F496002
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1896 | 982 | 3792 | 428 |
Family's Representative Sequence
| Representative Sequence | 3300026067|Ga0207678_10020313|Ga0207678_100203135 |
| Length | 514 |
| Sequence | VPNEVAMEKMRRYVREIAGSKHEILREDDRYRAQRAGSQIPTKDWRCPLPLKRIVCCLVAWILLMNVPEPKGKAIMTTITATADSARKPIYQSLFVQVLAALLLGIVIGMAAPEFAVGLKIFSDAFLKLISMIVAPIVFCVVVHGIAGAGDLKKVGRVGVKALIYFEVMTTIALVVGLLLAYLFGPGHGMNIDPSTLDAKALNTYSDNAHKLQGGGIGSFLLNIIPSTSFDALSRNDVLQVLFFAILFGTGLALVGGEKGEKINALIDAVSTVLFRVMGLIVRVAPLGVLGAVAYTVGKYGVGSLKQLLSLVALFYVSLAIFVLXXXXGVMALAGLNILKFLAYLREELTIVLATASSDAVLPQIMRKLEALGVKKSVVGLVIPTGYSFNLDAFSIYLTLAVVFIAQATNTPLSFGDLLLVLGVSLITSKGAHGVPGSAIVILAATLNAVPSIPAIGLVLVLSVDWFIGMARALGNLIGNCVATVVIAAWEGDLDRDKARRVLDGAELVDVTAG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 2 | 2124908027 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 | Metagenome | Rhizosphere |
| 3 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 4 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 5 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 6 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 7 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 8 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 9 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 10 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 11 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 12 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 13 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 14 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 15 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 16 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 17 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 18 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 19 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 20 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 21 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 22 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 23 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 24 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 25 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 26 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 27 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 28 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 29 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 30 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 31 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 32 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 33 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 34 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 35 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 36 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 37 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 38 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 39 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 40 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 41 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 46 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 63 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 64 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 65 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 66 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 67 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 68 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 70 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 72 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 73 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 74 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 75 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 76 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 77 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 78 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 79 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 80 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 81 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 82 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 83 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 84 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 85 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 86 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 87 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 88 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 89 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 90 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 91 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 92 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 94 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 95 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 96 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 97 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 99 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 100 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 101 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 102 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 103 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 104 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 116 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Metagenome | Rhizosphere |
| 119 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 128 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 130 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 131 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 132 | 3300015683 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 | Metagenome | Rhizosphere |
| 133 | 3300016635 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 | Metagenome | Rhizosphere |
| 134 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 136 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 137 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 138 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 139 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 140 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 141 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 142 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 143 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 144 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 145 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 146 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 147 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 148 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 149 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 150 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 151 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 152 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 153 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 154 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 155 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 156 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 157 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 158 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 159 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 160 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 161 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 162 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 163 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 164 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 165 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 166 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 167 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 168 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 169 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 170 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 171 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 172 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 217 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 218 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 220 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 221 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 222 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 223 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 225 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 228 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 229 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 230 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 231 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 232 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 233 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 234 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 235 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 236 | 3300030734 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 | Metagenome | Rhizosphere |
| 237 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 238 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 239 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 240 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 241 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 242 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 243 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 244 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 245 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 246 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 247 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 248 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 249 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 250 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 251 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 252 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 253 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 254 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 255 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 256 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 257 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 258 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 259 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 260 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 261 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 262 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 263 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 264 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 265 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 266 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 267 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 268 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 269 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 270 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 271 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 272 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 273 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 274 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 275 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 276 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 277 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 278 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 279 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 280 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 281 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 282 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 283 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 284 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 285 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 286 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 287 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 288 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 289 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 290 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 291 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 292 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 293 | 3300042124 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 | Metagenome | Rhizosphere |
| 294 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 295 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 296 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 297 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 298 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 299 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 300 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 301 | 3300044666 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1E | Metagenome | Unclassified |
| 302 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 303 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 304 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 305 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 306 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 307 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 308 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 309 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 310 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 311 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 312 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 313 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 314 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 315 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 412 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 413 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 414 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 415 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 416 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 417 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 418 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 419 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 420 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 421 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 422 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 423 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 424 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 425 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 426 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 427 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 428 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 429 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 430 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 431 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 432 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 433 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 434 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 435 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 436 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 437 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 438 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 439 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 440 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 441 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 442 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 443 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 444 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 445 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 446 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 447 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 448 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 449 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 450 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 451 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 452 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 453 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 454 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 455 | 3300053089 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere | Metagenome | Endosphere |
| 456 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 457 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 458 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 459 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 460 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 461 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 462 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 463 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 464 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 465 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 466 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 467 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 468 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 469 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 470 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 471 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 472 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 473 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 474 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 475 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 476 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 477 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 478 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 479 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 480 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 481 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 482 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 483 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 484 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 485 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 486 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 487 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 488 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 489 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 490 | 2501025501 | Paraburkholderia silvatlantica PVA5 | Isolate | Unclassified |
| 491 | 2501025502 | Paraburkholderia unamae MTI-641 | Isolate | Rhizosphere |
| 492 | 2501025504 | Paraburkholderia silvatlantica SRMrh-20 | Isolate | Unclassified |
| 493 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 494 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 495 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 496 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 497 | 2510065045 | Paraburkholderia sprentiae WSM5005 | Isolate | Nodule |
| 498 | 2510917013 | Paraburkholderia unamae MTI-641 | Isolate | Rhizosphere |
| 499 | 2510917014 | Paraburkholderia silvatlantica SRMrh-20 | Isolate | Unclassified |
| 500 | 2510917015 | Paraburkholderia silvatlantica PVA5 | Isolate | Unclassified |
| 501 | 2511231003 | Herbaspirillum sp. CF444 | Isolate | Rhizosphere |
| 502 | 2511231004 | Pseudomonas sp. GM102 | Isolate | Nodule |
| 503 | 2511231006 | Pseudomonas sp. GM17 | Isolate | Nodule |
| 504 | 2511231007 | Pseudomonas sp. GM18 | Isolate | Nodule |
| 505 | 2511231011 | Pseudomonas sp. GM30 | Isolate | Nodule |
| 506 | 2511231012 | Pseudomonas sp. GM33 | Isolate | Nodule |
| 507 | 2511231015 | Pseudomonas sp. GM49 | Isolate | Nodule |
| 508 | 2511231016 | Pseudomonas sp. GM50 | Isolate | Nodule |
| 509 | 2511231017 | Pseudomonas sp. GM55 | Isolate | Nodule |
| 510 | 2511231018 | Pseudomonas sp. GM60 | Isolate | Nodule |
| 511 | 2511231019 | Pseudomonas sp. GM67 | Isolate | Nodule |
| 512 | 2511231020 | Pseudomonas sp. GM74 | Isolate | Nodule |
| 513 | 2511231021 | Pseudomonas sp. GM78 | Isolate | Nodule |
| 514 | 2511231022 | Pseudomonas sp. GM79 | Isolate | Nodule |
| 515 | 2511231023 | Pseudomonas sp. GM80 | Isolate | Nodule |
| 516 | 2511231024 | Pseudomonas sp. GM84 | Isolate | Nodule |
| 517 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 518 | 2511231156 | Pseudomonas ogarae F113 | Isolate | Rhizosphere |
| 519 | 2512047018 | Pseudomonas chlororaphis chlororaphis GP72 | Isolate | Rhizosphere |
| 520 | 2512047030 | Paraburkholderia tuberum STM678 | Isolate | Nodule |
| 521 | 2513237082 | Paraburkholderia mimosarum STM3621 | Isolate | Nodule |
| 522 | 2513237083 | Paraburkholderia mimosarum LMG 23256 | Isolate | Nodule |
