2599185191 Pseudomonas sp. NFPP24 Isolate Rhizoplane
583 2599185239 Burkholderia sp. NFACC38-1 Isolate Rhizoplane
584 2599185240 Burkholderia sp. NFPP32 Isolate Rhizoplane
585 2599185257 Pseudomonas sp. NFACC41-3 Isolate Rhizoplane
586 2599185288 Pseudomonas sp. NFACC25 Isolate Rhizoplane
587 2599185290 Pseudomonas sp. NFPP11 Isolate Rhizoplane
588 2599185300 Pseudomonas sp. NFACC39-1 Isolate Rhizoplane
589 2599185303 Pseudomonas sp. NFACC42-2 Isolate Rhizoplane
590 2599185311 Pseudomonas sp. NFACC04-2 Isolate Rhizoplane
591 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
592 2599185355 Burkholderia sp. NFACC33-1 Isolate Rhizoplane
593 2599185356 Pseudomonas sp. NFPP14 Isolate Rhizoplane
594 2600254931 Pseudomonas sp. NFIX28 Isolate Rhizoplane
595 2600255067 Paraburkholderia kururiensis thiooxydans NBRC 107107 Isolate Unclassified
596 2600255296 Pseudomonas sp. NFR02 Isolate Rhizoplane
597 2600255313 Pseudomonas sp. NFPP16 Isolate Rhizoplane
598 2600255318 Pseudomonas putida NFIX47 Isolate Rhizoplane
599 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
600 2603880185 Pseudomonas sp. NFIX46 Isolate Rhizoplane
601 2603880199 Pseudomonas sp. NFIX49 Isolate Rhizoplane
602 2606217733 Pseudomonas aeruginosa NFHH01 Isolate Rhizoplane
603 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
604 2619619299 Pseudomonas veronii R4 Genome sequencing Isolate Unclassified
605 2623620443 Pseudomonas sp. DR 5-09 Isolate Unclassified
606 2623620446 Pseudomonas sp. GR 6-02 Isolate Unclassified
607 2639762793 Acinetobacter calcoaceticus GK1 Isolate Rhizosphere
608 2643221571 Pseudomonas sp. Root569 Isolate Unclassified
609 2643221589 Pseudomonas sp. Root68 Isolate Unclassified
610 2643221602 Pseudomonas sp. Root71 Isolate Unclassified
611 2643221633 Pseudomonas sp. Root329 Isolate Unclassified
612 2643221650 Pseudomonas sp. Root401 Isolate Unclassified
613 2643221713 Pseudomonas sp. Root9 Isolate Unclassified
614 2651869719 Genome Sequence of Pseudomonas fluorescens UM270 Isolate Rhizosphere
615 2667528171 Pseudomonas sp. NFPP22 Isolate Rhizoplane
616 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
617 2671180172 Pseudomonas sp. NFIX51 Isolate Rhizoplane
618 2675903129 Burkholderia pyrrocinia NFIX32 Isolate Rhizoplane
619 2675903420 Pseudomonas fluorescens Ps006 Isolate Unclassified
620 2675903507 Acinetobacter calcoaceticus GK2 Isolate Unclassified
621 2675903515 Pseudomonas thivervalensis DSM 13194 Isolate Unclassified
622 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
623 2713897148 Pseudomonas fluorescens SF39a Isolate Rhizosphere
624 2713897149 Pseudomonas fluorescens SF4c Isolate Rhizosphere
625 2718217725 Pseudomonas fluorescens CREA-C16 Isolate Rhizosphere
626 2718217991 Paraburkholderia sprentiae WSM5005 Isolate Nodule
627 2721755607 Pseudomonas fluorescens Pt14 Isolate Rhizosphere
628 2721755763 Pandoraea thiooxydans ATSB16 Isolate Rhizosphere
629 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
630 2738541265 Pseudomonas sp. GV077 Isolate Unclassified
631 2738541281 Methylobacterium sp. GV094 Isolate Unclassified
632 2738541282 Pseudomonas sp. GV058 Isolate Unclassified
633 2738541294 Pseudomonas sp. GV087 Isolate Unclassified
634 2738541296 Paraburkholderia sp. GV073 Isolate Unclassified
635 2738541298 Paraburkholderia sp. GV068 Isolate Unclassified
636 2738541303 Pseudomonas sp. GV105 Isolate Unclassified
637 2738541306 Paraburkholderia sp. GV052 Isolate Unclassified
638 2738541309 Pseudomonas sp. GV047 Isolate Unclassified
639 2738543002 Paraburkholderia sp. GV072 Isolate Unclassified
640 2738543004 Pseudomonas sp. GV085 Isolate Unclassified
641 2738543008 Paraburkholderia sp. GV060 Isolate Unclassified
642 2738543015 Pseudomonas sp. GV041 Isolate Unclassified
643 2738543025 Pseudomonas sp. GV091 Isolate Unclassified
644 2738543032 Methylobacterium sp. GV104 Isolate Unclassified
645 2740892503 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
646 2744054620 Pseudomonas thivervalensis LMG 21626 Isolate Unclassified
647 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
648 2744054900 Paraburkholderia ginsengiterrae DCY85-1 Isolate Unclassified
649 2744054901 Paraburkholderia ginsengiterrae DCY85 Isolate Unclassified
650 2751185846 Paraburkholderia ribeironis STM 7296 Isolate Unclassified
651 2765235838 Herbaspirillum robiniae AA6 Isolate Unclassified
652 2765235841 Pseudomonas putida AA7 Isolate Unclassified
653 2773857670 Pseudomonas sp. 478 Isolate Unclassified
654 2773857673 Pseudomonas sp. 443 Isolate Unclassified
655 2773857761 Acinetobacter sp. 3664 Isolate Unclassified
656 2773857770 Acinetobacter sp. 3636 Isolate Unclassified
657 2784132063 Pseudomonas sp. 424 Isolate Unclassified
658 2784132072 Pseudomonas sp. 460 Isolate Unclassified
659 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
660 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
661 2791355199
662 2791355520 Pseudomonas sp. s211(2017) Isolate Unclassified
663 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
664 2806310737 Pseudomonas mosselii BS011 Isolate Unclassified
665 2806310745 Pseudomonas mosselii PtA1 Isolate Unclassified
666 2808606361 Pseudomonas sp. SJZ075 Isolate Rhizosphere
667 2808606376 Pseudomonas sp. SJZ074 Isolate Rhizosphere
668 2808606377 Pseudomonas sp. SJZ083 Isolate Rhizosphere
669 2808606378 Pseudomonas sp. SJZ078 Isolate Rhizosphere
670 2808606380 Pseudomonas sp. SJZ085 Isolate Rhizosphere
671 2808606381 Pseudomonas sp. SJZ077 Isolate Rhizosphere
672 2808606382 Pseudomonas sp. SJZ080 Isolate Rhizosphere
673 2808606383 Pseudomonas sp. SJZ124 Isolate Rhizosphere
674 2808606384 Burkholderia sp. SJZ089 Isolate Rhizosphere
675 2808606385 Pseudomonas sp. SJZ103 Isolate Rhizosphere
676 2808606388 Pseudomonas sp. SJZ094 Isolate Rhizosphere
677 2808606389 Pseudomonas sp. SJZ101 Isolate Rhizosphere
678 2808606390 Burkholderia sp. SJZ115 Isolate Rhizosphere
679 2808606391 Burkholderia sp. SJZ091 Isolate Rhizosphere
680 2808606445 Pseudomonas sp. SJZ131 Isolate Rhizosphere
681 2811994881 Pseudomonas sp. SLBN-26 Isolate Unclassified
682 2816332253 Burkholderia vietnamiensis HI2297 Isolate Unclassified
683 2816332256 Burkholderia vietnamiensis MSMB608WGS Isolate Unclassified
684 2816332286 Burkholderia vietnamiensis HI2221 Isolate Rhizosphere
685 2816332298 Pseudomonas veronii R02 Isolate Rhizosphere
686 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
687 2818991436 Collimonas arenae 515 Isolate Unclassified
688 2818991445 Herbaspirillum hiltneri 3195 Isolate Unclassified
689 2818991449 Herbaspirillum huttiense 1147 Isolate Unclassified
690 2818991452 Burkholderia cepacia 561 Isolate Unclassified
691 2818991456 Pseudomonas koreensis 3286 Isolate Rhizosphere
692 2818991464 Pseudomonas protegens 3295 Isolate Rhizosphere
693 2823421272 Pseudomonas mendocina S5.2 Isolate Rhizoplane
694 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
695 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
696 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
697 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
698 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
699 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
700 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
701 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
702 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
703 2825651385 Pseudomonas brassicacearum L13-6-12 Isolate Rhizosphere
704 2829745981 Methylorubrum rhodinum DSM 2163 Isolate Rhizosphere
705 2834028612 Pseudomonas fluorescens 513 Isolate Unclassified
706 2834641062 Cupriavidus gilardii JZ4 Isolate Unclassified
707 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
708 2839094727 Herbaspirillum robiniae HZ10 Isolate Nodule
709 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
710 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
711 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
712 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
713 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
714 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
715 2842324504 Paraburkholderia fungorum SEMIA 4007 Isolate Nodule
716 2842348783 Paraburkholderia fungorum SEMIA 4013 Isolate Nodule
717 2842454564 Paraburkholderia fungorum SEMIA 4056 Isolate Nodule
718 2842698319 Methylobacterium sp. R-72139 Isolate Unclassified
719 2842826826 Pseudomonas sp. R-72172 Isolate Unclassified
720 2842832357 Pseudomonas sp. R-72164 Isolate Unclassified
721 2842837860 Pseudomonas sp. R-72102 Isolate Unclassified
722 2842843487 Pseudomonas sp. R-72074 Isolate Unclassified
723 2844665904 Pseudomonas protegens H1F10C Isolate Unclassified
724 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
725 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
726 2852612431 Pseudomonas sp. SJZ073 Isolate Rhizosphere
727 2852657418 Pseudomonas sp. JAI115 Isolate Rhizosphere
728 2852667396 Pseudomonas sp. JAI120 Isolate Rhizosphere
729 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
730 2858688981 Cupriavidus sp. UYMMa02A Isolate Unclassified
731 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
732 2860867994 Pseudomonas sp. R1-43-08 Isolate Rhizosphere
733 2861691609 Methylorubrum thiocyanatum DSM 11490 Isolate Rhizosphere
734 2863421361 Burkholderia cenocepacia CACua-24 Isolate Rhizosphere
735 2870068957 Burkholderia sp. JP2-270 Isolate Unclassified
736 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
737 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
738 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
739 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
740 2878029506 Pseudomonas fluorescens DR397 Isolate Rhizosphere
741 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
742 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
743 2880230671 Pseudomonas fluorescens LBUM677 Isolate Unclassified
744 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
745 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
746 2884811622 Herbaspirillum sp. 3C11 Isolate Unclassified
747 2884836552 Herbaspirillum sp. 3R-11 Isolate Unclassified
748 2884852848 Herbaspirillum sp. 3R11 Isolate Unclassified
749 2885266251 Ralstonia sp. SET104 Isolate Nodule
750 2885270888 Paraburkholderia sp. UYCPa14C Isolate Unclassified
751 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
752 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
753 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
754 2889306138 Methylobacterium sp. PvR107 Isolate Rhizosphere
755 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
756 2896154374 Herbaspirillum sp. 3R-3a1 Isolate Nodule
757 2900634093 Paraburkholderia dipogonis ICMP 19430 Isolate Unclassified
758 2901300506 Cupriavidus sp. UYMSc13B Isolate Unclassified
759 2902330777 Methylobacterium sp. 2A Isolate Unclassified
760 2902682994 Paraburkholderia atlantica CNPSo 3155 Isolate Unclassified
761 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
762 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
763 2904424332 Duganella sp. 1411 Isolate Rhizosphere
764 2904439833 Herbaspirillum sp. 1589 Isolate Rhizosphere
765 2904518522 Pseudomonas fluorescens 4488 Isolate Rhizosphere
766 2904530477 Herbaspirillum huttiense 611 Isolate Unclassified
767 2904550169 Stutzerimonas stutzeri 1099 Isolate Rhizosphere
768 2904564687 Burkholderia sp. 571 Isolate Unclassified
769 2904571731 Burkholderia cenocepacia 574 Isolate Unclassified
770 2904584206 Herbaspirillum sp. 1050 Isolate Unclassified
771 2904589729 Herbaspirillum sp. 1130 Isolate Unclassified
772 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
773 2904615490 Paraburkholderia franconis CNPSo 3157 Isolate Unclassified
774 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
775 2904699407
776 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
777 2906610324
778 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
779 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
780 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
781 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
782 2908446538 Pseudomonas sp. R76 Isolate Rhizosphere
783 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
784 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
785 2909042592 Labrys sp. LIt4 Isolate Nodule
786 2912963787 Pseudomonas sp. R32 Isolate Rhizosphere
787 2913036834 Pseudomonas viciae 11K1 Isolate Rhizosphere
788 2917070673 Pseudomonas protegens CHA0 Isolate Rhizosphere
789 2919063839 Pseudomonas pharyngis 1098 Isolate Rhizosphere
790 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
791 2919079590 Herbaspirillum sp. 1173 Isolate Unclassified
792 2919155634 Pseudomonas fulva 1992 Isolate Unclassified
793 2919182534 Acinetobacter calcoaceticus 2589 Isolate Rhizosphere
794 2919385768 Pseudomonas sp. 2957 Isolate Unclassified
795 2919456309 Pseudomonas sp. 3296 Isolate Rhizosphere
796 2919487758 Pseudomonas koreensis 3441 Isolate Unclassified
797 2919501602 Pseudomonas alcaliphila 3512 Isolate Unclassified
798 2919697872 Pseudomonas frederiksbergensis 4169 Isolate Unclassified
799 2921643360 Paraburkholderia steynii HC1.1ba Isolate Nodule
800 2922368715
801 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
802 2922425934
803 2923153595 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
804 2923510766 Herbaspirillum rubrisubalbicans SLBN-127 Isolate Rhizosphere
805 2923519811 Pseudomonas otitidis SLBN-103 Isolate Rhizosphere
806 2923586266 Pseudomonas fluorescens 1550 Isolate Rhizosphere
807 2926063275 Pseudomonas sp. 3400 Isolate Unclassified
808 2928058823 Ralstonia sp. 1138 Isolate Unclassified
809 2928108538 Paraburkholderia terricola 1595 Isolate Rhizosphere
810 2928125067 Methylobacterium sp. 1973 Isolate Unclassified
811 2928130867 Herbaspirillum seropedicae 1977 Isolate Unclassified
812 2928135762 Paraburkholderia terricola 1988 Isolate Unclassified
813 2928157003 Burkholderia ambifaria 566 Isolate Unclassified
814 2928163908 Burkholderia sp. 567 Isolate Unclassified
815 2928170801 Burkholderia sp. 572 Isolate Unclassified
816 2928503688 Paraburkholderia terricola 1263 Isolate Rhizosphere
817 2928536128 Burkholderia sola 565 Isolate Unclassified
818 2929144301 Pseudomonas sp. R-71838 Hybrid assembly Isolate Unclassified
819 2929189879 Pseudomonas sp. R-71842 Hybrid assembly Isolate Unclassified
820 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
821 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
822 2931369376 Pseudomonas fluorescens DR133 Isolate Rhizosphere
823 2931390751 Pseudomonas sp. DR208 Isolate Rhizosphere
824 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
825 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
826 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
827 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
828 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
829 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
830 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
831 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
832 2935353572 Pseudomonas protegens TECH19 Isolate Unclassified
833 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
834 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
835 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
836 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
837 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
838 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
839 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
840 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
841 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
842 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
843 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
844 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
845 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
846 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
847 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
848 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
849 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
850 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
851 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
852 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
853 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
854 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
855 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
856 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
857 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
858 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
859 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
860 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
861 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
862 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
863 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
864 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
865 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
866 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
867 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
868 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
869 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
870 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
871 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
872 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
873 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
874 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
875 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
876 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
877 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
878 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
879 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
880 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
881 2939636861 Pseudomonas sp. 2725 Isolate Rhizosphere
882 2939651529 Pseudomonas sp. 2835 Isolate Rhizosphere
883 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
884 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
885 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
886 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
887 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
888 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
889 2945928738 Pseudomonas cedrina W1I11 Isolate Rhizosphere
890 2945934425 Paraburkholderia graminis W1I13 Isolate Rhizosphere
891 2945961074 Pseudomonas sp. W2I6 Isolate Rhizosphere
892 2946006987 Pseudomonas sp. W3I7 Isolate Rhizosphere
893 2946027586 Pseudomonas sp. W4I3 Isolate Rhizosphere
894 2947233263 Pseudomonas synxantha W2I4 Isolate Rhizosphere
895 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
896 2969304461 Pseudomonas sp. R84 Isolate Rhizosphere
897 2974289157 Pseudomonas fluorescens SORGH_AS 191 Isolate Unclassified
898 2981990288 Burkholderia sp. PvR073 Isolate Rhizosphere
899 2984286254 Pseudomonas chlororaphis aurantiaca JD37 Isolate Rhizosphere
900 2988728565 Pseudomonas corrugata RM1-1-4 Isolate Rhizosphere
901 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
902 2990703756 Paraburkholderia graminis SLBN-33 Isolate Rhizosphere
903 2998139840 Pseudomonas iranensis SWRI54 Isolate Rhizosphere
904 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
905 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
906 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
907 3007395558 Pseudomonas chlororaphis PCL1601 Isolate Rhizosphere
908 3007419365 Pseudomonas vanderleydeniana RW8P3 Isolate Unclassified
909 3007614139 Pseudomonas sp. PB106 Isolate Unclassified
910 3007718800 Pseudomonas fluorescens BW11P2 Isolate Rhizosphere
911 3007803356 Pseudomonas sp. CM27 Isolate Unclassified
912 3007855910 Pseudomonas khorasanensis SWRI153 Isolate Rhizosphere
913 3007861166 Pseudomonas hamedanensis SWRI65 Isolate Rhizosphere
914 3007872151 Pseudomonas sp. SWRI51 Isolate Rhizosphere
915 637000220 Pseudomonas protegens Pf-5 Isolate Rhizoplane
916 641228493 Gluconacetobacter diazotrophicus PA1 5 Isolate Unclassified
917 641736151 Paraburkholderia graminis C4D1M Isolate Rhizoplane
918 641736154 Burkholderia ambifaria IOP40-10 Isolate Rhizosphere
919 642555112 Paraburkholderia phymatum STM815 Isolate Nodule
920 642555113 Paraburkholderia phytofirmans PsJN Isolate Unclassified
921 643348555 Gluconacetobacter diazotrophicus PA1 5 Isolate Unclassified
922 644736347 Cupriavidus taiwanensis LMG 19424 Isolate Nodule
923 8002392321 Alcaligenes faecalis Mc250 Isolate Rhizosphere
924 8003400568 Cupriavidus gilardii USM5 Isolate Rhizosphere
925 8003955200 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
926 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
927 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
928 8015687852 Pseudomonas chlororaphis aurantiaca RP4 Isolate Rhizosphere
929 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
930 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
931 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
932 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
933 8018845410 Burkholderia reimsis BE51 Isolate Rhizosphere
934 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
935 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
936 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
937 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
938 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
939 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
940 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
941 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
942 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
943 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
944 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
945 8019769354 Pseudomonas sp. MSSRFD41 Isolate Rhizosphere
946 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere
947 8020807995 Burkholderia sp. B10 Isolate Rhizosphere
948 8020938398 Burkholderia sp. BE12 Isolate Rhizosphere
949 8020945358 Burkholderia sp. BE17 Isolate Rhizosphere
950 8020953355 Burkholderia sp. BE24 Isolate Rhizosphere
951 8021120328 Burkholderia sp. LS-044 Isolate Rhizosphere
952 8029995093 Pseudomonas atacamensis SM1 Isolate Rhizosphere
953 8034962539 Pseudomonas sediminis PI11 Isolate Rhizosphere
954 8039098773 Burkholderia multivorans MSMB612WGS Isolate Unclassified
955 8040167225 Burkholderia vietnamiensis RS1 Isolate Unclassified
956 8040173305 Burkholderia vietnamiensis BE10 Isolate Rhizosphere
957 8052494512 Pseudomonas putida LD6 Isolate Unclassified
958 8054285046 Pseudomonas petroselini MAFF 311096 Isolate Nodule
959 8054347763 Pseudomonas carnis NWU Be30 Isolate Unclassified
960 8054503363 Pseudomonas sivasensis BsEB-1 Isolate Unclassified
961 8054929484 Pseudomonas vlassakiae RW4S1 Isolate Rhizosphere
962 8055266321 Paraburkholderia rhynchosiae LMG 27174 Isolate Nodule
963 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
964 8055770955 Pseudomonas chlororaphis qlu-1 Isolate Rhizosphere
965 8055817908 Pseudomonas pergaminensis 1008 Isolate Rhizosphere
966 8055878733 Pseudomonas palmensis BBB001 Isolate Rhizosphere
967 8056115690 Pseudomonas muyukensis COW39 Isolate Rhizosphere
968 8056120720 Pseudomonas maumuensis COW77 Isolate Rhizosphere
969 8056125926 Pseudomonas azerbaijanorientalis SWRI123 Isolate Rhizosphere
970 8056131705 Pseudomonas asgharzadehiana SWRI132 Isolate Rhizosphere
971 8056137416 Pseudomonas fakonensis COW40 Isolate Rhizosphere
972 8056148874 Pseudomonas khavaziana SWRI124 Isolate Rhizosphere
973 8056155041 Pseudomonas farris SWRI79 Isolate Rhizosphere
974 8056161164 Pseudomonas azadiae SWRI103 Isolate Rhizosphere
975 8056166840 Pseudomonas triticicola SWRI88 Isolate Rhizosphere
976 8056172158 Pseudomonas ekonensis COR58 Isolate Rhizosphere
977 8056177738 Pseudomonas azerbaijanoccidentalis SWRI74 Isolate Rhizosphere
978 8056569372 Pseudomonas serboccidentalis IT-P374 Isolate Rhizosphere
979 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
980 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
981 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule
982 8057798959 Pseudomonas piscis BW16M1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 73.56
Metatranscriptomes 0.26
Isolates 26.18

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.61
Nodule 10.23
Rhizoplane 4.38
Rhizosphere 57.75
Stem 0
Stem Tuber 0
Unclassified 0.11

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207678_10020313 3300026067 Bacteria 5828
2 MRS2a_Contig_116 2124908027 Bacteria 7334
3 MRS2a_Contig_6751 2124908027 Bacteria 9129
4 JGI24741J21665_1000205 3300001915 Bacteria 17562
5 JGI24740J21852_10000417 3300001979 Bacteria 18191
6 JGI24740J21852_10000439 3300001979 Bacteria 17770
7 JGI24740J21852_10000760 3300001979 Bacteria 14118
8 JGI24740J21852_10015327 3300001979 Bacteria 2802
9 JGI24739J22299_10002573 3300001989 Bacteria 6992
10 JGI24739J22299_10038511 3300001989 Bacteria 1606
11 JGI24737J22298_10002427 3300001990 Bacteria 6642
12 JGI24737J22298_10012337 3300001990 Bacteria 2786
13 JGI24737J22298_10034108 3300001990 Bacteria 1578
14 JGI24735J21928_10000196 3300002067 Bacteria 21296
15 JGI24735J21928_10001455 3300002067 Bacteria 8367
16 JGI24735J21928_10003047 3300002067 Bacteria 5746
17 JGI24735J21928_10004296 3300002067 Bacteria 4794
18 JGI25156J39149_1003155 3300002705 Bacteria 5548
19 JGI25156J39149_1003951 3300002705 Bacteria 4684
20 JGI25156J39149_1010327 3300002705 Bacteria 2201
21 JGI25162J39368_1000502 3300002737 Bacteria 29548
22 JGI25162J39368_1000626 3300002737 Bacteria 25132
23 JGI25162J39368_1000664 3300002737 Bacteria 24298
24 JGI25154J39366_1000133 3300002738 Bacteria 58381
25 JGI25163J39215_1001643 3300002771 Bacteria 3315
26 JGI25163J39215_1002276 3300002771 Bacteria 2096
27 JGI25164J39214_1000340 3300002772 Bacteria 29548
28 JGI25164J39214_1000400 3300002772 Bacteria 25132
29 JGI25150J39212_1005748 3300002774 Bacteria 2620
30 JGI25151J46595_10004227 3300003187 Bacteria 7640
31 JGI25151J46595_10029166 3300003187 Bacteria 2188
32 JGI25165J46597_1000391 3300003214 Bacteria 46730
33 JGI25165J46597_1000745 3300003214 Bacteria 25132
34 JGI25165J46597_1000776 3300003214 Bacteria 24298
35 rootH1_10062200 3300003316 Bacteria 7503
36 JGI25160J50197_1000447 3300003354 Bacteria 25781
37 JGI25160J50197_1007409 3300003354 Bacteria 4299
38 Ga0006562J51391_1006335 3300003578 Bacteria 5950
39 Ga0055538_1000007 3300003751 Bacteria 399715
40 Ga0055538_1000024 3300003751 Bacteria 241526
41 Ga0055538_1000305 3300003751 Bacteria 24298
42 Ga0055539_1000011 3300003752 Bacteria 399747
43 Ga0055539_1000031 3300003752 Bacteria 241526
44 Ga0055539_1000073 3300003752 Bacteria 131094
45 Ga0055539_1000324 3300003752 Bacteria 24298
46 Ga0055533_1000014 3300003756 Bacteria 399747
47 Ga0055533_1000041 3300003756 Bacteria 241526
48 Ga0055533_1000305 3300003756 Bacteria 24298
49 Ga0055533_1002148 3300003756 Bacteria 4713
50 Ga0055533_1002294 3300003756 Bacteria 4437
51 Ga0055532_1000009 3300003758 Bacteria 399537
52 Ga0055532_1000090 3300003758 Bacteria 104391
53 Ga0055525_1000016 3300003759 Bacteria 399724
54 Ga0055525_1000049 3300003759 Bacteria 241526
55 Ga0055525_1000439 3300003759 Bacteria 24298
56 Ga0055525_1000938 3300003759 Bacteria 8145
57 Ga0055527_1000900 3300003760 Bacteria 7539
58 Ga0055535_1000085 3300003761 Bacteria 104391
59 Ga0055529_1000134 3300003763 Bacteria 104391
60 Ga0055526_1008653 3300003771 Bacteria 5030
61 Ga0055526_1009460 3300003771 Bacteria 4681
62 Ga0055526_1012176 3300003771 Bacteria 3780
63 Ga0055524_1000413 3300003775 Bacteria 36091
64 Ga0055536_1000059 3300003781 Bacteria 103307
65 Ga0055536_1000061 3300003781 Bacteria 100255
66 Ga0055536_1000154 3300003781 Bacteria 59301
67 Ga0055536_1002544 3300003781 Bacteria 10201
68 Ga0055536_1002620 3300003781 Bacteria 10017
69 Ga0055534_1001757 3300003784 Bacteria 8168
70 Ga0055534_1002165 3300003784 Bacteria 7015
71 Ga0055534_1006164 3300003784 Bacteria 3072
72 Ga0055528_1001944 3300003790 Bacteria 11700
73 Ga0055530_10000096 3300003791 Bacteria 73950
74 Ga0055530_10000171 3300003791 Bacteria 59301
75 Ga0055530_10000874 3300003791 Bacteria 24782
76 Ga0055530_10002302 3300003791 Bacteria 12482
77 Ga0055540_1000084 3300003792 Bacteria 107482
78 Ga0055540_1000214 3300003792 Bacteria 54779
79 Ga0055540_1000648 3300003792 Bacteria 24458
80 Ga0055540_1001741 3300003792 Bacteria 12482
81 Ga0055531_10000266 3300003794 Bacteria 54559
82 Ga0055541_1000008 3300003841 Bacteria 399724
83 Ga0055541_1000022 3300003841 Bacteria 241526
84 Ga0055541_1000213 3300003841 Bacteria 24298
85 Ga0055541_1000346 3300003841 Bacteria 14455
86 Ga0055541_1006842 3300003841 Bacteria 1909
87 Ga0058692_1000014 3300003856 Bacteria 313984
88 Ga0055543_1004552 3300004625 Bacteria 3743
89 Ga0065165_1000244 3300005262 Bacteria 93411
90 Ga0065165_1000368 3300005262 Bacteria 73904
91 Ga0065165_1001437 3300005262 Bacteria 25810
92 Ga0065714_10000085 3300005288 Bacteria 12095
93 Ga0065714_10005412 3300005288 Bacteria 5969
94 Ga0065714_10006886 3300005288 Bacteria 3836
95 Ga0065704_10018874 3300005289 Bacteria 1682
96 Ga0065704_10084484 3300005289 Bacteria 3318
97 Ga0065704_10091819 3300005289 Bacteria 2692
98 Ga0065704_10150193 3300005289 Bacteria 1436
99 Ga0070658_10017560 3300005327 Bacteria 5724
100 Ga0070658_10018393 3300005327 Bacteria 5593
101 Ga0070658_10092389 3300005327 Bacteria 2495
102 Ga0070658_10143166 3300005327 Bacteria 1998
103 Ga0070683_100138178 3300005329 Bacteria 2308
104 Ga0070670_100005474 3300005331 Bacteria 10713
105 Ga0070670_100145170 3300005331 Bacteria 2053
106 Ga0070666_10012949 3300005335 Bacteria 5278
107 Ga0070680_100019559 3300005336 Bacteria 5368
108 Ga0070660_100001445 3300005339 Bacteria 16232
109 Ga0070660_100001741 3300005339 Bacteria 14919
110 Ga0070660_100019883 3300005339 Bacteria 4926
111 Ga0070691_10027029 3300005341 Bacteria 2676
112 Ga0070661_100000683 3300005344 Bacteria 24923
113 Ga0070661_100000829 3300005344 Bacteria 22251
114 Ga0070668_100036478 3300005347 Bacteria 3752
115 Ga0070668_100055824 3300005347 Bacteria 3049
116 Ga0070669_100001270 3300005353 Bacteria 18313
117 Ga0070669_100006569 3300005353 Bacteria 8369
118 Ga0070669_100018381 3300005353 Bacteria 4996
119 Ga0070675_100139551 3300005354 Bacteria 2071
120 Ga0070659_100000035 3300005366 Bacteria 115022
121 Ga0070659_100001478 3300005366 Bacteria 16932
122 Ga0070667_100002744 3300005367 Bacteria 15234
123 Ga0070667_100019966 3300005367 Bacteria 5561
124 Ga0070667_100022517 3300005367 Bacteria 5224
125 Ga0070709_10000407 3300005434 Bacteria 26293
126 Ga0070709_10027331 3300005434 Bacteria 3391
127 Ga0070714_100185287 3300005435 Bacteria 1896
128 Ga0070714_100235201 3300005435 Bacteria 1689
129 Ga0070713_100047323 3300005436 Bacteria 3534
130 Ga0070713_100053812 3300005436 Bacteria 3337
131 Ga0070710_10006310 3300005437 Bacteria 5685
132 Ga0070710_10035406 3300005437 Bacteria 2722
133 Ga0070711_100006265 3300005439 Bacteria 7167
134 Ga0070663_100000251 3300005455 Bacteria 27107
135 Ga0070663_100003477 3300005455 Bacteria 9080
136 Ga0070663_100045511 3300005455 Bacteria 3100
137 Ga0070663_100160335 3300005455 Bacteria 1731
138 Ga0070678_100005891 3300005456 Bacteria 7131
139 Ga0070662_100116271 3300005457 Bacteria 2044
140 Ga0068867_100074043 3300005459 Bacteria 2551
141 Ga0070706_100074209 3300005467 Bacteria 3149
142 Ga0070698_100122056 3300005471 Bacteria 2564
143 Ga0070684_100048880 3300005535 Bacteria 3670
144 Ga0070697_100154854 3300005536 Bacteria 1934
145 Ga0068853_100034377 3300005539 Bacteria 4302
146 Ga0068853_100069502 3300005539 Bacteria 3064
147 Ga0070665_100007326 3300005548 Bacteria 11223
148 Ga0070665_100021701 3300005548 Bacteria 6457
149 Ga0068855_100000366 3300005563 Bacteria 55965
150 Ga0068855_100004438 3300005563 Bacteria 17140
151 Ga0068855_100024563 3300005563 Bacteria 7209
152 Ga0068855_100145412 3300005563 Bacteria 2699
153 Ga0068855_100159275 3300005563 Bacteria 2563
154 Ga0070664_100000623 3300005564 Bacteria 27102
155 Ga0070664_100000878 3300005564 Bacteria 23328
156 Ga0068857_100013415 3300005577 Bacteria 7138
157 Ga0068857_100024577 3300005577 Bacteria 5305
158 Ga0068857_100085485 3300005577 Bacteria 2819
159 Ga0068857_100101512 3300005577 Bacteria 2582
160 Ga0068857_100209200 3300005577 Bacteria 1780
161 Ga0068854_100000308 3300005578 Bacteria 32248
162 Ga0068854_100093960 3300005578 Bacteria 2236
163 Ga0068856_100001206 3300005614 Bacteria 27139
164 Ga0068856_100021342 3300005614 Bacteria 6294
165 Ga0068856_100069364 3300005614 Bacteria 3486
166 Ga0068856_100160460 3300005614 Bacteria 2259
167 Ga0068852_100017907 3300005616 Bacteria 5569
168 Ga0068852_100021423 3300005616 Bacteria 5160
169 Ga0068852_100054812 3300005616 Bacteria 3438
170 Ga0068859_100080918 3300005617 Bacteria 3290
171 Ga0068859_100334951 3300005617 Bacteria 1607
172 Ga0068851_10000316 3300005834 Bacteria 21838
173 Ga0068851_10019934 3300005834 Bacteria 3243
174 Ga0068863_100083044 3300005841 Bacteria 3035
175 Ga0068858_100240812 3300005842 Bacteria 1717
176 Ga0068860_100019238 3300005843 Bacteria 6629
177 Ga0081455_10010447 3300005937 Bacteria 9420
178 Ga0081455_10010813 3300005937 Bacteria 9222
179 Ga0081540_1003649 3300005983 Bacteria 12076
180 Ga0081540_1006563 3300005983 Bacteria 8443
181 Ga0081540_1032672 3300005983 Bacteria 2838
182 Ga0081540_1038988 3300005983 Bacteria 2496
183 Ga0081540_1055583 3300005983 Bacteria 1927
184 Ga0075365_10017044 3300006038 Bacteria 4435
185 Ga0075365_10033426 3300006038 Bacteria 3314
186 Ga0075368_10002670 3300006042 Bacteria 5866
187 Ga0075368_10032589 3300006042 Bacteria 2025
188 Ga0075363_100017395 3300006048 Bacteria 3565
189 Ga0075364_10041753 3300006051 Bacteria 2979
190 Ga0075364_10060885 3300006051 Bacteria 2475
191 Ga0075364_10132837 3300006051 Bacteria 1671
192 Ga0070715_10061041 3300006163 Bacteria 1655
193 Ga0070716_100007807 3300006173 Bacteria 5287
194 Ga0070716_100036500 3300006173 Bacteria 2710
195 Ga0070716_100043300 3300006173 Bacteria 2516
196 Ga0075362_10009652 3300006177 Bacteria 3741
197 Ga0075367_10039150 3300006178 Bacteria 2763
198 Ga0075367_10059488 3300006178 Bacteria 2275
199 Ga0075369_10039897 3300006186 Bacteria 2006
200 Ga0075366_10004392 3300006195 Bacteria 7565
201 Ga0075366_10012373 3300006195 Bacteria 4840
202 Ga0097621_100104136 3300006237 Bacteria 2391
203 Ga0075370_10008865 3300006353 Bacteria 5193
204 Ga0075370_10041818 3300006353 Bacteria 2588
205 Ga0068871_100070465 3300006358 Bacteria 2874
206 Ga0075430_100009079 3300006846 Bacteria 8400
207 Ga0075429_100011122 3300006880 Bacteria 7790
208 Ga0097620_100080913 3300006931 Bacteria 3290
209 Ga0097620_100334939 3300006931 Bacteria 1607
210 Ga0099824_1011829 3300006942 Bacteria 9727
211 Ga0099822_1005398 3300006943 Bacteria 16681
212 Ga0099823_1000091 3300006944 Bacteria 43725
213 Ga0079104_1000008 3300006946 Bacteria 371223
214 Ga0079104_1000707 3300006946 Bacteria 30262
215 Ga0079104_1003900 3300006946 Bacteria 6665
216 Ga0099826_10000022 3300006948 Bacteria 159004
217 Ga0099826_10013588 3300006948 Bacteria 6153
218 Ga0075435_100196129 3300007076 Bacteria 1710
219 Ga0105251_10000016 3300009011 Bacteria 146400
220 Ga0105251_10000756 3300009011 Bacteria 29516
221 Ga0105251_10001655 3300009011 Bacteria 18854
222 Ga0105251_10001720 3300009011 Bacteria 18316
223 Ga0105251_10007644 3300009011 Bacteria 6617
224 Ga0105251_10014969 3300009011 Bacteria 4258
225 Ga0105251_10031596 3300009011 Bacteria 2647
226 Ga0105251_10037622 3300009011 Bacteria 2373
227 Ga0105251_10055820 3300009011 Bacteria 1872
228 Ga0105251_10072451 3300009011 Bacteria 1602
229 Ga0105244_10000445 3300009036 Bacteria 37731
230 Ga0105244_10000722 3300009036 Bacteria 28538
231 Ga0105244_10000848 3300009036 Bacteria 25829
232 Ga0105244_10004788 3300009036 Bacteria 9198
233 Ga0105244_10005113 3300009036 Bacteria 8805
234 Ga0105244_10005282 3300009036 Bacteria 8615
235 Ga0105244_10007991 3300009036 Bacteria 6657
236 Ga0105244_10010257 3300009036 Bacteria 5689
237 Ga0105244_10022095 3300009036 Bacteria 3507
238 Ga0105244_10023508 3300009036 Bacteria 3378
239 Ga0105244_10032773 3300009036 Bacteria 2746
240 Ga0105244_10032791 3300009036 Bacteria 2745
241 Ga0105244_10050878 3300009036 Bacteria 2113
242 Ga0105250_10000327 3300009092 Bacteria 36659
243 Ga0105250_10000871 3300009092 Bacteria 17836
244 Ga0105250_10003137 3300009092 Bacteria 7941
245 Ga0105250_10004372 3300009092 Bacteria 6508
246 Ga0105250_10008745 3300009092 Bacteria 4286
247 Ga0105250_10051581 3300009092 Bacteria 1650
248 Ga0105250_10052821 3300009092 Bacteria 1631
249 Ga0105250_10068048 3300009092 Bacteria 1437
250 Ga0105240_10001168 3300009093 Bacteria 46052
251 Ga0105240_10007353 3300009093 Bacteria 16022
252 Ga0105240_10013962 3300009093 Bacteria 10996
253 Ga0105240_10019503 3300009093 Bacteria 9059
254 Ga0105240_10096984 3300009093 Bacteria 3592
255 Ga0105240_10146644 3300009093 Bacteria 2815
256 Ga0105240_10159931 3300009093 Bacteria 2676
257 Ga0105240_10276454 3300009093 Bacteria 1931
258 Ga0105245_10035213 3300009098 Bacteria 4443
259 Ga0105245_10122928 3300009098 Bacteria 2426
260 Ga0105247_10000727 3300009101 Bacteria 25628
261 Ga0105243_10000115 3300009148 Bacteria 92572
262 Ga0105243_10000163 3300009148 Bacteria 75904
263 Ga0105243_10001544 3300009148 Bacteria 20122
264 Ga0105243_10001757 3300009148 Bacteria 18663
265 Ga0105243_10001924 3300009148 Bacteria 17707
266 Ga0105243_10002556 3300009148 Bacteria 15207
267 Ga0105243_10025527 3300009148 Bacteria 4517
268 Ga0105243_10025925 3300009148 Bacteria 4485
269 Ga0105241_10006488 3300009174 Bacteria 8625
270 Ga0105241_10123341 3300009174 Bacteria 2089
271 Ga0105237_10000093 3300009545 Bacteria 122006
272 Ga0105237_10003198 3300009545 Bacteria 19646
273 Ga0105237_10006810 3300009545 Bacteria 12601
274 Ga0105237_10022053 3300009545 Bacteria 6537
275 Ga0105237_10025336 3300009545 Bacteria 6066
276 Ga0105237_10048393 3300009545 Bacteria 4273
277 Ga0105237_10104263 3300009545 Bacteria 2827
278 Ga0105237_10125223 3300009545 Bacteria 2564
279 Ga0105238_10000031 3300009551 Bacteria 179497
280 Ga0105238_10040672 3300009551 Bacteria 4710
281 Ga0105238_10053968 3300009551 Bacteria 4038
282 Ga0105238_10085629 3300009551 Bacteria 3139
283 Ga0105238_10123118 3300009551 Bacteria 2573
284 Ga0105238_10126943 3300009551 Bacteria 2529
285 Ga0105249_10022548 3300009553 Bacteria 5641
286 Ga0099796_10020287 3300010159 Bacteria 2029
287 Ga0105239_10001806 3300010375 Bacteria 28120
288 Ga0105239_10002893 3300010375 Bacteria 21450
289 Ga0105239_10024933 3300010375 Bacteria 6588
290 Ga0105239_10034894 3300010375 Bacteria 5525
291 Ga0105239_10042348 3300010375 Bacteria 4991
292 Ga0105239_10079968 3300010375 Bacteria 3597
293 Ga0105246_10001153 3300011119 Bacteria 15334
294 Ga0105246_10001933 3300011119 Bacteria 12503
295 Ga0105246_10029137 3300011119 Bacteria 3633
296 Ga0105246_10177467 3300011119 Bacteria 1637
297 Ga0157345_1000154 3300012498 Bacteria 11456
298 Ga0157345_1002204 3300012498 Bacteria 1368
299 Ga0157373_10005588 3300013100 Bacteria 9427