| 523 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 524 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 525 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 526 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 527 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 528 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 529 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 530 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 531 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 532 | 2513237150 | Cupriavidus taiwanensis STM6018 | Isolate | Nodule |
| 533 | 2513237151 | Burkholderia sp. WSM2230 | Isolate | Nodule |
| 534 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 535 | 2513237165 | Cupriavidus neocaledonicus STM6070 | Isolate | Nodule |
| 536 | 2513237166 | Paraburkholderia azotifigens UYPR1.413 | Isolate | Nodule |
| 537 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 538 | 2515154122 | Paraburkholderia atlantica JPY251 | Isolate | Nodule |
| 539 | 2515154123 | Trinickia symbiotica JPY347 | Isolate | Nodule |
| 540 | 2515154189 | Paraburkholderia nodosa DSM 21604 | Isolate | Unclassified |
| 541 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 542 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 543 | 2519103095 | Burkholderia sp. KJ006 | Isolate | Nodule |
| 544 | 2521172590 | Herbaspirillum sp. GW103 | Isolate | Rhizosphere |
| 545 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 546 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 547 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 548 | 2526164713 | Paraburkholderia phenoliruptrix JPY366 | Isolate | Nodule |
| 549 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 550 | 2548876994 | Herbaspirillum lusitanum P6-12 | Isolate | Nodule |
| 551 | 2551306352 | Acinetobacter sp. GG2 | Isolate | Rhizosphere |
| 552 | 2551306416 | Herbaspirillum seropedicae Os34 | Isolate | Unclassified |
| 553 | 2554235132 | Pseudomonas aeruginosa PGPR2 | Isolate | Unclassified |
| 554 | 2554235231 | Pseudomonas putida MTCC 5279 | Isolate | Unclassified |
| 555 | 2554235341 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 556 | 2562617112 | Burkholderia sp. BT03 | Isolate | Rhizosphere |
| 557 | 2582580891 | Pseudomonas chlororaphis YL-1 | Isolate | Unclassified |
| 558 | 2582581311 | Burkholderia sp. WP42 | Isolate | Rhizosphere |
| 559 | 2595698237 | Methylobacterium sp. UNCCL125 | Isolate | Unclassified |
| 560 | 2596583598 | Ralstonia sp. UNCCL144 | Isolate | Unclassified |
| 561 | 2597489887 | Pseudomonas chlororaphis aureofaciens 30-84 | Isolate | Rhizosphere |
| 562 | 2597489888 | Pseudomonas fluorescens SS101 | Isolate | Rhizosphere |
| 563 | 2597489889 | Pseudomonas synxantha BG33R | Isolate | Rhizosphere |
| 564 | 2599185160 | Pseudomonas sp. NFPP25 | Isolate | Rhizoplane |
| 565 | 2599185161 | Pseudomonas sp. NFPP09 | Isolate | Rhizoplane |
| 566 | 2599185162 | Pseudomonas sp. NFPP10 | Isolate | Rhizoplane |
| 567 | 2599185163 | Pseudomonas sp. NFPP12 | Isolate | Rhizoplane |
| 568 | 2599185164 | Pseudomonas sp. NFPP13 | Isolate | Rhizoplane |
| 569 | 2599185165 | Pseudomonas sp. NFPP18 | Isolate | Rhizoplane |
| 570 | 2599185166 | Pseudomonas sp. NFPP08 | Isolate | Rhizoplane |
| 571 | 2599185167 | Pseudomonas sp. NFPP28 | Isolate | Rhizoplane |
| 572 | 2599185168 | Pseudomonas sp. NFPP05 | Isolate | Rhizoplane |
| 573 | 2599185178 | Ralstonia sp. NFACC01 | Isolate | Rhizoplane |
| 574 | 2599185179 | Pseudomonas sp. NFR09 | Isolate | Rhizoplane |
| 575 | 2599185181 | Pseudomonas sp. NFPP17 | Isolate | Rhizoplane |
| 576 | 2599185182 | Pseudomonas sp. NFPP19 | Isolate | Rhizoplane |
| 577 | 2599185185 | Pseudomonas sp. NFPP07 | Isolate | Rhizoplane |
| 578 | 2599185186 | Pseudomonas sp. NFPP15 | Isolate | Rhizoplane |
| 579 | 2599185188 | Pseudomonas sp. NFACC45 | Isolate | Rhizoplane |
| 580 | 2599185189 | Pseudomonas sp. NFPP02 | Isolate | Rhizoplane |
| 581 | 2599185190 | Pseudomonas sp. NFPP04 | Isolate | Rhizoplane |
| 582 | 2599185191 | Pseudomonas sp. NFPP24 | Isolate | Rhizoplane |
| 583 | 2599185239 | Burkholderia sp. NFACC38-1 | Isolate | Rhizoplane |
| 584 | 2599185240 | Burkholderia sp. NFPP32 | Isolate | Rhizoplane |
| 585 | 2599185257 | Pseudomonas sp. NFACC41-3 | Isolate | Rhizoplane |
| 586 | 2599185288 | Pseudomonas sp. NFACC25 | Isolate | Rhizoplane |
| 587 | 2599185290 | Pseudomonas sp. NFPP11 | Isolate | Rhizoplane |
| 588 | 2599185300 | Pseudomonas sp. NFACC39-1 | Isolate | Rhizoplane |
| 589 | 2599185303 | Pseudomonas sp. NFACC42-2 | Isolate | Rhizoplane |
| 590 | 2599185311 | Pseudomonas sp. NFACC04-2 | Isolate | Rhizoplane |
| 591 | 2599185352 | Sinorhizobium sp. NFACC03 | Isolate | Rhizoplane |
| 592 | 2599185355 | Burkholderia sp. NFACC33-1 | Isolate | Rhizoplane |
| 593 | 2599185356 | Pseudomonas sp. NFPP14 | Isolate | Rhizoplane |
| 594 | 2600254931 | Pseudomonas sp. NFIX28 | Isolate | Rhizoplane |
| 595 | 2600255067 | Paraburkholderia kururiensis thiooxydans NBRC 107107 | Isolate | Unclassified |
| 596 | 2600255296 | Pseudomonas sp. NFR02 | Isolate | Rhizoplane |
| 597 | 2600255313 | Pseudomonas sp. NFPP16 | Isolate | Rhizoplane |
| 598 | 2600255318 | Pseudomonas putida NFIX47 | Isolate | Rhizoplane |
| 599 | 2602042107 | Bradyrhizobium sp. NFR13 | Isolate | Rhizoplane |
| 600 | 2603880185 | Pseudomonas sp. NFIX46 | Isolate | Rhizoplane |
| 601 | 2603880199 | Pseudomonas sp. NFIX49 | Isolate | Rhizoplane |
| 602 | 2606217733 | Pseudomonas aeruginosa NFHH01 | Isolate | Rhizoplane |
| 603 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 604 | 2619619299 | Pseudomonas veronii R4 Genome sequencing | Isolate | Unclassified |
| 605 | 2623620443 | Pseudomonas sp. DR 5-09 | Isolate | Unclassified |
| 606 | 2623620446 | Pseudomonas sp. GR 6-02 | Isolate | Unclassified |
| 607 | 2639762793 | Acinetobacter calcoaceticus GK1 | Isolate | Rhizosphere |
| 608 | 2643221571 | Pseudomonas sp. Root569 | Isolate | Unclassified |
| 609 | 2643221589 | Pseudomonas sp. Root68 | Isolate | Unclassified |
| 610 | 2643221602 | Pseudomonas sp. Root71 | Isolate | Unclassified |
| 611 | 2643221633 | Pseudomonas sp. Root329 | Isolate | Unclassified |
| 612 | 2643221650 | Pseudomonas sp. Root401 | Isolate | Unclassified |
| 613 | 2643221713 | Pseudomonas sp. Root9 | Isolate | Unclassified |
| 614 | 2651869719 | Genome Sequence of Pseudomonas fluorescens UM270 | Isolate | Rhizosphere |
| 615 | 2667528171 | Pseudomonas sp. NFPP22 | Isolate | Rhizoplane |
| 616 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 617 | 2671180172 | Pseudomonas sp. NFIX51 | Isolate | Rhizoplane |
| 618 | 2675903129 | Burkholderia pyrrocinia NFIX32 | Isolate | Rhizoplane |
| 619 | 2675903420 | Pseudomonas fluorescens Ps006 | Isolate | Unclassified |
| 620 | 2675903507 | Acinetobacter calcoaceticus GK2 | Isolate | Unclassified |
| 621 | 2675903515 | Pseudomonas thivervalensis DSM 13194 | Isolate | Unclassified |
| 622 | 2711768613 | Burkholderia sp. BT03 | Isolate | Rhizosphere |
| 623 | 2713897148 | Pseudomonas fluorescens SF39a | Isolate | Rhizosphere |
| 624 | 2713897149 | Pseudomonas fluorescens SF4c | Isolate | Rhizosphere |
| 625 | 2718217725 | Pseudomonas fluorescens CREA-C16 | Isolate | Rhizosphere |
| 626 | 2718217991 | Paraburkholderia sprentiae WSM5005 | Isolate | Nodule |
| 627 | 2721755607 | Pseudomonas fluorescens Pt14 | Isolate | Rhizosphere |
| 628 | 2721755763 | Pandoraea thiooxydans ATSB16 | Isolate | Rhizosphere |
| 629 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 630 | 2738541265 | Pseudomonas sp. GV077 | Isolate | Unclassified |
| 631 | 2738541281 | Methylobacterium sp. GV094 | Isolate | Unclassified |
| 632 | 2738541282 | Pseudomonas sp. GV058 | Isolate | Unclassified |
| 633 | 2738541294 | Pseudomonas sp. GV087 | Isolate | Unclassified |
| 634 | 2738541296 | Paraburkholderia sp. GV073 | Isolate | Unclassified |
| 635 | 2738541298 | Paraburkholderia sp. GV068 | Isolate | Unclassified |
| 636 | 2738541303 | Pseudomonas sp. GV105 | Isolate | Unclassified |
| 637 | 2738541306 | Paraburkholderia sp. GV052 | Isolate | Unclassified |
| 638 | 2738541309 | Pseudomonas sp. GV047 | Isolate | Unclassified |
| 639 | 2738543002 | Paraburkholderia sp. GV072 | Isolate | Unclassified |
| 640 | 2738543004 | Pseudomonas sp. GV085 | Isolate | Unclassified |
| 641 | 2738543008 | Paraburkholderia sp. GV060 | Isolate | Unclassified |
| 642 | 2738543015 | Pseudomonas sp. GV041 | Isolate | Unclassified |
| 643 | 2738543025 | Pseudomonas sp. GV091 | Isolate | Unclassified |
| 644 | 2738543032 | Methylobacterium sp. GV104 | Isolate | Unclassified |
| 645 | 2740892503 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 646 | 2744054620 | Pseudomonas thivervalensis LMG 21626 | Isolate | Unclassified |
| 647 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 648 | 2744054900 | Paraburkholderia ginsengiterrae DCY85-1 | Isolate | Unclassified |
| 649 | 2744054901 | Paraburkholderia ginsengiterrae DCY85 | Isolate | Unclassified |
| 650 | 2751185846 | Paraburkholderia ribeironis STM 7296 | Isolate | Unclassified |
| 651 | 2765235838 | Herbaspirillum robiniae AA6 | Isolate | Unclassified |
| 652 | 2765235841 | Pseudomonas putida AA7 | Isolate | Unclassified |
| 653 | 2773857670 | Pseudomonas sp. 478 | Isolate | Unclassified |
| 654 | 2773857673 | Pseudomonas sp. 443 | Isolate | Unclassified |
| 655 | 2773857761 | Acinetobacter sp. 3664 | Isolate | Unclassified |
| 656 | 2773857770 | Acinetobacter sp. 3636 | Isolate | Unclassified |
| 657 | 2784132063 | Pseudomonas sp. 424 | Isolate | Unclassified |
| 658 | 2784132072 | Pseudomonas sp. 460 | Isolate | Unclassified |
| 659 | 2791355137 | Paraburkholderia piptadeniae STM7183 | Isolate | Unclassified |
| 660 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 661 | 2791355199 | |||
| 662 | 2791355520 | Pseudomonas sp. s211(2017) | Isolate | Unclassified |
| 663 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 664 | 2806310737 | Pseudomonas mosselii BS011 | Isolate | Unclassified |
| 665 | 2806310745 | Pseudomonas mosselii PtA1 | Isolate | Unclassified |
| 666 | 2808606361 | Pseudomonas sp. SJZ075 | Isolate | Rhizosphere |
| 667 | 2808606376 | Pseudomonas sp. SJZ074 | Isolate | Rhizosphere |
| 668 | 2808606377 | Pseudomonas sp. SJZ083 | Isolate | Rhizosphere |
| 669 | 2808606378 | Pseudomonas sp. SJZ078 | Isolate | Rhizosphere |
| 670 | 2808606380 | Pseudomonas sp. SJZ085 | Isolate | Rhizosphere |
| 671 | 2808606381 | Pseudomonas sp. SJZ077 | Isolate | Rhizosphere |
| 672 | 2808606382 | Pseudomonas sp. SJZ080 | Isolate | Rhizosphere |
| 673 | 2808606383 | Pseudomonas sp. SJZ124 | Isolate | Rhizosphere |
| 674 | 2808606384 | Burkholderia sp. SJZ089 | Isolate | Rhizosphere |
| 675 | 2808606385 | Pseudomonas sp. SJZ103 | Isolate | Rhizosphere |
| 676 | 2808606388 | Pseudomonas sp. SJZ094 | Isolate | Rhizosphere |
| 677 | 2808606389 | Pseudomonas sp. SJZ101 | Isolate | Rhizosphere |
| 678 | 2808606390 | Burkholderia sp. SJZ115 | Isolate | Rhizosphere |
| 679 | 2808606391 | Burkholderia sp. SJZ091 | Isolate | Rhizosphere |
| 680 | 2808606445 | Pseudomonas sp. SJZ131 | Isolate | Rhizosphere |
| 681 | 2811994881 | Pseudomonas sp. SLBN-26 | Isolate | Unclassified |
| 682 | 2816332253 | Burkholderia vietnamiensis HI2297 | Isolate | Unclassified |
| 683 | 2816332256 | Burkholderia vietnamiensis MSMB608WGS | Isolate | Unclassified |
| 684 | 2816332286 | Burkholderia vietnamiensis HI2221 | Isolate | Rhizosphere |
| 685 | 2816332298 | Pseudomonas veronii R02 | Isolate | Rhizosphere |
| 686 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 687 | 2818991436 | Collimonas arenae 515 | Isolate | Unclassified |
| 688 | 2818991445 | Herbaspirillum hiltneri 3195 | Isolate | Unclassified |
| 689 | 2818991449 | Herbaspirillum huttiense 1147 | Isolate | Unclassified |
| 690 | 2818991452 | Burkholderia cepacia 561 | Isolate | Unclassified |
| 691 | 2818991456 | Pseudomonas koreensis 3286 | Isolate | Rhizosphere |
| 692 | 2818991464 | Pseudomonas protegens 3295 | Isolate | Rhizosphere |
| 693 | 2823421272 | Pseudomonas mendocina S5.2 | Isolate | Rhizoplane |
| 694 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 695 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 696 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 697 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 698 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 699 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 700 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 701 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 702 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 703 | 2825651385 | Pseudomonas brassicacearum L13-6-12 | Isolate | Rhizosphere |
| 704 | 2829745981 | Methylorubrum rhodinum DSM 2163 | Isolate | Rhizosphere |
| 705 | 2834028612 | Pseudomonas fluorescens 513 | Isolate | Unclassified |
| 706 | 2834641062 | Cupriavidus gilardii JZ4 | Isolate | Unclassified |
| 707 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 708 | 2839094727 | Herbaspirillum robiniae HZ10 | Isolate | Nodule |
| 709 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 710 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 711 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 712 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 713 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 714 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 715 | 2842324504 | Paraburkholderia fungorum SEMIA 4007 | Isolate | Nodule |
| 716 | 2842348783 | Paraburkholderia fungorum SEMIA 4013 | Isolate | Nodule |
| 717 | 2842454564 | Paraburkholderia fungorum SEMIA 4056 | Isolate | Nodule |
| 718 | 2842698319 | Methylobacterium sp. R-72139 | Isolate | Unclassified |
| 719 | 2842826826 | Pseudomonas sp. R-72172 | Isolate | Unclassified |
| 720 | 2842832357 | Pseudomonas sp. R-72164 | Isolate | Unclassified |
| 721 | 2842837860 | Pseudomonas sp. R-72102 | Isolate | Unclassified |
| 722 | 2842843487 | Pseudomonas sp. R-72074 | Isolate | Unclassified |
| 723 | 2844665904 | Pseudomonas protegens H1F10C | Isolate | Unclassified |
| 724 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 725 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 726 | 2852612431 | Pseudomonas sp. SJZ073 | Isolate | Rhizosphere |
| 727 | 2852657418 | Pseudomonas sp. JAI115 | Isolate | Rhizosphere |
| 728 | 2852667396 | Pseudomonas sp. JAI120 | Isolate | Rhizosphere |
| 729 | 2857524615 | Tardiphaga sp. R-73074 | Isolate | Unclassified |
| 730 | 2858688981 | Cupriavidus sp. UYMMa02A | Isolate | Unclassified |
| 731 | 2860339153 | Pseudomonas sp. JAI111 | Isolate | Rhizosphere |
| 732 | 2860867994 | Pseudomonas sp. R1-43-08 | Isolate | Rhizosphere |
| 733 | 2861691609 | Methylorubrum thiocyanatum DSM 11490 | Isolate | Rhizosphere |
| 734 | 2863421361 | Burkholderia cenocepacia CACua-24 | Isolate | Rhizosphere |
| 735 | 2870068957 | Burkholderia sp. JP2-270 | Isolate | Unclassified |
| 736 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 737 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 738 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 739 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 740 | 2878029506 | Pseudomonas fluorescens DR397 | Isolate | Rhizosphere |
| 741 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 742 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 743 | 2880230671 | Pseudomonas fluorescens LBUM677 | Isolate | Unclassified |
| 744 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 745 | 2883087390 | Paraburkholderia guartelaensis CNPSo 3008 | Isolate | Unclassified |
| 746 | 2884811622 | Herbaspirillum sp. 3C11 | Isolate | Unclassified |
| 747 | 2884836552 | Herbaspirillum sp. 3R-11 | Isolate | Unclassified |
| 748 | 2884852848 | Herbaspirillum sp. 3R11 | Isolate | Unclassified |
| 749 | 2885266251 | Ralstonia sp. SET104 | Isolate | Nodule |
| 750 | 2885270888 | Paraburkholderia sp. UYCPa14C | Isolate | Unclassified |
| 751 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 752 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 753 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 754 | 2889306138 | Methylobacterium sp. PvR107 | Isolate | Rhizosphere |
| 755 | 2893066018 | Tardiphaga sp. P9-11 | Isolate | Unclassified |
| 756 | 2896154374 | Herbaspirillum sp. 3R-3a1 | Isolate | Nodule |
| 757 | 2900634093 | Paraburkholderia dipogonis ICMP 19430 | Isolate | Unclassified |
| 758 | 2901300506 | Cupriavidus sp. UYMSc13B | Isolate | Unclassified |
| 759 | 2902330777 | Methylobacterium sp. 2A | Isolate | Unclassified |
| 760 | 2902682994 | Paraburkholderia atlantica CNPSo 3155 | Isolate | Unclassified |
| 761 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 762 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 763 | 2904424332 | Duganella sp. 1411 | Isolate | Rhizosphere |
| 764 | 2904439833 | Herbaspirillum sp. 1589 | Isolate | Rhizosphere |
| 765 | 2904518522 | Pseudomonas fluorescens 4488 | Isolate | Rhizosphere |
| 766 | 2904530477 | Herbaspirillum huttiense 611 | Isolate | Unclassified |
| 767 | 2904550169 | Stutzerimonas stutzeri 1099 | Isolate | Rhizosphere |
| 768 | 2904564687 | Burkholderia sp. 571 | Isolate | Unclassified |
| 769 | 2904571731 | Burkholderia cenocepacia 574 | Isolate | Unclassified |
| 770 | 2904584206 | Herbaspirillum sp. 1050 | Isolate | Unclassified |
| 771 | 2904589729 | Herbaspirillum sp. 1130 | Isolate | Unclassified |
| 772 | 2904601388 | Herbaspirillum sp. 1273 | Isolate | Rhizosphere |
| 773 | 2904615490 | Paraburkholderia franconis CNPSo 3157 | Isolate | Unclassified |
| 774 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 775 | 2904699407 | |||
| 776 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 777 | 2906610324 | |||
| 778 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 779 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 780 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 781 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 782 | 2908446538 | Pseudomonas sp. R76 | Isolate | Rhizosphere |
| 783 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 784 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 785 | 2909042592 | Labrys sp. LIt4 | Isolate | Nodule |
| 786 | 2912963787 | Pseudomonas sp. R32 | Isolate | Rhizosphere |
| 787 | 2913036834 | Pseudomonas viciae 11K1 | Isolate | Rhizosphere |
| 788 | 2917070673 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 789 | 2919063839 | Pseudomonas pharyngis 1098 | Isolate | Rhizosphere |
| 790 | 2919073203 | Tardiphaga robiniae 1155 | Isolate | Unclassified |
| 791 | 2919079590 | Herbaspirillum sp. 1173 | Isolate | Unclassified |
| 792 | 2919155634 | Pseudomonas fulva 1992 | Isolate | Unclassified |
| 793 | 2919182534 | Acinetobacter calcoaceticus 2589 | Isolate | Rhizosphere |
| 794 | 2919385768 | Pseudomonas sp. 2957 | Isolate | Unclassified |
| 795 | 2919456309 | Pseudomonas sp. 3296 | Isolate | Rhizosphere |
| 796 | 2919487758 | Pseudomonas koreensis 3441 | Isolate | Unclassified |
| 797 | 2919501602 | Pseudomonas alcaliphila 3512 | Isolate | Unclassified |
| 798 | 2919697872 | Pseudomonas frederiksbergensis 4169 | Isolate | Unclassified |
| 799 | 2921643360 | Paraburkholderia steynii HC1.1ba | Isolate | Nodule |
| 800 | 2922368715 | |||
| 801 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 802 | 2922425934 | |||
| 803 | 2923153595 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 804 | 2923510766 | Herbaspirillum rubrisubalbicans SLBN-127 | Isolate | Rhizosphere |
| 805 | 2923519811 | Pseudomonas otitidis SLBN-103 | Isolate | Rhizosphere |
| 806 | 2923586266 | Pseudomonas fluorescens 1550 | Isolate | Rhizosphere |
| 807 | 2926063275 | Pseudomonas sp. 3400 | Isolate | Unclassified |
| 808 | 2928058823 | Ralstonia sp. 1138 | Isolate | Unclassified |
| 809 | 2928108538 | Paraburkholderia terricola 1595 | Isolate | Rhizosphere |
| 810 | 2928125067 | Methylobacterium sp. 1973 | Isolate | Unclassified |
| 811 | 2928130867 | Herbaspirillum seropedicae 1977 | Isolate | Unclassified |
| 812 | 2928135762 | Paraburkholderia terricola 1988 | Isolate | Unclassified |
| 813 | 2928157003 | Burkholderia ambifaria 566 | Isolate | Unclassified |
| 814 | 2928163908 | Burkholderia sp. 567 | Isolate | Unclassified |
| 815 | 2928170801 | Burkholderia sp. 572 | Isolate | Unclassified |
| 816 | 2928503688 | Paraburkholderia terricola 1263 | Isolate | Rhizosphere |
| 817 | 2928536128 | Burkholderia sola 565 | Isolate | Unclassified |
| 818 | 2929144301 | Pseudomonas sp. R-71838 Hybrid assembly | Isolate | Unclassified |
| 819 | 2929189879 | Pseudomonas sp. R-71842 Hybrid assembly | Isolate | Unclassified |
| 820 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 821 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 822 | 2931369376 | Pseudomonas fluorescens DR133 | Isolate | Rhizosphere |