300 Ga0157373_10005943 3300013100 Bacteria 9129
301 Ga0157373_10006624 3300013100 Bacteria 8637
302 Ga0157373_10016497 3300013100 Bacteria 5386
303 Ga0157373_10021291 3300013100 Bacteria 4708
304 Ga0157373_10109989 3300013100 Bacteria 1937
305 Ga0157373_10112505 3300013100 Bacteria 1914
306 Ga0157371_10001237 3300013102 Bacteria 27113
307 Ga0157371_10009792 3300013102 Bacteria 7516
308 Ga0157371_10016290 3300013102 Bacteria 5552
309 Ga0157371_10023424 3300013102 Bacteria 4515
310 Ga0157371_10172865 3300013102 Bacteria 1544
311 Ga0157370_10000930 3300013104 Bacteria 37091
312 Ga0157370_10003240 3300013104 Bacteria 19205
313 Ga0157370_10019712 3300013104 Bacteria 6753
314 Ga0157370_10022770 3300013104 Bacteria 6232
315 Ga0157369_10000067 3300013105 Bacteria 144506
316 Ga0157369_10000622 3300013105 Bacteria 46108
317 Ga0157369_10004182 3300013105 Bacteria 17103
318 Ga0157369_10013986 3300013105 Bacteria 9069
319 Ga0157369_10030355 3300013105 Bacteria 5962
320 Ga0157369_10034300 3300013105 Bacteria 5571
321 Ga0157369_10056554 3300013105 Bacteria 4233
322 Ga0157369_10057580 3300013105 Bacteria 4193
323 Ga0157369_10065958 3300013105 Bacteria 3895
324 Ga0157369_10166955 3300013105 Bacteria 2321
325 Ga0157374_10000219 3300013296 Bacteria 52748
326 Ga0163162_10001053 3300013306 Bacteria 25634
327 Ga0163162_10001780 3300013306 Bacteria 20197
328 Ga0163162_10060633 3300013306 Bacteria 3819
329 Ga0157372_10001285 3300013307 Bacteria 27113
330 Ga0157372_10002581 3300013307 Bacteria 19627
331 Ga0157372_10011859 3300013307 Bacteria 9283
332 Ga0157372_10033148 3300013307 Bacteria 5671
333 Ga0157372_10054493 3300013307 Bacteria 4461
334 Ga0157375_10008932 3300013308 Bacteria 8769
335 Ga0157375_10333976 3300013308 Bacteria 1681
336 Ga0182008_10005238 3300014497 Bacteria 7425
337 Ga0182008_10006760 3300014497 Bacteria 6381
338 Ga0182008_10013195 3300014497 Bacteria 4344
339 Ga0182008_10017485 3300014497 Bacteria 3720
340 Ga0157376_10046771 3300014969 Bacteria 3570
341 Ga0182006_1001712 3300015261 Bacteria 12774
342 Ga0182006_1007656 3300015261 Bacteria 4935
343 Ga0182006_1009278 3300015261 Bacteria 4416
344 Ga0182006_1011378 3300015261 Bacteria 3917
345 Ga0182006_1012197 3300015261 Bacteria 3763
346 Ga0182006_1013028 3300015261 Bacteria 3622
347 Ga0182006_1016766 3300015261 Bacteria 3122
348 Ga0182006_1018078 3300015261 Bacteria 2984
349 Ga0182006_1018576 3300015261 Bacteria 2935
350 Ga0182006_1040422 3300015261 Bacteria 1836
351 Ga0182006_1041211 3300015261 Bacteria 1814
352 Ga0182007_10001412 3300015262 Bacteria 12924
353 Ga0182007_10019156 3300015262 Bacteria 2465
354 Ga0182005_1000500 3300015265 Bacteria 20026
355 Ga0182005_1004949 3300015265 Bacteria 4223
356 Ga0182005_1014535 3300015265 Bacteria 2202
357 Ga0182005_1021236 3300015265 Bacteria 1782
358 Ga0183362_10003 3300015683 Bacteria 977584
359 Ga0183361_10012 3300016635 Bacteria 203395
360 Ga0163161_10006169 3300017792 Bacteria 8303
361 Ga0163161_10047143 3300017792 Bacteria 3112
362 Ga0163161_10051253 3300017792 Bacteria 2989
363 Ga0163161_10210036 3300017792 Bacteria 1503
364 Ga0206351_10815903 3300020077 Bacteria 5002
365 Ga0154015_1153479 3300020610 Bacteria 7739
366 Ga0214542_1010499 3300021321 Bacteria 13472
367 Ga0214543_1000005 3300021327 Bacteria 454523
368 Ga0213875_10024758 3300021388 Bacteria 2862
369 Ga0224712_10000086 3300022467 Bacteria 14399
370 Ga0209435_100305 3300025206 Bacteria 11896
371 Ga0209760_100009 3300025207 Bacteria 207878
372 Ga0209760_100157 3300025207 Bacteria 40911
373 Ga0209760_100772 3300025207 Bacteria 4545
374 Ga0209784_100006 3300025224 Bacteria 930704
375 Ga0209784_100018 3300025224 Bacteria 456816
376 Ga0209784_100023 3300025224 Bacteria 399841
377 Ga0209784_100323 3300025224 Bacteria 24350
378 Ga0209784_100428 3300025224 Bacteria 18349
379 Ga0209566_100002 3300025225 Bacteria 2614868
380 Ga0209566_100016 3300025225 Bacteria 456824
381 Ga0209566_100019 3300025225 Bacteria 414836
382 Ga0209566_100555 3300025225 Bacteria 25068
383 Ga0209566_100562 3300025225 Bacteria 24350
384 Ga0209566_100572 3300025225 Bacteria 23824
385 Ga0209674_100010 3300025226 Bacteria 1038638
386 Ga0209674_100030 3300025226 Bacteria 456824
387 Ga0209674_100034 3300025226 Bacteria 414903
388 Ga0209674_100355 3300025226 Bacteria 25986
389 Ga0209674_100374 3300025226 Bacteria 24350
390 Ga0209674_101472 3300025226 Bacteria 6151
391 Ga0209674_103235 3300025226 Bacteria 3069
392 Ga0209672_100028 3300025228 Bacteria 341962
393 Ga0209672_100038 3300025228 Bacteria 286731
394 Ga0209672_100110 3300025228 Bacteria 95441
395 Ga0209672_100175 3300025228 Bacteria 53342
396 Ga0209672_100806 3300025228 Bacteria 14786
397 Ga0209147_100018 3300025229 Bacteria 515719
398 Ga0209147_100027 3300025229 Bacteria 414610
399 Ga0209147_100235 3300025229 Bacteria 54699
400 Ga0209147_100277 3300025229 Bacteria 44758
401 Ga0209147_100294 3300025229 Bacteria 42223
402 Ga0209563_100034 3300025230 Bacteria 456824
403 Ga0209563_100037 3300025230 Bacteria 414903
404 Ga0209563_100041 3300025230 Bacteria 407467
405 Ga0209563_100258 3300025230 Bacteria 24350
406 Ga0209563_101545 3300025230 Bacteria 6001
407 Ga0207427_100016 3300025231 Bacteria 538697
408 Ga0207427_100092 3300025231 Bacteria 128454
409 Ga0207427_101010 3300025231 Bacteria 11767
410 Ga0209437_100011 3300025233 Bacteria 818520
411 Ga0209437_100065 3300025233 Bacteria 332417
412 Ga0209437_100565 3300025233 Bacteria 24350
413 Ga0209437_109964 3300025233 Bacteria 1466
414 Ga0209258_100028 3300025242 Bacteria 515719
415 Ga0209258_100191 3300025242 Bacteria 125980
416 Ga0209258_100268 3300025242 Bacteria 89701
417 Ga0209258_100289 3300025242 Bacteria 82650
418 Ga0207425_1002758 3300025245 Bacteria 5972
419 Ga0209646_1000120 3300025246 Bacteria 146035
420 Ga0209646_1000153 3300025246 Bacteria 96707
421 Ga0209646_1002598 3300025246 Bacteria 3899
422 Ga0209026_1010400 3300025250 Bacteria 1736
423 Ga0209677_100007 3300025253 Bacteria 1021332
424 Ga0209677_100019 3300025253 Bacteria 456824
425 Ga0209677_100021 3300025253 Bacteria 414954
426 Ga0209677_100438 3300025253 Bacteria 24350
427 Ga0209148_1000081 3300025254 Bacteria 273676
428 Ga0209148_1000224 3300025254 Bacteria 92967
429 Ga0209148_1000297 3300025254 Bacteria 72735
430 Ga0209148_1003390 3300025254 Bacteria 4446
431 Ga0209759_1000406 3300025256 Bacteria 53034
432 Ga0209759_1001683 3300025256 Bacteria 11529
433 Ga0209759_1011208 3300025256 Bacteria 2566
434 Ga0209233_1000019 3300025261 Bacteria 818520
435 Ga0209233_1000085 3300025261 Bacteria 333078
436 Ga0209233_1000483 3300025261 Bacteria 24350
437 Ga0209233_1013553 3300025261 Bacteria 2326
438 Ga0209565_1000257 3300025263 Bacteria 56512
439 Ga0209565_1000987 3300025263 Bacteria 14624
440 Ga0209455_1000050 3300025272 Bacteria 373239
441 Ga0209455_1000107 3300025272 Bacteria 195136
442 Ga0209455_1000879 3300025272 Bacteria 15861
443 Ga0209673_1000038 3300025273 Bacteria 312957
444 Ga0209675_1000302 3300025291 Bacteria 44768
445 Ga0209675_1000645 3300025291 Bacteria 24769
446 Ga0209675_1003576 3300025291 Bacteria 7313
447 Ga0209675_1007019 3300025291 Bacteria 4396
448 Ga0209675_1009151 3300025291 Bacteria 3529
449 Ga0209676_1000076 3300025292 Bacteria 301393
450 Ga0209676_1000147 3300025292 Bacteria 172386
451 Ga0209676_1000183 3300025292 Bacteria 145352
452 Ga0209676_1000264 3300025292 Bacteria 110593
453 Ga0209676_1000313 3300025292 Bacteria 94925
454 Ga0209676_1001123 3300025292 Bacteria 29456
455 Ga0209676_1001708 3300025292 Bacteria 18966
456 Ga0209676_1010886 3300025292 Bacteria 3732
457 Ga0209676_1020041 3300025292 Bacteria 2283
458 Ga0209025_1000229 3300025294 Bacteria 131241
459 Ga0209025_1000256 3300025294 Bacteria 125758
460 Ga0209025_1000508 3300025294 Bacteria 74740
461 Ga0209025_1000610 3300025294 Bacteria 64118
462 Ga0209025_1001636 3300025294 Bacteria 27739
463 Ga0209025_1004445 3300025294 Bacteria 12176
464 Ga0209564_1000310 3300025295 Bacteria 95920
465 Ga0209564_1001587 3300025295 Bacteria 22207
466 Ga0209564_1002607 3300025295 Bacteria 13790
467 Ga0209564_1003460 3300025295 Bacteria 10764
468 Ga0209564_1004695 3300025295 Bacteria 8195
469 Ga0209564_1011300 3300025295 Bacteria 4013
470 Ga0209758_1000423 3300025297 Bacteria 71797
471 Ga0209758_1003740 3300025297 Bacteria 13475
472 Ga0209758_1006087 3300025297 Bacteria 8874
473 Ga0209758_1008604 3300025297 Bacteria 6561
474 Ga0209758_1025788 3300025297 Bacteria 2567
475 Ga0209050_1000062 3300025298 Bacteria 316538
476 Ga0209050_1000063 3300025298 Bacteria 314955
477 Ga0209050_1000106 3300025298 Bacteria 224396
478 Ga0209050_1000701 3300025298 Bacteria 49786
479 Ga0209050_1002668 3300025298 Bacteria 14580
480 Ga0209256_1000248 3300025299 Bacteria 95920
481 Ga0209256_1000300 3300025299 Bacteria 86738
482 Ga0207426_1000037 3300025302 Bacteria 442735
483 Ga0207426_1000289 3300025302 Bacteria 99963
484 Ga0207426_1000312 3300025302 Bacteria 95006
485 Ga0207426_1004510 3300025302 Bacteria 6744
486 Ga0207426_1007390 3300025302 Bacteria 4607
487 Ga0209051_1000045 3300025303 Bacteria 297882
488 Ga0209051_1000139 3300025303 Bacteria 136281
489 Ga0209051_1000409 3300025303 Bacteria 59325
490 Ga0209051_1000499 3300025303 Bacteria 49786
491 Ga0209051_1006094 3300025303 Bacteria 6867
492 Ga0209257_1000539 3300025304 Bacteria 64964
493 Ga0209257_1009014 3300025304 Bacteria 5474
494 Ga0209257_1016143 3300025304 Bacteria 3045
495 Ga0207656_10003183 3300025321 Bacteria 5612
496 Ga0207696_1000023 3300025711 Bacteria 422195
497 Ga0207696_1000047 3300025711 Bacteria 285005
498 Ga0207696_1000091 3300025711 Bacteria 187999
499 Ga0207696_1002016 3300025711 Bacteria 10278
500 Ga0207696_1002515 3300025711 Bacteria 8949
501 Ga0207696_1013608 3300025711 Bacteria 2825
502 Ga0207696_1015388 3300025711 Bacteria 2596
503 Ga0207655_1000015 3300025728 Bacteria 600662
504 Ga0207655_1000118 3300025728 Bacteria 159617
505 Ga0207655_1000302 3300025728 Bacteria 74492
506 Ga0207655_1000327 3300025728 Bacteria 70037
507 Ga0207655_1000339 3300025728 Bacteria 68128
508 Ga0207655_1000658 3300025728 Bacteria 41061
509 Ga0207655_1001444 3300025728 Bacteria 22008
510 Ga0207655_1003450 3300025728 Bacteria 11757
511 Ga0207655_1003542 3300025728 Bacteria 11564
512 Ga0207655_1005682 3300025728 Bacteria 8433
513 Ga0207655_1009464 3300025728 Bacteria 6041
514 Ga0207655_1010065 3300025728 Bacteria 5784
515 Ga0207655_1014108 3300025728 Bacteria 4537
516 Ga0207655_1014236 3300025728 Bacteria 4509
517 Ga0207655_1016444 3300025728 Bacteria 4045
518 Ga0207655_1018839 3300025728 Bacteria 3639
519 Ga0207655_1021378 3300025728 Bacteria 3285
520 Ga0207655_1023774 3300025728 Bacteria 3026
521 Ga0207713_1000041 3300025735 Bacteria 244768
522 Ga0207713_1000060 3300025735 Bacteria 213145
523 Ga0207713_1000348 3300025735 Bacteria 50677
524 Ga0207713_1001043 3300025735 Bacteria 24019
525 Ga0207713_1001161 3300025735 Bacteria 22265
526 Ga0207713_1001267 3300025735 Bacteria 20840
527 Ga0207713_1002181 3300025735 Bacteria 14511
528 Ga0207713_1004039 3300025735 Bacteria 9692
529 Ga0207713_1008860 3300025735 Bacteria 5734
530 Ga0207713_1014647 3300025735 Bacteria 4062
531 Ga0207713_1041877 3300025735 Bacteria 1906
532 Ga0207713_1041888 3300025735 Bacteria 1906
533 Ga0207692_10004858 3300025898 Bacteria 5352
534 Ga0207692_10058195 3300025898 Bacteria 1990
535 Ga0207710_10000122 3300025900 Bacteria 94509
536 Ga0207710_10070892 3300025900 Bacteria 1598
537 Ga0207688_10050778 3300025901 Bacteria 2323
538 Ga0207647_10003182 3300025904 Bacteria 12326
539 Ga0207647_10005156 3300025904 Bacteria 9612
540 Ga0207647_10008176 3300025904 Bacteria 7517
541 Ga0207647_10009659 3300025904 Bacteria 6850
542 Ga0207699_10000826 3300025906 Bacteria 14743
543 Ga0207699_10064608 3300025906 Bacteria 2215
544 Ga0207699_10071546 3300025906 Bacteria 2121
545 Ga0207705_10000771 3300025909 Bacteria 26342
546 Ga0207705_10135394 3300025909 Bacteria 1836
547 Ga0207684_10071066 3300025910 Bacteria 2958
548 Ga0207684_10074537 3300025910 Bacteria 2883
549 Ga0207654_10010475 3300025911 Bacteria 4722
550 Ga0207654_10087703 3300025911 Bacteria 1889
551 Ga0207707_10032404 3300025912 Bacteria 4573
552 Ga0207695_10000240 3300025913 Bacteria 143196
553 Ga0207695_10008368 3300025913 Bacteria 12959
554 Ga0207695_10021034 3300025913 Bacteria 7453
555 Ga0207695_10049593 3300025913 Bacteria 4424
556 Ga0207695_10097448 3300025913 Bacteria 2942
557 Ga0207671_10000604 3300025914 Bacteria 47638
558 Ga0207671_10007182 3300025914 Bacteria 9707
559 Ga0207671_10008177 3300025914 Bacteria 8918
560 Ga0207671_10023233 3300025914 Bacteria 4677
561 Ga0207671_10112512 3300025914 Bacteria 2073
562 Ga0207671_10119778 3300025914 Bacteria 2011
563 Ga0207693_10006908 3300025915 Bacteria 9374
564 Ga0207693_10074546 3300025915 Bacteria 2658
565 Ga0207663_10030874 3300025916 Bacteria 3164
566 Ga0207663_10111723 3300025916 Bacteria 1855
567 Ga0207657_10000595 3300025919 Bacteria 38324
568 Ga0207657_10003541 3300025919 Bacteria 16685
569 Ga0207657_10030614 3300025919 Bacteria 4883
570 Ga0207657_10082545 3300025919 Bacteria 2697
571 Ga0207649_10000639 3300025920 Bacteria 23386
572 Ga0207649_10000668 3300025920 Bacteria 22913
573 Ga0207681_10006411 3300025923 Bacteria 7225
574 Ga0207681_10014158 3300025923 Bacteria 4949
575 Ga0207694_10000236 3300025924 Bacteria 52960
576 Ga0207694_10056478 3300025924 Bacteria 3049
577 Ga0207694_10083220 3300025924 Bacteria 2516
578 Ga0207694_10099663 3300025924 Bacteria 2301
579 Ga0207650_10000248 3300025925 Bacteria 58658
580 Ga0207650_10001140 3300025925 Bacteria 19511
581 Ga0207650_10001620 3300025925 Bacteria 16061
582 Ga0207650_10259834 3300025925 Bacteria 1408
583 Ga0207687_10034082 3300025927 Bacteria 3456
584 Ga0207700_10057984 3300025928 Bacteria 2923
585 Ga0207700_10132142 3300025928 Bacteria 2040
586 Ga0207700_10165808 3300025928 Bacteria 1838
587 Ga0207664_10117055 3300025929 Bacteria 2224
588 Ga0207664_10149876 3300025929 Bacteria 1980
589 Ga0207690_10000034 3300025932 Bacteria 149574
590 Ga0207690_10001619 3300025932 Bacteria 14018
591 Ga0207690_10071507 3300025932 Bacteria 2393
592 Ga0207706_10002708 3300025933 Bacteria 17260
593 Ga0207706_10006523 3300025933 Bacteria 10817
594 Ga0207706_10014066 3300025933 Bacteria 7256
595 Ga0207706_10074628 3300025933 Bacteria 2982
596 Ga0207709_10000001 3300025935 Bacteria 2228154
597 Ga0207709_10000030 3300025935 Bacteria 331710
598 Ga0207709_10000070 3300025935 Bacteria 183020
599 Ga0207709_10000127 3300025935 Bacteria 112650
600 Ga0207709_10000610 3300025935 Bacteria 29558
601 Ga0207709_10004847 3300025935 Bacteria 7706
602 Ga0207709_10005912 3300025935 Bacteria 6903
603 Ga0207709_10024205 3300025935 Bacteria 3465
604 Ga0207709_10068348 3300025935 Bacteria 2245
605 Ga0207665_10001950 3300025939 Bacteria 13887
606 Ga0207665_10012034 3300025939 Bacteria 5679
607 Ga0207661_10012230 3300025944 Bacteria 6234
608 Ga0207679_10000021 3300025945 Bacteria 221630
609 Ga0207679_10000349 3300025945 Bacteria 33664
610 Ga0207667_10000044 3300025949 Bacteria 248251
611 Ga0207667_10000347 3300025949 Bacteria 63149
612 Ga0207667_10007034 3300025949 Bacteria 13594
613 Ga0207667_10024451 3300025949 Bacteria 6632
614 Ga0207667_10034699 3300025949 Bacteria 5415
615 Ga0207667_10156943 3300025949 Bacteria 2341
616 Ga0207651_10151706 3300025960 Bacteria 1805
617 Ga0207668_10149151 3300025972 Bacteria 1808
618 Ga0207640_10000490 3300025981 Bacteria 24099
619 Ga0207658_10000701 3300025986 Bacteria 29053
620 Ga0207658_10035321 3300025986 Bacteria 3579
621 Ga0207703_10244121 3300026035 Bacteria 1616
622 Ga0207639_10019471 3300026041 Bacteria 4841
623 Ga0207678_10000419 3300026067 Bacteria 38457
624 Ga0207678_10000911 3300026067 Bacteria 27065
625 Ga0207678_10004582 3300026067 Bacteria 12433
626 Ga0207678_10037826 3300026067 Bacteria 4196
627 Ga0207678_10041614 3300026067 Bacteria 3984
628 Ga0207678_10067645 3300026067 Bacteria 3066
629 Ga0207708_10207132 3300026075 Bacteria 1566
630 Ga0207702_10006736 3300026078 Bacteria 9870
631 Ga0207702_10093167 3300026078 Bacteria 2642
632 Ga0207674_10027513 3300026116 Bacteria 6014
633 Ga0207674_10056006 3300026116 Bacteria 4005
634 Ga0207675_100250766 3300026118 Bacteria 1713
635 Ga0207683_10030261 3300026121 Bacteria 4690
636 Ga0207683_10135168 3300026121 Bacteria 2219
637 Ga0207698_10069769 3300026142 Bacteria 2781
638 Ga0209281_1000029 3300027111 Bacteria 431495
639 Ga0209281_1000070 3300027111 Bacteria 277098
640 Ga0209281_1000249 3300027111 Bacteria 107266
641 Ga0209389_1000078 3300027296 Bacteria 90574
642 Ga0209389_1000210 3300027296 Bacteria 41871
643 Ga0209371_1000040 3300027312 Bacteria 340804
644 Ga0209371_1000114 3300027312 Bacteria 139090
645 Ga0209371_1004048 3300027312 Bacteria 6625
646 Ga0209589_1000011 3300027357 Bacteria 236981
647 Ga0209589_1001190 3300027357 Bacteria 41871
648 Ga0209489_100012 3300027361 Bacteria 236981
649 Ga0209489_100192 3300027361 Bacteria 98028
650 Ga0209700_100019 3300027363 Bacteria 236981
651 Ga0209282_1000074 3300027666 Bacteria 78298
652 Ga0209282_1018720 3300027666 Bacteria 4392
653 Ga0209588_1013766 3300027671 Bacteria 2471
654 Ga0207428_10026308 3300027907 Bacteria 4857
655 Ga0268266_10007711 3300028379 Bacteria 9662
656 Ga0268264_10000194 3300028381 Bacteria 125395
657 Ga0265319_1023195 3300028563 Bacteria 2250
658 Ga0265334_10003980 3300028573 Bacteria 6634
659 Ga0265318_10008391 3300028577 Bacteria 4602
660 Ga0265323_10000516 3300028653 Bacteria 21579
661 Ga0265322_10002082 3300028654 Bacteria 6274
662 Ga0265336_10000456 3300028666 Bacteria 24746
663 Ga0265338_10000065 3300028800 Bacteria 188966
664 Ga0265324_10007686 3300029957 Bacteria 4340
665 Ga0268256_1000041 3300030500 Bacteria 340725
666 Ga0268256_1000218 3300030500 Bacteria 63709
667 Ga0268256_1003598 3300030500 Bacteria 6898
668 Ga0316179_1034064 3300030734 Bacteria 2314
669 Ga0316178_1152882 3300030735 Bacteria 8839
670 Ga0265760_10022728 3300031090 Bacteria 1818
671 Ga0265332_10026610 3300031238 Bacteria 2537
672 Ga0265325_10037169 3300031241 Bacteria 2575
673 Ga0265339_10075563 3300031249 Bacteria 1788
674 Ga0265331_10019239 3300031250 Bacteria 3528
675 Ga0265327_10007366 3300031251 Bacteria 8515
676 Ga0265327_10012518 3300031251 Bacteria 5714
677 Ga0265316_10047668 3300031344 Bacteria 3388
678 Ga0265316_10219946 3300031344 Bacteria 1402
679 Ga0307509_10161097 3300031507 Bacteria 2141
680 Ga0307408_100023917 3300031548 Bacteria 4165
681 Ga0307408_100027855 3300031548 Bacteria 3898
682 Ga0307508_10000001 3300031616 Bacteria 553635
683 Ga0307508_10034274 3300031616 Bacteria 4578
684 Ga0307508_10095256 3300031616 Bacteria 2567
685 Ga0307508_10185720 3300031616 Bacteria 1681
686 Ga0265314_10011314 3300031711 Bacteria 7377
687 Ga0307516_10000859 3300031730 Bacteria 41636
688 Ga0307516_10012610 3300031730 Bacteria 9092
689 Ga0307405_10056842 3300031731 Bacteria 2455
690 Ga0307407_10085133 3300031903 Bacteria 1923
691 Ga0307412_10000044 3300031911 Bacteria 165237
692 Ga0307412_10006504 3300031911 Bacteria 6610
693 Ga0307412_10070442 3300031911 Bacteria 2383
694 Ga0307409_100069835 3300031995 Bacteria 2786
695 Ga0307415_100087092 3300032126 Bacteria 2249
696 Ga0307507_10010371 3300033179 Bacteria 12061
697 Ga0307510_10003141 3300033180 Bacteria 19142
698 Ga0307510_10034158 3300033180 Bacteria 5698
699 Ga0307510_10052649 3300033180 Bacteria 4287
700 Ga0307510_10178511 3300033180 Bacteria 1690
701 Ga0373934_0026823 3300035086 Bacteria 2236
702 Ga0373923_0003759 3300035111 Bacteria 4924
703 Ga0373936_0049770 3300035113 Bacteria 1693
704 Ga0373945_0013272 3300035116 Bacteria 2747
705 Ga0373953_0002356 3300035117 Bacteria 5691
706 Ga0373943_0003856 3300035170 Bacteria 6820