| 823 | 2931390751 | Pseudomonas sp. DR208 | Isolate | Rhizosphere |
| 824 | 2931396565 | Pseudomonas sp. DR48 | Isolate | Rhizosphere |
| 825 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 826 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 827 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 828 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 829 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 830 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 831 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 832 | 2935353572 | Pseudomonas protegens TECH19 | Isolate | Unclassified |
| 833 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 834 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 835 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 836 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 837 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 838 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 839 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 840 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 841 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 842 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 843 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 844 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 845 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 846 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 847 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 848 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 849 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 850 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 851 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 852 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 853 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 854 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 855 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 856 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 857 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 858 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 859 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 860 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 861 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 862 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 863 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 864 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 865 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 866 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 867 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 868 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 869 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 870 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 871 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 872 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 873 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 874 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 875 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 876 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 877 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 878 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 879 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 880 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 881 | 2939636861 | Pseudomonas sp. 2725 | Isolate | Rhizosphere |
| 882 | 2939651529 | Pseudomonas sp. 2835 | Isolate | Rhizosphere |
| 883 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 884 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 885 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 886 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 887 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 888 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 889 | 2945928738 | Pseudomonas cedrina W1I11 | Isolate | Rhizosphere |
| 890 | 2945934425 | Paraburkholderia graminis W1I13 | Isolate | Rhizosphere |
| 891 | 2945961074 | Pseudomonas sp. W2I6 | Isolate | Rhizosphere |
| 892 | 2946006987 | Pseudomonas sp. W3I7 | Isolate | Rhizosphere |
| 893 | 2946027586 | Pseudomonas sp. W4I3 | Isolate | Rhizosphere |
| 894 | 2947233263 | Pseudomonas synxantha W2I4 | Isolate | Rhizosphere |
| 895 | 2954767861 | Variovorax sp. TBS-050B | Isolate | Rhizosphere |
| 896 | 2969304461 | Pseudomonas sp. R84 | Isolate | Rhizosphere |
| 897 | 2974289157 | Pseudomonas fluorescens SORGH_AS 191 | Isolate | Unclassified |
| 898 | 2981990288 | Burkholderia sp. PvR073 | Isolate | Rhizosphere |
| 899 | 2984286254 | Pseudomonas chlororaphis aurantiaca JD37 | Isolate | Rhizosphere |
| 900 | 2988728565 | Pseudomonas corrugata RM1-1-4 | Isolate | Rhizosphere |
| 901 | 2989349275 | Shinella kummerowiae CCBAU 25048 | Isolate | Unclassified |
| 902 | 2990703756 | Paraburkholderia graminis SLBN-33 | Isolate | Rhizosphere |
| 903 | 2998139840 | Pseudomonas iranensis SWRI54 | Isolate | Rhizosphere |
| 904 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 905 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 906 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 907 | 3007395558 | Pseudomonas chlororaphis PCL1601 | Isolate | Rhizosphere |
| 908 | 3007419365 | Pseudomonas vanderleydeniana RW8P3 | Isolate | Unclassified |
| 909 | 3007614139 | Pseudomonas sp. PB106 | Isolate | Unclassified |
| 910 | 3007718800 | Pseudomonas fluorescens BW11P2 | Isolate | Rhizosphere |
| 911 | 3007803356 | Pseudomonas sp. CM27 | Isolate | Unclassified |
| 912 | 3007855910 | Pseudomonas khorasanensis SWRI153 | Isolate | Rhizosphere |
| 913 | 3007861166 | Pseudomonas hamedanensis SWRI65 | Isolate | Rhizosphere |
| 914 | 3007872151 | Pseudomonas sp. SWRI51 | Isolate | Rhizosphere |
| 915 | 637000220 | Pseudomonas protegens Pf-5 | Isolate | Rhizoplane |
| 916 | 641228493 | Gluconacetobacter diazotrophicus PA1 5 | Isolate | Unclassified |
| 917 | 641736151 | Paraburkholderia graminis C4D1M | Isolate | Rhizoplane |
| 918 | 641736154 | Burkholderia ambifaria IOP40-10 | Isolate | Rhizosphere |
| 919 | 642555112 | Paraburkholderia phymatum STM815 | Isolate | Nodule |
| 920 | 642555113 | Paraburkholderia phytofirmans PsJN | Isolate | Unclassified |
| 921 | 643348555 | Gluconacetobacter diazotrophicus PA1 5 | Isolate | Unclassified |
| 922 | 644736347 | Cupriavidus taiwanensis LMG 19424 | Isolate | Nodule |
| 923 | 8002392321 | Alcaligenes faecalis Mc250 | Isolate | Rhizosphere |
| 924 | 8003400568 | Cupriavidus gilardii USM5 | Isolate | Rhizosphere |
| 925 | 8003955200 | Paraburkholderia mimosarum LMG 23256 | Isolate | Nodule |
| 926 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 927 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 928 | 8015687852 | Pseudomonas chlororaphis aurantiaca RP4 | Isolate | Rhizosphere |
| 929 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 930 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 931 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 932 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 933 | 8018845410 | Burkholderia reimsis BE51 | Isolate | Rhizosphere |
| 934 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 935 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 936 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 937 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 938 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 939 | 8019629233 | Bradyrhizobium sp. GM6.1 | Isolate | Nodule |
| 940 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 941 | 8019659431 | Bradyrhizobium sp. GM22.5 | Isolate | Nodule |
| 942 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 943 | 8019678201 | Bradyrhizobium sp. GM0.4 | Isolate | Nodule |
| 944 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 945 | 8019769354 | Pseudomonas sp. MSSRFD41 | Isolate | Rhizosphere |
| 946 | 8019775933 | Pseudomonas sp. PvR083 | Isolate | Rhizosphere |
| 947 | 8020807995 | Burkholderia sp. B10 | Isolate | Rhizosphere |
| 948 | 8020938398 | Burkholderia sp. BE12 | Isolate | Rhizosphere |
| 949 | 8020945358 | Burkholderia sp. BE17 | Isolate | Rhizosphere |
| 950 | 8020953355 | Burkholderia sp. BE24 | Isolate | Rhizosphere |
| 951 | 8021120328 | Burkholderia sp. LS-044 | Isolate | Rhizosphere |
| 952 | 8029995093 | Pseudomonas atacamensis SM1 | Isolate | Rhizosphere |
| 953 | 8034962539 | Pseudomonas sediminis PI11 | Isolate | Rhizosphere |
| 954 | 8039098773 | Burkholderia multivorans MSMB612WGS | Isolate | Unclassified |
| 955 | 8040167225 | Burkholderia vietnamiensis RS1 | Isolate | Unclassified |
| 956 | 8040173305 | Burkholderia vietnamiensis BE10 | Isolate | Rhizosphere |
| 957 | 8052494512 | Pseudomonas putida LD6 | Isolate | Unclassified |
| 958 | 8054285046 | Pseudomonas petroselini MAFF 311096 | Isolate | Nodule |
| 959 | 8054347763 | Pseudomonas carnis NWU Be30 | Isolate | Unclassified |
| 960 | 8054503363 | Pseudomonas sivasensis BsEB-1 | Isolate | Unclassified |
| 961 | 8054929484 | Pseudomonas vlassakiae RW4S1 | Isolate | Rhizosphere |
| 962 | 8055266321 | Paraburkholderia rhynchosiae LMG 27174 | Isolate | Nodule |
| 963 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 964 | 8055770955 | Pseudomonas chlororaphis qlu-1 | Isolate | Rhizosphere |
| 965 | 8055817908 | Pseudomonas pergaminensis 1008 | Isolate | Rhizosphere |
| 966 | 8055878733 | Pseudomonas palmensis BBB001 | Isolate | Rhizosphere |
| 967 | 8056115690 | Pseudomonas muyukensis COW39 | Isolate | Rhizosphere |
| 968 | 8056120720 | Pseudomonas maumuensis COW77 | Isolate | Rhizosphere |
| 969 | 8056125926 | Pseudomonas azerbaijanorientalis SWRI123 | Isolate | Rhizosphere |
| 970 | 8056131705 | Pseudomonas asgharzadehiana SWRI132 | Isolate | Rhizosphere |
| 971 | 8056137416 | Pseudomonas fakonensis COW40 | Isolate | Rhizosphere |
| 972 | 8056148874 | Pseudomonas khavaziana SWRI124 | Isolate | Rhizosphere |
| 973 | 8056155041 | Pseudomonas farris SWRI79 | Isolate | Rhizosphere |
| 974 | 8056161164 | Pseudomonas azadiae SWRI103 | Isolate | Rhizosphere |
| 975 | 8056166840 | Pseudomonas triticicola SWRI88 | Isolate | Rhizosphere |
| 976 | 8056172158 | Pseudomonas ekonensis COR58 | Isolate | Rhizosphere |
| 977 | 8056177738 | Pseudomonas azerbaijanoccidentalis SWRI74 | Isolate | Rhizosphere |
| 978 | 8056569372 | Pseudomonas serboccidentalis IT-P374 | Isolate | Rhizosphere |
| 979 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
| 980 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
| 981 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
| 982 | 8057798959 | Pseudomonas piscis BW16M1 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 73.56 |
| Metatranscriptomes | 0.26 |
| Isolates | 26.18 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 13.61 |
| Nodule | 10.23 |
| Rhizoplane | 4.38 |
| Rhizosphere | 57.75 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.11 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0207678_10020313 | 3300026067 | Bacteria | 5828 |
| 2 | MRS2a_Contig_116 | 2124908027 | Bacteria | 7334 |
| 3 | MRS2a_Contig_6751 | 2124908027 | Bacteria | 9129 |
| 4 | JGI24741J21665_1000205 | 3300001915 | Bacteria | 17562 |
| 5 | JGI24740J21852_10000417 | 3300001979 | Bacteria | 18191 |
| 6 | JGI24740J21852_10000439 | 3300001979 | Bacteria | 17770 |
| 7 | JGI24740J21852_10000760 | 3300001979 | Bacteria | 14118 |
| 8 | JGI24740J21852_10015327 | 3300001979 | Bacteria | 2802 |
| 9 | JGI24739J22299_10002573 | 3300001989 | Bacteria | 6992 |
| 10 | JGI24739J22299_10038511 | 3300001989 | Bacteria | 1606 |
| 11 | JGI24737J22298_10002427 | 3300001990 | Bacteria | 6642 |
| 12 | JGI24737J22298_10012337 | 3300001990 | Bacteria | 2786 |
| 13 | JGI24737J22298_10034108 | 3300001990 | Bacteria | 1578 |
| 14 | JGI24735J21928_10000196 | 3300002067 | Bacteria | 21296 |
| 15 | JGI24735J21928_10001455 | 3300002067 | Bacteria | 8367 |
| 16 | JGI24735J21928_10003047 | 3300002067 | Bacteria | 5746 |
| 17 | JGI24735J21928_10004296 | 3300002067 | Bacteria | 4794 |
| 18 | JGI25156J39149_1003155 | 3300002705 | Bacteria | 5548 |
| 19 | JGI25156J39149_1003951 | 3300002705 | Bacteria | 4684 |
| 20 | JGI25156J39149_1010327 | 3300002705 | Bacteria | 2201 |
| 21 | JGI25162J39368_1000502 | 3300002737 | Bacteria | 29548 |
| 22 | JGI25162J39368_1000626 | 3300002737 | Bacteria | 25132 |
| 23 | JGI25162J39368_1000664 | 3300002737 | Bacteria | 24298 |
| 24 | JGI25154J39366_1000133 | 3300002738 | Bacteria | 58381 |
| 25 | JGI25163J39215_1001643 | 3300002771 | Bacteria | 3315 |
| 26 | JGI25163J39215_1002276 | 3300002771 | Bacteria | 2096 |
| 27 | JGI25164J39214_1000340 | 3300002772 | Bacteria | 29548 |
| 28 | JGI25164J39214_1000400 | 3300002772 | Bacteria | 25132 |
| 29 | JGI25150J39212_1005748 | 3300002774 | Bacteria | 2620 |
| 30 | JGI25151J46595_10004227 | 3300003187 | Bacteria | 7640 |
| 31 | JGI25151J46595_10029166 | 3300003187 | Bacteria | 2188 |
| 32 | JGI25165J46597_1000391 | 3300003214 | Bacteria | 46730 |
| 33 | JGI25165J46597_1000745 | 3300003214 | Bacteria | 25132 |
| 34 | JGI25165J46597_1000776 | 3300003214 | Bacteria | 24298 |
| 35 | rootH1_10062200 | 3300003316 | Bacteria | 7503 |
| 36 | JGI25160J50197_1000447 | 3300003354 | Bacteria | 25781 |
| 37 | JGI25160J50197_1007409 | 3300003354 | Bacteria | 4299 |
| 38 | Ga0006562J51391_1006335 | 3300003578 | Bacteria | 5950 |
| 39 | Ga0055538_1000007 | 3300003751 | Bacteria | 399715 |
| 40 | Ga0055538_1000024 | 3300003751 | Bacteria | 241526 |
| 41 | Ga0055538_1000305 | 3300003751 | Bacteria | 24298 |
| 42 | Ga0055539_1000011 | 3300003752 | Bacteria | 399747 |
| 43 | Ga0055539_1000031 | 3300003752 | Bacteria | 241526 |
| 44 | Ga0055539_1000073 | 3300003752 | Bacteria | 131094 |
| 45 | Ga0055539_1000324 | 3300003752 | Bacteria | 24298 |
| 46 | Ga0055533_1000014 | 3300003756 | Bacteria | 399747 |
| 47 | Ga0055533_1000041 | 3300003756 | Bacteria | 241526 |
| 48 | Ga0055533_1000305 | 3300003756 | Bacteria | 24298 |
| 49 | Ga0055533_1002148 | 3300003756 | Bacteria | 4713 |
| 50 | Ga0055533_1002294 | 3300003756 | Bacteria | 4437 |
| 51 | Ga0055532_1000009 | 3300003758 | Bacteria | 399537 |
| 52 | Ga0055532_1000090 | 3300003758 | Bacteria | 104391 |
| 53 | Ga0055525_1000016 | 3300003759 | Bacteria | 399724 |
| 54 | Ga0055525_1000049 | 3300003759 | Bacteria | 241526 |
| 55 | Ga0055525_1000439 | 3300003759 | Bacteria | 24298 |
| 56 | Ga0055525_1000938 | 3300003759 | Bacteria | 8145 |
| 57 | Ga0055527_1000900 | 3300003760 | Bacteria | 7539 |
| 58 | Ga0055535_1000085 | 3300003761 | Bacteria | 104391 |
| 59 | Ga0055529_1000134 | 3300003763 | Bacteria | 104391 |
| 60 | Ga0055526_1008653 | 3300003771 | Bacteria | 5030 |
| 61 | Ga0055526_1009460 | 3300003771 | Bacteria | 4681 |
| 62 | Ga0055526_1012176 | 3300003771 | Bacteria | 3780 |
| 63 | Ga0055524_1000413 | 3300003775 | Bacteria | 36091 |
| 64 | Ga0055536_1000059 | 3300003781 | Bacteria | 103307 |
| 65 | Ga0055536_1000061 | 3300003781 | Bacteria | 100255 |
| 66 | Ga0055536_1000154 | 3300003781 | Bacteria | 59301 |
| 67 | Ga0055536_1002544 | 3300003781 | Bacteria | 10201 |
| 68 | Ga0055536_1002620 | 3300003781 | Bacteria | 10017 |
| 69 | Ga0055534_1001757 | 3300003784 | Bacteria | 8168 |
| 70 | Ga0055534_1002165 | 3300003784 | Bacteria | 7015 |
| 71 | Ga0055534_1006164 | 3300003784 | Bacteria | 3072 |
| 72 | Ga0055528_1001944 | 3300003790 | Bacteria | 11700 |
| 73 | Ga0055530_10000096 | 3300003791 | Bacteria | 73950 |
| 74 | Ga0055530_10000171 | 3300003791 | Bacteria | 59301 |
| 75 | Ga0055530_10000874 | 3300003791 | Bacteria | 24782 |
| 76 | Ga0055530_10002302 | 3300003791 | Bacteria | 12482 |
| 77 | Ga0055540_1000084 | 3300003792 | Bacteria | 107482 |
| 78 | Ga0055540_1000214 | 3300003792 | Bacteria | 54779 |
| 79 | Ga0055540_1000648 | 3300003792 | Bacteria | 24458 |
| 80 | Ga0055540_1001741 | 3300003792 | Bacteria | 12482 |
| 81 | Ga0055531_10000266 | 3300003794 | Bacteria | 54559 |
| 82 | Ga0055541_1000008 | 3300003841 | Bacteria | 399724 |
| 83 | Ga0055541_1000022 | 3300003841 | Bacteria | 241526 |
| 84 | Ga0055541_1000213 | 3300003841 | Bacteria | 24298 |
| 85 | Ga0055541_1000346 | 3300003841 | Bacteria | 14455 |
| 86 | Ga0055541_1006842 | 3300003841 | Bacteria | 1909 |
| 87 | Ga0058692_1000014 | 3300003856 | Bacteria | 313984 |
| 88 | Ga0055543_1004552 | 3300004625 | Bacteria | 3743 |
| 89 | Ga0065165_1000244 | 3300005262 | Bacteria | 93411 |
| 90 | Ga0065165_1000368 | 3300005262 | Bacteria | 73904 |
| 91 | Ga0065165_1001437 | 3300005262 | Bacteria | 25810 |
| 92 | Ga0065714_10000085 | 3300005288 | Bacteria | 12095 |
| 93 | Ga0065714_10005412 | 3300005288 | Bacteria | 5969 |
| 94 | Ga0065714_10006886 | 3300005288 | Bacteria | 3836 |
| 95 | Ga0065704_10018874 | 3300005289 | Bacteria | 1682 |
| 96 | Ga0065704_10084484 | 3300005289 | Bacteria | 3318 |
| 97 | Ga0065704_10091819 | 3300005289 | Bacteria | 2692 |
| 98 | Ga0065704_10150193 | 3300005289 | Bacteria | 1436 |
| 99 | Ga0070658_10017560 | 3300005327 | Bacteria | 5724 |
| 100 | Ga0070658_10018393 | 3300005327 | Bacteria | 5593 |
| 101 | Ga0070658_10092389 | 3300005327 | Bacteria | 2495 |
| 102 | Ga0070658_10143166 | 3300005327 | Bacteria | 1998 |
| 103 | Ga0070683_100138178 | 3300005329 | Bacteria | 2308 |
| 104 | Ga0070670_100005474 | 3300005331 | Bacteria | 10713 |
| 105 | Ga0070670_100145170 | 3300005331 | Bacteria | 2053 |
| 106 | Ga0070666_10012949 | 3300005335 | Bacteria | 5278 |
| 107 | Ga0070680_100019559 | 3300005336 | Bacteria | 5368 |
| 108 | Ga0070660_100001445 | 3300005339 | Bacteria | 16232 |
| 109 | Ga0070660_100001741 | 3300005339 | Bacteria | 14919 |
| 110 | Ga0070660_100019883 | 3300005339 | Bacteria | 4926 |
| 111 | Ga0070691_10027029 | 3300005341 | Bacteria | 2676 |
| 112 | Ga0070661_100000683 | 3300005344 | Bacteria | 24923 |
| 113 | Ga0070661_100000829 | 3300005344 | Bacteria | 22251 |
| 114 | Ga0070668_100036478 | 3300005347 | Bacteria | 3752 |
| 115 | Ga0070668_100055824 | 3300005347 | Bacteria | 3049 |
| 116 | Ga0070669_100001270 | 3300005353 | Bacteria | 18313 |
| 117 | Ga0070669_100006569 | 3300005353 | Bacteria | 8369 |
| 118 | Ga0070669_100018381 | 3300005353 | Bacteria | 4996 |
| 119 | Ga0070675_100139551 | 3300005354 | Bacteria | 2071 |
| 120 | Ga0070659_100000035 | 3300005366 | Bacteria | 115022 |
| 121 | Ga0070659_100001478 | 3300005366 | Bacteria | 16932 |
| 122 | Ga0070667_100002744 | 3300005367 | Bacteria | 15234 |
| 123 | Ga0070667_100019966 | 3300005367 | Bacteria | 5561 |
| 124 | Ga0070667_100022517 | 3300005367 | Bacteria | 5224 |
| 125 | Ga0070709_10000407 | 3300005434 | Bacteria | 26293 |
| 126 | Ga0070709_10027331 | 3300005434 | Bacteria | 3391 |
| 127 | Ga0070714_100185287 | 3300005435 | Bacteria | 1896 |
| 128 | Ga0070714_100235201 | 3300005435 | Bacteria | 1689 |
| 129 | Ga0070713_100047323 | 3300005436 | Bacteria | 3534 |
| 130 | Ga0070713_100053812 | 3300005436 | Bacteria | 3337 |
| 131 | Ga0070710_10006310 | 3300005437 | Bacteria | 5685 |
| 132 | Ga0070710_10035406 | 3300005437 | Bacteria | 2722 |
| 133 | Ga0070711_100006265 | 3300005439 | Bacteria | 7167 |
| 134 | Ga0070663_100000251 | 3300005455 | Bacteria | 27107 |
| 135 | Ga0070663_100003477 | 3300005455 | Bacteria | 9080 |
| 136 | Ga0070663_100045511 | 3300005455 | Bacteria | 3100 |
| 137 | Ga0070663_100160335 | 3300005455 | Bacteria | 1731 |
| 138 | Ga0070678_100005891 | 3300005456 | Bacteria | 7131 |
| 139 | Ga0070662_100116271 | 3300005457 | Bacteria | 2044 |
| 140 | Ga0068867_100074043 | 3300005459 | Bacteria | 2551 |
| 141 | Ga0070706_100074209 | 3300005467 | Bacteria | 3149 |
| 142 | Ga0070698_100122056 | 3300005471 | Bacteria | 2564 |
| 143 | Ga0070684_100048880 | 3300005535 | Bacteria | 3670 |
| 144 | Ga0070697_100154854 | 3300005536 | Bacteria | 1934 |
| 145 | Ga0068853_100034377 | 3300005539 | Bacteria | 4302 |
| 146 | Ga0068853_100069502 | 3300005539 | Bacteria | 3064 |
| 147 | Ga0070665_100007326 | 3300005548 | Bacteria | 11223 |
| 148 | Ga0070665_100021701 | 3300005548 | Bacteria | 6457 |
| 149 | Ga0068855_100000366 | 3300005563 | Bacteria | 55965 |
| 150 | Ga0068855_100004438 | 3300005563 | Bacteria | 17140 |
| 151 | Ga0068855_100024563 | 3300005563 | Bacteria | 7209 |
| 152 | Ga0068855_100145412 | 3300005563 | Bacteria | 2699 |
| 153 | Ga0068855_100159275 | 3300005563 | Bacteria | 2563 |
| 154 | Ga0070664_100000623 | 3300005564 | Bacteria | 27102 |
| 155 | Ga0070664_100000878 | 3300005564 | Bacteria | 23328 |
| 156 | Ga0068857_100013415 | 3300005577 | Bacteria | 7138 |
| 157 | Ga0068857_100024577 | 3300005577 | Bacteria | 5305 |
| 158 | Ga0068857_100085485 | 3300005577 | Bacteria | 2819 |