707 Ga0373943_0006295 3300035170 Bacteria 5328
708 Ga0373955_0016136 3300035172 Bacteria 3671
709 Ga0373924_0024858 3300035410 Bacteria 2364
710 Ga0373935_0003793 3300035692 Bacteria 8827
711 Ga0373935_0073663 3300035692 Bacteria 2206
712 Ga0373927_0001305 3300035695 Bacteria 18850
713 Ga0373927_0046440 3300035695 Bacteria 2809
714 Ga0373947_0001572 3300035725 Bacteria 13996
715 Ga0373947_0020287 3300035725 Bacteria 3836
716 Ga0373947_0124690 3300035725 Bacteria 1639
717 Ga0373937_0055490 3300036401 Bacteria 3637
718 Ga0373925_0000676 3300037068 Bacteria 32014
719 Ga0373925_0014327 3300037068 Bacteria 5736
720 Ga0395899_0000029 3300037312 Bacteria 329371
721 Ga0395899_0022392 3300037312 Bacteria 4792
722 Ga0395899_0055223 3300037312 Bacteria 2938
723 Ga0395900_0000098 3300037418 Bacteria 158030
724 Ga0395900_0000196 3300037418 Bacteria 96480
725 Ga0395900_0048824 3300037418 Bacteria 4359
726 Ga0395900_0090030 3300037418 Bacteria 3154
727 Ga0395900_0097693 3300037418 Bacteria 3017
728 Ga0395900_0111219 3300037418 Bacteria 2814
729 Ga0395900_0114223 3300037418 Bacteria 2771
730 Ga0395900_0126587 3300037418 Bacteria 2620
731 Ga0395900_0177638 3300037418 Bacteria 2165
732 Ga0395900_0197752 3300037418 Bacteria 2036
733 Ga0395900_0291642 3300037418 Unclassified 1620
734 Ga0395898_0000086 3300037466 Bacteria 239895
735 Ga0395898_0000577 3300037466 Bacteria 67972
736 Ga0395898_0010898 3300037466 Bacteria 9487
737 Ga0395898_0032583 3300037466 Bacteria 5202
738 Ga0395898_0115359 3300037466 Unclassified 2573
739 Ga0395905_0000201 3300037471 Bacteria 92923
740 Ga0395905_0004566 3300037471 Bacteria 14330
741 Ga0395905_0072502 3300037471 Bacteria 3229
742 Ga0395905_0077342 3300037471 Bacteria 3118
743 Ga0395905_0132714 3300037471 Bacteria 2342
744 Ga0436364_1144417 3300037853 Bacteria 4542
745 Ga0395901_0000104 3300038443 Bacteria 114939
746 Ga0395901_0000137 3300038443 Bacteria 95185
747 Ga0395901_0000231 3300038443 Bacteria 70033
748 Ga0395901_0155286 3300038443 Bacteria 2403
749 Ga0395901_0340447 3300038443 Bacteria 1550
750 Ga0237819_01466 3300038705 Bacteria 6059
751 Ga0436365_0473945 3300039437 Bacteria 2459
752 Ga0436360_0304504 3300039438 Bacteria 2981
753 Ga0436360_0536580 3300039438 Bacteria 4379
754 Ga0436360_0755309 3300039438 Bacteria 1977
755 Ga0436361_0138725 3300039447 Bacteria 20138
756 Ga0436361_0246054 3300039447 Bacteria 1516
757 Ga0436361_0512633 3300039447 Bacteria 2021
758 Ga0436363_0561374 3300039450 Bacteria 1521
759 Ga0439436_0006431 3300041404 Bacteria 3608
760 Ga0439438_000199 3300041405 Bacteria 27351
761 Ga0439438_005671 3300041405 Bacteria 4548
762 Ga0439438_006276 3300041405 Bacteria 4223
763 Ga0439438_006309 3300041405 Bacteria 4208
764 Ga0439438_011933 3300041405 Bacteria 2684
765 Ga0439447_000909 3300041407 Bacteria 10819
766 Ga0439447_004721 3300041407 Bacteria 4644
767 Ga0439447_007300 3300041407 Bacteria 3520
768 Ga0439447_011535 3300041407 Bacteria 2572
769 Ga0439466_0002213 3300041411 Bacteria 7610
770 Ga0439466_0004939 3300041411 Bacteria 5125
771 Ga0439466_0005069 3300041411 Bacteria 5050
772 Ga0439466_0016378 3300041411 Bacteria 2679
773 Ga0439466_0018526 3300041411 Bacteria 2496
774 Ga0439431_0004281 3300041997 Bacteria 3134
775 Ga0439448_0000169 3300042005 Bacteria 13105
776 Ga0439432_000453 3300042006 Bacteria 15287
777 Ga0439432_000827 3300042006 Bacteria 11540
778 Ga0439432_006423 3300042006 Bacteria 4198
779 Ga0439432_038933 3300042006 Bacteria 1512
780 Ga0439451_003268 3300042009 Bacteria 3286
781 Ga0439451_011933 3300042009 Bacteria 1752
782 Ga0439452_000581 3300042010 Bacteria 18965
783 Ga0439452_001230 3300042010 Bacteria 10926
784 Ga0439452_001923 3300042010 Bacteria 7962
785 Ga0439452_005307 3300042010 Bacteria 4161
786 Ga0439452_007817 3300042010 Bacteria 3246
787 Ga0439452_008357 3300042010 Bacteria 3121
788 Ga0439456_000063 3300042013 Bacteria 38227
789 Ga0439456_001296 3300042013 Bacteria 4980
790 Ga0439456_003137 3300042013 Bacteria 3342
791 Ga0439463_003980 3300042016 Bacteria 3719
792 Ga0450920_001220 3300042122 Bacteria 4220
793 Ga0450922_000404 3300042124 Bacteria 4646
794 Ga0450902_000643 3300042137 Bacteria 4448
795 Ga0450902_000756 3300042137 Bacteria 4159
796 Ga0450907_000025 3300042146 Bacteria 72853
797 Ga0450907_003669 3300042146 Bacteria 2708
798 Ga0450910_000561 3300042147 Bacteria 4403
799 Ga0439434_0001115 3300042435 Bacteria 7763
800 Ga0439460_0006661 3300042461 Bacteria 2871
801 Ga0439460_0007288 3300042461 Bacteria 2759
802 Ga0466969_0000226 3300044656 Bacteria 30801
803 Ga0466969_0003247 3300044656 Bacteria 8647
804 Ga0466969_0008544 3300044656 Bacteria 5433
805 Ga0466969_0012351 3300044656 Bacteria 4505
806 Ga0466969_0030975 3300044656 Bacteria 2724
807 Ga0466972_0005663 3300044658 Bacteria 6266
808 Ga0466977_0008418 3300044666 Bacteria 5721
809 Ga0466965_0005365 3300044683 Bacteria 5772
810 Ga0466965_0010859 3300044683 Bacteria 4260
811 Ga0466965_0027306 3300044683 Bacteria 2770
812 Ga0466965_0038803 3300044683 Bacteria 2340
813 Ga0466966_0000005 3300044684 Bacteria 193939
814 Ga0466966_0002330 3300044684 Bacteria 12390
815 Ga0466961_0000656 3300044693 Bacteria 21722
816 Ga0466961_0000908 3300044693 Bacteria 18384
817 Ga0466961_0002934 3300044693 Bacteria 10591
818 Ga0466961_0039867 3300044693 Bacteria 3010
819 Ga0466963_0001778 3300044694 Bacteria 11734
820 Ga0466963_0007803 3300044694 Bacteria 6401
821 Ga0466963_0110019 3300044694 Bacteria 1891
822 Ga0466964_0062504 3300044706 Bacteria 1553
823 Ga0466971_0000225 3300044719 Bacteria 21713
824 Ga0466971_0022608 3300044719 Bacteria 2803
825 Ga0466971_0049325 3300044719 Bacteria 1894
826 Ga0466968_0004192 3300044735 Bacteria 5372
827 Ga0466970_0003203 3300044765 Bacteria 7958
828 Ga0466970_0003629 3300044765 Bacteria 7525
829 Ga0466970_0024106 3300044765 Bacteria 3181
830 Ga0466957_0004704 3300044842 Bacteria 7638
831 Ga0466957_0005749 3300044842 Bacteria 6967
832 Ga0466957_0013067 3300044842 Bacteria 4810
833 Ga0466957_0153471 3300044842 Bacteria 1491
834 Ga0466960_0014731 3300044901 Bacteria 3357
835 Ga0466959_0004419 3300045049 Bacteria 9413
836 Ga0466959_0016104 3300045049 Bacteria 5456
837 Ga0466959_0045224 3300045049 Bacteria 3242
838 Ga0466959_0045299 3300045049 Bacteria 3239
839 Ga0466959_0132757 3300045049 Bacteria 1764
840 Ga0466958_0000956 3300045836 Bacteria 13061
841 Ga0466958_0053171 3300045836 Bacteria 2455
842 Ga0466967_0027405 3300045976 Bacteria 4739
843 Ga0466967_0139369 3300045976 Bacteria 2258
844 Ga0495617_000479 3300046452 Bacteria 21276
845 Ga0495617_004457 3300046452 Bacteria 5094
846 Ga0495627_001494 3300046453 Bacteria 13525
847 Ga0495592_0020729 3300046454 Bacteria 5000
848 Ga0495592_0057295 3300046454 Bacteria 2876
849 Ga0495592_0097075 3300046454 Bacteria 2105
850 Ga0495603_0000003 3300046455 Bacteria 83533
851 Ga0495603_0067662 3300046455 Bacteria 2102
852 Ga0495590_0000005 3300046457 Bacteria 384276
853 Ga0495590_0009816 3300046457 Bacteria 3623
854 Ga0495590_0012583 3300046457 Bacteria 3138
855 Ga0495591_000165 3300046458 Bacteria 70496
856 Ga0495591_000387 3300046458 Bacteria 37257
857 Ga0495591_001132 3300046458 Bacteria 17598
858 Ga0495591_002013 3300046458 Bacteria 11827
859 Ga0495591_003323 3300046458 Bacteria 8374
860 Ga0495591_004232 3300046458 Bacteria 7113
861 Ga0495591_015106 3300046458 Bacteria 2740
862 Ga0495591_034200 3300046458 Bacteria 1498
863 Ga0495629_0000105 3300046459 Bacteria 74421
864 Ga0495629_0000133 3300046459 Bacteria 64806
865 Ga0495629_0002853 3300046459 Bacteria 13208
866 Ga0495629_0002887 3300046459 Bacteria 13125
867 Ga0495629_0003517 3300046459 Bacteria 11840
868 Ga0495629_0020285 3300046459 Bacteria 4747
869 Ga0495638_0005386 3300046460 Bacteria 9540
870 Ga0495638_0011092 3300046460 Bacteria 6228
871 Ga0495638_0018018 3300046460 Bacteria 4698
872 Ga0495638_0019977 3300046460 Bacteria 4428
873 Ga0495638_0029251 3300046460 Bacteria 3553
874 Ga0495638_0048476 3300046460 Bacteria 2658
875 Ga0495638_0055785 3300046460 Bacteria 2452
876 Ga0495641_0011455 3300046461 Bacteria 5051
877 Ga0495651_0001898 3300046462 Bacteria 16168
878 Ga0495651_0005111 3300046462 Bacteria 10010
879 Ga0495653_0004087 3300046463 Bacteria 11805
880 Ga0495653_0011821 3300046463 Bacteria 7128
881 Ga0495653_0036791 3300046463 Bacteria 3852
882 Ga0495653_0108648 3300046463 Bacteria 1997
883 Ga0495650_0000710 3300046471 Bacteria 42545
884 Ga0495650_0003689 3300046471 Bacteria 10968
885 Ga0495650_0010859 3300046471 Bacteria 5047
886 Ga0495650_0017508 3300046471 Bacteria 3591
887 Ga0495650_0018394 3300046471 Bacteria 3473
888 Ga0495650_0029283 3300046471 Bacteria 2512
889 Ga0495580_0008949 3300046472 Bacteria 7913
890 Ga0495580_0027216 3300046472 Bacteria 4161
891 Ga0495580_0031628 3300046472 Bacteria 3822
892 Ga0495580_0038848 3300046472 Bacteria 3406
893 Ga0495580_0041966 3300046472 Bacteria 3260
894 Ga0495582_0000016 3300046473 Bacteria 100714
895 Ga0495582_0015213 3300046473 Bacteria 4230
896 Ga0495582_0061015 3300046473 Bacteria 2082
897 Ga0495605_0000124 3300046474 Bacteria 101623
898 Ga0495605_0004497 3300046474 Bacteria 8168
899 Ga0495605_0006881 3300046474 Bacteria 6494
900 Ga0495605_0013089 3300046474 Bacteria 4583
901 Ga0495605_0019294 3300046474 Bacteria 3646
902 Ga0495605_0075352 3300046474 Bacteria 1586
903 Ga0495639_0000014 3300046475 Bacteria 82866
904 Ga0495662_0002084 3300046476 Bacteria 10025
905 Ga0495664_0005109 3300046477 Bacteria 7195
906 Ga0495664_0024757 3300046477 Bacteria 3489
907 Ga0495664_0029656 3300046477 Bacteria 3201
908 Ga0495584_0001735 3300046491 Bacteria 12743
909 Ga0495584_0020821 3300046491 Bacteria 3330
910 Ga0495584_0056498 3300046491 Bacteria 1975
911 Ga0495585_0004287 3300046492 Bacteria 9283
912 Ga0495585_0013257 3300046492 Bacteria 4828
913 Ga0495585_0026629 3300046492 Bacteria 3303
914 Ga0495594_0000051 3300046499 Bacteria 52030
915 Ga0495596_0005234 3300046500 Bacteria 6163
916 Ga0495596_0023490 3300046500 Bacteria 2501
917 Ga0495596_0031980 3300046500 Bacteria 2099
918 Ga0495607_0001371 3300046501 Bacteria 21663
919 Ga0495607_0024161 3300046501 Bacteria 3792
920 Ga0495607_0074335 3300046501 Bacteria 1886
921 Ga0495607_0076806 3300046501 Bacteria 1846
922 Ga0495607_0105546 3300046501 Bacteria 1501
923 Ga0495583_0001112 3300046506 Bacteria 29748
924 Ga0495583_0001552 3300046506 Bacteria 22749
925 Ga0495583_0009174 3300046506 Bacteria 5942
926 Ga0495583_0010184 3300046506 Bacteria 5516
927 Ga0495583_0020079 3300046506 Bacteria 3470
928 Ga0495583_0023951 3300046506 Bacteria 3077
929 Ga0495606_0000032 3300046507 Bacteria 248690
930 Ga0495606_0000042 3300046507 Bacteria 215099
931 Ga0495606_0002242 3300046507 Bacteria 23003
932 Ga0495606_0007911 3300046507 Bacteria 9375
933 Ga0495606_0008338 3300046507 Bacteria 9027
934 Ga0495606_0011843 3300046507 Bacteria 7060
935 Ga0495606_0023220 3300046507 Bacteria 4500
936 Ga0495606_0024810 3300046507 Bacteria 4310
937 Ga0495606_0029806 3300046507 Bacteria 3823
938 Ga0495606_0053148 3300046507 Bacteria 2629
939 Ga0495606_0121034 3300046507 Bacteria 1567
940 Ga0495608_0038590 3300046511 Bacteria 3206
941 Ga0495608_0053734 3300046511 Bacteria 2664
942 Ga0495610_0003579 3300046512 Bacteria 12005
943 Ga0495610_0006567 3300046512 Bacteria 7960
944 Ga0495610_0007629 3300046512 Bacteria 7159
945 Ga0495610_0012101 3300046512 Bacteria 5216
946 Ga0495616_0019156 3300046513 Bacteria 3739
947 Ga0495616_0033914 3300046513 Bacteria 2655
948 Ga0495618_0013194 3300046514 Bacteria 5027
949 Ga0495618_0033388 3300046514 Bacteria 3227
950 Ga0495618_0071878 3300046514 Bacteria 2201
951 Ga0495620_0000004 3300046515 Bacteria 344148
952 Ga0495620_0025065 3300046515 Bacteria 2827
953 Ga0495620_0033355 3300046515 Bacteria 2338
954 Ga0495628_0002656 3300046516 Bacteria 16030
955 Ga0495628_0008450 3300046516 Bacteria 8829
956 Ga0495628_0013006 3300046516 Bacteria 7009
957 Ga0495628_0039809 3300046516 Bacteria 3758
958 Ga0495630_0022261 3300046517 Bacteria 4682
959 Ga0495630_0023055 3300046517 Bacteria 4600
960 Ga0495630_0034082 3300046517 Bacteria 3799
961 Ga0495630_0035570 3300046517 Bacteria 3721
962 Ga0495630_0046608 3300046517 Bacteria 3240
963 Ga0495630_0074543 3300046517 Bacteria 2556
964 Ga0495631_0000953 3300046518 Bacteria 18020
965 Ga0495631_0003004 3300046518 Bacteria 9333
966 Ga0495631_0005227 3300046518 Bacteria 6830
967 Ga0495632_0001439 3300046519 Bacteria 19832
968 Ga0495632_0001542 3300046519 Bacteria 19038
969 Ga0495632_0005956 3300046519 Bacteria 7943
970 Ga0495632_0014688 3300046519 Bacteria 4420
971 Ga0495632_0018769 3300046519 Bacteria 3786
972 Ga0495637_0000171 3300046520 Bacteria 49947
973 Ga0495637_0000931 3300046520 Bacteria 18727
974 Ga0495637_0005318 3300046520 Bacteria 6583
975 Ga0495637_0010013 3300046520 Bacteria 4605
976 Ga0495637_0012785 3300046520 Bacteria 4005
977 Ga0495643_0000297 3300046522 Bacteria 69703
978 Ga0495643_0002410 3300046522 Bacteria 14866
979 Ga0495643_0009717 3300046522 Bacteria 5950
980 Ga0495643_0010056 3300046522 Bacteria 5836
981 Ga0495643_0010572 3300046522 Bacteria 5671
982 Ga0495643_0033537 3300046522 Bacteria 2839
983 Ga0495644_0001175 3300046523 Bacteria 10733
984 Ga0495644_0002862 3300046523 Bacteria 6837
985 Ga0495644_0016424 3300046523 Bacteria 2833
986 Ga0495648_0000188 3300046524 Bacteria 71222
987 Ga0495648_0001828 3300046524 Bacteria 20470
988 Ga0495648_0010069 3300046524 Bacteria 7243
989 Ga0495648_0019703 3300046524 Bacteria 4731
990 Ga0495648_0038878 3300046524 Bacteria 3035
991 Ga0495648_0060170 3300046524 Bacteria 2261
992 Ga0495648_0062533 3300046524 Bacteria 2203
993 Ga0495663_0001152 3300046525 Bacteria 8544
994 Ga0495666_0007152 3300046526 Bacteria 5606
995 Ga0495666_0017365 3300046526 Bacteria 3584
996 Ga0495666_0040284 3300046526 Bacteria 2265
997 Ga0495642_0000276 3300046528 Bacteria 29070
998 Ga0495652_0007000 3300046529 Bacteria 10422
999 Ga0495652_0026204 3300046529 Bacteria 5153
1000 Ga0495652_0058154 3300046529 Bacteria 3275
1001 Ga0495652_0062651 3300046529 Bacteria 3135
1002 Ga0495654_0000878 3300046530 Bacteria 22561
1003 Ga0495654_0005444 3300046530 Bacteria 7391
1004 Ga0495654_0005926 3300046530 Bacteria 7026
1005 Ga0495654_0007926 3300046530 Bacteria 5902
1006 Ga0495654_0018888 3300046530 Bacteria 3607
1007 Ga0495654_0038697 3300046530 Bacteria 2383
1008 Ga0495665_0000270 3300046531 Bacteria 26319
1009 Ga0495665_0032847 3300046531 Bacteria 2776
1010 Ga0495665_0036946 3300046531 Bacteria 2607
1011 Ga0495640_0015373 3300046533 Bacteria 5762
1012 Ga0495640_0028712 3300046533 Bacteria 4002
1013 Ga0495586_0001447 3300046535 Bacteria 13109
1014 Ga0495587_0005433 3300046536 Bacteria 8315
1015 Ga0495587_0006220 3300046536 Bacteria 7792
1016 Ga0495587_0011069 3300046536 Bacteria 5720
1017 Ga0495587_0027077 3300046536 Bacteria 3491
1018 Ga0495609_0000456 3300046538 Bacteria 33462
1019 Ga0495609_0003025 3300046538 Bacteria 9908
1020 Ga0495609_0008086 3300046538 Bacteria 5183
1021 Ga0495609_0009745 3300046538 Bacteria 4633
1022 Ga0495597_0009516 3300046542 Bacteria 4795
1023 Ga0495597_0010021 3300046542 Bacteria 4652
1024 Ga0495597_0053325 3300046542 Bacteria 1778
1025 Ga0495645_0001550 3300046543 Bacteria 15539
1026 Ga0495645_0007057 3300046543 Bacteria 7817
1027 Ga0495645_0010772 3300046543 Bacteria 6423
1028 Ga0495645_0014623 3300046543 Bacteria 5572
1029 Ga0495645_0078236 3300046543 Bacteria 2377
1030 Ga0495645_0101017 3300046543 Bacteria 2051
1031 Ga0495622_0001439 3300046557 Bacteria 12019
1032 Ga0495622_0001690 3300046557 Bacteria 10908
1033 Ga0495622_0005935 3300046557 Bacteria 5675
1034 Ga0495622_0011047 3300046557 Bacteria 4168
1035 Ga0495622_0020971 3300046557 Bacteria 3043
1036 Ga0495622_0039348 3300046557 Bacteria 2202
1037 Ga0495622_0040666 3300046557 Bacteria 2163
1038 Ga0495622_0058480 3300046557 Bacteria 1786
1039 Ga0495633_0000896 3300046558 Bacteria 25429
1040 Ga0495667_0033070 3300046559 Bacteria 3461
1041 Ga0495667_0046874 3300046559 Bacteria 2857
1042 Ga0495667_0051787 3300046559 Bacteria 2707
1043 Ga0495656_0010985 3300046615 Bacteria 3311
1044 Ga0495668_0000096 3300046616 Bacteria 139693
1045 Ga0495668_0012211 3300046616 Bacteria 5103
1046 Ga0495668_0069304 3300046616 Bacteria 1939
1047 Ga0495634_0000064 3300046642 Bacteria 85710
1048 Ga0495634_0012589 3300046642 Bacteria 6123
1049 Ga0495634_0014826 3300046642 Bacteria 5604
1050 Ga0495611_0002721 3300046648 Bacteria 7958
1051 Ga0495611_0008969 3300046648 Bacteria 4229
1052 Ga0495625_0000010 3300046660 Bacteria 381775
1053 Ga0495625_0003810 3300046660 Bacteria 14594
1054 Ga0495625_0005012 3300046660 Bacteria 12284
1055 Ga0495625_0100211 3300046660 Bacteria 1991
1056 Ga0495635_0001480 3300046663 Bacteria 15709
1057 Ga0495635_0006440 3300046663 Bacteria 8185
1058 Ga0495635_0019099 3300046663 Bacteria 4784
1059 Ga0495635_0025503 3300046663 Bacteria 4119
1060 Ga0495635_0042289 3300046663 Bacteria 3146
1061 Ga0495635_0042546 3300046663 Bacteria 3136
1062 Ga0495659_0000457 3300046664 Bacteria 15230
1063 Ga0495661_0000790 3300046665 Bacteria 30045
1064 Ga0495661_0001455 3300046665 Bacteria 19817
1065 Ga0495661_0005867 3300046665 Bacteria 8677
1066 Ga0495661_0016543 3300046665 Bacteria 4885
1067 Ga0495588_0058054 3300046674 Bacteria 2000
1068 Ga0495657_0008807 3300046675 Bacteria 7688
1069 Ga0495599_0000823 3300046678 Bacteria 17484
1070 Ga0495599_0019978 3300046678 Bacteria 4171
1071 Ga0495599_0085027 3300046678 Bacteria 1976
1072 Ga0495623_0007544 3300046679 Bacteria 7058
1073 Ga0495623_0036727 3300046679 Bacteria 3137
1074 Ga0495646_0010120 3300046680 Bacteria 5995
1075 Ga0495646_0023117 3300046680 Bacteria 3913
1076 Ga0495646_0024091 3300046680 Bacteria 3833
1077 Ga0495646_0024315 3300046680 Bacteria 3815
1078 Ga0495646_0030608 3300046680 Bacteria 3360
1079 Ga0495646_0071739 3300046680 Bacteria 2037
1080 Ga0495647_0060641 3300046681 Bacteria 1492
1081 Ga0495658_0001546 3300046683 Bacteria 12029
1082 Ga0495669_0007735 3300046684 Bacteria 4511
1083 Ga0495613_0001602 3300046689 Bacteria 17178
1084 Ga0495613_0017809 3300046689 Bacteria 5294
1085 Ga0495613_0060922 3300046689 Bacteria 2764
1086 Ga0495624_0000201 3300046690 Bacteria 45984
1087 Ga0495624_0003503 3300046690 Bacteria 11629
1088 Ga0495624_0014549 3300046690 Bacteria 5336
1089 Ga0495624_0015332 3300046690 Bacteria 5178
1090 Ga0495624_0050733 3300046690 Bacteria 2627
1091 Ga0495670_0018076 3300046691 Bacteria 3473
1092 Ga0495670_0022050 3300046691 Bacteria 3144
1093 Ga0495671_0026716 3300046692 Bacteria 2989
1094 Ga0495671_0029088 3300046692 Bacteria 2840
1095 Ga0495671_0039935 3300046692 Bacteria 2367
1096 Ga0495649_0001000 3300046694 Bacteria 22223
1097 Ga0495649_0008348 3300046694 Bacteria 6232
1098 Ga0495649_0017672 3300046694 Bacteria 4022
1099 Ga0495649_0037014 3300046694 Bacteria 2679
1100 Ga0495649_0058384 3300046694 Bacteria 2079
1101 Ga0495649_0066481 3300046694 Bacteria 1934
1102 Ga0495589_0001771 3300046794 Bacteria 12299
1103 Ga0495589_0004057 3300046794 Bacteria 7848
1104 Ga0495589_0006766 3300046794 Bacteria 6037
1105 Ga0495589_0012759 3300046794 Bacteria 4343
1106 Ga0495600_0010359 3300046809 Bacteria 5785
1107 Ga0495600_0027469 3300046809 Bacteria 3677
1108 Ga0495600_0122816 3300046809 Bacteria 1689
1109 Ga0495660_0013447 3300046810 Bacteria 4742
1110 Ga0495660_0037615 3300046810 Bacteria 2694
1111 Ga0495660_0075272 3300046810 Bacteria 1781
1112 Ga0495581_0000014 3300047315 Bacteria 60735
1113 Ga0495581_0021153 3300047315 Bacteria 3773
1114 Ga0495604_0001045 3300047317 Bacteria 23003
1115 Ga0495604_0012911 3300047317 Bacteria 6654
1116 Ga0495604_0015866 3300047317 Bacteria 6013
1117 Ga0495604_0017993 3300047317 Bacteria 5655
1118 Ga0495604_0059746 3300047317 Bacteria 2921
1119 Ga0495674_0013843 3300047319 Bacteria 7571
1120 Ga0495674_0037786 3300047319 Bacteria 4337
1121 Ga0495674_0046100 3300047319 Bacteria 3870
1122 Ga0495674_0048125 3300047319 Bacteria 3775
1123 Ga0495674_0063784 3300047319 Bacteria 3204
1124 Ga0495672_0004532 3300047320 Bacteria 11333
1125 Ga0495672_0009651 3300047320 Bacteria 6966
1126 Ga0495672_0013081 3300047320 Bacteria 5743
1127 Ga0495672_0017425 3300047320 Bacteria 4805
1128 Ga0495672_0018025 3300047320 Bacteria 4702
1129 Ga0495672_0018797 3300047320 Bacteria 4576
1130 Ga0495672_0020229 3300047320 Bacteria 4367
1131 Ga0495672_0030535 3300047320 Bacteria 3378
1132 Ga0495672_0032208 3300047320 Bacteria 3265
1133 Ga0495672_0060533 3300047320 Bacteria 2186
1134 Ga0495676_0000002 3300047321 Bacteria 373918
1135 Ga0495676_0008340 3300047321 Bacteria 9503
1136 Ga0495676_0017761 3300047321 Bacteria 6282
1137 Ga0495676_0049156 3300047321 Bacteria 3394
1138 Ga0495676_0059463 3300047321 Bacteria 3001
1139 Ga0495680_0001894 3300047322 Bacteria 21963
1140 Ga0495680_0005126 3300047322 Bacteria 12372
1141 Ga0495680_0087224 3300047322 Bacteria 2348
1142 Ga0495680_0091270 3300047322 Bacteria 2283
1143 Ga0495683_0001174 3300047323 Bacteria 17901
1144 Ga0495683_0001446 3300047323 Bacteria 15578
1145 Ga0495683_0003592 3300047323 Bacteria 9011
1146 Ga0495683_0009570 3300047323 Bacteria 5160
1147 Ga0495683_0014270 3300047323 Bacteria 4139
1148 Ga0495683_0018159 3300047323 Bacteria 3639
1149 Ga0495683_0068421 3300047323 Bacteria 1746
1150 Ga0495687_005784 3300047443 Bacteria 7758
1151 Ga0495687_021419 3300047443 Bacteria 3127
1152 Ga0495675_0012153 3300047444 Bacteria 5416
1153 Ga0495675_0045850 3300047444 Bacteria 2784
1154 Ga0495675_0047451 3300047444 Bacteria 2732
1155 Ga0495675_0055414 3300047444 Bacteria 2514
1156 Ga0495675_0064304 3300047444 Bacteria 2320
1157 Ga0495677_0027531 3300047445 Bacteria 2063
1158 Ga0495679_000243 3300047446 Bacteria 45339
1159 Ga0495679_000498 3300047446 Bacteria 27846
1160 Ga0495679_000540 3300047446 Bacteria 26653
1161 Ga0495679_002453 3300047446 Bacteria 9446
1162 Ga0495679_003917 3300047446 Bacteria 7031
1163 Ga0495679_008749 3300047446 Bacteria 4092
1164 Ga0495673_0001376 3300047469 Bacteria 19632
1165 Ga0495673_0001555 3300047469 Bacteria 17984
1166 Ga0495673_0001654 3300047469 Bacteria 17196
1167 Ga0495673_0009282 3300047469 Bacteria 5455
1168 Ga0495673_0014320 3300047469 Bacteria 4127
1169 Ga0495673_0040678 3300047469 Bacteria 2097
1170 Ga0495673_0045778 3300047469 Bacteria 1942
1171 Ga0495681_0002070 3300047470 Bacteria 14573
1172 Ga0495681_0003032 3300047470 Bacteria 11804
1173 Ga0495681_0008069 3300047470 Bacteria 6634
1174 Ga0495681_0013937 3300047470 Bacteria 4637
1175 Ga0495681_0022735 3300047470 Bacteria 3348
1176 Ga0495681_0024250 3300047470 Bacteria 3201
1177 Ga0495681_0082596 3300047470 Bacteria 1431
1178 Ga0495684_0031468 3300047471 Bacteria 4073
1179 Ga0495684_0108536 3300047471 Bacteria 2096
1180 Ga0495686_0028914 3300047472 Bacteria 3608
1181 Ga0495593_0000003 3300047673 Bacteria 120744
1182 Ga0495593_0013772 3300047673 Bacteria 4606
1183 Ga0495593_0032489 3300047673 Bacteria 2844
1184 Ga0495602_0004392 3300048088 Bacteria 14715
1185 Ga0495602_0019904 3300048088 Bacteria 6646
1186 Ga0495602_0027496 3300048088 Bacteria 5464
1187 Ga0495602_0032356 3300048088 Bacteria 4924
1188 Ga0495602_0056054 3300048088 Bacteria 3468
1189 Ga0495614_0001273 3300048089 Bacteria 10833
1190 Ga0495614_0009420 3300048089 Bacteria 4317
1191 Ga0495614_0049336 3300048089 Bacteria 1805
1192 Ga0495626_0000319 3300048091 Bacteria 50529
1193 Ga0495626_0001455 3300048091 Bacteria 18744
1194 Ga0495626_0001872 3300048091 Bacteria 15768
1195 Ga0495626_0005066 3300048091 Bacteria 7858
1196 Ga0495626_0006702 3300048091 Bacteria 6523
1197 Ga0495626_0008178 3300048091 Bacteria 5762
1198 Ga0496100_0000770 3300048903 Bacteria 15251
1199 Ga0496100_0036563 3300048903 Bacteria 3098
1200 Ga0496100_0049984 3300048903 Bacteria 2706
1201 Ga0496101_0003605 3300048904 Bacteria 9667
1202 Ga0496101_0062499 3300048904 Bacteria 2707
1203 Ga0496101_0120761 3300048904 Bacteria 1981
1204 Ga0496102_0001989 3300048905 Bacteria 17649
1205 Ga0496102_0002699 3300048905 Bacteria 15088
1206 Ga0496102_0044305 3300048905 Bacteria 4037
1207 Ga0496102_0110231 3300048905 Bacteria 2565
1208 Ga0496102_0130940 3300048905 Bacteria 2348
1209 Ga0496103_0000854 3300048906 Bacteria 22289
1210 Ga0496103_0002629 3300048906 Bacteria 11252
1211 Ga0496103_0019548 3300048906 Bacteria 4067
1212 Ga0496103_0024009 3300048906 Bacteria 3678
1213 Ga0496104_0043929 3300048907 Bacteria 4198
1214 Ga0496104_0061727 3300048907 Bacteria 3554
1215 Ga0496105_0159600 3300048908 Bacteria 1851
1216 Ga0496106_0000152 3300048909 Bacteria 51253
1217 Ga0496106_0003247 3300048909 Bacteria 12162
1218 Ga0496107_0030056 3300048910 Bacteria 3871
1219 Ga0496108_0083230 3300048911 Bacteria 2714
1220 Ga0496108_0140914 3300048911 Bacteria 2077
1221 Ga0496110_0114659 3300048913 Bacteria 2425
1222 Ga0496110_0130468 3300048913 Bacteria 2269
1223 Ga0496110_0143978 3300048913 Bacteria 2155
1224 Ga0496110_0252289 3300048913 Bacteria 1606
1225 Ga0496111_0026372 3300048914 Bacteria 4103
1226 Ga0496111_0168103 3300048914 Bacteria 1629
1227 Ga0496112_0000101 3300048915 Bacteria 54429
1228 Ga0496112_0034008 3300048915 Bacteria 4959
1229 Ga0496113_0043290 3300048916 Bacteria 3331
1230 Ga0496114_0002669 3300048917 Bacteria 13620
1231 Ga0496114_0157507 3300048917 Bacteria 1972
1232 Ga0496115_0099049 3300048918 Bacteria 2388
1233 Ga0496115_0102345 3300048918 Bacteria 2349
1234 Ga0496115_0181310 3300048918 Bacteria 1740
1235 Ga0496116_0000267 3300048919 Bacteria 91320
1236 Ga0496116_0087204 3300048919 Bacteria 1911
1237 Ga0496117_0001021 3300048920 Bacteria 42741
1238 Ga0496117_0003014 3300048920 Bacteria 20232
1239 Ga0496117_0003521 3300048920 Bacteria 18127
1240 Ga0496117_0020845 3300048920 Bacteria 5332
1241 Ga0496117_0023031 3300048920 Bacteria 4977
1242 Ga0496117_0023500 3300048920 Bacteria 4907
1243 Ga0496117_0031790 3300048920 Bacteria 4024
1244 Ga0496117_0049041 3300048920 Bacteria 3008
1245 Ga0496117_0053870 3300048920 Bacteria 2823
1246 Ga0496117_0090442 3300048920 Bacteria 1972
1247 Ga0496117_0106074 3300048920 Bacteria 1764
1248 Ga0496118_0001205 3300048921 Bacteria 39819
1249 Ga0496118_0002131 3300048921 Bacteria 27643
1250 Ga0496118_0003163 3300048921 Bacteria 21053
1251 Ga0496118_0007073 3300048921 Bacteria 12054
1252 Ga0496118_0009055 3300048921 Bacteria 10144
1253 Ga0496118_0011650 3300048921 Bacteria 8553
1254 Ga0496118_0022178 3300048921 Bacteria 5562
1255 Ga0496118_0030612 3300048921 Bacteria 4486
1256 Ga0496118_0037948 3300048921 Bacteria 3868
1257 Ga0496118_0044984 3300048921 Bacteria 3451
1258 Ga0496118_0052309 3300048921 Bacteria 3116
1259 Ga0496118_0103556 3300048921 Bacteria 1914
1260 Ga0496118_0138795 3300048921 Bacteria 1546
1261 Ga0496119_0000046 3300048922 Bacteria 190003
1262 Ga0496119_0024863 3300048922 Bacteria 4199
1263 Ga0496119_0058364 3300048922 Bacteria 2326
1264 Ga0496120_0002213 3300048923 Bacteria 20511
1265 Ga0496121_0000041 3300048924 Bacteria 346686
1266 Ga0496121_0000366 3300048924 Bacteria 92773
1267 Ga0496121_0000824 3300048924 Bacteria 56559
1268 Ga0496121_0001446 3300048924 Bacteria 40065
1269 Ga0496121_0002599 3300048924 Bacteria 27274
1270 Ga0496121_0003643 3300048924 Bacteria 21671
1271 Ga0496121_0004448 3300048924 Bacteria 18832
1272 Ga0496121_0012188 3300048924 Bacteria 9425
1273 Ga0496121_0014389 3300048924 Bacteria 8400
1274 Ga0496121_0025746 3300048924 Bacteria 5570
1275 Ga0496121_0029189 3300048924 Bacteria 5110
1276 Ga0496121_0033209 3300048924 Bacteria 4675
1277 Ga0496121_0034546 3300048924 Bacteria 4550
1278 Ga0496121_0044568 3300048924 Bacteria 3824
1279 Ga0496121_0160259 3300048924 Bacteria 1646
1280 Ga0496122_0000167 3300048925 Bacteria 157130
1281 Ga0496122_0001027 3300048925 Bacteria 49219
1282 Ga0496122_0012761 3300048925 Bacteria 8315
1283 Ga0496122_0041991 3300048925 Bacteria 3605
1284 Ga0496122_0070884 3300048925 Bacteria 2486
1285 Ga0496123_0000127 3300048926 Bacteria 154927
1286 Ga0496123_0000240 3300048926 Bacteria 110383
1287 Ga0496123_0015663 3300048926 Bacteria 6204
1288 Ga0496123_0018849 3300048926 Bacteria 5466
1289 Ga0496123_0032067 3300048926 Bacteria 3812
1290 Ga0496123_0032885 3300048926 Bacteria 3744
1291 Ga0496124_0000261 3300048927 Bacteria 101660
1292 Ga0496124_0001966 3300048927 Bacteria 28060
1293 Ga0496124_0003100 3300048927 Bacteria 20651
1294 Ga0496124_0003299 3300048927 Bacteria 19894
1295 Ga0496124_0004055 3300048927 Bacteria 17367
1296 Ga0496124_0019838 3300048927 Bacteria 6237
1297 Ga0496124_0118373 3300048927 Bacteria 2120
1298 Ga0496125_0000944 3300048928 Bacteria 45671
1299 Ga0496125_0002606 3300048928 Bacteria 23156
1300 Ga0496125_0003132 3300048928 Bacteria 20535
1301 Ga0496125_0007271 3300048928 Bacteria 11793
1302 Ga0496125_0008276 3300048928 Bacteria 10921
1303 Ga0496125_0015617 3300048928 Bacteria 7328
1304 Ga0496125_0026562 3300048928 Bacteria 5271
1305 Ga0496125_0026953 3300048928 Bacteria 5218
1306 Ga0496125_0031343 3300048928 Bacteria 4740
1307 Ga0496125_0056609 3300048928 Bacteria 3183
1308 Ga0496126_0000603 3300048929 Bacteria 67970
1309 Ga0496126_0005095 3300048929 Bacteria 15235
1310 Ga0496126_0011447 3300048929 Bacteria 9181
1311 Ga0496126_0011697 3300048929 Bacteria 9048
1312 Ga0496126_0013263 3300048929 Bacteria 8397
1313 Ga0496126_0022380 3300048929 Bacteria 6152
1314 Ga0496126_0032972 3300048929 Bacteria 4875
1315 Ga0495678_003902 3300049459 Bacteria 8945
1316 Ga0495678_006155 3300049459 Bacteria 6437
1317 Ga0495678_006531 3300049459 Bacteria 6193
1318 Ga0495678_008431 3300049459 Bacteria 5199
1319 Ga0495678_009281 3300049459 Bacteria 4883
1320 Ga0495678_015960 3300049459 Bacteria 3446
1321 Ga0495682_0000234 3300049460 Bacteria 43711
1322 Ga0501032_0005184 3300049569 Bacteria 9711
1323 Ga0501034_0000260 3300049571 Bacteria 95474
1324 Ga0501034_0001389 3300049571 Bacteria 32569
1325 Ga0501034_0100213 3300049571 Bacteria 2891
1326 Ga0501038_0178113 3300049574 Bacteria 1717
1327 nmdc:mga00v17_22677_c1 3300050491 Bacteria 3625
1328 nmdc:mga0yw44_12450_c1 3300050492 Bacteria 4435
1329 nmdc:mga0k408_2812_c1 3300050493 Bacteria 9240
1330 nmdc:mga06z11_21475_c1 3300050494 Bacteria 3000
1331 nmdc:mga06z11_24614_c1 3300050494 Bacteria 2842
1332 nmdc:mga06z11_42430_c1 3300050494 Bacteria 2282
1333 nmdc:mga04h51_18623_c1 3300050495 Bacteria 2047
1334 nmdc:mga07m45_4272_c1 3300050496 Bacteria 6990
1335 nmdc:mga09592_49041_c1 3300050508 Bacteria 3560
1336 nmdc:mga0sz30_23955_c1 3300050516 Bacteria 2489
1337 nmdc:mga0sz30_25723_c1 3300050516 Bacteria 2408
1338 nmdc:mga0sz30_34829_c1 3300050516 Bacteria 2098
1339 nmdc:mga0sz30_5037_c1 3300050516 Bacteria 4825
1340 Ga0495601_0012258 3300053077 Bacteria 5141
1341 Ga0495601_0015749 3300053077 Bacteria 4574
1342 Ga0495601_0034735 3300053077 Bacteria 3146
1343 Ga0495601_0078238 3300053077 Bacteria 2119
1344 Ga0495601_0080234 3300053077 Bacteria 2093
1345 Ga0500635_0009073 3300053080 Bacteria 2748
1346 Ga0495655_0015207 3300053083 Bacteria 1631
1347 Ga0495619_0005097 3300053085 Bacteria 8345
1348 Ga0495619_0021762 3300053085 Bacteria 4096
1349 Ga0495619_0173567 3300053085 Bacteria 1491
1350 Ga0500643_000037 3300053087 Bacteria 180821
1351 Ga0500581_039952 3300053089 Bacteria 2403
1352 Ga0500647_0015495 3300053091 Bacteria 3488
1353 Ga0500566_0000367 3300053094 Bacteria 24682
1354 Ga0500566_0001124 3300053094 Bacteria 15513
1355 Ga0500566_0002925 3300053094 Bacteria 10193
1356 Ga0500566_0013595 3300053094 Bacteria 4789
1357 Ga0500640_021741 3300053095 Bacteria 2768
1358 Ga0500641_0010054 3300053096 Bacteria 3411
1359 Ga0500556_0000015 3300053104 Bacteria 202598
1360 Ga0500557_000014 3300053105 Bacteria 107928
1361 Ga0500562_002831 3300053108 Bacteria 4322
1362 Ga0500562_016822 3300053108 Bacteria 1881
1363 Ga0500569_006860 3300053109 Bacteria 2524
1364 Ga0500569_039970 3300053109 Bacteria 1368
1365 Ga0500572_002314 3300053111 Bacteria 4609
1366 Ga0500595_001223 3300053119 Bacteria 14197
1367 Ga0500595_003517 3300053119 Bacteria 7286
1368 Ga0500595_004674 3300053119 Bacteria 6087
1369 Ga0500595_024288 3300053119 Bacteria 2117
1370 Ga0500608_018564 3300053122 Bacteria 3174
1371 Ga0500614_003104 3300053123 Bacteria 3609
1372 Ga0500642_0000044 3300053130 Bacteria 82877
1373 Ga0500642_0000332 3300053130 Bacteria 16203
1374 Ga0500652_000397 3300053131 Bacteria 15556
1375 Ga0500658_0063432 3300053134 Bacteria 1542
1376 Ga0500559_0000146 3300053136 Bacteria 55375
1377 Ga0500568_0000729 3300053139 Bacteria 23585
1378 Ga0500577_0001065 3300053142 Bacteria 7072
1379 Ga0500589_065107 3300053147 Bacteria 1662
1380 Ga0500590_074679 3300053148 Bacteria 1677
1381 Ga0500603_001248 3300053150 Bacteria 5898
1382 Ga0500604_0013015 3300053151 Bacteria 2251
1383 Ga0500616_0000041 3300053153 Bacteria 359328
1384 Ga0500616_0024588 3300053153 Bacteria 3344
1385 Ga0500619_002481 3300053154 Bacteria 3563
1386 Ga0500622_0001128 3300053156 Bacteria 22282
1387 Ga0500634_0007703 3300053161 Bacteria 5336
1388 Ga0500638_076420 3300053162 Bacteria 1595
1389 Ga0500639_000085 3300053163 Bacteria 44045
1390 Ga0500636_0003535 3300053177 Bacteria 8795
1391 Ga0500637_0000231 3300053178 Bacteria 20786
1392 Ga0500645_023268 3300053730 Bacteria 1900
1393 Ga0500599_000271 3300053736 Bacteria 5002
1394 Ga0500601_000073 3300053737 Bacteria 20487
1395 Ga0466962_0000559 3300061719 Bacteria 16346
1396 Ga0466962_0010024 3300061719 Bacteria 4547
1397 2501070895 2501025501 Bacteria 7768574
1398 2501084874 2501025502 Bacteria 9641094
1399 2501413723 2501025504 Bacteria 8008976
1400 2507510665 2507262055 Bacteria 8048963
1401 2508544468 2508501009 Bacteria 7784016
1402 2508697388 2508501042 Bacteria 8719808
1403 2509152063 2508501128 Bacteria 8613869
1404 2510252339 2510065045 Bacteria 7761063
1405 2511089598 2510917013 Bacteria 9951648
1406 2511095007 2510917014 Bacteria 8296963
1407 2511104663 2510917015 Bacteria 7950052
1408 2511251717 2511231003 Bacteria 5606035
1409 2511252915 2511231004 Bacteria 6669789
1410 2511267771 2511231006 Bacteria 6794709
1411 2511271352 2511231007 Bacteria 6306603
1412 2511271848 2511231007 Bacteria 6306603
1413 2511295287 2511231011 Bacteria 6149768
1414 2511299610 2511231012 Bacteria 6738011
1415 2511323225 2511231015 Bacteria 6598026
1416 2511329440 2511231016 Bacteria 6704427
1417 2511335019 2511231017 Bacteria 6503007
1418 2511338315 2511231018 Bacteria 6436256
1419 2511344554 2511231019 Bacteria 6520662
1420 2511351658 2511231020 Bacteria 6115223
1421 2511356019 2511231021 Bacteria 7302637
1422 2511363405 2511231022 Bacteria 6719296
1423 2511367322 2511231023 Bacteria 6808468
1424 2511372869 2511231024 Bacteria 5835885
1425 2511393692 2511231028 Bacteria 8046582
1426 2511827062 2511231156 Bacteria 6845832
1427 2512324672 2512047018 Bacteria 6663241
1428 2512327719 2512047018 Bacteria 6663241
1429 2512344737 2512047030 Bacteria 9031815
1430 2513551472 2513237082 Bacteria 8640282
1431 2513560122 2513237083 Bacteria 8410967
1432 2513627858 2513237092 Bacteria 8341956
1433 2513650686 2513237095 Bacteria 8976980
1434 2513661776 2513237096 Bacteria 8722461
1435 2513672608 2513237098 Bacteria 9902361
1436 2513715802 2513237104 Bacteria 10034502
1437 2513856985 2513237137 Bacteria 9558895
1438 2513877823 2513237139 Bacteria 8737671
1439 2513888252 2513237141 Bacteria 8496279
1440 2513923423 2513237145 Bacteria 8979722
1441 2513956978 2513237150 Bacteria 6553639
1442 2513963043 2513237151 Bacteria 6309801
1443 2514014974 2513237161 Bacteria 8871253
1444 2514043142 2513237165 Bacteria 6771773
1445 2514046188 2513237166 Bacteria 10373764
1446 2515630243 2515154112 Bacteria 8294334
1447 2515682520 2515154122 Bacteria 8609520
1448 2515688740 2515154123 Bacteria 6387382
1449 2516016879 2515154189 Bacteria 9629850
1450 2517106869 2517093001 Bacteria 9002274
1451 2517891195 2517572143 Bacteria 9484767
1452 2519457789 2519103095 Bacteria 6629912
1453 2521560464 2521172590 Bacteria 5047645
1454 2524437054 2524023205 Bacteria 8918781
1455 2524468792 2524023210 Bacteria 9029266
1456 2524533618 2524023228 Bacteria 10118060
1457 2527080649 2526164713 Bacteria 6780608
1458 2528856325 2528768022 Bacteria 10457665
1459 2550694140 2548876994 Bacteria 4904866
1460 2552746373 2551306352 Bacteria 3873115
1461 2553005585 2551306416 Bacteria 6152985
1462 2554812470 2554235132 Bacteria 6772433
1463 2555248218 2554235231 Bacteria 5215788
1464 2555672264 2554235341 Bacteria 6867980
1465 2563061803 2562617112 Bacteria 10918404
1466 2583792770 2582580891 Bacteria 6800976
1467 2583794769 2582580891 Bacteria 6800976
1468 2585294525 2582581311 Bacteria 6763856
1469 2596373449 2595698237 Bacteria 6712432
1470 2597032383 2596583598 Bacteria 5251611
1471 2597860343 2597489887 Bacteria 6666321
1472 2597863619 2597489888 Bacteria 6179543
1473 2597869579 2597489889 Bacteria 6297495
1474 2599358300 2599185160 Bacteria 6844013
1475 2599364649 2599185161 Bacteria 6960462
1476 2599370815 2599185162 Bacteria 6957254
1477 2599376837 2599185163 Bacteria 6995158
1478 2599383465 2599185164 Bacteria 6841688
1479 2599389912 2599185165 Bacteria 6843250
1480 2599396195 2599185166 Bacteria 6959206
1481 2599398609 2599185167 Bacteria 6353609
1482 2599408035 2599185168 Bacteria 6997636
1483 2599448469 2599185178 Bacteria 5365746
1484 2599450663 2599185179 Bacteria 6611171
1485 2599465115 2599185181 Bacteria 6844519
1486 2599471424 2599185182 Bacteria 6883168
1487 2599486815 2599185185 Bacteria 6652270
1488 2599487013 2599185185 Bacteria 6652270
1489 2599493970 2599185186 Bacteria 6831633
1490 2599505355 2599185188 Bacteria 6164180
1491 2599507090 2599185189 Bacteria 5862825
1492 2599513097 2599185190 Bacteria 6285678
1493 2599520786 2599185191 Bacteria 6297582
1494 2599736919 2599185239 Bacteria 8686614
1495 2599742968 2599185240 Bacteria 7968121
1496 2599807061 2599185257 Bacteria 6492581
1497 2599880251 2599185288 Bacteria 6666191
1498 2599891774 2599185290 Bacteria 6289611
1499 2599934533 2599185300 Bacteria 6062622
1500 2599947038 2599185303 Bacteria 6512725
1501 2599997666 2599185311 Bacteria 6354990
1502 2600196576 2599185352 Bacteria 7228948
1503 2600205086 2599185355 Bacteria 7968906
1504 2600217849 2599185356 Bacteria 6843884
1505 2600367143 2600254931 Bacteria 6734225
1506 2600813689 2600255067 Bacteria 6795583
1507 2601691721 2600255296 Bacteria 5784754
1508 2601778016 2600255313 Bacteria 6842543
1509 2601800442 2600255318 Bacteria 6383414
1510 2603860738 2602042107 Bacteria 6226103
1511 2606078750 2603880185 Bacteria 6379190
1512 2606125590 2603880199 Bacteria 6377649
1513 2608384783 2606217733 Bacteria 6360972
1514 2617352646 2617270735 Bacteria 9163226
1515 2621300109 2619619299 Bacteria 6649820
1516 2624482857 2623620443 Bacteria 6427864
1517 2624494398 2623620446 Bacteria 6500345
1518 2640733327 2639762793 Bacteria 3943681
1519 2643870462 2643221571 Bacteria 6228673
1520 2643957544 2643221589 Bacteria 6250934
1521 2644025658 2643221602 Bacteria 6249926
1522 2644187769 2643221633 Bacteria 6733554
1523 2644286016 2643221650 Bacteria 7029547
1524 2644620945 2643221713 Bacteria 6554480
1525 2652546489 2651869719 Bacteria 6047974
1526 2671100821 2667528171 Bacteria 6900659
1527 2671123198 2667528175 Bacteria 7532676
1528 2671773381 2671180172 Bacteria 6495783
1529 2676742075 2675903129 Bacteria 7964495
1530 2677896142 2675903420 Bacteria 6247433
1531 2678230358 2675903507 Bacteria 3737791
1532 2678265435 2675903515 Bacteria 6580491
1533 2713478362 2711768613 Bacteria 11048459