| 159 | Ga0068857_100101512 | 3300005577 | Bacteria | 2582 |
| 160 | Ga0068857_100209200 | 3300005577 | Bacteria | 1780 |
| 161 | Ga0068854_100000308 | 3300005578 | Bacteria | 32248 |
| 162 | Ga0068854_100093960 | 3300005578 | Bacteria | 2236 |
| 163 | Ga0068856_100001206 | 3300005614 | Bacteria | 27139 |
| 164 | Ga0068856_100021342 | 3300005614 | Bacteria | 6294 |
| 165 | Ga0068856_100069364 | 3300005614 | Bacteria | 3486 |
| 166 | Ga0068856_100160460 | 3300005614 | Bacteria | 2259 |
| 167 | Ga0068852_100017907 | 3300005616 | Bacteria | 5569 |
| 168 | Ga0068852_100021423 | 3300005616 | Bacteria | 5160 |
| 169 | Ga0068852_100054812 | 3300005616 | Bacteria | 3438 |
| 170 | Ga0068859_100080918 | 3300005617 | Bacteria | 3290 |
| 171 | Ga0068859_100334951 | 3300005617 | Bacteria | 1607 |
| 172 | Ga0068851_10000316 | 3300005834 | Bacteria | 21838 |
| 173 | Ga0068851_10019934 | 3300005834 | Bacteria | 3243 |
| 174 | Ga0068863_100083044 | 3300005841 | Bacteria | 3035 |
| 175 | Ga0068858_100240812 | 3300005842 | Bacteria | 1717 |
| 176 | Ga0068860_100019238 | 3300005843 | Bacteria | 6629 |
| 177 | Ga0081455_10010447 | 3300005937 | Bacteria | 9420 |
| 178 | Ga0081455_10010813 | 3300005937 | Bacteria | 9222 |
| 179 | Ga0081540_1003649 | 3300005983 | Bacteria | 12076 |
| 180 | Ga0081540_1006563 | 3300005983 | Bacteria | 8443 |
| 181 | Ga0081540_1032672 | 3300005983 | Bacteria | 2838 |
| 182 | Ga0081540_1038988 | 3300005983 | Bacteria | 2496 |
| 183 | Ga0081540_1055583 | 3300005983 | Bacteria | 1927 |
| 184 | Ga0075365_10017044 | 3300006038 | Bacteria | 4435 |
| 185 | Ga0075365_10033426 | 3300006038 | Bacteria | 3314 |
| 186 | Ga0075368_10002670 | 3300006042 | Bacteria | 5866 |
| 187 | Ga0075368_10032589 | 3300006042 | Bacteria | 2025 |
| 188 | Ga0075363_100017395 | 3300006048 | Bacteria | 3565 |
| 189 | Ga0075364_10041753 | 3300006051 | Bacteria | 2979 |
| 190 | Ga0075364_10060885 | 3300006051 | Bacteria | 2475 |
| 191 | Ga0075364_10132837 | 3300006051 | Bacteria | 1671 |
| 192 | Ga0070715_10061041 | 3300006163 | Bacteria | 1655 |
| 193 | Ga0070716_100007807 | 3300006173 | Bacteria | 5287 |
| 194 | Ga0070716_100036500 | 3300006173 | Bacteria | 2710 |
| 195 | Ga0070716_100043300 | 3300006173 | Bacteria | 2516 |
| 196 | Ga0075362_10009652 | 3300006177 | Bacteria | 3741 |
| 197 | Ga0075367_10039150 | 3300006178 | Bacteria | 2763 |
| 198 | Ga0075367_10059488 | 3300006178 | Bacteria | 2275 |
| 199 | Ga0075369_10039897 | 3300006186 | Bacteria | 2006 |
| 200 | Ga0075366_10004392 | 3300006195 | Bacteria | 7565 |
| 201 | Ga0075366_10012373 | 3300006195 | Bacteria | 4840 |
| 202 | Ga0097621_100104136 | 3300006237 | Bacteria | 2391 |
| 203 | Ga0075370_10008865 | 3300006353 | Bacteria | 5193 |
| 204 | Ga0075370_10041818 | 3300006353 | Bacteria | 2588 |
| 205 | Ga0068871_100070465 | 3300006358 | Bacteria | 2874 |
| 206 | Ga0075430_100009079 | 3300006846 | Bacteria | 8400 |
| 207 | Ga0075429_100011122 | 3300006880 | Bacteria | 7790 |
| 208 | Ga0097620_100080913 | 3300006931 | Bacteria | 3290 |
| 209 | Ga0097620_100334939 | 3300006931 | Bacteria | 1607 |
| 210 | Ga0099824_1011829 | 3300006942 | Bacteria | 9727 |
| 211 | Ga0099822_1005398 | 3300006943 | Bacteria | 16681 |
| 212 | Ga0099823_1000091 | 3300006944 | Bacteria | 43725 |
| 213 | Ga0079104_1000008 | 3300006946 | Bacteria | 371223 |
| 214 | Ga0079104_1000707 | 3300006946 | Bacteria | 30262 |
| 215 | Ga0079104_1003900 | 3300006946 | Bacteria | 6665 |
| 216 | Ga0099826_10000022 | 3300006948 | Bacteria | 159004 |
| 217 | Ga0099826_10013588 | 3300006948 | Bacteria | 6153 |
| 218 | Ga0075435_100196129 | 3300007076 | Bacteria | 1710 |
| 219 | Ga0105251_10000016 | 3300009011 | Bacteria | 146400 |
| 220 | Ga0105251_10000756 | 3300009011 | Bacteria | 29516 |
| 221 | Ga0105251_10001655 | 3300009011 | Bacteria | 18854 |
| 222 | Ga0105251_10001720 | 3300009011 | Bacteria | 18316 |
| 223 | Ga0105251_10007644 | 3300009011 | Bacteria | 6617 |
| 224 | Ga0105251_10014969 | 3300009011 | Bacteria | 4258 |
| 225 | Ga0105251_10031596 | 3300009011 | Bacteria | 2647 |
| 226 | Ga0105251_10037622 | 3300009011 | Bacteria | 2373 |
| 227 | Ga0105251_10055820 | 3300009011 | Bacteria | 1872 |
| 228 | Ga0105251_10072451 | 3300009011 | Bacteria | 1602 |
| 229 | Ga0105244_10000445 | 3300009036 | Bacteria | 37731 |
| 230 | Ga0105244_10000722 | 3300009036 | Bacteria | 28538 |
| 231 | Ga0105244_10000848 | 3300009036 | Bacteria | 25829 |
| 232 | Ga0105244_10004788 | 3300009036 | Bacteria | 9198 |
| 233 | Ga0105244_10005113 | 3300009036 | Bacteria | 8805 |
| 234 | Ga0105244_10005282 | 3300009036 | Bacteria | 8615 |
| 235 | Ga0105244_10007991 | 3300009036 | Bacteria | 6657 |
| 236 | Ga0105244_10010257 | 3300009036 | Bacteria | 5689 |
| 237 | Ga0105244_10022095 | 3300009036 | Bacteria | 3507 |
| 238 | Ga0105244_10023508 | 3300009036 | Bacteria | 3378 |
| 239 | Ga0105244_10032773 | 3300009036 | Bacteria | 2746 |
| 240 | Ga0105244_10032791 | 3300009036 | Bacteria | 2745 |
| 241 | Ga0105244_10050878 | 3300009036 | Bacteria | 2113 |
| 242 | Ga0105250_10000327 | 3300009092 | Bacteria | 36659 |
| 243 | Ga0105250_10000871 | 3300009092 | Bacteria | 17836 |
| 244 | Ga0105250_10003137 | 3300009092 | Bacteria | 7941 |
| 245 | Ga0105250_10004372 | 3300009092 | Bacteria | 6508 |
| 246 | Ga0105250_10008745 | 3300009092 | Bacteria | 4286 |
| 247 | Ga0105250_10051581 | 3300009092 | Bacteria | 1650 |
| 248 | Ga0105250_10052821 | 3300009092 | Bacteria | 1631 |
| 249 | Ga0105250_10068048 | 3300009092 | Bacteria | 1437 |
| 250 | Ga0105240_10001168 | 3300009093 | Bacteria | 46052 |
| 251 | Ga0105240_10007353 | 3300009093 | Bacteria | 16022 |
| 252 | Ga0105240_10013962 | 3300009093 | Bacteria | 10996 |
| 253 | Ga0105240_10019503 | 3300009093 | Bacteria | 9059 |
| 254 | Ga0105240_10096984 | 3300009093 | Bacteria | 3592 |
| 255 | Ga0105240_10146644 | 3300009093 | Bacteria | 2815 |
| 256 | Ga0105240_10159931 | 3300009093 | Bacteria | 2676 |
| 257 | Ga0105240_10276454 | 3300009093 | Bacteria | 1931 |
| 258 | Ga0105245_10035213 | 3300009098 | Bacteria | 4443 |
| 259 | Ga0105245_10122928 | 3300009098 | Bacteria | 2426 |
| 260 | Ga0105247_10000727 | 3300009101 | Bacteria | 25628 |
| 261 | Ga0105243_10000115 | 3300009148 | Bacteria | 92572 |
| 262 | Ga0105243_10000163 | 3300009148 | Bacteria | 75904 |
| 263 | Ga0105243_10001544 | 3300009148 | Bacteria | 20122 |
| 264 | Ga0105243_10001757 | 3300009148 | Bacteria | 18663 |
| 265 | Ga0105243_10001924 | 3300009148 | Bacteria | 17707 |
| 266 | Ga0105243_10002556 | 3300009148 | Bacteria | 15207 |
| 267 | Ga0105243_10025527 | 3300009148 | Bacteria | 4517 |
| 268 | Ga0105243_10025925 | 3300009148 | Bacteria | 4485 |
| 269 | Ga0105241_10006488 | 3300009174 | Bacteria | 8625 |
| 270 | Ga0105241_10123341 | 3300009174 | Bacteria | 2089 |
| 271 | Ga0105237_10000093 | 3300009545 | Bacteria | 122006 |
| 272 | Ga0105237_10003198 | 3300009545 | Bacteria | 19646 |
| 273 | Ga0105237_10006810 | 3300009545 | Bacteria | 12601 |
| 274 | Ga0105237_10022053 | 3300009545 | Bacteria | 6537 |
| 275 | Ga0105237_10025336 | 3300009545 | Bacteria | 6066 |
| 276 | Ga0105237_10048393 | 3300009545 | Bacteria | 4273 |
| 277 | Ga0105237_10104263 | 3300009545 | Bacteria | 2827 |
| 278 | Ga0105237_10125223 | 3300009545 | Bacteria | 2564 |
| 279 | Ga0105238_10000031 | 3300009551 | Bacteria | 179497 |
| 280 | Ga0105238_10040672 | 3300009551 | Bacteria | 4710 |
| 281 | Ga0105238_10053968 | 3300009551 | Bacteria | 4038 |
| 282 | Ga0105238_10085629 | 3300009551 | Bacteria | 3139 |
| 283 | Ga0105238_10123118 | 3300009551 | Bacteria | 2573 |
| 284 | Ga0105238_10126943 | 3300009551 | Bacteria | 2529 |
| 285 | Ga0105249_10022548 | 3300009553 | Bacteria | 5641 |
| 286 | Ga0099796_10020287 | 3300010159 | Bacteria | 2029 |
| 287 | Ga0105239_10001806 | 3300010375 | Bacteria | 28120 |
| 288 | Ga0105239_10002893 | 3300010375 | Bacteria | 21450 |
| 289 | Ga0105239_10024933 | 3300010375 | Bacteria | 6588 |
| 290 | Ga0105239_10034894 | 3300010375 | Bacteria | 5525 |
| 291 | Ga0105239_10042348 | 3300010375 | Bacteria | 4991 |
| 292 | Ga0105239_10079968 | 3300010375 | Bacteria | 3597 |
| 293 | Ga0105246_10001153 | 3300011119 | Bacteria | 15334 |
| 294 | Ga0105246_10001933 | 3300011119 | Bacteria | 12503 |
| 295 | Ga0105246_10029137 | 3300011119 | Bacteria | 3633 |
| 296 | Ga0105246_10177467 | 3300011119 | Bacteria | 1637 |
| 297 | Ga0157345_1000154 | 3300012498 | Bacteria | 11456 |
| 298 | Ga0157345_1002204 | 3300012498 | Bacteria | 1368 |
| 299 | Ga0157373_10005588 | 3300013100 | Bacteria | 9427 |
| 300 | Ga0157373_10005943 | 3300013100 | Bacteria | 9129 |
| 301 | Ga0157373_10006624 | 3300013100 | Bacteria | 8637 |
| 302 | Ga0157373_10016497 | 3300013100 | Bacteria | 5386 |
| 303 | Ga0157373_10021291 | 3300013100 | Bacteria | 4708 |
| 304 | Ga0157373_10109989 | 3300013100 | Bacteria | 1937 |
| 305 | Ga0157373_10112505 | 3300013100 | Bacteria | 1914 |
| 306 | Ga0157371_10001237 | 3300013102 | Bacteria | 27113 |
| 307 | Ga0157371_10009792 | 3300013102 | Bacteria | 7516 |
| 308 | Ga0157371_10016290 | 3300013102 | Bacteria | 5552 |
| 309 | Ga0157371_10023424 | 3300013102 | Bacteria | 4515 |
| 310 | Ga0157371_10172865 | 3300013102 | Bacteria | 1544 |
| 311 | Ga0157370_10000930 | 3300013104 | Bacteria | 37091 |
| 312 | Ga0157370_10003240 | 3300013104 | Bacteria | 19205 |
| 313 | Ga0157370_10019712 | 3300013104 | Bacteria | 6753 |
| 314 | Ga0157370_10022770 | 3300013104 | Bacteria | 6232 |
| 315 | Ga0157369_10000067 | 3300013105 | Bacteria | 144506 |
| 316 | Ga0157369_10000622 | 3300013105 | Bacteria | 46108 |
| 317 | Ga0157369_10004182 | 3300013105 | Bacteria | 17103 |
| 318 | Ga0157369_10013986 | 3300013105 | Bacteria | 9069 |
| 319 | Ga0157369_10030355 | 3300013105 | Bacteria | 5962 |
| 320 | Ga0157369_10034300 | 3300013105 | Bacteria | 5571 |
| 321 | Ga0157369_10056554 | 3300013105 | Bacteria | 4233 |
| 322 | Ga0157369_10057580 | 3300013105 | Bacteria | 4193 |
| 323 | Ga0157369_10065958 | 3300013105 | Bacteria | 3895 |
| 324 | Ga0157369_10166955 | 3300013105 | Bacteria | 2321 |
| 325 | Ga0157374_10000219 | 3300013296 | Bacteria | 52748 |
| 326 | Ga0163162_10001053 | 3300013306 | Bacteria | 25634 |
| 327 | Ga0163162_10001780 | 3300013306 | Bacteria | 20197 |
| 328 | Ga0163162_10060633 | 3300013306 | Bacteria | 3819 |
| 329 | Ga0157372_10001285 | 3300013307 | Bacteria | 27113 |
| 330 | Ga0157372_10002581 | 3300013307 | Bacteria | 19627 |
| 331 | Ga0157372_10011859 | 3300013307 | Bacteria | 9283 |
| 332 | Ga0157372_10033148 | 3300013307 | Bacteria | 5671 |
| 333 | Ga0157372_10054493 | 3300013307 | Bacteria | 4461 |
| 334 | Ga0157375_10008932 | 3300013308 | Bacteria | 8769 |
| 335 | Ga0157375_10333976 | 3300013308 | Bacteria | 1681 |
| 336 | Ga0182008_10005238 | 3300014497 | Bacteria | 7425 |
| 337 | Ga0182008_10006760 | 3300014497 | Bacteria | 6381 |
| 338 | Ga0182008_10013195 | 3300014497 | Bacteria | 4344 |
| 339 | Ga0182008_10017485 | 3300014497 | Bacteria | 3720 |
| 340 | Ga0157376_10046771 | 3300014969 | Bacteria | 3570 |
| 341 | Ga0182006_1001712 | 3300015261 | Bacteria | 12774 |
| 342 | Ga0182006_1007656 | 3300015261 | Bacteria | 4935 |
| 343 | Ga0182006_1009278 | 3300015261 | Bacteria | 4416 |
| 344 | Ga0182006_1011378 | 3300015261 | Bacteria | 3917 |
| 345 | Ga0182006_1012197 | 3300015261 | Bacteria | 3763 |
| 346 | Ga0182006_1013028 | 3300015261 | Bacteria | 3622 |
| 347 | Ga0182006_1016766 | 3300015261 | Bacteria | 3122 |
| 348 | Ga0182006_1018078 | 3300015261 | Bacteria | 2984 |
| 349 | Ga0182006_1018576 | 3300015261 | Bacteria | 2935 |
| 350 | Ga0182006_1040422 | 3300015261 | Bacteria | 1836 |
| 351 | Ga0182006_1041211 | 3300015261 | Bacteria | 1814 |
| 352 | Ga0182007_10001412 | 3300015262 | Bacteria | 12924 |
| 353 | Ga0182007_10019156 | 3300015262 | Bacteria | 2465 |
| 354 | Ga0182005_1000500 | 3300015265 | Bacteria | 20026 |
| 355 | Ga0182005_1004949 | 3300015265 | Bacteria | 4223 |
| 356 | Ga0182005_1014535 | 3300015265 | Bacteria | 2202 |
| 357 | Ga0182005_1021236 | 3300015265 | Bacteria | 1782 |
| 358 | Ga0183362_10003 | 3300015683 | Bacteria | 977584 |
| 359 | Ga0183361_10012 | 3300016635 | Bacteria | 203395 |
| 360 | Ga0163161_10006169 | 3300017792 | Bacteria | 8303 |
| 361 | Ga0163161_10047143 | 3300017792 | Bacteria | 3112 |
| 362 | Ga0163161_10051253 | 3300017792 | Bacteria | 2989 |
| 363 | Ga0163161_10210036 | 3300017792 | Bacteria | 1503 |
| 364 | Ga0206351_10815903 | 3300020077 | Bacteria | 5002 |
| 365 | Ga0154015_1153479 | 3300020610 | Bacteria | 7739 |
| 366 | Ga0214542_1010499 | 3300021321 | Bacteria | 13472 |
| 367 | Ga0214543_1000005 | 3300021327 | Bacteria | 454523 |
| 368 | Ga0213875_10024758 | 3300021388 | Bacteria | 2862 |
| 369 | Ga0224712_10000086 | 3300022467 | Bacteria | 14399 |
| 370 | Ga0209435_100305 | 3300025206 | Bacteria | 11896 |
| 371 | Ga0209760_100009 | 3300025207 | Bacteria | 207878 |
| 372 | Ga0209760_100157 | 3300025207 | Bacteria | 40911 |
| 373 | Ga0209760_100772 | 3300025207 | Bacteria | 4545 |
| 374 | Ga0209784_100006 | 3300025224 | Bacteria | 930704 |
| 375 | Ga0209784_100018 | 3300025224 | Bacteria | 456816 |
| 376 | Ga0209784_100023 | 3300025224 | Bacteria | 399841 |
| 377 | Ga0209784_100323 | 3300025224 | Bacteria | 24350 |
| 378 | Ga0209784_100428 | 3300025224 | Bacteria | 18349 |
| 379 | Ga0209566_100002 | 3300025225 | Bacteria | 2614868 |
| 380 | Ga0209566_100016 | 3300025225 | Bacteria | 456824 |
| 381 | Ga0209566_100019 | 3300025225 | Bacteria | 414836 |
| 382 | Ga0209566_100555 | 3300025225 | Bacteria | 25068 |
| 383 | Ga0209566_100562 | 3300025225 | Bacteria | 24350 |
| 384 | Ga0209566_100572 | 3300025225 | Bacteria | 23824 |
| 385 | Ga0209674_100010 | 3300025226 | Bacteria | 1038638 |
| 386 | Ga0209674_100030 | 3300025226 | Bacteria | 456824 |
| 387 | Ga0209674_100034 | 3300025226 | Bacteria | 414903 |
| 388 | Ga0209674_100355 | 3300025226 | Bacteria | 25986 |
| 389 | Ga0209674_100374 | 3300025226 | Bacteria | 24350 |
| 390 | Ga0209674_101472 | 3300025226 | Bacteria | 6151 |
| 391 | Ga0209674_103235 | 3300025226 | Bacteria | 3069 |
| 392 | Ga0209672_100028 | 3300025228 | Bacteria | 341962 |
| 393 | Ga0209672_100038 | 3300025228 | Bacteria | 286731 |
| 394 | Ga0209672_100110 | 3300025228 | Bacteria | 95441 |
| 395 | Ga0209672_100175 | 3300025228 | Bacteria | 53342 |
| 396 | Ga0209672_100806 | 3300025228 | Bacteria | 14786 |
| 397 | Ga0209147_100018 | 3300025229 | Bacteria | 515719 |
| 398 | Ga0209147_100027 | 3300025229 | Bacteria | 414610 |
| 399 | Ga0209147_100235 | 3300025229 | Bacteria | 54699 |
| 400 | Ga0209147_100277 | 3300025229 | Bacteria | 44758 |
| 401 | Ga0209147_100294 | 3300025229 | Bacteria | 42223 |
| 402 | Ga0209563_100034 | 3300025230 | Bacteria | 456824 |
| 403 | Ga0209563_100037 | 3300025230 | Bacteria | 414903 |
| 404 | Ga0209563_100041 | 3300025230 | Bacteria | 407467 |
| 405 | Ga0209563_100258 | 3300025230 | Bacteria | 24350 |
| 406 | Ga0209563_101545 | 3300025230 | Bacteria | 6001 |
| 407 | Ga0207427_100016 | 3300025231 | Bacteria | 538697 |
| 408 | Ga0207427_100092 | 3300025231 | Bacteria | 128454 |
| 409 | Ga0207427_101010 | 3300025231 | Bacteria | 11767 |
| 410 | Ga0209437_100011 | 3300025233 | Bacteria | 818520 |
| 411 | Ga0209437_100065 | 3300025233 | Bacteria | 332417 |
| 412 | Ga0209437_100565 | 3300025233 | Bacteria | 24350 |
| 413 | Ga0209437_109964 | 3300025233 | Bacteria | 1466 |
| 414 | Ga0209258_100028 | 3300025242 | Bacteria | 515719 |
| 415 | Ga0209258_100191 | 3300025242 | Bacteria | 125980 |
| 416 | Ga0209258_100268 | 3300025242 | Bacteria | 89701 |
| 417 | Ga0209258_100289 | 3300025242 | Bacteria | 82650 |
| 418 | Ga0207425_1002758 | 3300025245 | Bacteria | 5972 |
| 419 | Ga0209646_1000120 | 3300025246 | Bacteria | 146035 |
| 420 | Ga0209646_1000153 | 3300025246 | Bacteria | 96707 |
| 421 | Ga0209646_1002598 | 3300025246 | Bacteria | 3899 |
| 422 | Ga0209026_1010400 | 3300025250 | Bacteria | 1736 |
| 423 | Ga0209677_100007 | 3300025253 | Bacteria | 1021332 |
| 424 | Ga0209677_100019 | 3300025253 | Bacteria | 456824 |
| 425 | Ga0209677_100021 | 3300025253 | Bacteria | 414954 |
| 426 | Ga0209677_100438 | 3300025253 | Bacteria | 24350 |
| 427 | Ga0209148_1000081 | 3300025254 | Bacteria | 273676 |
| 428 | Ga0209148_1000224 | 3300025254 | Bacteria | 92967 |
| 429 | Ga0209148_1000297 | 3300025254 | Bacteria | 72735 |
| 430 | Ga0209148_1003390 | 3300025254 | Bacteria | 4446 |
| 431 | Ga0209759_1000406 | 3300025256 | Bacteria | 53034 |
| 432 | Ga0209759_1001683 | 3300025256 | Bacteria | 11529 |
| 433 | Ga0209759_1011208 | 3300025256 | Bacteria | 2566 |
| 434 | Ga0209233_1000019 | 3300025261 | Bacteria | 818520 |
| 435 | Ga0209233_1000085 | 3300025261 | Bacteria | 333078 |
| 436 | Ga0209233_1000483 | 3300025261 | Bacteria | 24350 |
| 437 | Ga0209233_1013553 | 3300025261 | Bacteria | 2326 |
| 438 | Ga0209565_1000257 | 3300025263 | Bacteria | 56512 |
| 439 | Ga0209565_1000987 | 3300025263 | Bacteria | 14624 |
| 440 | Ga0209455_1000050 | 3300025272 | Bacteria | 373239 |
| 441 | Ga0209455_1000107 | 3300025272 | Bacteria | 195136 |
| 442 | Ga0209455_1000879 | 3300025272 | Bacteria | 15861 |
| 443 | Ga0209673_1000038 | 3300025273 | Bacteria | 312957 |
| 444 | Ga0209675_1000302 | 3300025291 | Bacteria | 44768 |
| 445 | Ga0209675_1000645 | 3300025291 | Bacteria | 24769 |
| 446 | Ga0209675_1003576 | 3300025291 | Bacteria | 7313 |
| 447 | Ga0209675_1007019 | 3300025291 | Bacteria | 4396 |
| 448 | Ga0209675_1009151 | 3300025291 | Bacteria | 3529 |
| 449 | Ga0209676_1000076 | 3300025292 | Bacteria | 301393 |
| 450 | Ga0209676_1000147 | 3300025292 | Bacteria | 172386 |
| 451 | Ga0209676_1000183 | 3300025292 | Bacteria | 145352 |
| 452 | Ga0209676_1000264 | 3300025292 | Bacteria | 110593 |
| 453 | Ga0209676_1000313 | 3300025292 | Bacteria | 94925 |
| 454 | Ga0209676_1001123 | 3300025292 | Bacteria | 29456 |
| 455 | Ga0209676_1001708 | 3300025292 | Bacteria | 18966 |
| 456 | Ga0209676_1010886 | 3300025292 | Bacteria | 3732 |
| 457 | Ga0209676_1020041 | 3300025292 | Bacteria | 2283 |
| 458 | Ga0209025_1000229 | 3300025294 | Bacteria | 131241 |
| 459 | Ga0209025_1000256 | 3300025294 | Bacteria | 125758 |
| 460 | Ga0209025_1000508 | 3300025294 | Bacteria | 74740 |
| 461 | Ga0209025_1000610 | 3300025294 | Bacteria | 64118 |
| 462 | Ga0209025_1001636 | 3300025294 | Bacteria | 27739 |
| 463 | Ga0209025_1004445 | 3300025294 | Bacteria | 12176 |
| 464 | Ga0209564_1000310 | 3300025295 | Bacteria | 95920 |
| 465 | Ga0209564_1001587 | 3300025295 | Bacteria | 22207 |
| 466 | Ga0209564_1002607 | 3300025295 | Bacteria | 13790 |
| 467 | Ga0209564_1003460 | 3300025295 | Bacteria | 10764 |
| 468 | Ga0209564_1004695 | 3300025295 | Bacteria | 8195 |
| 469 | Ga0209564_1011300 | 3300025295 | Bacteria | 4013 |
| 470 | Ga0209758_1000423 | 3300025297 | Bacteria | 71797 |
| 471 | Ga0209758_1003740 | 3300025297 | Bacteria | 13475 |
| 472 | Ga0209758_1006087 | 3300025297 | Bacteria | 8874 |
| 473 | Ga0209758_1008604 | 3300025297 | Bacteria | 6561 |
| 474 | Ga0209758_1025788 | 3300025297 | Bacteria | 2567 |
| 475 | Ga0209050_1000062 | 3300025298 | Bacteria | 316538 |
| 476 | Ga0209050_1000063 | 3300025298 | Bacteria | 314955 |
| 477 | Ga0209050_1000106 | 3300025298 | Bacteria | 224396 |
| 478 | Ga0209050_1000701 | 3300025298 | Bacteria | 49786 |
| 479 | Ga0209050_1002668 | 3300025298 | Bacteria | 14580 |
| 480 | Ga0209256_1000248 | 3300025299 | Bacteria | 95920 |
| 481 | Ga0209256_1000300 | 3300025299 | Bacteria | 86738 |
| 482 | Ga0207426_1000037 | 3300025302 | Bacteria | 442735 |
| 483 | Ga0207426_1000289 | 3300025302 | Bacteria | 99963 |
| 484 | Ga0207426_1000312 | 3300025302 | Bacteria | 95006 |
| 485 | Ga0207426_1004510 | 3300025302 | Bacteria | 6744 |
| 486 | Ga0207426_1007390 | 3300025302 | Bacteria | 4607 |
| 487 | Ga0209051_1000045 | 3300025303 | Bacteria | 297882 |
| 488 | Ga0209051_1000139 | 3300025303 | Bacteria | 136281 |
| 489 | Ga0209051_1000409 | 3300025303 | Bacteria | 59325 |
| 490 | Ga0209051_1000499 | 3300025303 | Bacteria | 49786 |
| 491 | Ga0209051_1006094 | 3300025303 | Bacteria | 6867 |
| 492 | Ga0209257_1000539 | 3300025304 | Bacteria | 64964 |
| 493 | Ga0209257_1009014 | 3300025304 | Bacteria | 5474 |
| 494 | Ga0209257_1016143 | 3300025304 | Bacteria | 3045 |
| 495 | Ga0207656_10003183 | 3300025321 | Bacteria | 5612 |
| 496 | Ga0207696_1000023 | 3300025711 | Bacteria | 422195 |
| 497 | Ga0207696_1000047 | 3300025711 | Bacteria | 285005 |
| 498 | Ga0207696_1000091 | 3300025711 | Bacteria | 187999 |
| 499 | Ga0207696_1002016 | 3300025711 | Bacteria | 10278 |
| 500 | Ga0207696_1002515 | 3300025711 | Bacteria | 8949 |
| 501 | Ga0207696_1013608 | 3300025711 | Bacteria | 2825 |
| 502 | Ga0207696_1015388 | 3300025711 | Bacteria | 2596 |