1534 2715752293 2713897148 Bacteria 5883533
1535 2715759032 2713897149 Bacteria 6506249
1536 2718636071 2718217725 Bacteria 5758958
1537 2719641431 2718217991 Bacteria 7829542
1538 2723248548 2721755607 Bacteria 5841722
1539 2723876852 2721755763 Bacteria 4464185
1540 2728755563 2728368998 Bacteria 8720350
1541 2738670118 2738541265 Bacteria 6594665
1542 2738747478 2738541281 Bacteria 5112672
1543 2738748511 2738541282 Bacteria 6593925
1544 2738806472 2738541294 Bacteria 6925949
1545 2738821679 2738541296 Bacteria 7285013
1546 2738834161 2738541298 Bacteria 7286732
1547 2738857553 2738541303 Bacteria 6591772
1548 2738875365 2738541306 Bacteria 7284992
1549 2738893832 2738541309 Bacteria 6926455
1550 2739187318 2738543002 Bacteria 7284546
1551 2739198203 2738543004 Bacteria 6381073
1552 2739221963 2738543008 Bacteria 7282815
1553 2739260967 2738543015 Bacteria 6750701
1554 2739316604 2738543025 Bacteria 6600348
1555 2739356760 2738543032 Bacteria 5115625
1556 2743739885 2740892503 Bacteria 6855563
1557 2745005889 2744054620 Bacteria 6551379
1558 2745076265 2744054633 Bacteria 8678936
1559 2746088626 2744054900 Bacteria 8399525
1560 2746092665 2744054901 Bacteria 8397047
1561 2753569568 2751185846 Bacteria 7242164
1562 2765568384 2765235838 Bacteria 5445269
1563 2765585051 2765235841 Bacteria 6137024
1564 2774121769 2773857670 Bacteria 6407454
1565 2774137010 2773857673 Bacteria 6513460
1566 2774389083 2773857761 Bacteria 3837365
1567 2774439282 2773857770 Bacteria 3911866
1568 2784262363 2784132063 Bacteria 6262788
1569 2784314432 2784132072 Bacteria 6596533
1570 2792835730 2791355137 Bacteria 9654227
1571 2793066538 2791355197 Bacteria 8420563
1572 2793076444
1573 2794598424 2791355520 Bacteria 5948615
1574 2805917048 2802429603 Bacteria 8777136
1575 2807409124 2806310737 Bacteria 5751088
1576 2807457460 2806310745 Bacteria 5742165
1577 2808857989 2808606361 Bacteria 6136259
1578 2808926603 2808606376 Bacteria 6248667
1579 2808930823 2808606377 Bacteria 6646337
1580 2808937483 2808606378 Bacteria 6177535
1581 2808948764 2808606380 Bacteria 6248705
1582 2808952945 2808606381 Bacteria 6646461
1583 2808959275 2808606382 Bacteria 6841132
1584 2808966474 2808606383 Bacteria 6138645
1585 2808971679 2808606384 Bacteria 8474373
1586 2808978809 2808606385 Bacteria 6711065
1587 2808994541 2808606388 Bacteria 6706662
1588 2809001357 2808606389 Bacteria 6138126
1589 2809006508 2808606390 Bacteria 8476311
1590 2809013574 2808606391 Bacteria 8308166
1591 2809219320 2808606445 Bacteria 6057339
1592 2812365946 2811994881 Bacteria 6298475
1593 2817259975 2816332253 Bacteria 6764532
1594 2817277638 2816332256 Bacteria 6891714
1595 2817456949 2816332286 Bacteria 6853759
1596 2817491456 2816332298 Bacteria 6852809
1597 2818242545 2816332527 Bacteria 8933356
1598 2819545352 2818991436 Bacteria 5376622
1599 2819591891 2818991445 Bacteria 4955017
1600 2819617133 2818991449 Bacteria 5518009
1601 2819632420 2818991452 Bacteria 8442785
1602 2819659149 2818991456 Bacteria 6123676
1603 2819706489 2818991464 Bacteria 6907494
1604 2823421333 2823421272 Bacteria 5372474
1605 2824662494 2824661429 Bacteria 9877870
1606 2824675296 2824671348 Bacteria 8369588
1607 2824681171 2824679649 Bacteria 8248951
1608 2824691529 2824687955 Bacteria 8360029
1609 2824697389 2824696289 Bacteria 8335049
1610 2824705587 2824704595 Bacteria 9667483
1611 2824756315 2824753945 Bacteria 9787441
1612 2824763999 2824763712 Bacteria 9792355
1613 2824780255 2824773399 Bacteria 8360218
1614 2825655671 2825651385 Bacteria 6715909
1615 2829750805 2829745981 Bacteria 5406054
1616 2834033508 2834028612 Bacteria 6354979
1617 2834643852 2834641062 Bacteria 5559922
1618 2838125323 2838122688 Bacteria 8803140
1619 2839094729 2839094727 Bacteria 5534556
1620 2841942024 2841941048 Bacteria 8688029
1621 2841951436 2841949485 Bacteria 8680857
1622 2841958886 2841957949 Bacteria 8652217
1623 2841968549 2841966195 Bacteria 8673214
1624 2841976250 2841974524 Bacteria 8931498
1625 2841987615 2841983080 Bacteria 8395090
1626 2842324598 2842324504 Bacteria 9364110
1627 2842348877 2842348783 Bacteria 9002918
1628 2842457417 2842454564 Bacteria 8730687
1629 2842701310 2842698319 Bacteria 5190321
1630 2842827179 2842826826 Bacteria 5974129
1631 2842837009 2842832357 Bacteria 5959113
1632 2842843270 2842837860 Bacteria 6066181
1633 2842847748 2842843487 Bacteria 6004777
1634 2844666436 2844665904 Bacteria 6817974
1635 2847944618 2847939898 Bacteria 8606328
1636 2849081147 2849076700 Bacteria 7039503
1637 2852614196 2852612431 Bacteria 6885235
1638 2852660982 2852657418 Bacteria 6472974
1639 2852668067 2852667396 Bacteria 6885555
1640 2857524823 2857524615 Bacteria 6615449
1641 2858697851 2858688981 Bacteria 8184122
1642 2860343842 2860339153 Bacteria 6846989
1643 2860870355 2860867994 Bacteria 5645326
1644 2861694362 2861691609 Bacteria 5628931
1645 2863421460 2863421361 Bacteria 7300805
1646 2870069115 2870068957 Bacteria 8925310
1647 2874634662 2874628541 Bacteria 8630250
1648 2874649980 2874645413 Bacteria 8214782
1649 2876775494 2876771140 Bacteria 8287509
1650 2876826154 2876818435 Bacteria 8274608
1651 2878034790 2878029506 Bacteria 6418441
1652 2879079419 2879074833 Bacteria 8279565
1653 2879109696 2879099564 Bacteria 10442239
1654 2880235439 2880230671 Bacteria 6140320
1655 2881667671 2881665667 Bacteria 8175609
1656 2883094639 2883087390 Bacteria 9532701
1657 2884816851 2884811622 Bacteria 5552861
1658 2884837720 2884836552 Bacteria 5219991
1659 2884854012 2884852848 Bacteria 5221161
1660 2885268788 2885266251 Bacteria 4796748
1661 2885279763 2885270888 Bacteria 9831543
1662 2885382926 2885374607 Bacteria 8927485
1663 2888381938 2888378607 Bacteria 9652610
1664 2888388706 2888388044 Bacteria 7304136
1665 2889310086 2889306138 Bacteria 6358934
1666 2893069337 2893066018 Bacteria 6158120
1667 2896154871 2896154374 Bacteria 5221518
1668 2900637315 2900634093 Bacteria 10263517
1669 2901310331 2901300506 Bacteria 8463898
1670 2902335314 2902330777 Bacteria 6395352
1671 2902691213 2902682994 Bacteria 8951596
1672 2903749683 2903748898 Bacteria 9972761
1673 2903768483 2903768456 Bacteria 9749579
1674 2904425814 2904424332 Bacteria 7633521
1675 2904442763 2904439833 Bacteria 5931679
1676 2904522997 2904518522 Bacteria 6068986
1677 2904535024 2904530477 Bacteria 5876334
1678 2904555906 2904550169 Bacteria 6221258
1679 2904565638 2904564687 Bacteria 7609577
1680 2904572681 2904571731 Bacteria 7608790
1681 2904588638 2904584206 Bacteria 6028872
1682 2904594288 2904589729 Bacteria 6113573
1683 2904604870 2904601388 Bacteria 5884906
1684 2904618979 2904615490 Bacteria 10047340
1685 2904698894 2904690495 Bacteria 9412302
1686 2904701082
1687 2904720417 2904711408 Bacteria 9771557
1688 2906616379
1689 2906630520 2906626472 Bacteria 8826946
1690 2906638167 2906635258 Bacteria 8601019
1691 2906648302 2906643746 Bacteria 8722424
1692 2906662842 2906660503 Bacteria 8595048
1693 2908449357 2908446538 Bacteria 6829095
1694 2908741515 2908739725 Bacteria 8628932
1695 2908758690 2908756301 Bacteria 8864324
1696 2909044301 2909042592 Bacteria 6499737
1697 2912967314 2912963787 Bacteria 5646108
1698 2913041983 2913036834 Bacteria 6704877
1699 2917076145 2917070673 Bacteria 6868303
1700 2919067828 2919063839 Bacteria 6302690
1701 2919078709 2919073203 Bacteria 6531949
1702 2919083108 2919079590 Bacteria 5946433
1703 2919156997 2919155634 Bacteria 4860545
1704 2919185346 2919182534 Bacteria 3907101
1705 2919390716 2919385768 Bacteria 5897293
1706 2919461788 2919456309 Bacteria 6586567
1707 2919490995 2919487758 Bacteria 5929766
1708 2919502954 2919501602 Bacteria 5286340
1709 2919701501 2919697872 Bacteria 6553725
1710 2921651754 2921643360 Bacteria 11448031
1711 2922371887
1712 2922399395 2922393267 Bacteria 8285685
1713 2922431625
1714 2923158975 2923153595 Bacteria 6870622
1715 2923514254 2923510766 Bacteria 5926163
1716 2923519967 2923519811 Bacteria 6298479
1717 2923592039 2923586266 Bacteria 6565975
1718 2926064627 2926063275 Bacteria 5285848
1719 2928060545 2928058823 Bacteria 5520022
1720 2928113569 2928108538 Bacteria 7360024
1721 2928127025 2928125067 Bacteria 5937560
1722 2928132965 2928130867 Bacteria 5467269
1723 2928140718 2928135762 Bacteria 7259641
1724 2928159957 2928157003 Bacteria 7522202
1725 2928164002 2928163908 Bacteria 7561269
1726 2928177132 2928170801 Bacteria 8785406
1727 2928506165 2928503688 Bacteria 7268108
1728 2928538796 2928536128 Bacteria 7657547
1729 2929149362 2929144301 Bacteria 6622272
1730 2929192855 2929189879 Bacteria 5930554
1731 2929616762 2929615660 Bacteria 9193770
1732 2929625506 2929624759 Bacteria 9339455
1733 2931373221 2931369376 Bacteria 6847892
1734 2931393647 2931390751 Bacteria 6273349
1735 2931397512 2931396565 Bacteria 7251677
1736 2932791215 2932784394 Bacteria 9704911
1737 2932799262 2932794094 Bacteria 7915132
1738 2932803743 2932801729 Bacteria 7987968
1739 2932811602 2932809354 Bacteria 9135765
1740 2932826481 2932818245 Bacteria 9955613
1741 2932834173 2932828146 Bacteria 9745859
1742 2933577955 2933577622 Bacteria 9116884
1743 2935359569 2935353572 Unclassified 6955622
1744 2935610601 2935608549 Bacteria 8203142
1745 2935624003 2935616580 Bacteria 9032984
1746 2935635821 2935630451 Bacteria 8169952
1747 2935647049 2935638405 Bacteria 10015038
1748 2935656209 2935648319 Bacteria 8801166
1749 2935665081 2935656913 Bacteria 8965014
1750 2935674259 2935665750 Bacteria 9571747
1751 2935682431 2935675223 Bacteria 9928132
1752 2935691646 2935684952 Bacteria 9590419
1753 2935699520 2935694250 Bacteria 9291695
1754 2935707749 2935703347 Bacteria 10242284
1755 2935719480 2935713505 Bacteria 9608509
1756 2935728920 2935722832 Bacteria 9608746
1757 2935737839 2935732158 Bacteria 9706831
1758 2935747215 2935741537 Bacteria 9707219
1759 2935757985 2935750917 Bacteria 9590372
1760 2935766623 2935760218 Bacteria 9817913
1761 2935770613 2935769743 Bacteria 7878163
1762 2935787102 2935785616 Bacteria 7962367
1763 2935795150 2935793552 Bacteria 8012592
1764 2935809496 2935801545 Bacteria 9301974
1765 2935817745 2935810662 Bacteria 9401221
1766 2935820098 2935819856 Bacteria 8261050
1767 2935836316 2935827899 Bacteria 10038562
1768 2935845227 2935837841 Bacteria 9454360
1769 2935849891 2935847175 Bacteria 8228321
1770 2935862147 2935855204 Bacteria 9035059
1771 2935870926 2935864058 Bacteria 9784707
1772 2935881319 2935873716 Bacteria 9632195
1773 2935884379 2935883170 Bacteria 7964738
1774 2935914421 2935908558 Bacteria 8568796
1775 2935918971 2935916978 Bacteria 9113783
1776 2935932198 2935926038 Bacteria 8601059
1777 2935940796 2935934488 Bacteria 8602579
1778 2935948617 2935942939 Bacteria 8599779
1779 2935957276 2935951376 Bacteria 8602333
1780 2935963705 2935959822 Bacteria 7869783
1781 2935973752 2935967501 Bacteria 8603075
1782 2935979591 2935975950 Bacteria 8347125
1783 2935991446 2935984226 Bacteria 8302647
1784 2936001066 2935992306 Bacteria 9802711
1785 2936005507 2936002035 Bacteria 9362176
1786 2936019051 2936011229 Bacteria 8801034
1787 2936023156 2936019824 Bacteria 8804134
1788 2936032391 2936028420 Bacteria 8965941
1789 2936042038 2936037263 Bacteria 9446081
1790 2936050252 2936046547 Bacteria 8903709
1791 2936061040 2936055302 Bacteria 8785755
1792 2939641782 2939636861 Bacteria 6297853
1793 2939654813 2939651529 Bacteria 5895393
1794 2940564104 2940556831 Bacteria 9590747
1795 2941512342 2941507105 Bacteria 8166816
1796 2941520153 2941515067 Bacteria 8166720
1797 2941528302 2941523033 Bacteria 8169134
1798 2941535088 2941531003 Bacteria 7653939
1799 2941545554 2941538514 Bacteria 9402094
1800 2945933193 2945928738 Bacteria 6053221
1801 2945938132 2945934425 Bacteria 7444609
1802 2945964169 2945961074 Bacteria 7342064
1803 2946009422 2946006987 Bacteria 6705746
1804 2946030598 2946027586 Bacteria 6049274
1805 2947238085 2947233263 Bacteria 6439278
1806 2954768657 2954767861 Bacteria 5535784
1807 2969309608 2969304461 Bacteria 6601805
1808 2974294659 2974289157 Bacteria 6080362
1809 2981994395 2981990288 Bacteria 7590678
1810 2984287193 2984286254 Bacteria 6702062
1811 2984288840 2984286254 Bacteria 6702062
1812 2988730907 2988728565 Bacteria 6124362
1813 2989350406 2989349275 Bacteria 6349068
1814 2990705151 2990703756 Bacteria 7715990
1815 2998144859 2998139840 Bacteria 6073514
1816 3005481420 3005474847 Bacteria 9259049
1817 3005596954 3005594810 Bacteria 8716512
1818 3005712985 3005710791 Bacteria 7622528
1819 3007398599 3007395558 Bacteria 6755444
1820 3007420403 3007419365 Bacteria 7026924
1821 3007615237 3007614139 Bacteria 6053559
1822 3007722248 3007718800 Bacteria 5971527
1823 3007805579 3007803356 Bacteria 5931491
1824 3007860066 3007855910 Bacteria 5637581
1825 3007866316 3007861166 Bacteria 6045338
1826 3007875826 3007872151 Bacteria 5268868
1827 637322682 637000220 Bacteria 7074893
1828 641337799 641228493 Bacteria 3999591
1829 642426204 641736151 Bacteria 7477263
1830 642418069 641736154 Bacteria 7689995
1831 642594385 642555112 Bacteria 8676562
1832 642622962 642555113 Bacteria 8214658
1833 643392226 643348555 Bacteria 3914947
1834 644749367 644736347 Bacteria 6476522
1835 8002395155 8002392321 Bacteria 4159911
1836 8003404808 8003400568 Bacteria 5535898
1837 8003957387 8003955200 Bacteria 8601927
1838 8006978949 8006973647 Bacteria 10679141
1839 8006984758 8006984368 Bacteria 9651211
1840 8015691454 8015687852 Bacteria 6613826
1841 8015693061 8015687852 Bacteria 6613826
1842 8016515794 8016511872 Bacteria 9921665
1843 8016590007 8016583857 Bacteria 10421953
1844 8016633442 8016630954 Bacteria 9217207
1845 8017060710 8017057580 Bacteria 10023680
1846 8018850683 8018845410 Bacteria 8933938
1847 8019565157 8019555841 Bacteria 9642137
1848 8019575258 8019565922 Bacteria 9639779
1849 8019587945 8019586578 Bacteria 10212056
1850 8019603385 8019597564 Bacteria 10041141
1851 8019625695 8019619141 Bacteria 9218857
1852 8019636598 8019629233 Bacteria 8687553
1853 8019655918 8019648815 Bacteria 10014479
1854 8019664394 8019659431 Bacteria 8577854
1855 8019673988 8019668869 Bacteria 8791617
1856 8019682137 8019678201 Bacteria 8863603
1857 8019687915 8019687851 Bacteria 8712826
1858 8019771402 8019769354 Bacteria 6924660
1859 8019781882 8019775933 Bacteria 6858656
1860 8020808528 8020807995 Bacteria 6801506
1861 8020939546 8020938398 Bacteria 7472757
1862 8020947590 8020945358 Bacteria 8467355
1863 8020953868 8020953355 Bacteria 7439080
1864 8021126839 8021120328 Bacteria 8782274
1865 8029996036 8029995093 Bacteria 5990776
1866 8034965501 8034962539 Bacteria 4884839
1867 8039099099 8039098773 Bacteria 6602928
1868 8040170898 8040167225 Bacteria 6542727
1869 8040175189 8040173305 Bacteria 6827067
1870 8052496445 8052494512 Bacteria 5765634
1871 8054287003 8054285046 Bacteria 6919322
1872 8054352507 8054347763 Bacteria 5901107
1873 8054506606 8054503363 Bacteria 6101651
1874 8054932440 8054929484 Bacteria 5599761
1875 8055267438 8055266321 Bacteria 7999742
1876 8055748408 8055742211 Bacteria 9226248
1877 8055774627 8055770955 Bacteria 6827675
1878 8055776308 8055770955 Bacteria 6827675
1879 8055821390 8055817908 Bacteria 6609162
1880 8055882006 8055878733 Bacteria 5907058
1881 8056119491 8056115690 Bacteria 5527654
1882 8056122578 8056120720 Bacteria 5758328
1883 8056131072 8056125926 Bacteria 6228218
1884 8056134487 8056131705 Bacteria 6107031
1885 8056139304 8056137416 Bacteria 6147080
1886 8056154876 8056148874 Bacteria 6479865
1887 8056158178 8056155041 Bacteria 6486948
1888 8056165834 8056161164 Bacteria 6106669
1889 8056171709 8056166840 Bacteria 5820959
1890 8056172388 8056172158 Bacteria 6133900
1891 8056179134 8056177738 Bacteria 6748268
1892 8056571888 8056569372 Bacteria 5997322
1893 8056687265 8056681323 Bacteria 8472857
1894 8056690650 8056689827 Bacteria 6712655
1895 8056976201 8056967851 Bacteria 9038162
1896 8057805148 8057798959 Bacteria 6713499
1897 Ga0207678_10020313
1898 MRS2a_Contig_116
1899 MRS2a_Contig_6751
1900 JGI24741J21665_1000205
1901 JGI24740J21852_10000417
1902 JGI24740J21852_10000439
1903 JGI24740J21852_10000760
1904 JGI24740J21852_10015327
1905 JGI24739J22299_10002573
1906 JGI24739J22299_10038511
1907 JGI24737J22298_10002427
1908 JGI24737J22298_10012337
1909 JGI24737J22298_10034108
1910 JGI24735J21928_10000196
1911 JGI24735J21928_10001455
1912 JGI24735J21928_10003047
1913 JGI24735J21928_10004296
1914 JGI25156J39149_1003155
1915 JGI25156J39149_1003951
1916 JGI25156J39149_1010327
1917 JGI25162J39368_1000502
1918 JGI25162J39368_1000626
1919 JGI25162J39368_1000664
1920 JGI25154J39366_1000133
1921 JGI25163J39215_1001643
1922 JGI25163J39215_1002276
1923 JGI25164J39214_1000340
1924 JGI25164J39214_1000400
1925 JGI25150J39212_1005748
1926 JGI25151J46595_10004227
1927 JGI25151J46595_10029166
1928 JGI25165J46597_1000391
1929 JGI25165J46597_1000745
1930 JGI25165J46597_1000776
1931 rootH1_10062200
1932 JGI25160J50197_1000447
1933 JGI25160J50197_1007409
1934 Ga0006562J51391_1006335
1935 Ga0055538_1000007
1936 Ga0055538_1000024
1937 Ga0055538_1000305
1938 Ga0055539_1000011
1939 Ga0055539_1000031
1940 Ga0055539_1000073
1941 Ga0055539_1000324
1942 Ga0055533_1000014
1943 Ga0055533_1000041
1944 Ga0055533_1000305
1945 Ga0055533_1002148
1946 Ga0055533_1002294
1947 Ga0055532_1000009
1948 Ga0055532_1000090
1949 Ga0055525_1000016
1950 Ga0055525_1000049
1951 Ga0055525_1000439
1952 Ga0055525_1000938
1953 Ga0055527_1000900
1954 Ga0055535_1000085
1955 Ga0055529_1000134
1956 Ga0055526_1008653
1957 Ga0055526_1009460
1958 Ga0055526_1012176
1959 Ga0055524_1000413
1960 Ga0055536_1000059
1961 Ga0055536_1000061
1962 Ga0055536_1000154
1963 Ga0055536_1002544
1964 Ga0055536_1002620
1965 Ga0055534_1001757
1966 Ga0055534_1002165
1967 Ga0055534_1006164
1968 Ga0055528_1001944
1969 Ga0055530_10000096
1970 Ga0055530_10000171
1971 Ga0055530_10000874
1972 Ga0055530_10002302
1973 Ga0055540_1000084
1974 Ga0055540_1000214
1975 Ga0055540_1000648
1976 Ga0055540_1001741
1977 Ga0055531_10000266
1978 Ga0055541_1000008
1979 Ga0055541_1000022
1980 Ga0055541_1000213
1981 Ga0055541_1000346
1982 Ga0055541_1006842
1983 Ga0058692_1000014
1984 Ga0055543_1004552
1985 Ga0065165_1000244
1986 Ga0065165_1000368
1987 Ga0065165_1001437
1988 Ga0065714_10000085
1989 Ga0065714_10005412
1990 Ga0065714_10006886
1991 Ga0065704_10018874
1992 Ga0065704_10084484
1993 Ga0065704_10091819
1994 Ga0065704_10150193
1995 Ga0070658_10017560
1996 Ga0070658_10018393
1997 Ga0070658_10092389
1998 Ga0070658_10143166
1999 Ga0070683_100138178
2000 Ga0070670_100005474
2001 Ga0070670_100145170
2002 Ga0070666_10012949
2003 Ga0070680_100019559
2004 Ga0070660_100001445
2005 Ga0070660_100001741
2006 Ga0070660_100019883
2007 Ga0070691_10027029
2008 Ga0070661_100000683
2009 Ga0070661_100000829
2010 Ga0070668_100036478
2011 Ga0070668_100055824
2012 Ga0070669_100001270
2013 Ga0070669_100006569
2014 Ga0070669_100018381
2015 Ga0070675_100139551
2016 Ga0070659_100000035
2017 Ga0070659_100001478
2018 Ga0070667_100002744
2019 Ga0070667_100019966
2020 Ga0070667_100022517
2021 Ga0070709_10000407
2022 Ga0070709_10027331
2023 Ga0070714_100185287
2024 Ga0070714_100235201
2025 Ga0070713_100047323
2026 Ga0070713_100053812
2027 Ga0070710_10006310
2028 Ga0070710_10035406
2029 Ga0070711_100006265
2030 Ga0070663_100000251
2031 Ga0070663_100003477
2032 Ga0070663_100045511
2033 Ga0070663_100160335
2034 Ga0070678_100005891
2035 Ga0070662_100116271
2036 Ga0068867_100074043
2037 Ga0070706_100074209
2038 Ga0070698_100122056
2039 Ga0070684_100048880
2040 Ga0070697_100154854
2041 Ga0068853_100034377
2042 Ga0068853_100069502
2043 Ga0070665_100007326
2044 Ga0070665_100021701
2045 Ga0068855_100000366
2046 Ga0068855_100004438
2047 Ga0068855_100024563
2048 Ga0068855_100145412
2049 Ga0068855_100159275
2050 Ga0070664_100000623
2051 Ga0070664_100000878
2052 Ga0068857_100013415
2053 Ga0068857_100024577
2054 Ga0068857_100085485
2055 Ga0068857_100101512
2056 Ga0068857_100209200
2057 Ga0068854_100000308
2058 Ga0068854_100093960
2059 Ga0068856_100001206
2060 Ga0068856_100021342
2061 Ga0068856_100069364
2062 Ga0068856_100160460
2063 Ga0068852_100017907
2064 Ga0068852_100021423
2065 Ga0068852_100054812
2066 Ga0068859_100080918
2067 Ga0068859_100334951
2068 Ga0068851_10000316
2069 Ga0068851_10019934
2070 Ga0068863_100083044
2071 Ga0068858_100240812
2072 Ga0068860_100019238
2073 Ga0081455_10010447
2074 Ga0081455_10010813
2075 Ga0081540_1003649
2076 Ga0081540_1006563
2077 Ga0081540_1032672
2078 Ga0081540_1038988
2079 Ga0081540_1055583
2080 Ga0075365_10017044
2081 Ga0075365_10033426
2082 Ga0075368_10002670
2083 Ga0075368_10032589
2084 Ga0075363_100017395
2085 Ga0075364_10041753
2086 Ga0075364_10060885
2087 Ga0075364_10132837
2088 Ga0070715_10061041
2089 Ga0070716_100007807
2090 Ga0070716_100036500
2091 Ga0070716_100043300
2092 Ga0075362_10009652
2093 Ga0075367_10039150
2094 Ga0075367_10059488
2095 Ga0075369_10039897
2096 Ga0075366_10004392
2097 Ga0075366_10012373
2098 Ga0097621_100104136
2099 Ga0075370_10008865
2100 Ga0075370_10041818
2101 Ga0068871_100070465
2102 Ga0075430_100009079
2103 Ga0075429_100011122
2104 Ga0097620_100080913
2105 Ga0097620_100334939
2106 Ga0099824_1011829
2107 Ga0099822_1005398
2108 Ga0099823_1000091
2109 Ga0079104_1000008
2110 Ga0079104_1000707
2111 Ga0079104_1003900
2112 Ga0099826_10000022
2113 Ga0099826_10013588
2114 Ga0075435_100196129
2115 Ga0105251_10000016
2116 Ga0105251_10000756
2117 Ga0105251_10001655
2118 Ga0105251_10001720
2119 Ga0105251_10007644
2120 Ga0105251_10014969
2121 Ga0105251_10031596
2122 Ga0105251_10037622
2123 Ga0105251_10055820
2124 Ga0105251_10072451
2125 Ga0105244_10000445
2126 Ga0105244_10000722
2127 Ga0105244_10000848
2128 Ga0105244_10004788
2129 Ga0105244_10005113
2130 Ga0105244_10005282
2131 Ga0105244_10007991
2132 Ga0105244_10010257
2133 Ga0105244_10022095
2134 Ga0105244_10023508
2135 Ga0105244_10032773
2136 Ga0105244_10032791
2137 Ga0105244_10050878
2138 Ga0105250_10000327
2139 Ga0105250_10000871
2140 Ga0105250_10003137
2141 Ga0105250_10004372
2142 Ga0105250_10008745
2143 Ga0105250_10051581
2144 Ga0105250_10052821
2145 Ga0105250_10068048
2146 Ga0105240_10001168
2147 Ga0105240_10007353
2148 Ga0105240_10013962
2149 Ga0105240_10019503
2150 Ga0105240_10096984
2151 Ga0105240_10146644
2152 Ga0105240_10159931
2153 Ga0105240_10276454
2154 Ga0105245_10035213
2155 Ga0105245_10122928
2156 Ga0105247_10000727
2157 Ga0105243_10000115
2158 Ga0105243_10000163
2159 Ga0105243_10001544
2160 Ga0105243_10001757
2161 Ga0105243_10001924
2162 Ga0105243_10002556
2163 Ga0105243_10025527
2164 Ga0105243_10025925
2165 Ga0105241_10006488
2166 Ga0105241_10123341
2167 Ga0105237_10000093
2168 Ga0105237_10003198
2169 Ga0105237_10006810
2170 Ga0105237_10022053
2171 Ga0105237_10025336
2172 Ga0105237_10048393
2173 Ga0105237_10104263
2174 Ga0105237_10125223
2175 Ga0105238_10000031
2176 Ga0105238_10040672
2177 Ga0105238_10053968
2178 Ga0105238_10085629
2179 Ga0105238_10123118
2180 Ga0105238_10126943
2181 Ga0105249_10022548
2182 Ga0099796_10020287
2183 Ga0105239_10001806
2184 Ga0105239_10002893
2185 Ga0105239_10024933
2186 Ga0105239_10034894
2187 Ga0105239_10042348
2188 Ga0105239_10079968
2189 Ga0105246_10001153
2190 Ga0105246_10001933
2191 Ga0105246_10029137
2192 Ga0105246_10177467
2193 Ga0157345_1000154
2194 Ga0157345_1002204
2195 Ga0157373_10005588
2196 Ga0157373_10005943
2197 Ga0157373_10006624
2198 Ga0157373_10016497
2199 Ga0157373_10021291
2200 Ga0157373_10109989
2201 Ga0157373_10112505
2202 Ga0157371_10001237
2203 Ga0157371_10009792
2204 Ga0157371_10016290
2205 Ga0157371_10023424
2206 Ga0157371_10172865
2207 Ga0157370_10000930
2208 Ga0157370_10003240
2209 Ga0157370_10019712
2210 Ga0157370_10022770
2211 Ga0157369_10000067
2212 Ga0157369_10000622
2213 Ga0157369_10004182
2214 Ga0157369_10013986
2215 Ga0157369_10030355
2216 Ga0157369_10034300
2217 Ga0157369_10056554
2218 Ga0157369_10057580
2219 Ga0157369_10065958
2220 Ga0157369_10166955
2221 Ga0157374_10000219
2222 Ga0163162_10001053
2223 Ga0163162_10001780
2224 Ga0163162_10060633
2225 Ga0157372_10001285
2226 Ga0157372_10002581
2227 Ga0157372_10011859
2228 Ga0157372_10033148
2229 Ga0157372_10054493
2230 Ga0157375_10008932
2231 Ga0157375_10333976
2232 Ga0182008_10005238
2233 Ga0182008_10006760
2234 Ga0182008_10013195
2235 Ga0182008_10017485
2236 Ga0157376_10046771
2237 Ga0182006_1001712
2238 Ga0182006_1007656
2239 Ga0182006_1009278
2240 Ga0182006_1011378
2241 Ga0182006_1012197
2242 Ga0182006_1013028
2243 Ga0182006_1016766
2244 Ga0182006_1018078
2245 Ga0182006_1018576
2246 Ga0182006_1040422
2247 Ga0182006_1041211
2248 Ga0182007_10001412
2249 Ga0182007_10019156
2250 Ga0182005_1000500
2251 Ga0182005_1004949
2252 Ga0182005_1014535
2253 Ga0182005_1021236
2254 Ga0183362_10003
2255 Ga0183361_10012
2256 Ga0163161_10006169
2257 Ga0163161_10047143
2258 Ga0163161_10051253
2259 Ga0163161_10210036
2260 Ga0206351_10815903
2261 Ga0154015_1153479
2262 Ga0214542_1010499
2263 Ga0214543_1000005
2264 Ga0213875_10024758
2265 Ga0224712_10000086
2266 Ga0209435_100305
2267 Ga0209760_100009
2268 Ga0209760_100157
2269 Ga0209760_100772
2270 Ga0209784_100006
2271 Ga0209784_100018
2272 Ga0209784_100023
2273 Ga0209784_100323
2274 Ga0209784_100428
2275 Ga0209566_100002
2276 Ga0209566_100016
2277 Ga0209566_100019
2278 Ga0209566_100555
2279 Ga0209566_100562
2280 Ga0209566_100572
2281 Ga0209674_100010
2282 Ga0209674_100030
2283 Ga0209674_100034
2284 Ga0209674_100355
2285 Ga0209674_100374
2286 Ga0209674_101472
2287 Ga0209674_103235
2288 Ga0209672_100028
2289 Ga0209672_100038
2290 Ga0209672_100110
2291 Ga0209672_100175
2292 Ga0209672_100806
2293 Ga0209147_100018
2294 Ga0209147_100027
2295 Ga0209147_100235
2296 Ga0209147_100277
2297 Ga0209147_100294
2298 Ga0209563_100034
2299 Ga0209563_100037
2300 Ga0209563_100041
2301 Ga0209563_100258
2302 Ga0209563_101545
2303 Ga0207427_100016
2304 Ga0207427_100092
2305 Ga0207427_101010
2306 Ga0209437_100011
2307 Ga0209437_100065
2308 Ga0209437_100565
2309 Ga0209437_109964
2310 Ga0209258_100028
2311 Ga0209258_100191
2312 Ga0209258_100268
2313 Ga0209258_100289
2314 Ga0207425_1002758
2315 Ga0209646_1000120
2316 Ga0209646_1000153
2317 Ga0209646_1002598
2318 Ga0209026_1010400
2319 Ga0209677_100007
2320 Ga0209677_100019
2321 Ga0209677_100021
2322 Ga0209677_100438
2323 Ga0209148_1000081
2324 Ga0209148_1000224
2325 Ga0209148_1000297
2326 Ga0209148_1003390
2327 Ga0209759_1000406
2328 Ga0209759_1001683
2329 Ga0209759_1011208
2330 Ga0209233_1000019
2331 Ga0209233_1000085
2332 Ga0209233_1000483
2333 Ga0209233_1013553
2334 Ga0209565_1000257
2335 Ga0209565_1000987
2336 Ga0209455_1000050
2337 Ga0209455_1000107
2338 Ga0209455_1000879
2339 Ga0209673_1000038
2340 Ga0209675_1000302
2341 Ga0209675_1000645
2342 Ga0209675_1003576
2343 Ga0209675_1007019
2344 Ga0209675_1009151
2345 Ga0209676_1000076
2346 Ga0209676_1000147
2347 Ga0209676_1000183
2348 Ga0209676_1000264
2349 Ga0209676_1000313
2350 Ga0209676_1001123
2351 Ga0209676_1001708
2352 Ga0209676_1010886
2353 Ga0209676_1020041
2354 Ga0209025_1000229
2355 Ga0209025_1000256
2356 Ga0209025_1000508
2357 Ga0209025_1000610
2358 Ga0209025_1001636
2359 Ga0209025_1004445
2360 Ga0209564_1000310
2361 Ga0209564_1001587
2362 Ga0209564_1002607
2363 Ga0209564_1003460
2364 Ga0209564_1004695
2365 Ga0209564_1011300
2366 Ga0209758_1000423
2367 Ga0209758_1003740
2368 Ga0209758_1006087
2369 Ga0209758_1008604
2370 Ga0209758_1025788
2371 Ga0209050_1000062
2372 Ga0209050_1000063
2373 Ga0209050_1000106
2374 Ga0209050_1000701
2375 Ga0209050_1002668
2376 Ga0209256_1000248
2377 Ga0209256_1000300
2378 Ga0207426_1000037
2379 Ga0207426_1000289
2380 Ga0207426_1000312
2381 Ga0207426_1004510
2382 Ga0207426_1007390
2383 Ga0209051_1000045
2384 Ga0209051_1000139
2385 Ga0209051_1000409
2386 Ga0209051_1000499
2387 Ga0209051_1006094
2388 Ga0209257_1000539
2389 Ga0209257_1009014
2390 Ga0209257_1016143
2391 Ga0207656_10003183
2392 Ga0207696_1000023
2393 Ga0207696_1000047
2394 Ga0207696_1000091
2395 Ga0207696_1002016
2396 Ga0207696_1002515
2397 Ga0207696_1013608
2398 Ga0207696_1015388
2399 Ga0207655_1000015
2400 Ga0207655_1000118
2401 Ga0207655_1000302
2402 Ga0207655_1000327
2403 Ga0207655_1000339
2404 Ga0207655_1000658
2405 Ga0207655_1001444
2406 Ga0207655_1003450
2407 Ga0207655_1003542
2408 Ga0207655_1005682
2409 Ga0207655_1009464
2410 Ga0207655_1010065
2411 Ga0207655_1014108
2412 Ga0207655_1014236
2413 Ga0207655_1016444
2414 Ga0207655_1018839
2415 Ga0207655_1021378
2416 Ga0207655_1023774
2417 Ga0207713_1000041
2418 Ga0207713_1000060
2419 Ga0207713_1000348
2420 Ga0207713_1001043
2421 Ga0207713_1001161
2422 Ga0207713_1001267
2423 Ga0207713_1002181
2424 Ga0207713_1004039
2425 Ga0207713_1008860
2426 Ga0207713_1014647
2427 Ga0207713_1041877
2428 Ga0207713_1041888
2429 Ga0207692_10004858
2430 Ga0207692_10058195
2431 Ga0207710_10000122
2432 Ga0207710_10070892
2433 Ga0207688_10050778
2434 Ga0207647_10003182
2435 Ga0207647_10005156
2436 Ga0207647_10008176
2437 Ga0207647_10009659
2438 Ga0207699_10000826
2439 Ga0207699_10064608
2440 Ga0207699_10071546
2441 Ga0207705_10000771
2442 Ga0207705_10135394
2443 Ga0207684_10071066
2444 Ga0207684_10074537
2445 Ga0207654_10010475
2446 Ga0207654_10087703
2447 Ga0207707_10032404
2448 Ga0207695_10000240
2449 Ga0207695_10008368
2450 Ga0207695_10021034
2451 Ga0207695_10049593
2452 Ga0207695_10097448
2453 Ga0207671_10000604
2454 Ga0207671_10007182
2455 Ga0207671_10008177
2456 Ga0207671_10023233
2457 Ga0207671_10112512
2458 Ga0207671_10119778
2459 Ga0207693_10006908
2460 Ga0207693_10074546
2461 Ga0207663_10030874
2462 Ga0207663_10111723
2463 Ga0207657_10000595
2464 Ga0207657_10003541
2465 Ga0207657_10030614
2466 Ga0207657_10082545
2467 Ga0207649_10000639
2468 Ga0207649_10000668
2469 Ga0207681_10006411
2470 Ga0207681_10014158
2471 Ga0207694_10000236
2472 Ga0207694_10056478
2473 Ga0207694_10083220
2474 Ga0207694_10099663
2475 Ga0207650_10000248
2476 Ga0207650_10001140
2477 Ga0207650_10001620
2478 Ga0207650_10259834
2479 Ga0207687_10034082
2480 Ga0207700_10057984
2481 Ga0207700_10132142
2482 Ga0207700_10165808
2483 Ga0207664_10117055
2484 Ga0207664_10149876
2485 Ga0207690_10000034
2486 Ga0207690_10001619
2487 Ga0207690_10071507
2488 Ga0207706_10002708
2489 Ga0207706_10006523
2490 Ga0207706_10014066
2491 Ga0207706_10074628
2492 Ga0207709_10000001
2493 Ga0207709_10000030
2494 Ga0207709_10000070
2495 Ga0207709_10000127
2496 Ga0207709_10000610
2497 Ga0207709_10004847
2498 Ga0207709_10005912
2499 Ga0207709_10024205
2500 Ga0207709_10068348
2501 Ga0207665_10001950
2502 Ga0207665_10012034
2503 Ga0207661_10012230
2504 Ga0207679_10000021
2505 Ga0207679_10000349
2506 Ga0207667_10000044
2507 Ga0207667_10000347
2508 Ga0207667_10007034
2509 Ga0207667_10024451
2510 Ga0207667_10034699
2511 Ga0207667_10156943
2512 Ga0207651_10151706
2513 Ga0207668_10149151
2514 Ga0207640_10000490
2515 Ga0207658_10000701
2516 Ga0207658_10035321
2517 Ga0207703_10244121
2518 Ga0207639_10019471
2519 Ga0207678_10000419
2520 Ga0207678_10000911
2521 Ga0207678_10004582
2522 Ga0207678_10037826
2523 Ga0207678_10041614
2524 Ga0207678_10067645
2525 Ga0207708_10207132
2526 Ga0207702_10006736
2527 Ga0207702_10093167
2528 Ga0207674_10027513
2529 Ga0207674_10056006
2530 Ga0207675_100250766
2531 Ga0207683_10030261
2532 Ga0207683_10135168
2533 Ga0207698_10069769
2534 Ga0209281_1000029
2535 Ga0209281_1000070
2536 Ga0209281_1000249
2537 Ga0209389_1000078
2538 Ga0209389_1000210
2539 Ga0209371_1000040
2540 Ga0209371_1000114
2541 Ga0209371_1004048
2542 Ga0209589_1000011
2543 Ga0209589_1001190
2544 Ga0209489_100012
2545 Ga0209489_100192
2546 Ga0209700_100019
2547 Ga0209282_1000074
2548 Ga0209282_1018720
2549 Ga0209588_1013766
2550 Ga0207428_10026308
2551 Ga0268266_10007711
2552 Ga0268264_10000194
2553 Ga0265319_1023195
2554 Ga0265334_10003980
2555 Ga0265318_10008391
2556 Ga0265323_10000516
2557 Ga0265322_10002082
2558 Ga0265336_10000456
2559 Ga0265338_10000065
2560 Ga0265324_10007686
2561 Ga0268256_1000041
2562 Ga0268256_1000218
2563 Ga0268256_1003598
2564 Ga0316179_1034064
2565 Ga0316178_1152882
2566 Ga0265760_10022728
2567 Ga0265332_10026610
2568 Ga0265325_10037169
2569 Ga0265339_10075563
2570 Ga0265331_10019239
2571 Ga0265327_10007366
2572 Ga0265327_10012518
2573 Ga0265316_10047668
2574 Ga0265316_10219946
2575 Ga0307509_10161097
2576 Ga0307408_100023917
2577 Ga0307408_100027855
2578 Ga0307508_10000001
2579 Ga0307508_10034274
2580 Ga0307508_10095256
2581 Ga0307508_10185720
2582 Ga0265314_10011314
2583 Ga0307516_10000859
2584 Ga0307516_10012610
2585 Ga0307405_10056842
2586 Ga0307407_10085133
2587 Ga0307412_10000044
2588 Ga0307412_10006504
2589 Ga0307412_10070442
2590 Ga0307409_100069835
2591 Ga0307415_100087092
2592 Ga0307507_10010371
2593 Ga0307510_10003141
2594 Ga0307510_10034158
2595 Ga0307510_10052649
2596 Ga0307510_10178511
2597 Ga0373934_0026823
2598 Ga0373923_0003759
2599 Ga0373936_0049770
2600 Ga0373945_0013272
2601 Ga0373953_0002356
2602 Ga0373943_0003856
2603 Ga0373943_0006295
2604 Ga0373955_0016136
2605 Ga0373924_0024858
2606 Ga0373935_0003793
2607 Ga0373935_0073663
2608 Ga0373927_0001305
2609 Ga0373927_0046440
2610 Ga0373947_0001572
2611 Ga0373947_0020287
2612 Ga0373947_0124690
2613 Ga0373937_0055490
2614 Ga0373925_0000676
2615 Ga0373925_0014327
2616 Ga0395899_0000029
2617 Ga0395899_0022392
2618 Ga0395899_0055223
2619 Ga0395900_0000098
2620 Ga0395900_0000196
2621 Ga0395900_0048824
2622 Ga0395900_0090030
2623 Ga0395900_0097693
2624 Ga0395900_0111219
2625 Ga0395900_0114223
2626 Ga0395900_0126587
2627 Ga0395900_0177638
2628 Ga0395900_0197752
2629 Ga0395900_0291642
2630 Ga0395898_0000086
2631 Ga0395898_0000577
2632 Ga0395898_0010898
2633 Ga0395898_0032583
2634 Ga0395898_0115359
2635 Ga0395905_0000201
2636 Ga0395905_0004566
2637 Ga0395905_0072502
2638 Ga0395905_0077342
2639 Ga0395905_0132714
2640 Ga0436364_1144417
2641 Ga0395901_0000104
2642 Ga0395901_0000137
2643 Ga0395901_0000231
2644 Ga0395901_0155286
2645 Ga0395901_0340447
2646 Ga0237819_01466
2647 Ga0436365_0473945
2648 Ga0436360_0304504
2649 Ga0436360_0536580
2650 Ga0436360_0755309
2651 Ga0436361_0138725
2652 Ga0436361_0246054
2653 Ga0436361_0512633
2654 Ga0436363_0561374
2655 Ga0439436_0006431
2656 Ga0439438_000199
2657 Ga0439438_005671
2658 Ga0439438_006276
2659 Ga0439438_006309
2660 Ga0439438_011933
2661 Ga0439447_000909
2662 Ga0439447_004721
2663 Ga0439447_007300
2664 Ga0439447_011535
2665 Ga0439466_0002213
2666 Ga0439466_0004939
2667 Ga0439466_0005069
2668 Ga0439466_0016378
2669 Ga0439466_0018526
2670 Ga0439431_0004281
2671 Ga0439448_0000169
2672 Ga0439432_000453
2673 Ga0439432_000827
2674 Ga0439432_006423
2675 Ga0439432_038933
2676 Ga0439451_003268
2677 Ga0439451_011933
2678 Ga0439452_000581
2679 Ga0439452_001230
2680 Ga0439452_001923
2681 Ga0439452_005307
2682 Ga0439452_007817
2683 Ga0439452_008357
2684 Ga0439456_000063
2685 Ga0439456_001296
2686 Ga0439456_003137
2687 Ga0439463_003980
2688 Ga0450920_001220
2689 Ga0450922_000404
2690 Ga0450902_000643
2691 Ga0450902_000756
2692 Ga0450907_000025
2693 Ga0450907_003669
2694 Ga0450910_000561
2695 Ga0439434_0001115
2696 Ga0439460_0006661
2697 Ga0439460_0007288
2698 Ga0466969_0000226
2699 Ga0466969_0003247
2700 Ga0466969_0008544
2701 Ga0466969_0012351
2702 Ga0466969_0030975
2703 Ga0466972_0005663
2704 Ga0466977_0008418
2705 Ga0466965_0005365
2706 Ga0466965_0010859
2707 Ga0466965_0027306
2708 Ga0466965_0038803
2709 Ga0466966_0000005
2710 Ga0466966_0002330
2711 Ga0466961_0000656
2712 Ga0466961_0000908
2713 Ga0466961_0002934
2714 Ga0466961_0039867
2715 Ga0466963_0001778
2716 Ga0466963_0007803
2717 Ga0466963_0110019
2718 Ga0466964_0062504
2719 Ga0466971_0000225
2720 Ga0466971_0022608
2721 Ga0466971_0049325
2722 Ga0466968_0004192
2723 Ga0466970_0003203
2724 Ga0466970_0003629
2725 Ga0466970_0024106
2726 Ga0466957_0004704
2727 Ga0466957_0005749
2728 Ga0466957_0013067
2729 Ga0466957_0153471
2730 Ga0466960_0014731
2731 Ga0466959_0004419
2732 Ga0466959_0016104
2733 Ga0466959_0045224
2734 Ga0466959_0045299
2735 Ga0466959_0132757
2736 Ga0466958_0000956
2737 Ga0466958_0053171
2738 Ga0466967_0027405
2739 Ga0466967_0139369
2740 Ga0495617_000479
2741 Ga0495617_004457
2742 Ga0495627_001494
2743 Ga0495592_0020729
2744 Ga0495592_0057295
2745 Ga0495592_0097075
2746 Ga0495603_0000003
2747 Ga0495603_0067662
2748 Ga0495590_0000005
2749 Ga0495590_0009816
2750 Ga0495590_0012583
2751 Ga0495591_000165
2752 Ga0495591_000387
2753 Ga0495591_001132
2754 Ga0495591_002013
2755 Ga0495591_003323
2756 Ga0495591_004232
2757 Ga0495591_015106
2758 Ga0495591_034200
2759 Ga0495629_0000105
2760 Ga0495629_0000133
2761 Ga0495629_0002853
2762 Ga0495629_0002887
2763 Ga0495629_0003517
2764 Ga0495629_0020285
2765 Ga0495638_0005386
2766 Ga0495638_0011092
2767 Ga0495638_0018018
2768 Ga0495638_0019977
2769 Ga0495638_0029251
2770 Ga0495638_0048476
2771 Ga0495638_0055785
2772 Ga0495641_0011455
2773 Ga0495651_0001898
2774 Ga0495651_0005111
2775 Ga0495653_0004087
2776 Ga0495653_0011821
2777 Ga0495653_0036791
2778 Ga0495653_0108648
2779 Ga0495650_0000710
2780 Ga0495650_0003689
2781 Ga0495650_0010859
2782 Ga0495650_0017508
2783 Ga0495650_0018394
2784 Ga0495650_0029283
2785 Ga0495580_0008949
2786 Ga0495580_0027216
2787 Ga0495580_0031628
2788 Ga0495580_0038848
2789 Ga0495580_0041966
2790 Ga0495582_0000016
2791 Ga0495582_0015213
2792 Ga0495582_0061015
2793 Ga0495605_0000124
2794 Ga0495605_0004497
2795 Ga0495605_0006881
2796 Ga0495605_0013089
2797 Ga0495605_0019294
2798 Ga0495605_0075352
2799 Ga0495639_0000014
2800 Ga0495662_0002084
2801 Ga0495664_0005109
2802 Ga0495664_0024757
2803 Ga0495664_0029656
2804 Ga0495584_0001735
2805 Ga0495584_0020821
2806 Ga0495584_0056498
2807 Ga0495585_0004287
2808 Ga0495585_0013257
2809 Ga0495585_0026629
2810 Ga0495594_0000051
2811 Ga0495596_0005234
2812 Ga0495596_0023490
2813 Ga0495596_0031980
2814 Ga0495607_0001371
2815 Ga0495607_0024161
2816 Ga0495607_0074335
2817 Ga0495607_0076806
2818 Ga0495607_0105546
2819 Ga0495583_0001112
2820 Ga0495583_0001552
2821 Ga0495583_0009174
2822 Ga0495583_0010184
2823 Ga0495583_0020079
2824 Ga0495583_0023951
2825 Ga0495606_0000032
2826 Ga0495606_0000042
2827 Ga0495606_0002242
2828 Ga0495606_0007911
2829 Ga0495606_0008338
2830 Ga0495606_0011843
2831 Ga0495606_0023220
2832 Ga0495606_0024810
2833 Ga0495606_0029806
2834 Ga0495606_0053148
2835 Ga0495606_0121034
2836 Ga0495608_0038590
2837 Ga0495608_0053734
2838 Ga0495610_0003579
2839 Ga0495610_0006567
2840 Ga0495610_0007629
2841 Ga0495610_0012101
2842 Ga0495616_0019156
2843 Ga0495616_0033914
2844 Ga0495618_0013194
2845 Ga0495618_0033388
2846 Ga0495618_0071878
2847 Ga0495620_0000004
2848 Ga0495620_0025065
2849 Ga0495620_0033355
2850 Ga0495628_0002656
2851 Ga0495628_0008450
2852 Ga0495628_0013006
2853 Ga0495628_0039809
2854 Ga0495630_0022261
2855 Ga0495630_0023055
2856 Ga0495630_0034082
2857 Ga0495630_0035570
2858 Ga0495630_0046608
2859 Ga0495630_0074543
2860 Ga0495631_0000953
2861 Ga0495631_0003004
2862 Ga0495631_0005227
2863 Ga0495632_0001439
2864 Ga0495632_0001542
2865 Ga0495632_0005956
2866 Ga0495632_0014688
2867 Ga0495632_0018769
2868 Ga0495637_0000171
2869 Ga0495637_0000931
2870 Ga0495637_0005318
2871 Ga0495637_0010013
2872 Ga0495637_0012785
2873 Ga0495643_0000297
2874 Ga0495643_0002410
2875 Ga0495643_0009717
2876 Ga0495643_0010056
2877 Ga0495643_0010572
2878 Ga0495643_0033537
2879 Ga0495644_0001175
2880 Ga0495644_0002862
2881 Ga0495644_0016424