| 503 | Ga0207655_1000015 | 3300025728 | Bacteria | 600662 |
| 504 | Ga0207655_1000118 | 3300025728 | Bacteria | 159617 |
| 505 | Ga0207655_1000302 | 3300025728 | Bacteria | 74492 |
| 506 | Ga0207655_1000327 | 3300025728 | Bacteria | 70037 |
| 507 | Ga0207655_1000339 | 3300025728 | Bacteria | 68128 |
| 508 | Ga0207655_1000658 | 3300025728 | Bacteria | 41061 |
| 509 | Ga0207655_1001444 | 3300025728 | Bacteria | 22008 |
| 510 | Ga0207655_1003450 | 3300025728 | Bacteria | 11757 |
| 511 | Ga0207655_1003542 | 3300025728 | Bacteria | 11564 |
| 512 | Ga0207655_1005682 | 3300025728 | Bacteria | 8433 |
| 513 | Ga0207655_1009464 | 3300025728 | Bacteria | 6041 |
| 514 | Ga0207655_1010065 | 3300025728 | Bacteria | 5784 |
| 515 | Ga0207655_1014108 | 3300025728 | Bacteria | 4537 |
| 516 | Ga0207655_1014236 | 3300025728 | Bacteria | 4509 |
| 517 | Ga0207655_1016444 | 3300025728 | Bacteria | 4045 |
| 518 | Ga0207655_1018839 | 3300025728 | Bacteria | 3639 |
| 519 | Ga0207655_1021378 | 3300025728 | Bacteria | 3285 |
| 520 | Ga0207655_1023774 | 3300025728 | Bacteria | 3026 |
| 521 | Ga0207713_1000041 | 3300025735 | Bacteria | 244768 |
| 522 | Ga0207713_1000060 | 3300025735 | Bacteria | 213145 |
| 523 | Ga0207713_1000348 | 3300025735 | Bacteria | 50677 |
| 524 | Ga0207713_1001043 | 3300025735 | Bacteria | 24019 |
| 525 | Ga0207713_1001161 | 3300025735 | Bacteria | 22265 |
| 526 | Ga0207713_1001267 | 3300025735 | Bacteria | 20840 |
| 527 | Ga0207713_1002181 | 3300025735 | Bacteria | 14511 |
| 528 | Ga0207713_1004039 | 3300025735 | Bacteria | 9692 |
| 529 | Ga0207713_1008860 | 3300025735 | Bacteria | 5734 |
| 530 | Ga0207713_1014647 | 3300025735 | Bacteria | 4062 |
| 531 | Ga0207713_1041877 | 3300025735 | Bacteria | 1906 |
| 532 | Ga0207713_1041888 | 3300025735 | Bacteria | 1906 |
| 533 | Ga0207692_10004858 | 3300025898 | Bacteria | 5352 |
| 534 | Ga0207692_10058195 | 3300025898 | Bacteria | 1990 |
| 535 | Ga0207710_10000122 | 3300025900 | Bacteria | 94509 |
| 536 | Ga0207710_10070892 | 3300025900 | Bacteria | 1598 |
| 537 | Ga0207688_10050778 | 3300025901 | Bacteria | 2323 |
| 538 | Ga0207647_10003182 | 3300025904 | Bacteria | 12326 |
| 539 | Ga0207647_10005156 | 3300025904 | Bacteria | 9612 |
| 540 | Ga0207647_10008176 | 3300025904 | Bacteria | 7517 |
| 541 | Ga0207647_10009659 | 3300025904 | Bacteria | 6850 |
| 542 | Ga0207699_10000826 | 3300025906 | Bacteria | 14743 |
| 543 | Ga0207699_10064608 | 3300025906 | Bacteria | 2215 |
| 544 | Ga0207699_10071546 | 3300025906 | Bacteria | 2121 |
| 545 | Ga0207705_10000771 | 3300025909 | Bacteria | 26342 |
| 546 | Ga0207705_10135394 | 3300025909 | Bacteria | 1836 |
| 547 | Ga0207684_10071066 | 3300025910 | Bacteria | 2958 |
| 548 | Ga0207684_10074537 | 3300025910 | Bacteria | 2883 |
| 549 | Ga0207654_10010475 | 3300025911 | Bacteria | 4722 |
| 550 | Ga0207654_10087703 | 3300025911 | Bacteria | 1889 |
| 551 | Ga0207707_10032404 | 3300025912 | Bacteria | 4573 |
| 552 | Ga0207695_10000240 | 3300025913 | Bacteria | 143196 |
| 553 | Ga0207695_10008368 | 3300025913 | Bacteria | 12959 |
| 554 | Ga0207695_10021034 | 3300025913 | Bacteria | 7453 |
| 555 | Ga0207695_10049593 | 3300025913 | Bacteria | 4424 |
| 556 | Ga0207695_10097448 | 3300025913 | Bacteria | 2942 |
| 557 | Ga0207671_10000604 | 3300025914 | Bacteria | 47638 |
| 558 | Ga0207671_10007182 | 3300025914 | Bacteria | 9707 |
| 559 | Ga0207671_10008177 | 3300025914 | Bacteria | 8918 |
| 560 | Ga0207671_10023233 | 3300025914 | Bacteria | 4677 |
| 561 | Ga0207671_10112512 | 3300025914 | Bacteria | 2073 |
| 562 | Ga0207671_10119778 | 3300025914 | Bacteria | 2011 |
| 563 | Ga0207693_10006908 | 3300025915 | Bacteria | 9374 |
| 564 | Ga0207693_10074546 | 3300025915 | Bacteria | 2658 |
| 565 | Ga0207663_10030874 | 3300025916 | Bacteria | 3164 |
| 566 | Ga0207663_10111723 | 3300025916 | Bacteria | 1855 |
| 567 | Ga0207657_10000595 | 3300025919 | Bacteria | 38324 |
| 568 | Ga0207657_10003541 | 3300025919 | Bacteria | 16685 |
| 569 | Ga0207657_10030614 | 3300025919 | Bacteria | 4883 |
| 570 | Ga0207657_10082545 | 3300025919 | Bacteria | 2697 |
| 571 | Ga0207649_10000639 | 3300025920 | Bacteria | 23386 |
| 572 | Ga0207649_10000668 | 3300025920 | Bacteria | 22913 |
| 573 | Ga0207681_10006411 | 3300025923 | Bacteria | 7225 |
| 574 | Ga0207681_10014158 | 3300025923 | Bacteria | 4949 |
| 575 | Ga0207694_10000236 | 3300025924 | Bacteria | 52960 |
| 576 | Ga0207694_10056478 | 3300025924 | Bacteria | 3049 |
| 577 | Ga0207694_10083220 | 3300025924 | Bacteria | 2516 |
| 578 | Ga0207694_10099663 | 3300025924 | Bacteria | 2301 |
| 579 | Ga0207650_10000248 | 3300025925 | Bacteria | 58658 |
| 580 | Ga0207650_10001140 | 3300025925 | Bacteria | 19511 |
| 581 | Ga0207650_10001620 | 3300025925 | Bacteria | 16061 |
| 582 | Ga0207650_10259834 | 3300025925 | Bacteria | 1408 |
| 583 | Ga0207687_10034082 | 3300025927 | Bacteria | 3456 |
| 584 | Ga0207700_10057984 | 3300025928 | Bacteria | 2923 |
| 585 | Ga0207700_10132142 | 3300025928 | Bacteria | 2040 |
| 586 | Ga0207700_10165808 | 3300025928 | Bacteria | 1838 |
| 587 | Ga0207664_10117055 | 3300025929 | Bacteria | 2224 |
| 588 | Ga0207664_10149876 | 3300025929 | Bacteria | 1980 |
| 589 | Ga0207690_10000034 | 3300025932 | Bacteria | 149574 |
| 590 | Ga0207690_10001619 | 3300025932 | Bacteria | 14018 |
| 591 | Ga0207690_10071507 | 3300025932 | Bacteria | 2393 |
| 592 | Ga0207706_10002708 | 3300025933 | Bacteria | 17260 |
| 593 | Ga0207706_10006523 | 3300025933 | Bacteria | 10817 |
| 594 | Ga0207706_10014066 | 3300025933 | Bacteria | 7256 |
| 595 | Ga0207706_10074628 | 3300025933 | Bacteria | 2982 |
| 596 | Ga0207709_10000001 | 3300025935 | Bacteria | 2228154 |
| 597 | Ga0207709_10000030 | 3300025935 | Bacteria | 331710 |
| 598 | Ga0207709_10000070 | 3300025935 | Bacteria | 183020 |
| 599 | Ga0207709_10000127 | 3300025935 | Bacteria | 112650 |
| 600 | Ga0207709_10000610 | 3300025935 | Bacteria | 29558 |
| 601 | Ga0207709_10004847 | 3300025935 | Bacteria | 7706 |
| 602 | Ga0207709_10005912 | 3300025935 | Bacteria | 6903 |
| 603 | Ga0207709_10024205 | 3300025935 | Bacteria | 3465 |
| 604 | Ga0207709_10068348 | 3300025935 | Bacteria | 2245 |
| 605 | Ga0207665_10001950 | 3300025939 | Bacteria | 13887 |
| 606 | Ga0207665_10012034 | 3300025939 | Bacteria | 5679 |
| 607 | Ga0207661_10012230 | 3300025944 | Bacteria | 6234 |
| 608 | Ga0207679_10000021 | 3300025945 | Bacteria | 221630 |
| 609 | Ga0207679_10000349 | 3300025945 | Bacteria | 33664 |
| 610 | Ga0207667_10000044 | 3300025949 | Bacteria | 248251 |
| 611 | Ga0207667_10000347 | 3300025949 | Bacteria | 63149 |
| 612 | Ga0207667_10007034 | 3300025949 | Bacteria | 13594 |
| 613 | Ga0207667_10024451 | 3300025949 | Bacteria | 6632 |
| 614 | Ga0207667_10034699 | 3300025949 | Bacteria | 5415 |
| 615 | Ga0207667_10156943 | 3300025949 | Bacteria | 2341 |
| 616 | Ga0207651_10151706 | 3300025960 | Bacteria | 1805 |
| 617 | Ga0207668_10149151 | 3300025972 | Bacteria | 1808 |
| 618 | Ga0207640_10000490 | 3300025981 | Bacteria | 24099 |
| 619 | Ga0207658_10000701 | 3300025986 | Bacteria | 29053 |
| 620 | Ga0207658_10035321 | 3300025986 | Bacteria | 3579 |
| 621 | Ga0207703_10244121 | 3300026035 | Bacteria | 1616 |
| 622 | Ga0207639_10019471 | 3300026041 | Bacteria | 4841 |
| 623 | Ga0207678_10000419 | 3300026067 | Bacteria | 38457 |
| 624 | Ga0207678_10000911 | 3300026067 | Bacteria | 27065 |
| 625 | Ga0207678_10004582 | 3300026067 | Bacteria | 12433 |
| 626 | Ga0207678_10037826 | 3300026067 | Bacteria | 4196 |
| 627 | Ga0207678_10041614 | 3300026067 | Bacteria | 3984 |
| 628 | Ga0207678_10067645 | 3300026067 | Bacteria | 3066 |
| 629 | Ga0207708_10207132 | 3300026075 | Bacteria | 1566 |
| 630 | Ga0207702_10006736 | 3300026078 | Bacteria | 9870 |
| 631 | Ga0207702_10093167 | 3300026078 | Bacteria | 2642 |
| 632 | Ga0207674_10027513 | 3300026116 | Bacteria | 6014 |
| 633 | Ga0207674_10056006 | 3300026116 | Bacteria | 4005 |
| 634 | Ga0207675_100250766 | 3300026118 | Bacteria | 1713 |
| 635 | Ga0207683_10030261 | 3300026121 | Bacteria | 4690 |
| 636 | Ga0207683_10135168 | 3300026121 | Bacteria | 2219 |
| 637 | Ga0207698_10069769 | 3300026142 | Bacteria | 2781 |
| 638 | Ga0209281_1000029 | 3300027111 | Bacteria | 431495 |
| 639 | Ga0209281_1000070 | 3300027111 | Bacteria | 277098 |
| 640 | Ga0209281_1000249 | 3300027111 | Bacteria | 107266 |
| 641 | Ga0209389_1000078 | 3300027296 | Bacteria | 90574 |
| 642 | Ga0209389_1000210 | 3300027296 | Bacteria | 41871 |
| 643 | Ga0209371_1000040 | 3300027312 | Bacteria | 340804 |
| 644 | Ga0209371_1000114 | 3300027312 | Bacteria | 139090 |
| 645 | Ga0209371_1004048 | 3300027312 | Bacteria | 6625 |
| 646 | Ga0209589_1000011 | 3300027357 | Bacteria | 236981 |
| 647 | Ga0209589_1001190 | 3300027357 | Bacteria | 41871 |
| 648 | Ga0209489_100012 | 3300027361 | Bacteria | 236981 |
| 649 | Ga0209489_100192 | 3300027361 | Bacteria | 98028 |
| 650 | Ga0209700_100019 | 3300027363 | Bacteria | 236981 |
| 651 | Ga0209282_1000074 | 3300027666 | Bacteria | 78298 |
| 652 | Ga0209282_1018720 | 3300027666 | Bacteria | 4392 |
| 653 | Ga0209588_1013766 | 3300027671 | Bacteria | 2471 |
| 654 | Ga0207428_10026308 | 3300027907 | Bacteria | 4857 |
| 655 | Ga0268266_10007711 | 3300028379 | Bacteria | 9662 |
| 656 | Ga0268264_10000194 | 3300028381 | Bacteria | 125395 |
| 657 | Ga0265319_1023195 | 3300028563 | Bacteria | 2250 |
| 658 | Ga0265334_10003980 | 3300028573 | Bacteria | 6634 |
| 659 | Ga0265318_10008391 | 3300028577 | Bacteria | 4602 |
| 660 | Ga0265323_10000516 | 3300028653 | Bacteria | 21579 |
| 661 | Ga0265322_10002082 | 3300028654 | Bacteria | 6274 |
| 662 | Ga0265336_10000456 | 3300028666 | Bacteria | 24746 |
| 663 | Ga0265338_10000065 | 3300028800 | Bacteria | 188966 |
| 664 | Ga0265324_10007686 | 3300029957 | Bacteria | 4340 |
| 665 | Ga0268256_1000041 | 3300030500 | Bacteria | 340725 |
| 666 | Ga0268256_1000218 | 3300030500 | Bacteria | 63709 |
| 667 | Ga0268256_1003598 | 3300030500 | Bacteria | 6898 |
| 668 | Ga0316179_1034064 | 3300030734 | Bacteria | 2314 |
| 669 | Ga0316178_1152882 | 3300030735 | Bacteria | 8839 |
| 670 | Ga0265760_10022728 | 3300031090 | Bacteria | 1818 |
| 671 | Ga0265332_10026610 | 3300031238 | Bacteria | 2537 |
| 672 | Ga0265325_10037169 | 3300031241 | Bacteria | 2575 |
| 673 | Ga0265339_10075563 | 3300031249 | Bacteria | 1788 |
| 674 | Ga0265331_10019239 | 3300031250 | Bacteria | 3528 |
| 675 | Ga0265327_10007366 | 3300031251 | Bacteria | 8515 |
| 676 | Ga0265327_10012518 | 3300031251 | Bacteria | 5714 |
| 677 | Ga0265316_10047668 | 3300031344 | Bacteria | 3388 |
| 678 | Ga0265316_10219946 | 3300031344 | Bacteria | 1402 |
| 679 | Ga0307509_10161097 | 3300031507 | Bacteria | 2141 |
| 680 | Ga0307408_100023917 | 3300031548 | Bacteria | 4165 |
| 681 | Ga0307408_100027855 | 3300031548 | Bacteria | 3898 |
| 682 | Ga0307508_10000001 | 3300031616 | Bacteria | 553635 |
| 683 | Ga0307508_10034274 | 3300031616 | Bacteria | 4578 |
| 684 | Ga0307508_10095256 | 3300031616 | Bacteria | 2567 |
| 685 | Ga0307508_10185720 | 3300031616 | Bacteria | 1681 |
| 686 | Ga0265314_10011314 | 3300031711 | Bacteria | 7377 |
| 687 | Ga0307516_10000859 | 3300031730 | Bacteria | 41636 |
| 688 | Ga0307516_10012610 | 3300031730 | Bacteria | 9092 |
| 689 | Ga0307405_10056842 | 3300031731 | Bacteria | 2455 |
| 690 | Ga0307407_10085133 | 3300031903 | Bacteria | 1923 |
| 691 | Ga0307412_10000044 | 3300031911 | Bacteria | 165237 |
| 692 | Ga0307412_10006504 | 3300031911 | Bacteria | 6610 |
| 693 | Ga0307412_10070442 | 3300031911 | Bacteria | 2383 |
| 694 | Ga0307409_100069835 | 3300031995 | Bacteria | 2786 |
| 695 | Ga0307415_100087092 | 3300032126 | Bacteria | 2249 |
| 696 | Ga0307507_10010371 | 3300033179 | Bacteria | 12061 |
| 697 | Ga0307510_10003141 | 3300033180 | Bacteria | 19142 |
| 698 | Ga0307510_10034158 | 3300033180 | Bacteria | 5698 |
| 699 | Ga0307510_10052649 | 3300033180 | Bacteria | 4287 |
| 700 | Ga0307510_10178511 | 3300033180 | Bacteria | 1690 |
| 701 | Ga0373934_0026823 | 3300035086 | Bacteria | 2236 |
| 702 | Ga0373923_0003759 | 3300035111 | Bacteria | 4924 |
| 703 | Ga0373936_0049770 | 3300035113 | Bacteria | 1693 |
| 704 | Ga0373945_0013272 | 3300035116 | Bacteria | 2747 |
| 705 | Ga0373953_0002356 | 3300035117 | Bacteria | 5691 |
| 706 | Ga0373943_0003856 | 3300035170 | Bacteria | 6820 |
| 707 | Ga0373943_0006295 | 3300035170 | Bacteria | 5328 |
| 708 | Ga0373955_0016136 | 3300035172 | Bacteria | 3671 |
| 709 | Ga0373924_0024858 | 3300035410 | Bacteria | 2364 |
| 710 | Ga0373935_0003793 | 3300035692 | Bacteria | 8827 |
| 711 | Ga0373935_0073663 | 3300035692 | Bacteria | 2206 |
| 712 | Ga0373927_0001305 | 3300035695 | Bacteria | 18850 |
| 713 | Ga0373927_0046440 | 3300035695 | Bacteria | 2809 |
| 714 | Ga0373947_0001572 | 3300035725 | Bacteria | 13996 |
| 715 | Ga0373947_0020287 | 3300035725 | Bacteria | 3836 |
| 716 | Ga0373947_0124690 | 3300035725 | Bacteria | 1639 |
| 717 | Ga0373937_0055490 | 3300036401 | Bacteria | 3637 |
| 718 | Ga0373925_0000676 | 3300037068 | Bacteria | 32014 |
| 719 | Ga0373925_0014327 | 3300037068 | Bacteria | 5736 |
| 720 | Ga0395899_0000029 | 3300037312 | Bacteria | 329371 |
| 721 | Ga0395899_0022392 | 3300037312 | Bacteria | 4792 |
| 722 | Ga0395899_0055223 | 3300037312 | Bacteria | 2938 |
| 723 | Ga0395900_0000098 | 3300037418 | Bacteria | 158030 |
| 724 | Ga0395900_0000196 | 3300037418 | Bacteria | 96480 |
| 725 | Ga0395900_0048824 | 3300037418 | Bacteria | 4359 |
| 726 | Ga0395900_0090030 | 3300037418 | Bacteria | 3154 |
| 727 | Ga0395900_0097693 | 3300037418 | Bacteria | 3017 |
| 728 | Ga0395900_0111219 | 3300037418 | Bacteria | 2814 |
| 729 | Ga0395900_0114223 | 3300037418 | Bacteria | 2771 |
| 730 | Ga0395900_0126587 | 3300037418 | Bacteria | 2620 |
| 731 | Ga0395900_0177638 | 3300037418 | Bacteria | 2165 |
| 732 | Ga0395900_0197752 | 3300037418 | Bacteria | 2036 |
| 733 | Ga0395900_0291642 | 3300037418 | Unclassified | 1620 |
| 734 | Ga0395898_0000086 | 3300037466 | Bacteria | 239895 |
| 735 | Ga0395898_0000577 | 3300037466 | Bacteria | 67972 |
| 736 | Ga0395898_0010898 | 3300037466 | Bacteria | 9487 |
| 737 | Ga0395898_0032583 | 3300037466 | Bacteria | 5202 |
| 738 | Ga0395898_0115359 | 3300037466 | Unclassified | 2573 |
| 739 | Ga0395905_0000201 | 3300037471 | Bacteria | 92923 |
| 740 | Ga0395905_0004566 | 3300037471 | Bacteria | 14330 |
| 741 | Ga0395905_0072502 | 3300037471 | Bacteria | 3229 |
| 742 | Ga0395905_0077342 | 3300037471 | Bacteria | 3118 |
| 743 | Ga0395905_0132714 | 3300037471 | Bacteria | 2342 |
| 744 | Ga0436364_1144417 | 3300037853 | Bacteria | 4542 |
| 745 | Ga0395901_0000104 | 3300038443 | Bacteria | 114939 |
| 746 | Ga0395901_0000137 | 3300038443 | Bacteria | 95185 |
| 747 | Ga0395901_0000231 | 3300038443 | Bacteria | 70033 |
| 748 | Ga0395901_0155286 | 3300038443 | Bacteria | 2403 |
| 749 | Ga0395901_0340447 | 3300038443 | Bacteria | 1550 |
| 750 | Ga0237819_01466 | 3300038705 | Bacteria | 6059 |
| 751 | Ga0436365_0473945 | 3300039437 | Bacteria | 2459 |
| 752 | Ga0436360_0304504 | 3300039438 | Bacteria | 2981 |
| 753 | Ga0436360_0536580 | 3300039438 | Bacteria | 4379 |
| 754 | Ga0436360_0755309 | 3300039438 | Bacteria | 1977 |
| 755 | Ga0436361_0138725 | 3300039447 | Bacteria | 20138 |
| 756 | Ga0436361_0246054 | 3300039447 | Bacteria | 1516 |
| 757 | Ga0436361_0512633 | 3300039447 | Bacteria | 2021 |
| 758 | Ga0436363_0561374 | 3300039450 | Bacteria | 1521 |
| 759 | Ga0439436_0006431 | 3300041404 | Bacteria | 3608 |
| 760 | Ga0439438_000199 | 3300041405 | Bacteria | 27351 |
| 761 | Ga0439438_005671 | 3300041405 | Bacteria | 4548 |
| 762 | Ga0439438_006276 | 3300041405 | Bacteria | 4223 |
| 763 | Ga0439438_006309 | 3300041405 | Bacteria | 4208 |
| 764 | Ga0439438_011933 | 3300041405 | Bacteria | 2684 |
| 765 | Ga0439447_000909 | 3300041407 | Bacteria | 10819 |
| 766 | Ga0439447_004721 | 3300041407 | Bacteria | 4644 |
| 767 | Ga0439447_007300 | 3300041407 | Bacteria | 3520 |
| 768 | Ga0439447_011535 | 3300041407 | Bacteria | 2572 |
| 769 | Ga0439466_0002213 | 3300041411 | Bacteria | 7610 |
| 770 | Ga0439466_0004939 | 3300041411 | Bacteria | 5125 |
| 771 | Ga0439466_0005069 | 3300041411 | Bacteria | 5050 |
| 772 | Ga0439466_0016378 | 3300041411 | Bacteria | 2679 |
| 773 | Ga0439466_0018526 | 3300041411 | Bacteria | 2496 |
| 774 | Ga0439431_0004281 | 3300041997 | Bacteria | 3134 |
| 775 | Ga0439448_0000169 | 3300042005 | Bacteria | 13105 |
| 776 | Ga0439432_000453 | 3300042006 | Bacteria | 15287 |
| 777 | Ga0439432_000827 | 3300042006 | Bacteria | 11540 |
| 778 | Ga0439432_006423 | 3300042006 | Bacteria | 4198 |
| 779 | Ga0439432_038933 | 3300042006 | Bacteria | 1512 |
| 780 | Ga0439451_003268 | 3300042009 | Bacteria | 3286 |
| 781 | Ga0439451_011933 | 3300042009 | Bacteria | 1752 |
| 782 | Ga0439452_000581 | 3300042010 | Bacteria | 18965 |
| 783 | Ga0439452_001230 | 3300042010 | Bacteria | 10926 |
| 784 | Ga0439452_001923 | 3300042010 | Bacteria | 7962 |
| 785 | Ga0439452_005307 | 3300042010 | Bacteria | 4161 |
| 786 | Ga0439452_007817 | 3300042010 | Bacteria | 3246 |
| 787 | Ga0439452_008357 | 3300042010 | Bacteria | 3121 |
| 788 | Ga0439456_000063 | 3300042013 | Bacteria | 38227 |
| 789 | Ga0439456_001296 | 3300042013 | Bacteria | 4980 |
| 790 | Ga0439456_003137 | 3300042013 | Bacteria | 3342 |
| 791 | Ga0439463_003980 | 3300042016 | Bacteria | 3719 |
| 792 | Ga0450920_001220 | 3300042122 | Bacteria | 4220 |
| 793 | Ga0450922_000404 | 3300042124 | Bacteria | 4646 |
| 794 | Ga0450902_000643 | 3300042137 | Bacteria | 4448 |
| 795 | Ga0450902_000756 | 3300042137 | Bacteria | 4159 |
| 796 | Ga0450907_000025 | 3300042146 | Bacteria | 72853 |
| 797 | Ga0450907_003669 | 3300042146 | Bacteria | 2708 |
| 798 | Ga0450910_000561 | 3300042147 | Bacteria | 4403 |
| 799 | Ga0439434_0001115 | 3300042435 | Bacteria | 7763 |
| 800 | Ga0439460_0006661 | 3300042461 | Bacteria | 2871 |
| 801 | Ga0439460_0007288 | 3300042461 | Bacteria | 2759 |
| 802 | Ga0466969_0000226 | 3300044656 | Bacteria | 30801 |
| 803 | Ga0466969_0003247 | 3300044656 | Bacteria | 8647 |
| 804 | Ga0466969_0008544 | 3300044656 | Bacteria | 5433 |
| 805 | Ga0466969_0012351 | 3300044656 | Bacteria | 4505 |
| 806 | Ga0466969_0030975 | 3300044656 | Bacteria | 2724 |
| 807 | Ga0466972_0005663 | 3300044658 | Bacteria | 6266 |
| 808 | Ga0466977_0008418 | 3300044666 | Bacteria | 5721 |
| 809 | Ga0466965_0005365 | 3300044683 | Bacteria | 5772 |
| 810 | Ga0466965_0010859 | 3300044683 | Bacteria | 4260 |
| 811 | Ga0466965_0027306 | 3300044683 | Bacteria | 2770 |
| 812 | Ga0466965_0038803 | 3300044683 | Bacteria | 2340 |
| 813 | Ga0466966_0000005 | 3300044684 | Bacteria | 193939 |
| 814 | Ga0466966_0002330 | 3300044684 | Bacteria | 12390 |
| 815 | Ga0466961_0000656 | 3300044693 | Bacteria | 21722 |
| 816 | Ga0466961_0000908 | 3300044693 | Bacteria | 18384 |
| 817 | Ga0466961_0002934 | 3300044693 | Bacteria | 10591 |
| 818 | Ga0466961_0039867 | 3300044693 | Bacteria | 3010 |
| 819 | Ga0466963_0001778 | 3300044694 | Bacteria | 11734 |
| 820 | Ga0466963_0007803 | 3300044694 | Bacteria | 6401 |
| 821 | Ga0466963_0110019 | 3300044694 | Bacteria | 1891 |
| 822 | Ga0466964_0062504 | 3300044706 | Bacteria | 1553 |
| 823 | Ga0466971_0000225 | 3300044719 | Bacteria | 21713 |
| 824 | Ga0466971_0022608 | 3300044719 | Bacteria | 2803 |
| 825 | Ga0466971_0049325 | 3300044719 | Bacteria | 1894 |
| 826 | Ga0466968_0004192 | 3300044735 | Bacteria | 5372 |
| 827 | Ga0466970_0003203 | 3300044765 | Bacteria | 7958 |
| 828 | Ga0466970_0003629 | 3300044765 | Bacteria | 7525 |
| 829 | Ga0466970_0024106 | 3300044765 | Bacteria | 3181 |
| 830 | Ga0466957_0004704 | 3300044842 | Bacteria | 7638 |
| 831 | Ga0466957_0005749 | 3300044842 | Bacteria | 6967 |
| 832 | Ga0466957_0013067 | 3300044842 | Bacteria | 4810 |
| 833 | Ga0466957_0153471 | 3300044842 | Bacteria | 1491 |
| 834 | Ga0466960_0014731 | 3300044901 | Bacteria | 3357 |
| 835 | Ga0466959_0004419 | 3300045049 | Bacteria | 9413 |
| 836 | Ga0466959_0016104 | 3300045049 | Bacteria | 5456 |
| 837 | Ga0466959_0045224 | 3300045049 | Bacteria | 3242 |
| 838 | Ga0466959_0045299 | 3300045049 | Bacteria | 3239 |
| 839 | Ga0466959_0132757 | 3300045049 | Bacteria | 1764 |
| 840 | Ga0466958_0000956 | 3300045836 | Bacteria | 13061 |
| 841 | Ga0466958_0053171 | 3300045836 | Bacteria | 2455 |
| 842 | Ga0466967_0027405 | 3300045976 | Bacteria | 4739 |
| 843 | Ga0466967_0139369 | 3300045976 | Bacteria | 2258 |
| 844 | Ga0495617_000479 | 3300046452 | Bacteria | 21276 |
| 845 | Ga0495617_004457 | 3300046452 | Bacteria | 5094 |
| 846 | Ga0495627_001494 | 3300046453 | Bacteria | 13525 |
| 847 | Ga0495592_0020729 | 3300046454 | Bacteria | 5000 |
| 848 | Ga0495592_0057295 | 3300046454 | Bacteria | 2876 |