2882 Ga0495648_0000188
2883 Ga0495648_0001828
2884 Ga0495648_0010069
2885 Ga0495648_0019703
2886 Ga0495648_0038878
2887 Ga0495648_0060170
2888 Ga0495648_0062533
2889 Ga0495663_0001152
2890 Ga0495666_0007152
2891 Ga0495666_0017365
2892 Ga0495666_0040284
2893 Ga0495642_0000276
2894 Ga0495652_0007000
2895 Ga0495652_0026204
2896 Ga0495652_0058154
2897 Ga0495652_0062651
2898 Ga0495654_0000878
2899 Ga0495654_0005444
2900 Ga0495654_0005926
2901 Ga0495654_0007926
2902 Ga0495654_0018888
2903 Ga0495654_0038697
2904 Ga0495665_0000270
2905 Ga0495665_0032847
2906 Ga0495665_0036946
2907 Ga0495640_0015373
2908 Ga0495640_0028712
2909 Ga0495586_0001447
2910 Ga0495587_0005433
2911 Ga0495587_0006220
2912 Ga0495587_0011069
2913 Ga0495587_0027077
2914 Ga0495609_0000456
2915 Ga0495609_0003025
2916 Ga0495609_0008086
2917 Ga0495609_0009745
2918 Ga0495597_0009516
2919 Ga0495597_0010021
2920 Ga0495597_0053325
2921 Ga0495645_0001550
2922 Ga0495645_0007057
2923 Ga0495645_0010772
2924 Ga0495645_0014623
2925 Ga0495645_0078236
2926 Ga0495645_0101017
2927 Ga0495622_0001439
2928 Ga0495622_0001690
2929 Ga0495622_0005935
2930 Ga0495622_0011047
2931 Ga0495622_0020971
2932 Ga0495622_0039348
2933 Ga0495622_0040666
2934 Ga0495622_0058480
2935 Ga0495633_0000896
2936 Ga0495667_0033070
2937 Ga0495667_0046874
2938 Ga0495667_0051787
2939 Ga0495656_0010985
2940 Ga0495668_0000096
2941 Ga0495668_0012211
2942 Ga0495668_0069304
2943 Ga0495634_0000064
2944 Ga0495634_0012589
2945 Ga0495634_0014826
2946 Ga0495611_0002721
2947 Ga0495611_0008969
2948 Ga0495625_0000010
2949 Ga0495625_0003810
2950 Ga0495625_0005012
2951 Ga0495625_0100211
2952 Ga0495635_0001480
2953 Ga0495635_0006440
2954 Ga0495635_0019099
2955 Ga0495635_0025503
2956 Ga0495635_0042289
2957 Ga0495635_0042546
2958 Ga0495659_0000457
2959 Ga0495661_0000790
2960 Ga0495661_0001455
2961 Ga0495661_0005867
2962 Ga0495661_0016543
2963 Ga0495588_0058054
2964 Ga0495657_0008807
2965 Ga0495599_0000823
2966 Ga0495599_0019978
2967 Ga0495599_0085027
2968 Ga0495623_0007544
2969 Ga0495623_0036727
2970 Ga0495646_0010120
2971 Ga0495646_0023117
2972 Ga0495646_0024091
2973 Ga0495646_0024315
2974 Ga0495646_0030608
2975 Ga0495646_0071739
2976 Ga0495647_0060641
2977 Ga0495658_0001546
2978 Ga0495669_0007735
2979 Ga0495613_0001602
2980 Ga0495613_0017809
2981 Ga0495613_0060922
2982 Ga0495624_0000201
2983 Ga0495624_0003503
2984 Ga0495624_0014549
2985 Ga0495624_0015332
2986 Ga0495624_0050733
2987 Ga0495670_0018076
2988 Ga0495670_0022050
2989 Ga0495671_0026716
2990 Ga0495671_0029088
2991 Ga0495671_0039935
2992 Ga0495649_0001000
2993 Ga0495649_0008348
2994 Ga0495649_0017672
2995 Ga0495649_0037014
2996 Ga0495649_0058384
2997 Ga0495649_0066481
2998 Ga0495589_0001771
2999 Ga0495589_0004057
3000 Ga0495589_0006766
3001 Ga0495589_0012759
3002 Ga0495600_0010359
3003 Ga0495600_0027469
3004 Ga0495600_0122816
3005 Ga0495660_0013447
3006 Ga0495660_0037615
3007 Ga0495660_0075272
3008 Ga0495581_0000014
3009 Ga0495581_0021153
3010 Ga0495604_0001045
3011 Ga0495604_0012911
3012 Ga0495604_0015866
3013 Ga0495604_0017993
3014 Ga0495604_0059746
3015 Ga0495674_0013843
3016 Ga0495674_0037786
3017 Ga0495674_0046100
3018 Ga0495674_0048125
3019 Ga0495674_0063784
3020 Ga0495672_0004532
3021 Ga0495672_0009651
3022 Ga0495672_0013081
3023 Ga0495672_0017425
3024 Ga0495672_0018025
3025 Ga0495672_0018797
3026 Ga0495672_0020229
3027 Ga0495672_0030535
3028 Ga0495672_0032208
3029 Ga0495672_0060533
3030 Ga0495676_0000002
3031 Ga0495676_0008340
3032 Ga0495676_0017761
3033 Ga0495676_0049156
3034 Ga0495676_0059463
3035 Ga0495680_0001894
3036 Ga0495680_0005126
3037 Ga0495680_0087224
3038 Ga0495680_0091270
3039 Ga0495683_0001174
3040 Ga0495683_0001446
3041 Ga0495683_0003592
3042 Ga0495683_0009570
3043 Ga0495683_0014270
3044 Ga0495683_0018159
3045 Ga0495683_0068421
3046 Ga0495687_005784
3047 Ga0495687_021419
3048 Ga0495675_0012153
3049 Ga0495675_0045850
3050 Ga0495675_0047451
3051 Ga0495675_0055414
3052 Ga0495675_0064304
3053 Ga0495677_0027531
3054 Ga0495679_000243
3055 Ga0495679_000498
3056 Ga0495679_000540
3057 Ga0495679_002453
3058 Ga0495679_003917
3059 Ga0495679_008749
3060 Ga0495673_0001376
3061 Ga0495673_0001555
3062 Ga0495673_0001654
3063 Ga0495673_0009282
3064 Ga0495673_0014320
3065 Ga0495673_0040678
3066 Ga0495673_0045778
3067 Ga0495681_0002070
3068 Ga0495681_0003032
3069 Ga0495681_0008069
3070 Ga0495681_0013937
3071 Ga0495681_0022735
3072 Ga0495681_0024250
3073 Ga0495681_0082596
3074 Ga0495684_0031468
3075 Ga0495684_0108536
3076 Ga0495686_0028914
3077 Ga0495593_0000003
3078 Ga0495593_0013772
3079 Ga0495593_0032489
3080 Ga0495602_0004392
3081 Ga0495602_0019904
3082 Ga0495602_0027496
3083 Ga0495602_0032356
3084 Ga0495602_0056054
3085 Ga0495614_0001273
3086 Ga0495614_0009420
3087 Ga0495614_0049336
3088 Ga0495626_0000319
3089 Ga0495626_0001455
3090 Ga0495626_0001872
3091 Ga0495626_0005066
3092 Ga0495626_0006702
3093 Ga0495626_0008178
3094 Ga0496100_0000770
3095 Ga0496100_0036563
3096 Ga0496100_0049984
3097 Ga0496101_0003605
3098 Ga0496101_0062499
3099 Ga0496101_0120761
3100 Ga0496102_0001989
3101 Ga0496102_0002699
3102 Ga0496102_0044305
3103 Ga0496102_0110231
3104 Ga0496102_0130940
3105 Ga0496103_0000854
3106 Ga0496103_0002629
3107 Ga0496103_0019548
3108 Ga0496103_0024009
3109 Ga0496104_0043929
3110 Ga0496104_0061727
3111 Ga0496105_0159600
3112 Ga0496106_0000152
3113 Ga0496106_0003247
3114 Ga0496107_0030056
3115 Ga0496108_0083230
3116 Ga0496108_0140914
3117 Ga0496110_0114659
3118 Ga0496110_0130468
3119 Ga0496110_0143978
3120 Ga0496110_0252289
3121 Ga0496111_0026372
3122 Ga0496111_0168103
3123 Ga0496112_0000101
3124 Ga0496112_0034008
3125 Ga0496113_0043290
3126 Ga0496114_0002669
3127 Ga0496114_0157507
3128 Ga0496115_0099049
3129 Ga0496115_0102345
3130 Ga0496115_0181310
3131 Ga0496116_0000267
3132 Ga0496116_0087204
3133 Ga0496117_0001021
3134 Ga0496117_0003014
3135 Ga0496117_0003521
3136 Ga0496117_0020845
3137 Ga0496117_0023031
3138 Ga0496117_0023500
3139 Ga0496117_0031790
3140 Ga0496117_0049041
3141 Ga0496117_0053870
3142 Ga0496117_0090442
3143 Ga0496117_0106074
3144 Ga0496118_0001205
3145 Ga0496118_0002131
3146 Ga0496118_0003163
3147 Ga0496118_0007073
3148 Ga0496118_0009055
3149 Ga0496118_0011650
3150 Ga0496118_0022178
3151 Ga0496118_0030612
3152 Ga0496118_0037948
3153 Ga0496118_0044984
3154 Ga0496118_0052309
3155 Ga0496118_0103556
3156 Ga0496118_0138795
3157 Ga0496119_0000046
3158 Ga0496119_0024863
3159 Ga0496119_0058364
3160 Ga0496120_0002213
3161 Ga0496121_0000041
3162 Ga0496121_0000366
3163 Ga0496121_0000824
3164 Ga0496121_0001446
3165 Ga0496121_0002599
3166 Ga0496121_0003643
3167 Ga0496121_0004448
3168 Ga0496121_0012188
3169 Ga0496121_0014389
3170 Ga0496121_0025746
3171 Ga0496121_0029189
3172 Ga0496121_0033209
3173 Ga0496121_0034546
3174 Ga0496121_0044568
3175 Ga0496121_0160259
3176 Ga0496122_0000167
3177 Ga0496122_0001027
3178 Ga0496122_0012761
3179 Ga0496122_0041991
3180 Ga0496122_0070884
3181 Ga0496123_0000127
3182 Ga0496123_0000240
3183 Ga0496123_0015663
3184 Ga0496123_0018849
3185 Ga0496123_0032067
3186 Ga0496123_0032885
3187 Ga0496124_0000261
3188 Ga0496124_0001966
3189 Ga0496124_0003100
3190 Ga0496124_0003299
3191 Ga0496124_0004055
3192 Ga0496124_0019838
3193 Ga0496124_0118373
3194 Ga0496125_0000944
3195 Ga0496125_0002606
3196 Ga0496125_0003132
3197 Ga0496125_0007271
3198 Ga0496125_0008276
3199 Ga0496125_0015617
3200 Ga0496125_0026562
3201 Ga0496125_0026953
3202 Ga0496125_0031343
3203 Ga0496125_0056609
3204 Ga0496126_0000603
3205 Ga0496126_0005095
3206 Ga0496126_0011447
3207 Ga0496126_0011697
3208 Ga0496126_0013263
3209 Ga0496126_0022380
3210 Ga0496126_0032972
3211 Ga0495678_003902
3212 Ga0495678_006155
3213 Ga0495678_006531
3214 Ga0495678_008431
3215 Ga0495678_009281
3216 Ga0495678_015960
3217 Ga0495682_0000234
3218 Ga0501032_0005184
3219 Ga0501034_0000260
3220 Ga0501034_0001389
3221 Ga0501034_0100213
3222 Ga0501038_0178113
3223 nmdc:mga00v17_22677_c1
3224 nmdc:mga0yw44_12450_c1
3225 nmdc:mga0k408_2812_c1
3226 nmdc:mga06z11_21475_c1
3227 nmdc:mga06z11_24614_c1
3228 nmdc:mga06z11_42430_c1
3229 nmdc:mga04h51_18623_c1
3230 nmdc:mga07m45_4272_c1
3231 nmdc:mga09592_49041_c1
3232 nmdc:mga0sz30_23955_c1
3233 nmdc:mga0sz30_25723_c1
3234 nmdc:mga0sz30_34829_c1
3235 nmdc:mga0sz30_5037_c1
3236 Ga0495601_0012258
3237 Ga0495601_0015749
3238 Ga0495601_0034735
3239 Ga0495601_0078238
3240 Ga0495601_0080234
3241 Ga0500635_0009073
3242 Ga0495655_0015207
3243 Ga0495619_0005097
3244 Ga0495619_0021762
3245 Ga0495619_0173567
3246 Ga0500643_000037
3247 Ga0500581_039952
3248 Ga0500647_0015495
3249 Ga0500566_0000367
3250 Ga0500566_0001124
3251 Ga0500566_0002925
3252 Ga0500566_0013595
3253 Ga0500640_021741
3254 Ga0500641_0010054
3255 Ga0500556_0000015
3256 Ga0500557_000014
3257 Ga0500562_002831
3258 Ga0500562_016822
3259 Ga0500569_006860
3260 Ga0500569_039970
3261 Ga0500572_002314
3262 Ga0500595_001223
3263 Ga0500595_003517
3264 Ga0500595_004674
3265 Ga0500595_024288
3266 Ga0500608_018564
3267 Ga0500614_003104
3268 Ga0500642_0000044
3269 Ga0500642_0000332
3270 Ga0500652_000397
3271 Ga0500658_0063432
3272 Ga0500559_0000146
3273 Ga0500568_0000729
3274 Ga0500577_0001065
3275 Ga0500589_065107
3276 Ga0500590_074679
3277 Ga0500603_001248
3278 Ga0500604_0013015
3279 Ga0500616_0000041
3280 Ga0500616_0024588
3281 Ga0500619_002481
3282 Ga0500622_0001128
3283 Ga0500634_0007703
3284 Ga0500638_076420
3285 Ga0500639_000085
3286 Ga0500636_0003535
3287 Ga0500637_0000231
3288 Ga0500645_023268
3289 Ga0500599_000271
3290 Ga0500601_000073
3291 Ga0466962_0000559
3292 Ga0466962_0010024
3293 2501070895
3294 2501084874
3295 2501413723
3296 2507510665
3297 2508544468
3298 2508697388
3299 2509152063
3300 2510252339
3301 2511089598
3302 2511095007
3303 2511104663
3304 2511251717
3305 2511252915
3306 2511267771
3307 2511271352
3308 2511271848
3309 2511295287
3310 2511299610
3311 2511323225
3312 2511329440
3313 2511335019
3314 2511338315
3315 2511344554
3316 2511351658
3317 2511356019
3318 2511363405
3319 2511367322
3320 2511372869
3321 2511393692
3322 2511827062
3323 2512324672
3324 2512327719
3325 2512344737
3326 2513551472
3327 2513560122
3328 2513627858
3329 2513650686
3330 2513661776
3331 2513672608
3332 2513715802
3333 2513856985
3334 2513877823
3335 2513888252
3336 2513923423
3337 2513956978
3338 2513963043
3339 2514014974
3340 2514043142
3341 2514046188
3342 2515630243
3343 2515682520
3344 2515688740
3345 2516016879
3346 2517106869
3347 2517891195
3348 2519457789
3349 2521560464
3350 2524437054
3351 2524468792
3352 2524533618
3353 2527080649
3354 2528856325
3355 2550694140
3356 2552746373
3357 2553005585
3358 2554812470
3359 2555248218
3360 2555672264
3361 2563061803
3362 2583792770
3363 2583794769
3364 2585294525
3365 2596373449
3366 2597032383
3367 2597860343
3368 2597863619
3369 2597869579
3370 2599358300
3371 2599364649
3372 2599370815
3373 2599376837
3374 2599383465
3375 2599389912
3376 2599396195
3377 2599398609
3378 2599408035
3379 2599448469
3380 2599450663
3381 2599465115
3382 2599471424
3383 2599486815
3384 2599487013
3385 2599493970
3386 2599505355
3387 2599507090
3388 2599513097
3389 2599520786
3390 2599736919
3391 2599742968
3392 2599807061
3393 2599880251
3394 2599891774
3395 2599934533
3396 2599947038
3397 2599997666
3398 2600196576
3399 2600205086
3400 2600217849
3401 2600367143
3402 2600813689
3403 2601691721
3404 2601778016
3405 2601800442
3406 2603860738
3407 2606078750
3408 2606125590
3409 2608384783
3410 2617352646
3411 2621300109
3412 2624482857
3413 2624494398
3414 2640733327
3415 2643870462
3416 2643957544
3417 2644025658
3418 2644187769
3419 2644286016
3420 2644620945
3421 2652546489
3422 2671100821
3423 2671123198
3424 2671773381
3425 2676742075
3426 2677896142
3427 2678230358
3428 2678265435
3429 2713478362
3430 2715752293
3431 2715759032
3432 2718636071
3433 2719641431
3434 2723248548
3435 2723876852
3436 2728755563
3437 2738670118
3438 2738747478
3439 2738748511
3440 2738806472
3441 2738821679
3442 2738834161
3443 2738857553
3444 2738875365
3445 2738893832
3446 2739187318
3447 2739198203
3448 2739221963
3449 2739260967
3450 2739316604
3451 2739356760
3452 2743739885
3453 2745005889
3454 2745076265
3455 2746088626
3456 2746092665
3457 2753569568
3458 2765568384
3459 2765585051
3460 2774121769
3461 2774137010
3462 2774389083
3463 2774439282
3464 2784262363
3465 2784314432
3466 2792835730
3467 2793066538
3468 2793076444
3469 2794598424
3470 2805917048
3471 2807409124
3472 2807457460
3473 2808857989
3474 2808926603
3475 2808930823
3476 2808937483
3477 2808948764
3478 2808952945
3479 2808959275
3480 2808966474
3481 2808971679
3482 2808978809
3483 2808994541
3484 2809001357
3485 2809006508
3486 2809013574
3487 2809219320
3488 2812365946
3489 2817259975
3490 2817277638
3491 2817456949
3492 2817491456
3493 2818242545
3494 2819545352
3495 2819591891
3496 2819617133
3497 2819632420
3498 2819659149
3499 2819706489
3500 2823421333
3501 2824662494
3502 2824675296
3503 2824681171
3504 2824691529
3505 2824697389
3506 2824705587
3507 2824756315
3508 2824763999
3509 2824780255
3510 2825655671
3511 2829750805
3512 2834033508
3513 2834643852
3514 2838125323
3515 2839094729
3516 2841942024
3517 2841951436
3518 2841958886
3519 2841968549
3520 2841976250
3521 2841987615
3522 2842324598
3523 2842348877
3524 2842457417
3525 2842701310
3526 2842827179
3527 2842837009
3528 2842843270
3529 2842847748
3530 2844666436
3531 2847944618
3532 2849081147
3533 2852614196
3534 2852660982
3535 2852668067
3536 2857524823
3537 2858697851
3538 2860343842
3539 2860870355
3540 2861694362
3541 2863421460
3542 2870069115
3543 2874634662
3544 2874649980
3545 2876775494
3546 2876826154
3547 2878034790
3548 2879079419
3549 2879109696
3550 2880235439
3551 2881667671
3552 2883094639
3553 2884816851
3554 2884837720
3555 2884854012
3556 2885268788
3557 2885279763
3558 2885382926
3559 2888381938
3560 2888388706
3561 2889310086
3562 2893069337
3563 2896154871
3564 2900637315
3565 2901310331
3566 2902335314
3567 2902691213
3568 2903749683
3569 2903768483
3570 2904425814
3571 2904442763
3572 2904522997
3573 2904535024
3574 2904555906
3575 2904565638
3576 2904572681
3577 2904588638
3578 2904594288
3579 2904604870
3580 2904618979
3581 2904698894
3582 2904701082
3583 2904720417
3584 2906616379
3585 2906630520
3586 2906638167
3587 2906648302
3588 2906662842
3589 2908449357
3590 2908741515
3591 2908758690
3592 2909044301
3593 2912967314
3594 2913041983
3595 2917076145
3596 2919067828
3597 2919078709
3598 2919083108
3599 2919156997
3600 2919185346
3601 2919390716
3602 2919461788
3603 2919490995
3604 2919502954
3605 2919701501
3606 2921651754
3607 2922371887
3608 2922399395
3609 2922431625
3610 2923158975
3611 2923514254
3612 2923519967
3613 2923592039
3614 2926064627
3615 2928060545
3616 2928113569
3617 2928127025
3618 2928132965
3619 2928140718
3620 2928159957
3621 2928164002
3622 2928177132
3623 2928506165
3624 2928538796
3625 2929149362
3626 2929192855
3627 2929616762
3628 2929625506
3629 2931373221
3630 2931393647
3631 2931397512
3632 2932791215
3633 2932799262
3634 2932803743
3635 2932811602
3636 2932826481
3637 2932834173
3638 2933577955
3639 2935359569
3640 2935610601
3641 2935624003
3642 2935635821
3643 2935647049
3644 2935656209
3645 2935665081
3646 2935674259
3647 2935682431
3648 2935691646
3649 2935699520
3650 2935707749
3651 2935719480
3652 2935728920
3653 2935737839
3654 2935747215
3655 2935757985
3656 2935766623
3657 2935770613
3658 2935787102
3659 2935795150
3660 2935809496
3661 2935817745
3662 2935820098
3663 2935836316
3664 2935845227
3665 2935849891
3666 2935862147
3667 2935870926
3668 2935881319
3669 2935884379
3670 2935914421
3671 2935918971
3672 2935932198
3673 2935940796
3674 2935948617
3675 2935957276
3676 2935963705
3677 2935973752
3678 2935979591
3679 2935991446
3680 2936001066
3681 2936005507
3682 2936019051
3683 2936023156
3684 2936032391
3685 2936042038
3686 2936050252
3687 2936061040
3688 2939641782
3689 2939654813
3690 2940564104
3691 2941512342
3692 2941520153
3693 2941528302
3694 2941535088
3695 2941545554
3696 2945933193
3697 2945938132
3698 2945964169
3699 2946009422
3700 2946030598
3701 2947238085
3702 2954768657
3703 2969309608
3704 2974294659
3705 2981994395
3706 2984287193
3707 2984288840
3708 2988730907
3709 2989350406
3710 2990705151
3711 2998144859
3712 3005481420
3713 3005596954
3714 3005712985
3715 3007398599
3716 3007420403
3717 3007615237
3718 3007722248
3719 3007805579
3720 3007860066
3721 3007866316
3722 3007875826
3723 637322682
3724 641337799
3725 642426204
3726 642418069
3727 642594385
3728 642622962
3729 643392226
3730 644749367
3731 8002395155
3732 8003404808
3733 8003957387
3734 8006978949
3735 8006984758
3736 8015691454
3737 8015693061
3738 8016515794
3739 8016590007
3740 8016633442
3741 8017060710
3742 8018850683
3743 8019565157
3744 8019575258
3745 8019587945
3746 8019603385
3747 8019625695
3748 8019636598
3749 8019655918
3750 8019664394
3751 8019673988
3752 8019682137
3753 8019687915
3754 8019771402
3755 8019781882
3756 8020808528
3757 8020939546
3758 8020947590
3759 8020953868
3760 8021126839
3761 8029996036
3762 8034965501
3763 8039099099
3764 8040170898
3765 8040175189
3766 8052496445
3767 8054287003
3768 8054352507
3769 8054506606
3770 8054932440
3771 8055267438
3772 8055748408
3773 8055774627
3774 8055776308
3775 8055821390
3776 8055882006
3777 8056119491
3778 8056122578
3779 8056131072
3780 8056134487
3781 8056139304
3782 8056154876
3783 8056158178
3784 8056165834
3785 8056171709
3786 8056172388
3787 8056179134
3788 8056571888
3789 8056687265
3790 8056690650
3791 8056976201
3792 8057805148

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00375

SDF

Sodium:dicarboxylate symporter family

94

490

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3v8g-assembly1.cif.gz_C crystal structure of an asymmetric trimer of a glutamate transporter homologue (gltph) 0.8316 2 373
7ngh-assembly1.cif.gz_C structure of glutamate transporter homologue in complex with sybody 0.8294 1 381
6wyj-assembly1.cif.gz_A cryo-em structure of the gltph l152c-g321c mutant in the intermediate state 0.8198 1 373
6uwl-assembly1.cif.gz_A gltph in complex with l-aspartate and sodium ions in intermediate outward-facing state 0.8174 2 373
2nwx-assembly1.cif.gz_A crystal structure of gltph in complex with l-aspartate and sodium ions 0.8148 2 373
ID Description Score Start End Superfamily
af_P0A830_1_408_1.10.3860.10 Mainly Alpha;Orthogonal Bundle;Proton glutamate symport protein;Sodium:dicarboxylate symporter 0.9076 1 378 1.10.3860.10
af_P71906_20_424_1.10.3860.10 Mainly Alpha;Orthogonal Bundle;Proton glutamate symport protein;Sodium:dicarboxylate symporter 0.9022 1 378 1.10.3860.10
af_P21345_1_417_1.10.3860.10 Mainly Alpha;Orthogonal Bundle;Proton glutamate symport protein;Sodium:dicarboxylate symporter 0.8832 1 378 1.10.3860.10
af_P71906_20_424_1.10.3860.10 Mainly Alpha;Orthogonal Bundle;Proton glutamate symport protein;Sodium:dicarboxylate symporter 0.8436 1 378 1.10.3860.10
af_Q9UAY8_3_451_1.10.3860.10 Mainly Alpha;Orthogonal Bundle;Proton glutamate symport protein;Sodium:dicarboxylate symporter 0.8317 2 376 1.10.3860.10
ID Description Score Start End GO Terms
AF-A0A8B3G339-F1-model_v4 Efflux pump membrane transporter 0.9478 2 323 GO:0005886
GO:0015293
GO:0015562
GO:0042910
GO:0046942
AF-A0A2R7QME8-F1-model_v4 C4-dicarboxylate transporter DctA 0.9457 2 254 GO:0005886
GO:0015138
GO:0015141
GO:0015366
GO:0070778
AF-A0A2V8D4W6-F1-model_v4 C4-dicarboxylate transporter DctA 0.9435 4 219 GO:0005886
GO:0015138
GO:0015141
GO:0015366
GO:0070778
AF-A0A519XQT8-F1-model_v4 deleted 0.9429 1 206
AF-A0A3M3T398-F1-model_v4 deleted 0.936 2 208

Map