| 849 | Ga0495592_0097075 | 3300046454 | Bacteria | 2105 |
| 850 | Ga0495603_0000003 | 3300046455 | Bacteria | 83533 |
| 851 | Ga0495603_0067662 | 3300046455 | Bacteria | 2102 |
| 852 | Ga0495590_0000005 | 3300046457 | Bacteria | 384276 |
| 853 | Ga0495590_0009816 | 3300046457 | Bacteria | 3623 |
| 854 | Ga0495590_0012583 | 3300046457 | Bacteria | 3138 |
| 855 | Ga0495591_000165 | 3300046458 | Bacteria | 70496 |
| 856 | Ga0495591_000387 | 3300046458 | Bacteria | 37257 |
| 857 | Ga0495591_001132 | 3300046458 | Bacteria | 17598 |
| 858 | Ga0495591_002013 | 3300046458 | Bacteria | 11827 |
| 859 | Ga0495591_003323 | 3300046458 | Bacteria | 8374 |
| 860 | Ga0495591_004232 | 3300046458 | Bacteria | 7113 |
| 861 | Ga0495591_015106 | 3300046458 | Bacteria | 2740 |
| 862 | Ga0495591_034200 | 3300046458 | Bacteria | 1498 |
| 863 | Ga0495629_0000105 | 3300046459 | Bacteria | 74421 |
| 864 | Ga0495629_0000133 | 3300046459 | Bacteria | 64806 |
| 865 | Ga0495629_0002853 | 3300046459 | Bacteria | 13208 |
| 866 | Ga0495629_0002887 | 3300046459 | Bacteria | 13125 |
| 867 | Ga0495629_0003517 | 3300046459 | Bacteria | 11840 |
| 868 | Ga0495629_0020285 | 3300046459 | Bacteria | 4747 |
| 869 | Ga0495638_0005386 | 3300046460 | Bacteria | 9540 |
| 870 | Ga0495638_0011092 | 3300046460 | Bacteria | 6228 |
| 871 | Ga0495638_0018018 | 3300046460 | Bacteria | 4698 |
| 872 | Ga0495638_0019977 | 3300046460 | Bacteria | 4428 |
| 873 | Ga0495638_0029251 | 3300046460 | Bacteria | 3553 |
| 874 | Ga0495638_0048476 | 3300046460 | Bacteria | 2658 |
| 875 | Ga0495638_0055785 | 3300046460 | Bacteria | 2452 |
| 876 | Ga0495641_0011455 | 3300046461 | Bacteria | 5051 |
| 877 | Ga0495651_0001898 | 3300046462 | Bacteria | 16168 |
| 878 | Ga0495651_0005111 | 3300046462 | Bacteria | 10010 |
| 879 | Ga0495653_0004087 | 3300046463 | Bacteria | 11805 |
| 880 | Ga0495653_0011821 | 3300046463 | Bacteria | 7128 |
| 881 | Ga0495653_0036791 | 3300046463 | Bacteria | 3852 |
| 882 | Ga0495653_0108648 | 3300046463 | Bacteria | 1997 |
| 883 | Ga0495650_0000710 | 3300046471 | Bacteria | 42545 |
| 884 | Ga0495650_0003689 | 3300046471 | Bacteria | 10968 |
| 885 | Ga0495650_0010859 | 3300046471 | Bacteria | 5047 |
| 886 | Ga0495650_0017508 | 3300046471 | Bacteria | 3591 |
| 887 | Ga0495650_0018394 | 3300046471 | Bacteria | 3473 |
| 888 | Ga0495650_0029283 | 3300046471 | Bacteria | 2512 |
| 889 | Ga0495580_0008949 | 3300046472 | Bacteria | 7913 |
| 890 | Ga0495580_0027216 | 3300046472 | Bacteria | 4161 |
| 891 | Ga0495580_0031628 | 3300046472 | Bacteria | 3822 |
| 892 | Ga0495580_0038848 | 3300046472 | Bacteria | 3406 |
| 893 | Ga0495580_0041966 | 3300046472 | Bacteria | 3260 |
| 894 | Ga0495582_0000016 | 3300046473 | Bacteria | 100714 |
| 895 | Ga0495582_0015213 | 3300046473 | Bacteria | 4230 |
| 896 | Ga0495582_0061015 | 3300046473 | Bacteria | 2082 |
| 897 | Ga0495605_0000124 | 3300046474 | Bacteria | 101623 |
| 898 | Ga0495605_0004497 | 3300046474 | Bacteria | 8168 |
| 899 | Ga0495605_0006881 | 3300046474 | Bacteria | 6494 |
| 900 | Ga0495605_0013089 | 3300046474 | Bacteria | 4583 |
| 901 | Ga0495605_0019294 | 3300046474 | Bacteria | 3646 |
| 902 | Ga0495605_0075352 | 3300046474 | Bacteria | 1586 |
| 903 | Ga0495639_0000014 | 3300046475 | Bacteria | 82866 |
| 904 | Ga0495662_0002084 | 3300046476 | Bacteria | 10025 |
| 905 | Ga0495664_0005109 | 3300046477 | Bacteria | 7195 |
| 906 | Ga0495664_0024757 | 3300046477 | Bacteria | 3489 |
| 907 | Ga0495664_0029656 | 3300046477 | Bacteria | 3201 |
| 908 | Ga0495584_0001735 | 3300046491 | Bacteria | 12743 |
| 909 | Ga0495584_0020821 | 3300046491 | Bacteria | 3330 |
| 910 | Ga0495584_0056498 | 3300046491 | Bacteria | 1975 |
| 911 | Ga0495585_0004287 | 3300046492 | Bacteria | 9283 |
| 912 | Ga0495585_0013257 | 3300046492 | Bacteria | 4828 |
| 913 | Ga0495585_0026629 | 3300046492 | Bacteria | 3303 |
| 914 | Ga0495594_0000051 | 3300046499 | Bacteria | 52030 |
| 915 | Ga0495596_0005234 | 3300046500 | Bacteria | 6163 |
| 916 | Ga0495596_0023490 | 3300046500 | Bacteria | 2501 |
| 917 | Ga0495596_0031980 | 3300046500 | Bacteria | 2099 |
| 918 | Ga0495607_0001371 | 3300046501 | Bacteria | 21663 |
| 919 | Ga0495607_0024161 | 3300046501 | Bacteria | 3792 |
| 920 | Ga0495607_0074335 | 3300046501 | Bacteria | 1886 |
| 921 | Ga0495607_0076806 | 3300046501 | Bacteria | 1846 |
| 922 | Ga0495607_0105546 | 3300046501 | Bacteria | 1501 |
| 923 | Ga0495583_0001112 | 3300046506 | Bacteria | 29748 |
| 924 | Ga0495583_0001552 | 3300046506 | Bacteria | 22749 |
| 925 | Ga0495583_0009174 | 3300046506 | Bacteria | 5942 |
| 926 | Ga0495583_0010184 | 3300046506 | Bacteria | 5516 |
| 927 | Ga0495583_0020079 | 3300046506 | Bacteria | 3470 |
| 928 | Ga0495583_0023951 | 3300046506 | Bacteria | 3077 |
| 929 | Ga0495606_0000032 | 3300046507 | Bacteria | 248690 |
| 930 | Ga0495606_0000042 | 3300046507 | Bacteria | 215099 |
| 931 | Ga0495606_0002242 | 3300046507 | Bacteria | 23003 |
| 932 | Ga0495606_0007911 | 3300046507 | Bacteria | 9375 |
| 933 | Ga0495606_0008338 | 3300046507 | Bacteria | 9027 |
| 934 | Ga0495606_0011843 | 3300046507 | Bacteria | 7060 |
| 935 | Ga0495606_0023220 | 3300046507 | Bacteria | 4500 |
| 936 | Ga0495606_0024810 | 3300046507 | Bacteria | 4310 |
| 937 | Ga0495606_0029806 | 3300046507 | Bacteria | 3823 |
| 938 | Ga0495606_0053148 | 3300046507 | Bacteria | 2629 |
| 939 | Ga0495606_0121034 | 3300046507 | Bacteria | 1567 |
| 940 | Ga0495608_0038590 | 3300046511 | Bacteria | 3206 |
| 941 | Ga0495608_0053734 | 3300046511 | Bacteria | 2664 |
| 942 | Ga0495610_0003579 | 3300046512 | Bacteria | 12005 |
| 943 | Ga0495610_0006567 | 3300046512 | Bacteria | 7960 |
| 944 | Ga0495610_0007629 | 3300046512 | Bacteria | 7159 |
| 945 | Ga0495610_0012101 | 3300046512 | Bacteria | 5216 |
| 946 | Ga0495616_0019156 | 3300046513 | Bacteria | 3739 |
| 947 | Ga0495616_0033914 | 3300046513 | Bacteria | 2655 |
| 948 | Ga0495618_0013194 | 3300046514 | Bacteria | 5027 |
| 949 | Ga0495618_0033388 | 3300046514 | Bacteria | 3227 |
| 950 | Ga0495618_0071878 | 3300046514 | Bacteria | 2201 |
| 951 | Ga0495620_0000004 | 3300046515 | Bacteria | 344148 |
| 952 | Ga0495620_0025065 | 3300046515 | Bacteria | 2827 |
| 953 | Ga0495620_0033355 | 3300046515 | Bacteria | 2338 |
| 954 | Ga0495628_0002656 | 3300046516 | Bacteria | 16030 |
| 955 | Ga0495628_0008450 | 3300046516 | Bacteria | 8829 |
| 956 | Ga0495628_0013006 | 3300046516 | Bacteria | 7009 |
| 957 | Ga0495628_0039809 | 3300046516 | Bacteria | 3758 |
| 958 | Ga0495630_0022261 | 3300046517 | Bacteria | 4682 |
| 959 | Ga0495630_0023055 | 3300046517 | Bacteria | 4600 |
| 960 | Ga0495630_0034082 | 3300046517 | Bacteria | 3799 |
| 961 | Ga0495630_0035570 | 3300046517 | Bacteria | 3721 |
| 962 | Ga0495630_0046608 | 3300046517 | Bacteria | 3240 |
| 963 | Ga0495630_0074543 | 3300046517 | Bacteria | 2556 |
| 964 | Ga0495631_0000953 | 3300046518 | Bacteria | 18020 |
| 965 | Ga0495631_0003004 | 3300046518 | Bacteria | 9333 |
| 966 | Ga0495631_0005227 | 3300046518 | Bacteria | 6830 |
| 967 | Ga0495632_0001439 | 3300046519 | Bacteria | 19832 |
| 968 | Ga0495632_0001542 | 3300046519 | Bacteria | 19038 |
| 969 | Ga0495632_0005956 | 3300046519 | Bacteria | 7943 |
| 970 | Ga0495632_0014688 | 3300046519 | Bacteria | 4420 |
| 971 | Ga0495632_0018769 | 3300046519 | Bacteria | 3786 |
| 972 | Ga0495637_0000171 | 3300046520 | Bacteria | 49947 |
| 973 | Ga0495637_0000931 | 3300046520 | Bacteria | 18727 |
| 974 | Ga0495637_0005318 | 3300046520 | Bacteria | 6583 |
| 975 | Ga0495637_0010013 | 3300046520 | Bacteria | 4605 |
| 976 | Ga0495637_0012785 | 3300046520 | Bacteria | 4005 |
| 977 | Ga0495643_0000297 | 3300046522 | Bacteria | 69703 |
| 978 | Ga0495643_0002410 | 3300046522 | Bacteria | 14866 |
| 979 | Ga0495643_0009717 | 3300046522 | Bacteria | 5950 |
| 980 | Ga0495643_0010056 | 3300046522 | Bacteria | 5836 |
| 981 | Ga0495643_0010572 | 3300046522 | Bacteria | 5671 |
| 982 | Ga0495643_0033537 | 3300046522 | Bacteria | 2839 |
| 983 | Ga0495644_0001175 | 3300046523 | Bacteria | 10733 |
| 984 | Ga0495644_0002862 | 3300046523 | Bacteria | 6837 |
| 985 | Ga0495644_0016424 | 3300046523 | Bacteria | 2833 |
| 986 | Ga0495648_0000188 | 3300046524 | Bacteria | 71222 |
| 987 | Ga0495648_0001828 | 3300046524 | Bacteria | 20470 |
| 988 | Ga0495648_0010069 | 3300046524 | Bacteria | 7243 |
| 989 | Ga0495648_0019703 | 3300046524 | Bacteria | 4731 |
| 990 | Ga0495648_0038878 | 3300046524 | Bacteria | 3035 |
| 991 | Ga0495648_0060170 | 3300046524 | Bacteria | 2261 |
| 992 | Ga0495648_0062533 | 3300046524 | Bacteria | 2203 |
| 993 | Ga0495663_0001152 | 3300046525 | Bacteria | 8544 |
| 994 | Ga0495666_0007152 | 3300046526 | Bacteria | 5606 |
| 995 | Ga0495666_0017365 | 3300046526 | Bacteria | 3584 |
| 996 | Ga0495666_0040284 | 3300046526 | Bacteria | 2265 |
| 997 | Ga0495642_0000276 | 3300046528 | Bacteria | 29070 |
| 998 | Ga0495652_0007000 | 3300046529 | Bacteria | 10422 |
| 999 | Ga0495652_0026204 | 3300046529 | Bacteria | 5153 |
| 1000 | Ga0495652_0058154 | 3300046529 | Bacteria | 3275 |
| 1001 | Ga0495652_0062651 | 3300046529 | Bacteria | 3135 |
| 1002 | Ga0495654_0000878 | 3300046530 | Bacteria | 22561 |
| 1003 | Ga0495654_0005444 | 3300046530 | Bacteria | 7391 |
| 1004 | Ga0495654_0005926 | 3300046530 | Bacteria | 7026 |
| 1005 | Ga0495654_0007926 | 3300046530 | Bacteria | 5902 |
| 1006 | Ga0495654_0018888 | 3300046530 | Bacteria | 3607 |
| 1007 | Ga0495654_0038697 | 3300046530 | Bacteria | 2383 |
| 1008 | Ga0495665_0000270 | 3300046531 | Bacteria | 26319 |
| 1009 | Ga0495665_0032847 | 3300046531 | Bacteria | 2776 |
| 1010 | Ga0495665_0036946 | 3300046531 | Bacteria | 2607 |
| 1011 | Ga0495640_0015373 | 3300046533 | Bacteria | 5762 |
| 1012 | Ga0495640_0028712 | 3300046533 | Bacteria | 4002 |
| 1013 | Ga0495586_0001447 | 3300046535 | Bacteria | 13109 |
| 1014 | Ga0495587_0005433 | 3300046536 | Bacteria | 8315 |
| 1015 | Ga0495587_0006220 | 3300046536 | Bacteria | 7792 |
| 1016 | Ga0495587_0011069 | 3300046536 | Bacteria | 5720 |
| 1017 | Ga0495587_0027077 | 3300046536 | Bacteria | 3491 |
| 1018 | Ga0495609_0000456 | 3300046538 | Bacteria | 33462 |
| 1019 | Ga0495609_0003025 | 3300046538 | Bacteria | 9908 |
| 1020 | Ga0495609_0008086 | 3300046538 | Bacteria | 5183 |
| 1021 | Ga0495609_0009745 | 3300046538 | Bacteria | 4633 |
| 1022 | Ga0495597_0009516 | 3300046542 | Bacteria | 4795 |
| 1023 | Ga0495597_0010021 | 3300046542 | Bacteria | 4652 |
| 1024 | Ga0495597_0053325 | 3300046542 | Bacteria | 1778 |
| 1025 | Ga0495645_0001550 | 3300046543 | Bacteria | 15539 |
| 1026 | Ga0495645_0007057 | 3300046543 | Bacteria | 7817 |
| 1027 | Ga0495645_0010772 | 3300046543 | Bacteria | 6423 |
| 1028 | Ga0495645_0014623 | 3300046543 | Bacteria | 5572 |
| 1029 | Ga0495645_0078236 | 3300046543 | Bacteria | 2377 |
| 1030 | Ga0495645_0101017 | 3300046543 | Bacteria | 2051 |
| 1031 | Ga0495622_0001439 | 3300046557 | Bacteria | 12019 |
| 1032 | Ga0495622_0001690 | 3300046557 | Bacteria | 10908 |
| 1033 | Ga0495622_0005935 | 3300046557 | Bacteria | 5675 |
| 1034 | Ga0495622_0011047 | 3300046557 | Bacteria | 4168 |
| 1035 | Ga0495622_0020971 | 3300046557 | Bacteria | 3043 |
| 1036 | Ga0495622_0039348 | 3300046557 | Bacteria | 2202 |
| 1037 | Ga0495622_0040666 | 3300046557 | Bacteria | 2163 |
| 1038 | Ga0495622_0058480 | 3300046557 | Bacteria | 1786 |
| 1039 | Ga0495633_0000896 | 3300046558 | Bacteria | 25429 |
| 1040 | Ga0495667_0033070 | 3300046559 | Bacteria | 3461 |
| 1041 | Ga0495667_0046874 | 3300046559 | Bacteria | 2857 |
| 1042 | Ga0495667_0051787 | 3300046559 | Bacteria | 2707 |
| 1043 | Ga0495656_0010985 | 3300046615 | Bacteria | 3311 |
| 1044 | Ga0495668_0000096 | 3300046616 | Bacteria | 139693 |
| 1045 | Ga0495668_0012211 | 3300046616 | Bacteria | 5103 |
| 1046 | Ga0495668_0069304 | 3300046616 | Bacteria | 1939 |
| 1047 | Ga0495634_0000064 | 3300046642 | Bacteria | 85710 |
| 1048 | Ga0495634_0012589 | 3300046642 | Bacteria | 6123 |
| 1049 | Ga0495634_0014826 | 3300046642 | Bacteria | 5604 |
| 1050 | Ga0495611_0002721 | 3300046648 | Bacteria | 7958 |
| 1051 | Ga0495611_0008969 | 3300046648 | Bacteria | 4229 |
| 1052 | Ga0495625_0000010 | 3300046660 | Bacteria | 381775 |
| 1053 | Ga0495625_0003810 | 3300046660 | Bacteria | 14594 |
| 1054 | Ga0495625_0005012 | 3300046660 | Bacteria | 12284 |
| 1055 | Ga0495625_0100211 | 3300046660 | Bacteria | 1991 |
| 1056 | Ga0495635_0001480 | 3300046663 | Bacteria | 15709 |
| 1057 | Ga0495635_0006440 | 3300046663 | Bacteria | 8185 |
| 1058 | Ga0495635_0019099 | 3300046663 | Bacteria | 4784 |
| 1059 | Ga0495635_0025503 | 3300046663 | Bacteria | 4119 |
| 1060 | Ga0495635_0042289 | 3300046663 | Bacteria | 3146 |
| 1061 | Ga0495635_0042546 | 3300046663 | Bacteria | 3136 |
| 1062 | Ga0495659_0000457 | 3300046664 | Bacteria | 15230 |
| 1063 | Ga0495661_0000790 | 3300046665 | Bacteria | 30045 |
| 1064 | Ga0495661_0001455 | 3300046665 | Bacteria | 19817 |
| 1065 | Ga0495661_0005867 | 3300046665 | Bacteria | 8677 |
| 1066 | Ga0495661_0016543 | 3300046665 | Bacteria | 4885 |
| 1067 | Ga0495588_0058054 | 3300046674 | Bacteria | 2000 |
| 1068 | Ga0495657_0008807 | 3300046675 | Bacteria | 7688 |
| 1069 | Ga0495599_0000823 | 3300046678 | Bacteria | 17484 |
| 1070 | Ga0495599_0019978 | 3300046678 | Bacteria | 4171 |
| 1071 | Ga0495599_0085027 | 3300046678 | Bacteria | 1976 |
| 1072 | Ga0495623_0007544 | 3300046679 | Bacteria | 7058 |
| 1073 | Ga0495623_0036727 | 3300046679 | Bacteria | 3137 |
| 1074 | Ga0495646_0010120 | 3300046680 | Bacteria | 5995 |
| 1075 | Ga0495646_0023117 | 3300046680 | Bacteria | 3913 |
| 1076 | Ga0495646_0024091 | 3300046680 | Bacteria | 3833 |
| 1077 | Ga0495646_0024315 | 3300046680 | Bacteria | 3815 |
| 1078 | Ga0495646_0030608 | 3300046680 | Bacteria | 3360 |
| 1079 | Ga0495646_0071739 | 3300046680 | Bacteria | 2037 |
| 1080 | Ga0495647_0060641 | 3300046681 | Bacteria | 1492 |
| 1081 | Ga0495658_0001546 | 3300046683 | Bacteria | 12029 |
| 1082 | Ga0495669_0007735 | 3300046684 | Bacteria | 4511 |
| 1083 | Ga0495613_0001602 | 3300046689 | Bacteria | 17178 |
| 1084 | Ga0495613_0017809 | 3300046689 | Bacteria | 5294 |
| 1085 | Ga0495613_0060922 | 3300046689 | Bacteria | 2764 |
| 1086 | Ga0495624_0000201 | 3300046690 | Bacteria | 45984 |
| 1087 | Ga0495624_0003503 | 3300046690 | Bacteria | 11629 |
| 1088 | Ga0495624_0014549 | 3300046690 | Bacteria | 5336 |
| 1089 | Ga0495624_0015332 | 3300046690 | Bacteria | 5178 |
| 1090 | Ga0495624_0050733 | 3300046690 | Bacteria | 2627 |
| 1091 | Ga0495670_0018076 | 3300046691 | Bacteria | 3473 |
| 1092 | Ga0495670_0022050 | 3300046691 | Bacteria | 3144 |
| 1093 | Ga0495671_0026716 | 3300046692 | Bacteria | 2989 |
| 1094 | Ga0495671_0029088 | 3300046692 | Bacteria | 2840 |
| 1095 | Ga0495671_0039935 | 3300046692 | Bacteria | 2367 |
| 1096 | Ga0495649_0001000 | 3300046694 | Bacteria | 22223 |
| 1097 | Ga0495649_0008348 | 3300046694 | Bacteria | 6232 |
| 1098 | Ga0495649_0017672 | 3300046694 | Bacteria | 4022 |
| 1099 | Ga0495649_0037014 | 3300046694 | Bacteria | 2679 |
| 1100 | Ga0495649_0058384 | 3300046694 | Bacteria | 2079 |
| 1101 | Ga0495649_0066481 | 3300046694 | Bacteria | 1934 |
| 1102 | Ga0495589_0001771 | 3300046794 | Bacteria | 12299 |
| 1103 | Ga0495589_0004057 | 3300046794 | Bacteria | 7848 |
| 1104 | Ga0495589_0006766 | 3300046794 | Bacteria | 6037 |
| 1105 | Ga0495589_0012759 | 3300046794 | Bacteria | 4343 |
| 1106 | Ga0495600_0010359 | 3300046809 | Bacteria | 5785 |
| 1107 | Ga0495600_0027469 | 3300046809 | Bacteria | 3677 |
| 1108 | Ga0495600_0122816 | 3300046809 | Bacteria | 1689 |
| 1109 | Ga0495660_0013447 | 3300046810 | Bacteria | 4742 |
| 1110 | Ga0495660_0037615 | 3300046810 | Bacteria | 2694 |
| 1111 | Ga0495660_0075272 | 3300046810 | Bacteria | 1781 |
| 1112 | Ga0495581_0000014 | 3300047315 | Bacteria | 60735 |
| 1113 | Ga0495581_0021153 | 3300047315 | Bacteria | 3773 |
| 1114 | Ga0495604_0001045 | 3300047317 | Bacteria | 23003 |
| 1115 | Ga0495604_0012911 | 3300047317 | Bacteria | 6654 |
| 1116 | Ga0495604_0015866 | 3300047317 | Bacteria | 6013 |
| 1117 | Ga0495604_0017993 | 3300047317 | Bacteria | 5655 |
| 1118 | Ga0495604_0059746 | 3300047317 | Bacteria | 2921 |
| 1119 | Ga0495674_0013843 | 3300047319 | Bacteria | 7571 |
| 1120 | Ga0495674_0037786 | 3300047319 | Bacteria | 4337 |
| 1121 | Ga0495674_0046100 | 3300047319 | Bacteria | 3870 |
| 1122 | Ga0495674_0048125 | 3300047319 | Bacteria | 3775 |
| 1123 | Ga0495674_0063784 | 3300047319 | Bacteria | 3204 |
| 1124 | Ga0495672_0004532 | 3300047320 | Bacteria | 11333 |
| 1125 | Ga0495672_0009651 | 3300047320 | Bacteria | 6966 |
| 1126 | Ga0495672_0013081 | 3300047320 | Bacteria | 5743 |
| 1127 | Ga0495672_0017425 | 3300047320 | Bacteria | 4805 |
| 1128 | Ga0495672_0018025 | 3300047320 | Bacteria | 4702 |
| 1129 | Ga0495672_0018797 | 3300047320 | Bacteria | 4576 |
| 1130 | Ga0495672_0020229 | 3300047320 | Bacteria | 4367 |
| 1131 | Ga0495672_0030535 | 3300047320 | Bacteria | 3378 |
| 1132 | Ga0495672_0032208 | 3300047320 | Bacteria | 3265 |
| 1133 | Ga0495672_0060533 | 3300047320 | Bacteria | 2186 |
| 1134 | Ga0495676_0000002 | 3300047321 | Bacteria | 373918 |
| 1135 | Ga0495676_0008340 | 3300047321 | Bacteria | 9503 |
| 1136 | Ga0495676_0017761 | 3300047321 | Bacteria | 6282 |
| 1137 | Ga0495676_0049156 | 3300047321 | Bacteria | 3394 |
| 1138 | Ga0495676_0059463 | 3300047321 | Bacteria | 3001 |
| 1139 | Ga0495680_0001894 | 3300047322 | Bacteria | 21963 |
| 1140 | Ga0495680_0005126 | 3300047322 | Bacteria | 12372 |
| 1141 | Ga0495680_0087224 | 3300047322 | Bacteria | 2348 |
| 1142 | Ga0495680_0091270 | 3300047322 | Bacteria | 2283 |
| 1143 | Ga0495683_0001174 | 3300047323 | Bacteria | 17901 |
| 1144 | Ga0495683_0001446 | 3300047323 | Bacteria | 15578 |
| 1145 | Ga0495683_0003592 | 3300047323 | Bacteria | 9011 |
| 1146 | Ga0495683_0009570 | 3300047323 | Bacteria | 5160 |
| 1147 | Ga0495683_0014270 | 3300047323 | Bacteria | 4139 |
| 1148 | Ga0495683_0018159 | 3300047323 | Bacteria | 3639 |
| 1149 | Ga0495683_0068421 | 3300047323 | Bacteria | 1746 |
| 1150 | Ga0495687_005784 | 3300047443 | Bacteria | 7758 |
| 1151 | Ga0495687_021419 | 3300047443 | Bacteria | 3127 |
| 1152 | Ga0495675_0012153 | 3300047444 | Bacteria | 5416 |
| 1153 | Ga0495675_0045850 | 3300047444 | Bacteria | 2784 |
| 1154 | Ga0495675_0047451 | 3300047444 | Bacteria | 2732 |
| 1155 | Ga0495675_0055414 | 3300047444 | Bacteria | 2514 |
| 1156 | Ga0495675_0064304 | 3300047444 | Bacteria | 2320 |
| 1157 | Ga0495677_0027531 | 3300047445 | Bacteria | 2063 |
| 1158 | Ga0495679_000243 | 3300047446 | Bacteria | 45339 |
| 1159 | Ga0495679_000498 | 3300047446 | Bacteria | 27846 |
| 1160 | Ga0495679_000540 | 3300047446 | Bacteria | 26653 |
| 1161 | Ga0495679_002453 | 3300047446 | Bacteria | 9446 |
| 1162 | Ga0495679_003917 | 3300047446 | Bacteria | 7031 |
| 1163 | Ga0495679_008749 | 3300047446 | Bacteria | 4092 |
| 1164 | Ga0495673_0001376 | 3300047469 | Bacteria | 19632 |
| 1165 | Ga0495673_0001555 | 3300047469 | Bacteria | 17984 |
| 1166 | Ga0495673_0001654 | 3300047469 | Bacteria | 17196 |
| 1167 | Ga0495673_0009282 | 3300047469 | Bacteria | 5455 |
| 1168 | Ga0495673_0014320 | 3300047469 | Bacteria | 4127 |
| 1169 | Ga0495673_0040678 | 3300047469 | Bacteria | 2097 |
| 1170 | Ga0495673_0045778 | 3300047469 | Bacteria | 1942 |
| 1171 | Ga0495681_0002070 | 3300047470 | Bacteria | 14573 |
| 1172 | Ga0495681_0003032 | 3300047470 | Bacteria | 11804 |
| 1173 | Ga0495681_0008069 | 3300047470 | Bacteria | 6634 |
| 1174 | Ga0495681_0013937 | 3300047470 | Bacteria | 4637 |
| 1175 | Ga0495681_0022735 | 3300047470 | Bacteria | 3348 |
| 1176 | Ga0495681_0024250 | 3300047470 | Bacteria | 3201 |
| 1177 | Ga0495681_0082596 | 3300047470 | Bacteria | 1431 |
| 1178 | Ga0495684_0031468 | 3300047471 | Bacteria | 4073 |
| 1179 | Ga0495684_0108536 | 3300047471 | Bacteria | 2096 |
| 1180 | Ga0495686_0028914 | 3300047472 | Bacteria | 3608 |
| 1181 | Ga0495593_0000003 | 3300047673 | Bacteria | 120744 |
| 1182 | Ga0495593_0013772 | 3300047673 | Bacteria | 4606 |
| 1183 | Ga0495593_0032489 | 3300047673 | Bacteria | 2844 |
| 1184 | Ga0495602_0004392 | 3300048088 | Bacteria | 14715 |
| 1185 | Ga0495602_0019904 | 3300048088 | Bacteria | 6646 |
| 1186 | Ga0495602_0027496 | 3300048088 | Bacteria | 5464 |
| 1187 | Ga0495602_0032356 | 3300048088 | Bacteria | 4924 |
| 1188 | Ga0495602_0056054 | 3300048088 | Bacteria | 3468 |
| 1189 | Ga0495614_0001273 | 3300048089 | Bacteria | 10833 |
| 1190 | Ga0495614_0009420 | 3300048089 | Bacteria | 4317 |
| 1191 | Ga0495614_0049336 | 3300048089 | Bacteria | 1805 |
| 1192 | Ga0495626_0000319 | 3300048091 | Bacteria | 50529 |
| 1193 | Ga0495626_0001455 | 3300048091 | Bacteria | 18744 |
| 1194 | Ga0495626_0001872 | 3300048091 | Bacteria | 15768 |
| 1195 | Ga0495626_0005066 | 3300048091 | Bacteria | 7858 |
| 1196 | Ga0495626_0006702 | 3300048091 | Bacteria | 6523 |
| 1197 | Ga0495626_0008178 | 3300048091 | Bacteria | 5762 |
| 1198 | Ga0496100_0000770 | 3300048903 | Bacteria | 15251 |
| 1199 | Ga0496100_0036563 | 3300048903 | Bacteria | 3098 |
| 1200 | Ga0496100_0049984 | 3300048903 | Bacteria | 2706 |
| 1201 | Ga0496101_0003605 | 3300048904 | Bacteria | 9667 |
| 1202 | Ga0496101_0062499 | 3300048904 | Bacteria | 2707 |
| 1203 | Ga0496101_0120761 | 3300048904 | Bacteria | 1981 |
| 1204 | Ga0496102_0001989 | 3300048905 | Bacteria | 17649 |
| 1205 | Ga0496102_0002699 | 3300048905 | Bacteria | 15088 |
| 1206 | Ga0496102_0044305 | 3300048905 | Bacteria | 4037 |
| 1207 | Ga0496102_0110231 | 3300048905 | Bacteria | 2565 |
| 1208 | Ga0496102_0130940 | 3300048905 | Bacteria | 2348 |
| 1209 | Ga0496103_0000854 | 3300048906 | Bacteria | 22289 |
| 1210 | Ga0496103_0002629 | 3300048906 | Bacteria | 11252 |
| 1211 | Ga0496103_0019548 | 3300048906 | Bacteria | 4067 |
| 1212 | Ga0496103_0024009 | 3300048906 | Bacteria | 3678 |
| 1213 | Ga0496104_0043929 | 3300048907 | Bacteria | 4198 |
| 1214 | Ga0496104_0061727 | 3300048907 | Bacteria | 3554 |
| 1215 | Ga0496105_0159600 | 3300048908 | Bacteria | 1851 |
| 1216 | Ga0496106_0000152 | 3300048909 | Bacteria | 51253 |
| 1217 | Ga0496106_0003247 | 3300048909 | Bacteria | 12162 |
| 1218 | Ga0496107_0030056 | 3300048910 | Bacteria | 3871 |
| 1219 | Ga0496108_0083230 | 3300048911 | Bacteria | 2714 |
| 1220 | Ga0496108_0140914 | 3300048911 | Bacteria | 2077 |
| 1221 | Ga0496110_0114659 | 3300048913 | Bacteria | 2425 |
| 1222 | Ga0496110_0130468 | 3300048913 | Bacteria | 2269 |
| 1223 | Ga0496110_0143978 | 3300048913 | Bacteria | 2155 |
| 1224 | Ga0496110_0252289 | 3300048913 | Bacteria | 1606 |
| 1225 | Ga0496111_0026372 | 3300048914 | Bacteria | 4103 |
| 1226 | Ga0496111_0168103 | 3300048914 | Bacteria | 1629 |
| 1227 | Ga0496112_0000101 | 3300048915 | Bacteria | 54429 |
| 1228 | Ga0496112_0034008 | 3300048915 | Bacteria | 4959 |
| 1229 | Ga0496113_0043290 | 3300048916 | Bacteria | 3331 |
| 1230 | Ga0496114_0002669 | 3300048917 | Bacteria | 13620 |
| 1231 | Ga0496114_0157507 | 3300048917 | Bacteria | 1972 |
| 1232 | Ga0496115_0099049 | 3300048918 | Bacteria | 2388 |
| 1233 | Ga0496115_0102345 | 3300048918 | Bacteria | 2349 |
| 1234 | Ga0496115_0181310 | 3300048918 | Bacteria | 1740 |
| 1235 | Ga0496116_0000267 | 3300048919 | Bacteria | 91320 |
| 1236 | Ga0496116_0087204 | 3300048919 | Bacteria | 1911 |
| 1237 | Ga0496117_0001021 | 3300048920 | Bacteria | 42741 |
| 1238 | Ga0496117_0003014 | 3300048920 | Bacteria | 20232 |
| 1239 | Ga0496117_0003521 | 3300048920 | Bacteria | 18127 |
| 1240 | Ga0496117_0020845 | 3300048920 | Bacteria | 5332 |
| 1241 | Ga0496117_0023031 | 3300048920 | Bacteria | 4977 |
| 1242 | Ga0496117_0023500 | 3300048920 | Bacteria | 4907 |
| 1243 | Ga0496117_0031790 | 3300048920 | Bacteria | 4024 |
| 1244 | Ga0496117_0049041 | 3300048920 | Bacteria | 3008 |
| 1245 | Ga0496117_0053870 | 3300048920 | Bacteria | 2823 |
| 1246 | Ga0496117_0090442 | 3300048920 | Bacteria | 1972 |
| 1247 | Ga0496117_0106074 | 3300048920 | Bacteria | 1764 |
| 1248 | Ga0496118_0001205 | 3300048921 | Bacteria | 39819 |
| 1249 | Ga0496118_0002131 | 3300048921 | Bacteria | 27643 |
| 1250 | Ga0496118_0003163 | 3300048921 | Bacteria | 21053 |
| 1251 | Ga0496118_0007073 | 3300048921 | Bacteria | 12054 |
| 1252 | Ga0496118_0009055 | 3300048921 | Bacteria | 10144 |
| 1253 | Ga0496118_0011650 | 3300048921 | Bacteria | 8553 |
| 1254 | Ga0496118_0022178 | 3300048921 | Bacteria | 5562 |
| 1255 | Ga0496118_0030612 | 3300048921 | Bacteria | 4486 |
| 1256 | Ga0496118_0037948 | 3300048921 | Bacteria | 3868 |
| 1257 | Ga0496118_0044984 | 3300048921 | Bacteria | 3451 |
| 1258 | Ga0496118_0052309 | 3300048921 | Bacteria | 3116 |
| 1259 | Ga0496118_0103556 | 3300048921 | Bacteria | 1914 |
| 1260 | Ga0496118_0138795 | 3300048921 | Bacteria | 1546 |
| 1261 | Ga0496119_0000046 | 3300048922 | Bacteria | 190003 |
| 1262 | Ga0496119_0024863 | 3300048922 | Bacteria | 4199 |
| 1263 | Ga0496119_0058364 | 3300048922 | Bacteria | 2326 |
| 1264 | Ga0496120_0002213 | 3300048923 | Bacteria | 20511 |
| 1265 | Ga0496121_0000041 | 3300048924 | Bacteria | 346686 |
| 1266 | Ga0496121_0000366 | 3300048924 | Bacteria | 92773 |
| 1267 | Ga0496121_0000824 | 3300048924 | Bacteria | 56559 |
| 1268 | Ga0496121_0001446 | 3300048924 | Bacteria | 40065 |
| 1269 | Ga0496121_0002599 | 3300048924 | Bacteria | 27274 |
| 1270 | Ga0496121_0003643 | 3300048924 | Bacteria | 21671 |
| 1271 | Ga0496121_0004448 | 3300048924 | Bacteria | 18832 |
| 1272 | Ga0496121_0012188 | 3300048924 | Bacteria | 9425 |
| 1273 | Ga0496121_0014389 | 3300048924 | Bacteria | 8400 |
| 1274 | Ga0496121_0025746 | 3300048924 | Bacteria | 5570 |
| 1275 | Ga0496121_0029189 | 3300048924 | Bacteria | 5110 |
| 1276 | Ga0496121_0033209 | 3300048924 | Bacteria | 4675 |
| 1277 | Ga0496121_0034546 | 3300048924 | Bacteria | 4550 |
| 1278 | Ga0496121_0044568 | 3300048924 | Bacteria | 3824 |
| 1279 | Ga0496121_0160259 | 3300048924 | Bacteria | 1646 |
| 1280 | Ga0496122_0000167 | 3300048925 | Bacteria | 157130 |
| 1281 | Ga0496122_0001027 | 3300048925 | Bacteria | 49219 |
| 1282 | Ga0496122_0012761 | 3300048925 | Bacteria | 8315 |
| 1283 | Ga0496122_0041991 | 3300048925 | Bacteria | 3605 |
| 1284 | Ga0496122_0070884 | 3300048925 | Bacteria | 2486 |
| 1285 | Ga0496123_0000127 | 3300048926 | Bacteria | 154927 |
| 1286 | Ga0496123_0000240 | 3300048926 | Bacteria | 110383 |
| 1287 | Ga0496123_0015663 | 3300048926 | Bacteria | 6204 |
| 1288 | Ga0496123_0018849 | 3300048926 | Bacteria | 5466 |
| 1289 | Ga0496123_0032067 | 3300048926 | Bacteria | 3812 |
| 1290 | Ga0496123_0032885 | 3300048926 | Bacteria | 3744 |
| 1291 | Ga0496124_0000261 | 3300048927 | Bacteria | 101660 |
| 1292 | Ga0496124_0001966 | 3300048927 | Bacteria | 28060 |
| 1293 | Ga0496124_0003100 | 3300048927 | Bacteria | 20651 |
| 1294 | Ga0496124_0003299 | 3300048927 | Bacteria | 19894 |
| 1295 | Ga0496124_0004055 | 3300048927 | Bacteria | 17367 |
| 1296 | Ga0496124_0019838 | 3300048927 | Bacteria | 6237 |
| 1297 | Ga0496124_0118373 | 3300048927 | Bacteria | 2120 |
| 1298 | Ga0496125_0000944 | 3300048928 | Bacteria | 45671 |
| 1299 | Ga0496125_0002606 | 3300048928 | Bacteria | 23156 |
| 1300 | Ga0496125_0003132 | 3300048928 | Bacteria | 20535 |
| 1301 | Ga0496125_0007271 | 3300048928 | Bacteria | 11793 |
| 1302 | Ga0496125_0008276 | 3300048928 | Bacteria | 10921 |
| 1303 | Ga0496125_0015617 | 3300048928 | Bacteria | 7328 |
| 1304 | Ga0496125_0026562 | 3300048928 | Bacteria | 5271 |
| 1305 | Ga0496125_0026953 | 3300048928 | Bacteria | 5218 |
| 1306 | Ga0496125_0031343 | 3300048928 | Bacteria | 4740 |
| 1307 | Ga0496125_0056609 | 3300048928 | Bacteria | 3183 |
| 1308 | Ga0496126_0000603 | 3300048929 | Bacteria | 67970 |
| 1309 | Ga0496126_0005095 | 3300048929 | Bacteria | 15235 |
| 1310 | Ga0496126_0011447 | 3300048929 | Bacteria | 9181 |
| 1311 | Ga0496126_0011697 | 3300048929 | Bacteria | 9048 |
| 1312 | Ga0496126_0013263 | 3300048929 | Bacteria | 8397 |
| 1313 | Ga0496126_0022380 | 3300048929 | Bacteria | 6152 |
| 1314 | Ga0496126_0032972 | 3300048929 | Bacteria | 4875 |
| 1315 | Ga0495678_003902 | 3300049459 | Bacteria | 8945 |
| 1316 | Ga0495678_006155 | 3300049459 | Bacteria | 6437 |
| 1317 | Ga0495678_006531 | 3300049459 | Bacteria | 6193 |
| 1318 | Ga0495678_008431 | 3300049459 | Bacteria | 5199 |
| 1319 | Ga0495678_009281 | 3300049459 | Bacteria | 4883 |
| 1320 | Ga0495678_015960 | 3300049459 | Bacteria | 3446 |
| 1321 | Ga0495682_0000234 | 3300049460 | Bacteria | 43711 |
| 1322 | Ga0501032_0005184 | 3300049569 | Bacteria | 9711 |
| 1323 | Ga0501034_0000260 | 3300049571 | Bacteria | 95474 |
| 1324 | Ga0501034_0001389 | 3300049571 | Bacteria | 32569 |
| 1325 | Ga0501034_0100213 | 3300049571 | Bacteria | 2891 |
| 1326 | Ga0501038_0178113 | 3300049574 | Bacteria | 1717 |
| 1327 | nmdc:mga00v17_22677_c1 | 3300050491 | Bacteria | 3625 |
| 1328 | nmdc:mga0yw44_12450_c1 | 3300050492 | Bacteria | 4435 |
| 1329 | nmdc:mga0k408_2812_c1 | 3300050493 | Bacteria | 9240 |
| 1330 | nmdc:mga06z11_21475_c1 | 3300050494 | Bacteria | 3000 |
| 1331 | nmdc:mga06z11_24614_c1 | 3300050494 | Bacteria | 2842 |
| 1332 | nmdc:mga06z11_42430_c1 | 3300050494 | Bacteria | 2282 |
| 1333 | nmdc:mga04h51_18623_c1 | 3300050495 | Bacteria | 2047 |
| 1334 | nmdc:mga07m45_4272_c1 | 3300050496 | Bacteria | 6990 |
| 1335 | nmdc:mga09592_49041_c1 | 3300050508 | Bacteria | 3560 |
| 1336 | nmdc:mga0sz30_23955_c1 | 3300050516 | Bacteria | 2489 |
| 1337 | nmdc:mga0sz30_25723_c1 | 3300050516 | Bacteria | 2408 |
| 1338 | nmdc:mga0sz30_34829_c1 | 3300050516 | Bacteria | 2098 |
| 1339 | nmdc:mga0sz30_5037_c1 | 3300050516 | Bacteria | 4825 |
| 1340 | Ga0495601_0012258 | 3300053077 | Bacteria | 5141 |
| 1341 | Ga0495601_0015749 | 3300053077 | Bacteria | 4574 |
| 1342 | Ga0495601_0034735 | 3300053077 | Bacteria | 3146 |
| 1343 | Ga0495601_0078238 | 3300053077 | Bacteria | 2119 |
| 1344 | Ga0495601_0080234 | 3300053077 | Bacteria | 2093 |
| 1345 | Ga0500635_0009073 | 3300053080 | Bacteria | 2748 |
| 1346 | Ga0495655_0015207 | 3300053083 | Bacteria | 1631 |
| 1347 | Ga0495619_0005097 | 3300053085 | Bacteria | 8345 |
| 1348 | Ga0495619_0021762 | 3300053085 | Bacteria | 4096 |
| 1349 | Ga0495619_0173567 | 3300053085 | Bacteria | 1491 |
| 1350 | Ga0500643_000037 | 3300053087 | Bacteria | 180821 |
| 1351 | Ga0500581_039952 | 3300053089 | Bacteria | 2403 |
| 1352 | Ga0500647_0015495 | 3300053091 | Bacteria | 3488 |
| 1353 | Ga0500566_0000367 | 3300053094 | Bacteria | 24682 |
| 1354 | Ga0500566_0001124 | 3300053094 | Bacteria | 15513 |
| 1355 | Ga0500566_0002925 | 3300053094 | Bacteria | 10193 |
| 1356 | Ga0500566_0013595 | 3300053094 | Bacteria | 4789 |
| 1357 | Ga0500640_021741 | 3300053095 | Bacteria | 2768 |
| 1358 | Ga0500641_0010054 | 3300053096 | Bacteria | 3411 |
| 1359 | Ga0500556_0000015 | 3300053104 | Bacteria | 202598 |
| 1360 | Ga0500557_000014 | 3300053105 | Bacteria | 107928 |
| 1361 | Ga0500562_002831 | 3300053108 | Bacteria | 4322 |
| 1362 | Ga0500562_016822 | 3300053108 | Bacteria | 1881 |
| 1363 | Ga0500569_006860 | 3300053109 | Bacteria | 2524 |
| 1364 | Ga0500569_039970 | 3300053109 | Bacteria | 1368 |
| 1365 | Ga0500572_002314 | 3300053111 | Bacteria | 4609 |
| 1366 | Ga0500595_001223 | 3300053119 | Bacteria | 14197 |
| 1367 | Ga0500595_003517 | 3300053119 | Bacteria | 7286 |
| 1368 | Ga0500595_004674 | 3300053119 | Bacteria | 6087 |
| 1369 | Ga0500595_024288 | 3300053119 | Bacteria | 2117 |
| 1370 | Ga0500608_018564 | 3300053122 | Bacteria | 3174 |
| 1371 | Ga0500614_003104 | 3300053123 | Bacteria | 3609 |
| 1372 | Ga0500642_0000044 | 3300053130 | Bacteria | 82877 |
| 1373 | Ga0500642_0000332 | 3300053130 | Bacteria | 16203 |
| 1374 | Ga0500652_000397 | 3300053131 | Bacteria | 15556 |
| 1375 | Ga0500658_0063432 | 3300053134 | Bacteria | 1542 |
| 1376 | Ga0500559_0000146 | 3300053136 | Bacteria | 55375 |
| 1377 | Ga0500568_0000729 | 3300053139 | Bacteria | 23585 |
| 1378 | Ga0500577_0001065 | 3300053142 | Bacteria | 7072 |
| 1379 | Ga0500589_065107 | 3300053147 | Bacteria | 1662 |
| 1380 | Ga0500590_074679 | 3300053148 | Bacteria | 1677 |
| 1381 | Ga0500603_001248 | 3300053150 | Bacteria | 5898 |
| 1382 | Ga0500604_0013015 | 3300053151 | Bacteria | 2251 |
| 1383 | Ga0500616_0000041 | 3300053153 | Bacteria | 359328 |
| 1384 | Ga0500616_0024588 | 3300053153 | Bacteria | 3344 |
| 1385 | Ga0500619_002481 | 3300053154 | Bacteria | 3563 |
| 1386 | Ga0500622_0001128 | 3300053156 | Bacteria | 22282 |
| 1387 | Ga0500634_0007703 | 3300053161 | Bacteria | 5336 |
| 1388 | Ga0500638_076420 | 3300053162 | Bacteria | 1595 |
| 1389 | Ga0500639_000085 | 3300053163 | Bacteria | 44045 |
| 1390 | Ga0500636_0003535 | 3300053177 | Bacteria | 8795 |
| 1391 | Ga0500637_0000231 | 3300053178 | Bacteria | 20786 |
| 1392 | Ga0500645_023268 | 3300053730 | Bacteria | 1900 |
| 1393 | Ga0500599_000271 | 3300053736 | Bacteria | 5002 |
| 1394 | Ga0500601_000073 | 3300053737 | Bacteria | 20487 |
| 1395 | Ga0466962_0000559 | 3300061719 | Bacteria | 16346 |
| 1396 | Ga0466962_0010024 | 3300061719 | Bacteria | 4547 |
| 1397 | 2501070895 | 2501025501 | Bacteria | 7768574 |
| 1398 | 2501084874 | 2501025502 | Bacteria | 9641094 |
| 1399 | 2501413723 | 2501025504 | Bacteria | 8008976 |
| 1400 | 2507510665 | 2507262055 | Bacteria | 8048963 |
| 1401 | 2508544468 | 2508501009 | Bacteria | 7784016 |
| 1402 | 2508697388 | 2508501042 | Bacteria | 8719808 |
| 1403 | 2509152063 | 2508501128 | Bacteria | 8613869 |
| 1404 | 2510252339 | 2510065045 | Bacteria | 7761063 |
| 1405 | 2511089598 | 2510917013 | Bacteria | 9951648 |
| 1406 | 2511095007 | 2510917014 | Bacteria | 8296963 |
| 1407 | 2511104663 | 2510917015 | Bacteria | 7950052 |
| 1408 | 2511251717 | 2511231003 | Bacteria | 5606035 |
| 1409 | 2511252915 | 2511231004 | Bacteria | 6669789 |
| 1410 | 2511267771 | 2511231006 | Bacteria | 6794709 |
| 1411 | 2511271352 | 2511231007 | Bacteria | 6306603 |
| 1412 | 2511271848 | 2511231007 | Bacteria | 6306603 |
| 1413 | 2511295287 | 2511231011 | Bacteria | 6149768 |
| 1414 | 2511299610 | 2511231012 | Bacteria | 6738011 |
| 1415 | 2511323225 | 2511231015 | Bacteria | 6598026 |
| 1416 | 2511329440 | 2511231016 | Bacteria | 6704427 |
| 1417 | 2511335019 | 2511231017 | Bacteria | 6503007 |
| 1418 | 2511338315 | 2511231018 | Bacteria | 6436256 |
| 1419 | 2511344554 | 2511231019 | Bacteria | 6520662 |
| 1420 | 2511351658 | 2511231020 | Bacteria | 6115223 |
| 1421 | 2511356019 | 2511231021 | Bacteria | 7302637 |
| 1422 | 2511363405 | 2511231022 | Bacteria | 6719296 |
| 1423 | 2511367322 | 2511231023 | Bacteria | 6808468 |
| 1424 | 2511372869 | 2511231024 | Bacteria | 5835885 |
| 1425 | 2511393692 | 2511231028 | Bacteria | 8046582 |
| 1426 | 2511827062 | 2511231156 | Bacteria | 6845832 |
| 1427 | 2512324672 | 2512047018 | Bacteria | 6663241 |
| 1428 | 2512327719 | 2512047018 | Bacteria | 6663241 |
| 1429 | 2512344737 | 2512047030 | Bacteria | 9031815 |
| 1430 | 2513551472 | 2513237082 | Bacteria | 8640282 |
| 1431 | 2513560122 | 2513237083 | Bacteria | 8410967 |
| 1432 | 2513627858 | 2513237092 | Bacteria | 8341956 |
| 1433 | 2513650686 | 2513237095 | Bacteria | 8976980 |
| 1434 | 2513661776 | 2513237096 | Bacteria | 8722461 |
| 1435 | 2513672608 | 2513237098 | Bacteria | 9902361 |
| 1436 | 2513715802 | 2513237104 | Bacteria | 10034502 |
| 1437 | 2513856985 | 2513237137 | Bacteria | 9558895 |
| 1438 | 2513877823 | 2513237139 | Bacteria | 8737671 |
| 1439 | 2513888252 | 2513237141 | Bacteria | 8496279 |
| 1440 | 2513923423 | 2513237145 | Bacteria | 8979722 |
| 1441 | 2513956978 | 2513237150 | Bacteria | 6553639 |
| 1442 | 2513963043 | 2513237151 | Bacteria | 6309801 |
| 1443 | 2514014974 | 2513237161 | Bacteria | 8871253 |
| 1444 | 2514043142 | 2513237165 | Bacteria | 6771773 |
| 1445 | 2514046188 | 2513237166 | Bacteria | 10373764 |
| 1446 | 2515630243 | 2515154112 | Bacteria | 8294334 |
| 1447 | 2515682520 | 2515154122 | Bacteria | 8609520 |
| 1448 | 2515688740 | 2515154123 | Bacteria | 6387382 |
| 1449 | 2516016879 | 2515154189 | Bacteria | 9629850 |
| 1450 | 2517106869 | 2517093001 | Bacteria | 9002274 |
| 1451 | 2517891195 | 2517572143 | Bacteria | 9484767 |
| 1452 | 2519457789 | 2519103095 | Bacteria | 6629912 |
| 1453 | 2521560464 | 2521172590 | Bacteria | 5047645 |
| 1454 | 2524437054 | 2524023205 | Bacteria | 8918781 |
| 1455 | 2524468792 | 2524023210 | Bacteria | 9029266 |
| 1456 | 2524533618 | 2524023228 | Bacteria | 10118060 |
| 1457 | 2527080649 | 2526164713 | Bacteria | 6780608 |
| 1458 | 2528856325 | 2528768022 | Bacteria | 10457665 |
| 1459 | 2550694140 | 2548876994 | Bacteria | 4904866 |
| 1460 | 2552746373 | 2551306352 | Bacteria | 3873115 |
| 1461 | 2553005585 | 2551306416 | Bacteria | 6152985 |
| 1462 | 2554812470 | 2554235132 | Bacteria | 6772433 |
| 1463 | 2555248218 | 2554235231 | Bacteria | 5215788 |
| 1464 | 2555672264 | 2554235341 | Bacteria | 6867980 |
| 1465 | 2563061803 | 2562617112 | Bacteria | 10918404 |
| 1466 | 2583792770 | 2582580891 | Bacteria | 6800976 |
| 1467 | 2583794769 | 2582580891 | Bacteria | 6800976 |
| 1468 | 2585294525 | 2582581311 | Bacteria | 6763856 |
| 1469 | 2596373449 | 2595698237 | Bacteria | 6712432 |
| 1470 | 2597032383 | 2596583598 | Bacteria | 5251611 |
| 1471 | 2597860343 | 2597489887 | Bacteria | 6666321 |
| 1472 | 2597863619 | 2597489888 | Bacteria | 6179543 |
| 1473 | 2597869579 | 2597489889 | Bacteria | 6297495 |
| 1474 | 2599358300 | 2599185160 | Bacteria | 6844013 |
| 1475 | 2599364649 | 2599185161 | Bacteria | 6960462 |
| 1476 | 2599370815 | 2599185162 | Bacteria | 6957254 |
| 1477 | 2599376837 | 2599185163 | Bacteria | 6995158 |
| 1478 | 2599383465 | 2599185164 | Bacteria | 6841688 |
| 1479 | 2599389912 | 2599185165 | Bacteria | 6843250 |
| 1480 | 2599396195 | 2599185166 | Bacteria | 6959206 |
| 1481 | 2599398609 | 2599185167 | Bacteria | 6353609 |
| 1482 | 2599408035 | 2599185168 | Bacteria | 6997636 |
| 1483 | 2599448469 | 2599185178 | Bacteria | 5365746 |
| 1484 | 2599450663 | 2599185179 | Bacteria | 6611171 |
| 1485 | 2599465115 | 2599185181 | Bacteria | 6844519 |
| 1486 | 2599471424 | 2599185182 | Bacteria | 6883168 |
| 1487 | 2599486815 | 2599185185 | Bacteria | 6652270 |
| 1488 | 2599487013 | 2599185185 | Bacteria | 6652270 |
| 1489 | 2599493970 | 2599185186 | Bacteria | 6831633 |
| 1490 | 2599505355 | 2599185188 | Bacteria | 6164180 |
| 1491 | 2599507090 | 2599185189 | Bacteria | 5862825 |
| 1492 | 2599513097 | 2599185190 | Bacteria | 6285678 |
| 1493 | 2599520786 | 2599185191 | Bacteria | 6297582 |
| 1494 | 2599736919 | 2599185239 | Bacteria | 8686614 |
| 1495 | 2599742968 | 2599185240 | Bacteria | 7968121 |
| 1496 | 2599807061 | 2599185257 | Bacteria | 6492581 |
| 1497 | 2599880251 | 2599185288 | Bacteria | 6666191 |
| 1498 | 2599891774 | 2599185290 | Bacteria | 6289611 |
| 1499 | 2599934533 | 2599185300 | Bacteria | 6062622 |
| 1500 | 2599947038 | 2599185303 | Bacteria | 6512725 |
| 1501 | 2599997666 | 2599185311 | Bacteria | 6354990 |
| 1502 | 2600196576 | 2599185352 | Bacteria | 7228948 |
| 1503 | 2600205086 | 2599185355 | Bacteria | 7968906 |
| 1504 | 2600217849 | 2599185356 | Bacteria | 6843884 |
| 1505 | 2600367143 | 2600254931 | Bacteria | 6734225 |
| 1506 | 2600813689 | 2600255067 | Bacteria | 6795583 |
| 1507 | 2601691721 | 2600255296 | Bacteria | 5784754 |
| 1508 | 2601778016 | 2600255313 | Bacteria | 6842543 |
| 1509 | 2601800442 | 2600255318 | Bacteria | 6383414 |
| 1510 | 2603860738 | 2602042107 | Bacteria | 6226103 |
| 1511 | 2606078750 | 2603880185 | Bacteria | 6379190 |
| 1512 | 2606125590 | 2603880199 | Bacteria | 6377649 |
| 1513 | 2608384783 | 2606217733 | Bacteria | 6360972 |
| 1514 | 2617352646 | 2617270735 | Bacteria | 9163226 |
| 1515 | 2621300109 | 2619619299 | Bacteria | 6649820 |
| 1516 | 2624482857 | 2623620443 | Bacteria | 6427864 |
| 1517 | 2624494398 | 2623620446 | Bacteria | 6500345 |
| 1518 | 2640733327 | 2639762793 | Bacteria | 3943681 |
| 1519 | 2643870462 | 2643221571 | Bacteria | 6228673 |
| 1520 | 2643957544 | 2643221589 | Bacteria | 6250934 |
| 1521 | 2644025658 | 2643221602 | Bacteria | 6249926 |
| 1522 | 2644187769 | 2643221633 | Bacteria | 6733554 |
| 1523 | 2644286016 | 2643221650 | Bacteria | 7029547 |
| 1524 | 2644620945 | 2643221713 | Bacteria | 6554480 |
| 1525 | 2652546489 | 2651869719 | Bacteria | 6047974 |
| 1526 | 2671100821 | 2667528171 | Bacteria | 6900659 |
| 1527 | 2671123198 | 2667528175 | Bacteria | 7532676 |
| 1528 | 2671773381 | 2671180172 | Bacteria | 6495783 |
| 1529 | 2676742075 | 2675903129 | Bacteria | 7964495 |
| 1530 | 2677896142 | 2675903420 | Bacteria | 6247433 |
| 1531 | 2678230358 | 2675903507 | Bacteria | 3737791 |
| 1532 | 2678265435 | 2675903515 | Bacteria | 6580491 |
| 1533 | 2713478362 | 2711768613 | Bacteria | 11048459 |
| 1534 | 2715752293 | 2713897148 | Bacteria | 5883533 |
| 1535 | 2715759032 | 2713897149 | Bacteria | 6506249 |
| 1536 | 2718636071 | 2718217725 | Bacteria | 5758958 |
| 1537 | 2719641431 | 2718217991 | Bacteria | 7829542 |
| 1538 | 2723248548 | 2721755607 | Bacteria | 5841722 |
| 1539 | 2723876852 | 2721755763 | Bacteria | 4464185 |
| 1540 | 2728755563 | 2728368998 | Bacteria | 8720350 |
| 1541 | 2738670118 | 2738541265 | Bacteria | 6594665 |
| 1542 | 2738747478 | 2738541281 | Bacteria | 5112672 |
| 1543 | 2738748511 | 2738541282 | Bacteria | 6593925 |
| 1544 | 2738806472 | 2738541294 | Bacteria | 6925949 |
| 1545 | 2738821679 | 2738541296 | Bacteria | 7285013 |
| 1546 | 2738834161 | 2738541298 | Bacteria | 7286732 |
| 1547 | 2738857553 | 2738541303 | Bacteria | 6591772 |
| 1548 | 2738875365 | 2738541306 | Bacteria | 7284992 |
| 1549 | 2738893832 | 2738541309 | Bacteria | 6926455 |
| 1550 | 2739187318 | 2738543002 | Bacteria | 7284546 |
| 1551 | 2739198203 | 2738543004 | Bacteria | 6381073 |
| 1552 | 2739221963 | 2738543008 | Bacteria | 7282815 |
| 1553 | 2739260967 | 2738543015 | Bacteria | 6750701 |
| 1554 | 2739316604 | 2738543025 | Bacteria | 6600348 |
| 1555 | 2739356760 | 2738543032 | Bacteria | 5115625 |
| 1556 | 2743739885 | 2740892503 | Bacteria | 6855563 |
| 1557 | 2745005889 | 2744054620 | Bacteria | 6551379 |
| 1558 | 2745076265 | 2744054633 | Bacteria | 8678936 |
| 1559 | 2746088626 | 2744054900 | Bacteria | 8399525 |
| 1560 | 2746092665 | 2744054901 | Bacteria | 8397047 |
| 1561 | 2753569568 | 2751185846 | Bacteria | 7242164 |
| 1562 | 2765568384 | 2765235838 | Bacteria | 5445269 |
| 1563 | 2765585051 | 2765235841 | Bacteria | 6137024 |
| 1564 | 2774121769 | 2773857670 | Bacteria | 6407454 |
| 1565 | 2774137010 | 2773857673 | Bacteria | 6513460 |
| 1566 | 2774389083 | 2773857761 | Bacteria | 3837365 |
| 1567 | 2774439282 | 2773857770 | Bacteria | 3911866 |
| 1568 | 2784262363 | 2784132063 | Bacteria | 6262788 |
| 1569 | 2784314432 | 2784132072 | Bacteria | 6596533 |
| 1570 | 2792835730 | 2791355137 | Bacteria | 9654227 |
| 1571 | 2793066538 | 2791355197 | Bacteria | 8420563 |
| 1572 | 2793076444 | |||
| 1573 | 2794598424 | 2791355520 | Bacteria | 5948615 |
| 1574 | 2805917048 | 2802429603 | Bacteria | 8777136 |
| 1575 | 2807409124 | 2806310737 | Bacteria | 5751088 |
| 1576 | 2807457460 | 2806310745 | Bacteria | 5742165 |
| 1577 | 2808857989 | 2808606361 | Bacteria | 6136259 |
| 1578 | 2808926603 | 2808606376 | Bacteria | 6248667 |
| 1579 | 2808930823 | 2808606377 | Bacteria | 6646337 |
| 1580 | 2808937483 | 2808606378 | Bacteria | 6177535 |
| 1581 | 2808948764 | 2808606380 | Bacteria | 6248705 |
| 1582 | 2808952945 | 2808606381 | Bacteria | 6646461 |
| 1583 | 2808959275 | 2808606382 | Bacteria | 6841132 |
| 1584 | 2808966474 | 2808606383 | Bacteria | 6138645 |
| 1585 | 2808971679 | 2808606384 | Bacteria | 8474373 |
| 1586 | 2808978809 | 2808606385 | Bacteria | 6711065 |
| 1587 | 2808994541 | 2808606388 | Bacteria | 6706662 |
| 1588 | 2809001357 | 2808606389 | Bacteria | 6138126 |
| 1589 | 2809006508 | 2808606390 | Bacteria | 8476311 |
| 1590 | 2809013574 | 2808606391 | Bacteria | 8308166 |
| 1591 | 2809219320 | 2808606445 | Bacteria | 6057339 |
| 1592 | 2812365946 | 2811994881 | Bacteria | 6298475 |
| 1593 | 2817259975 | 2816332253 | Bacteria | 6764532 |
| 1594 | 2817277638 | 2816332256 | Bacteria | 6891714 |
| 1595 | 2817456949 | 2816332286 | Bacteria | 6853759 |
| 1596 | 2817491456 | 2816332298 | Bacteria | 6852809 |
| 1597 | 2818242545 | 2816332527 | Bacteria | 8933356 |
| 1598 | 2819545352 | 2818991436 | Bacteria | 5376622 |
| 1599 | 2819591891 | 2818991445 | Bacteria | 4955017 |
| 1600 | 2819617133 | 2818991449 | Bacteria | 5518009 |
| 1601 | 2819632420 | 2818991452 | Bacteria | 8442785 |
| 1602 | 2819659149 | 2818991456 | Bacteria | 6123676 |
| 1603 | 2819706489 | 2818991464 | Bacteria | 6907494 |
| 1604 | 2823421333 | 2823421272 | Bacteria | 5372474 |
| 1605 | 2824662494 | 2824661429 | Bacteria | 9877870 |
| 1606 | 2824675296 | 2824671348 | Bacteria | 8369588 |
| 1607 | 2824681171 | 2824679649 | Bacteria | 8248951 |
| 1608 | 2824691529 | 2824687955 | Bacteria | 8360029 |
| 1609 | 2824697389 | 2824696289 | Bacteria | 8335049 |
| 1610 | 2824705587 | 2824704595 | Bacteria | 9667483 |
| 1611 | 2824756315 | 2824753945 | Bacteria | 9787441 |
| 1612 | 2824763999 | 2824763712 | Bacteria | 9792355 |
| 1613 | 2824780255 | 2824773399 | Bacteria | 8360218 |
| 1614 | 2825655671 | 2825651385 | Bacteria | 6715909 |
| 1615 | 2829750805 | 2829745981 | Bacteria | 5406054 |
| 1616 | 2834033508 | 2834028612 | Bacteria | 6354979 |
| 1617 | 2834643852 | 2834641062 | Bacteria | 5559922 |
| 1618 | 2838125323 | 2838122688 | Bacteria | 8803140 |
| 1619 | 2839094729 | 2839094727 | Bacteria | 5534556 |
| 1620 | 2841942024 | 2841941048 | Bacteria | 8688029 |
| 1621 | 2841951436 | 2841949485 | Bacteria | 8680857 |
| 1622 | 2841958886 | 2841957949 | Bacteria | 8652217 |
| 1623 | 2841968549 | 2841966195 | Bacteria | 8673214 |
| 1624 | 2841976250 | 2841974524 | Bacteria | 8931498 |
| 1625 | 2841987615 | 2841983080 | Bacteria | 8395090 |
| 1626 | 2842324598 | 2842324504 | Bacteria | 9364110 |
| 1627 | 2842348877 | 2842348783 | Bacteria | 9002918 |
| 1628 | 2842457417 | 2842454564 | Bacteria | 8730687 |
| 1629 | 2842701310 | 2842698319 | Bacteria | 5190321 |
| 1630 | 2842827179 | 2842826826 | Bacteria | 5974129 |
| 1631 | 2842837009 | 2842832357 | Bacteria | 5959113 |
| 1632 | 2842843270 | 2842837860 | Bacteria | 6066181 |
| 1633 | 2842847748 | 2842843487 | Bacteria | 6004777 |
| 1634 | 2844666436 | 2844665904 | Bacteria | 6817974 |
| 1635 | 2847944618 | 2847939898 | Bacteria | 8606328 |
| 1636 | 2849081147 | 2849076700 | Bacteria | 7039503 |
| 1637 | 2852614196 | 2852612431 | Bacteria | 6885235 |
| 1638 | 2852660982 | 2852657418 | Bacteria | 6472974 |
| 1639 | 2852668067 | 2852667396 | Bacteria | 6885555 |
| 1640 | 2857524823 | 2857524615 | Bacteria | 6615449 |
| 1641 | 2858697851 | 2858688981 | Bacteria | 8184122 |
| 1642 | 2860343842 | 2860339153 | Bacteria | 6846989 |
| 1643 | 2860870355 | 2860867994 | Bacteria | 5645326 |
| 1644 | 2861694362 | 2861691609 | Bacteria | 5628931 |
| 1645 | 2863421460 | 2863421361 | Bacteria | 7300805 |
| 1646 | 2870069115 | 2870068957 | Bacteria | 8925310 |
| 1647 | 2874634662 | 2874628541 | Bacteria | 8630250 |
| 1648 | 2874649980 | 2874645413 | Bacteria | 8214782 |
| 1649 | 2876775494 | 2876771140 | Bacteria | 8287509 |
| 1650 | 2876826154 | 2876818435 | Bacteria | 8274608 |
| 1651 | 2878034790 | 2878029506 | Bacteria | 6418441 |
| 1652 | 2879079419 | 2879074833 | Bacteria | 8279565 |
| 1653 | 2879109696 | 2879099564 | Bacteria | 10442239 |
| 1654 | 2880235439 | 2880230671 | Bacteria | 6140320 |
| 1655 | 2881667671 | 2881665667 | Bacteria | 8175609 |
| 1656 | 2883094639 | 2883087390 | Bacteria | 9532701 |
| 1657 | 2884816851 | 2884811622 | Bacteria | 5552861 |
| 1658 | 2884837720 | 2884836552 | Bacteria | 5219991 |
| 1659 | 2884854012 | 2884852848 | Bacteria | 5221161 |
| 1660 | 2885268788 | 2885266251 | Bacteria | 4796748 |
| 1661 | 2885279763 | 2885270888 | Bacteria | 9831543 |
| 1662 | 2885382926 | 2885374607 | Bacteria | 8927485 |
| 1663 | 2888381938 | 2888378607 | Bacteria | 9652610 |
| 1664 | 2888388706 | 2888388044 | Bacteria | 7304136 |
| 1665 | 2889310086 | 2889306138 | Bacteria | 6358934 |
| 1666 | 2893069337 | 2893066018 | Bacteria | 6158120 |
| 1667 | 2896154871 | 2896154374 | Bacteria | 5221518 |
| 1668 | 2900637315 | 2900634093 | Bacteria | 10263517 |
| 1669 | 2901310331 | 2901300506 | Bacteria | 8463898 |
| 1670 | 2902335314 | 2902330777 | Bacteria | 6395352 |
| 1671 | 2902691213 | 2902682994 | Bacteria | 8951596 |
| 1672 | 2903749683 | 2903748898 | Bacteria | 9972761 |
| 1673 | 2903768483 | 2903768456 | Bacteria | 9749579 |
| 1674 | 2904425814 | 2904424332 | Bacteria | 7633521 |
| 1675 | 2904442763 | 2904439833 | Bacteria | 5931679 |
| 1676 | 2904522997 | 2904518522 | Bacteria | 6068986 |
| 1677 | 2904535024 | 2904530477 | Bacteria | 5876334 |
| 1678 | 2904555906 | 2904550169 | Bacteria | 6221258 |
| 1679 | 2904565638 | 2904564687 | Bacteria | 7609577 |
| 1680 | 2904572681 | 2904571731 | Bacteria | 7608790 |
| 1681 | 2904588638 | 2904584206 | Bacteria | 6028872 |
| 1682 | 2904594288 | 2904589729 | Bacteria | 6113573 |
| 1683 | 2904604870 | 2904601388 | Bacteria | 5884906 |
| 1684 | 2904618979 | 2904615490 | Bacteria | 10047340 |
| 1685 | 2904698894 | 2904690495 | Bacteria | 9412302 |
| 1686 | 2904701082 | |||
| 1687 | 2904720417 | 2904711408 | Bacteria | 9771557 |
| 1688 | 2906616379 | |||
| 1689 | 2906630520 | 2906626472 | Bacteria | 8826946 |
| 1690 | 2906638167 | 2906635258 | Bacteria | 8601019 |
| 1691 | 2906648302 | 2906643746 | Bacteria | 8722424 |
| 1692 | 2906662842 | 2906660503 | Bacteria | 8595048 |
| 1693 | 2908449357 | 2908446538 | Bacteria | 6829095 |
| 1694 | 2908741515 | 2908739725 | Bacteria | 8628932 |
| 1695 | 2908758690 | 2908756301 | Bacteria | 8864324 |
| 1696 | 2909044301 | 2909042592 | Bacteria | 6499737 |
| 1697 | 2912967314 | 2912963787 | Bacteria | 5646108 |
| 1698 | 2913041983 | 2913036834 | Bacteria | 6704877 |
| 1699 | 2917076145 | 2917070673 | Bacteria | 6868303 |
| 1700 | 2919067828 | 2919063839 | Bacteria | 6302690 |
| 1701 | 2919078709 | 2919073203 | Bacteria | 6531949 |
| 1702 | 2919083108 | 2919079590 | Bacteria | 5946433 |
| 1703 | 2919156997 | 2919155634 | Bacteria | 4860545 |
| 1704 | 2919185346 | 2919182534 | Bacteria | 3907101 |
| 1705 | 2919390716 | 2919385768 | Bacteria | 5897293 |
| 1706 | 2919461788 | 2919456309 | Bacteria | 6586567 |
| 1707 | 2919490995 | 2919487758 | Bacteria | 5929766 |
| 1708 | 2919502954 | 2919501602 | Bacteria | 5286340 |
| 1709 | 2919701501 | 2919697872 | Bacteria | 6553725 |
| 1710 | 2921651754 | 2921643360 | Bacteria | 11448031 |
| 1711 | 2922371887 | |||
| 1712 | 2922399395 | 2922393267 | Bacteria | 8285685 |
| 1713 | 2922431625 | |||
| 1714 | 2923158975 | 2923153595 | Bacteria | 6870622 |
| 1715 | 2923514254 | 2923510766 | Bacteria | 5926163 |
| 1716 | 2923519967 | 2923519811 | Bacteria | 6298479 |
| 1717 | 2923592039 | 2923586266 | Bacteria | 6565975 |
| 1718 | 2926064627 | 2926063275 | Bacteria | 5285848 |
| 1719 | 2928060545 | 2928058823 | Bacteria | 5520022 |
| 1720 | 2928113569 | 2928108538 | Bacteria | 7360024 |
| 1721 | 2928127025 | 2928125067 | Bacteria | 5937560 |
| 1722 | 2928132965 | 2928130867 | Bacteria | 5467269 |
| 1723 | 2928140718 | 2928135762 | Bacteria | 7259641 |
| 1724 | 2928159957 | 2928157003 | Bacteria | 7522202 |
| 1725 | 2928164002 | 2928163908 | Bacteria | 7561269 |
| 1726 | 2928177132 | 2928170801 | Bacteria | 8785406 |
| 1727 | 2928506165 | 2928503688 | Bacteria | 7268108 |
| 1728 | 2928538796 | 2928536128 | Bacteria | 7657547 |
| 1729 | 2929149362 | 2929144301 | Bacteria | 6622272 |
| 1730 | 2929192855 | 2929189879 | Bacteria | 5930554 |
| 1731 | 2929616762 | 2929615660 | Bacteria | 9193770 |
| 1732 | 2929625506 | 2929624759 | Bacteria | 9339455 |
| 1733 | 2931373221 | 2931369376 | Bacteria | 6847892 |
| 1734 | 2931393647 | 2931390751 | Bacteria | 6273349 |
| 1735 | 2931397512 | 2931396565 | Bacteria | 7251677 |
| 1736 | 2932791215 | 2932784394 | Bacteria | 9704911 |
| 1737 | 2932799262 | 2932794094 | Bacteria | 7915132 |
| 1738 | 2932803743 | 2932801729 | Bacteria | 7987968 |
| 1739 | 2932811602 | 2932809354 | Bacteria | 9135765 |
| 1740 | 2932826481 | 2932818245 | Bacteria | 9955613 |
| 1741 | 2932834173 | 2932828146 | Bacteria | 9745859 |
| 1742 | 2933577955 | 2933577622 | Bacteria | 9116884 |
| 1743 | 2935359569 | 2935353572 | Unclassified | 6955622 |
| 1744 | 2935610601 | 2935608549 | Bacteria | 8203142 |
| 1745 | 2935624003 | 2935616580 | Bacteria | 9032984 |
| 1746 | 2935635821 | 2935630451 | Bacteria | 8169952 |
| 1747 | 2935647049 | 2935638405 | Bacteria | 10015038 |
| 1748 | 2935656209 | 2935648319 | Bacteria | 8801166 |
| 1749 | 2935665081 | 2935656913 | Bacteria | 8965014 |
| 1750 | 2935674259 | 2935665750 | Bacteria | 9571747 |
| 1751 | 2935682431 | 2935675223 | Bacteria | 9928132 |
| 1752 | 2935691646 | 2935684952 | Bacteria | 9590419 |
| 1753 | 2935699520 | 2935694250 | Bacteria | 9291695 |
| 1754 | 2935707749 | 2935703347 | Bacteria | 10242284 |
| 1755 | 2935719480 | 2935713505 | Bacteria | 9608509 |
| 1756 | 2935728920 | 2935722832 | Bacteria | 9608746 |
| 1757 | 2935737839 | 2935732158 | Bacteria | 9706831 |
| 1758 | 2935747215 | 2935741537 | Bacteria | 9707219 |
| 1759 | 2935757985 | 2935750917 | Bacteria | 9590372 |
| 1760 | 2935766623 | 2935760218 | Bacteria | 9817913 |
| 1761 | 2935770613 | 2935769743 | Bacteria | 7878163 |
| 1762 | 2935787102 | 2935785616 | Bacteria | 7962367 |
| 1763 | 2935795150 | 2935793552 | Bacteria | 8012592 |
| 1764 | 2935809496 | 2935801545 | Bacteria | 9301974 |
| 1765 | 2935817745 | 2935810662 | Bacteria | 9401221 |
| 1766 | 2935820098 | 2935819856 | Bacteria | 8261050 |
| 1767 | 2935836316 | 2935827899 | Bacteria | 10038562 |
| 1768 | 2935845227 | 2935837841 | Bacteria | 9454360 |
| 1769 | 2935849891 | 2935847175 | Bacteria | 8228321 |
| 1770 | 2935862147 | 2935855204 | Bacteria | 9035059 |
| 1771 | 2935870926 | 2935864058 | Bacteria | 9784707 |
| 1772 | 2935881319 | 2935873716 | Bacteria | 9632195 |
| 1773 | 2935884379 | 2935883170 | Bacteria | 7964738 |
| 1774 | 2935914421 | 2935908558 | Bacteria | 8568796 |
| 1775 | 2935918971 | 2935916978 | Bacteria | 9113783 |
| 1776 | 2935932198 | 2935926038 | Bacteria | 8601059 |
| 1777 | 2935940796 | 2935934488 | Bacteria | 8602579 |
| 1778 | 2935948617 | 2935942939 | Bacteria | 8599779 |
| 1779 | 2935957276 | 2935951376 | Bacteria | 8602333 |
| 1780 | 2935963705 | 2935959822 | Bacteria | 7869783 |
| 1781 | 2935973752 | 2935967501 | Bacteria | 8603075 |
| 1782 | 2935979591 | 2935975950 | Bacteria | 8347125 |
| 1783 | 2935991446 | 2935984226 | Bacteria | 8302647 |
| 1784 | 2936001066 | 2935992306 | Bacteria | 9802711 |
| 1785 | 2936005507 | 2936002035 | Bacteria | 9362176 |
| 1786 | 2936019051 | 2936011229 | Bacteria | 8801034 |
| 1787 | 2936023156 | 2936019824 | Bacteria | 8804134 |
| 1788 | 2936032391 | 2936028420 | Bacteria | 8965941 |
| 1789 | 2936042038 | 2936037263 | Bacteria | 9446081 |
| 1790 | 2936050252 | 2936046547 | Bacteria | 8903709 |
| 1791 | 2936061040 | 2936055302 | Bacteria | 8785755 |
| 1792 | 2939641782 | 2939636861 | Bacteria | 6297853 |
| 1793 | 2939654813 | 2939651529 | Bacteria | 5895393 |
| 1794 | 2940564104 | 2940556831 | Bacteria | 9590747 |
| 1795 | 2941512342 | 2941507105 | Bacteria | 8166816 |
| 1796 | 2941520153 | 2941515067 | Bacteria | 8166720 |
| 1797 | 2941528302 | 2941523033 | Bacteria | 8169134 |
| 1798 | 2941535088 | 2941531003 | Bacteria | 7653939 |
| 1799 | 2941545554 | 2941538514 | Bacteria | 9402094 |
| 1800 | 2945933193 | 2945928738 | Bacteria | 6053221 |
| 1801 | 2945938132 | 2945934425 | Bacteria | 7444609 |
| 1802 | 2945964169 | 2945961074 | Bacteria | 7342064 |
| 1803 | 2946009422 | 2946006987 | Bacteria | 6705746 |
| 1804 | 2946030598 | 2946027586 | Bacteria | 6049274 |
| 1805 | 2947238085 | 2947233263 | Bacteria | 6439278 |
| 1806 | 2954768657 | 2954767861 | Bacteria | 5535784 |
| 1807 | 2969309608 | 2969304461 | Bacteria | 6601805 |
| 1808 | 2974294659 | 2974289157 | Bacteria | 6080362 |
| 1809 | 2981994395 | 2981990288 | Bacteria | 7590678 |
| 1810 | 2984287193 | 2984286254 | Bacteria | 6702062 |
| 1811 | 2984288840 | 2984286254 | Bacteria | 6702062 |
| 1812 | 2988730907 | 2988728565 | Bacteria | 6124362 |
| 1813 | 2989350406 | 2989349275 | Bacteria | 6349068 |
| 1814 | 2990705151 | 2990703756 | Bacteria | 7715990 |
| 1815 | 2998144859 | 2998139840 | Bacteria | 6073514 |
| 1816 | 3005481420 | 3005474847 | Bacteria | 9259049 |
| 1817 | 3005596954 | 3005594810 | Bacteria | 8716512 |
| 1818 | 3005712985 | 3005710791 | Bacteria | 7622528 |
| 1819 | 3007398599 | 3007395558 | Bacteria | 6755444 |
| 1820 | 3007420403 | 3007419365 | Bacteria | 7026924 |
| 1821 | 3007615237 | 3007614139 | Bacteria | 6053559 |
| 1822 | 3007722248 | 3007718800 | Bacteria | 5971527 |
| 1823 | 3007805579 | 3007803356 | Bacteria | 5931491 |
| 1824 | 3007860066 | 3007855910 | Bacteria | 5637581 |
| 1825 | 3007866316 | 3007861166 | Bacteria | 6045338 |
| 1826 | 3007875826 | 3007872151 | Bacteria | 5268868 |
| 1827 | 637322682 | 637000220 | Bacteria | 7074893 |
| 1828 | 641337799 | 641228493 | Bacteria | 3999591 |
| 1829 | 642426204 | 641736151 | Bacteria | 7477263 |
| 1830 | 642418069 | 641736154 | Bacteria | 7689995 |
| 1831 | 642594385 | 642555112 | Bacteria | 8676562 |
| 1832 | 642622962 | 642555113 | Bacteria | 8214658 |
| 1833 | 643392226 | 643348555 | Bacteria | 3914947 |
| 1834 | 644749367 | 644736347 | Bacteria | 6476522 |
| 1835 | 8002395155 | 8002392321 | Bacteria | 4159911 |
| 1836 | 8003404808 | 8003400568 | Bacteria | 5535898 |
| 1837 | 8003957387 | 8003955200 | Bacteria | 8601927 |
| 1838 | 8006978949 | 8006973647 | Bacteria | 10679141 |
| 1839 | 8006984758 | 8006984368 | Bacteria | 9651211 |
| 1840 | 8015691454 | 8015687852 | Bacteria | 6613826 |
| 1841 | 8015693061 | 8015687852 | Bacteria | 6613826 |
| 1842 | 8016515794 | 8016511872 | Bacteria | 9921665 |
| 1843 | 8016590007 | 8016583857 | Bacteria | 10421953 |
| 1844 | 8016633442 | 8016630954 | Bacteria | 9217207 |
| 1845 | 8017060710 | 8017057580 | Bacteria | 10023680 |
| 1846 | 8018850683 | 8018845410 | Bacteria | 8933938 |
| 1847 | 8019565157 | 8019555841 | Bacteria | 9642137 |
| 1848 | 8019575258 | 8019565922 | Bacteria | 9639779 |
| 1849 | 8019587945 | 8019586578 | Bacteria | 10212056 |
| 1850 | 8019603385 | 8019597564 | Bacteria | 10041141 |
| 1851 | 8019625695 | 8019619141 | Bacteria | 9218857 |
| 1852 | 8019636598 | 8019629233 | Bacteria | 8687553 |
| 1853 | 8019655918 | 8019648815 | Bacteria | 10014479 |
| 1854 | 8019664394 | 8019659431 | Bacteria | 8577854 |
| 1855 | 8019673988 | 8019668869 | Bacteria | 8791617 |
| 1856 | 8019682137 | 8019678201 | Bacteria | 8863603 |
| 1857 | 8019687915 | 8019687851 | Bacteria | 8712826 |
| 1858 | 8019771402 | 8019769354 | Bacteria | 6924660 |
| 1859 | 8019781882 | 8019775933 | Bacteria | 6858656 |
| 1860 | 8020808528 | 8020807995 | Bacteria | 6801506 |
| 1861 | 8020939546 | 8020938398 | Bacteria | 7472757 |
| 1862 | 8020947590 | 8020945358 | Bacteria | 8467355 |
| 1863 | 8020953868 | 8020953355 | Bacteria | 7439080 |
| 1864 | 8021126839 | 8021120328 | Bacteria | 8782274 |
| 1865 | 8029996036 | 8029995093 | Bacteria | 5990776 |
| 1866 | 8034965501 | 8034962539 | Bacteria | 4884839 |
| 1867 | 8039099099 | 8039098773 | Bacteria | 6602928 |
| 1868 | 8040170898 | 8040167225 | Bacteria | 6542727 |
| 1869 | 8040175189 | 8040173305 | Bacteria | 6827067 |
| 1870 | 8052496445 | 8052494512 | Bacteria | 5765634 |
| 1871 | 8054287003 | 8054285046 | Bacteria | 6919322 |
| 1872 | 8054352507 | 8054347763 | Bacteria | 5901107 |
| 1873 | 8054506606 | 8054503363 | Bacteria | 6101651 |
| 1874 | 8054932440 | 8054929484 | Bacteria | 5599761 |
| 1875 | 8055267438 | 8055266321 | Bacteria | 7999742 |
| 1876 | 8055748408 | 8055742211 | Bacteria | 9226248 |
| 1877 | 8055774627 | 8055770955 | Bacteria | 6827675 |
| 1878 | 8055776308 | 8055770955 | Bacteria | 6827675 |
| 1879 | 8055821390 | 8055817908 | Bacteria | 6609162 |
| 1880 | 8055882006 | 8055878733 | Bacteria | 5907058 |
| 1881 | 8056119491 | 8056115690 | Bacteria | 5527654 |
| 1882 | 8056122578 | 8056120720 | Bacteria | 5758328 |
| 1883 | 8056131072 | 8056125926 | Bacteria | 6228218 |
| 1884 | 8056134487 | 8056131705 | Bacteria | 6107031 |
| 1885 | 8056139304 | 8056137416 | Bacteria | 6147080 |
| 1886 | 8056154876 | 8056148874 | Bacteria | 6479865 |
| 1887 | 8056158178 | 8056155041 | Bacteria | 6486948 |
| 1888 | 8056165834 | 8056161164 | Bacteria | 6106669 |
| 1889 | 8056171709 | 8056166840 | Bacteria | 5820959 |
| 1890 | 8056172388 | 8056172158 | Bacteria | 6133900 |
| 1891 | 8056179134 | 8056177738 | Bacteria | 6748268 |
| 1892 | 8056571888 | 8056569372 | Bacteria | 5997322 |
| 1893 | 8056687265 | 8056681323 | Bacteria | 8472857 |
| 1894 | 8056690650 | 8056689827 | Bacteria | 6712655 |
| 1895 | 8056976201 | 8056967851 | Bacteria | 9038162 |
| 1896 | 8057805148 | 8057798959 | Bacteria | 6713499 |
| 1897 | Ga0207678_10020313 | |||
| 1898 | MRS2a_Contig_116 | |||
| 1899 | MRS2a_Contig_6751 | |||
| 1900 | JGI24741J21665_1000205 | |||
| 1901 | JGI24740J21852_10000417 | |||
| 1902 | JGI24740J21852_10000439 | |||
| 1903 | JGI24740J21852_10000760 | |||
| 1904 | JGI24740J21852_10015327 | |||
| 1905 | JGI24739J22299_10002573 | |||
| 1906 | JGI24739J22299_10038511 | |||
| 1907 | JGI24737J22298_10002427 | |||
| 1908 | JGI24737J22298_10012337 | |||
| 1909 | JGI24737J22298_10034108 | |||
| 1910 | JGI24735J21928_10000196 | |||
| 1911 | JGI24735J21928_10001455 | |||
| 1912 | JGI24735J21928_10003047 | |||
| 1913 | JGI24735J21928_10004296 | |||
| 1914 | JGI25156J39149_1003155 | |||
| 1915 | JGI25156J39149_1003951 | |||
| 1916 | JGI25156J39149_1010327 | |||
| 1917 | JGI25162J39368_1000502 | |||
| 1918 | JGI25162J39368_1000626 | |||
| 1919 | JGI25162J39368_1000664 | |||
| 1920 | JGI25154J39366_1000133 | |||
| 1921 | JGI25163J39215_1001643 | |||
| 1922 | JGI25163J39215_1002276 | |||
| 1923 | JGI25164J39214_1000340 | |||
| 1924 | JGI25164J39214_1000400 | |||
| 1925 | JGI25150J39212_1005748 | |||
| 1926 | JGI25151J46595_10004227 | |||
| 1927 | JGI25151J46595_10029166 | |||
| 1928 | JGI25165J46597_1000391 | |||
| 1929 | JGI25165J46597_1000745 | |||
| 1930 | JGI25165J46597_1000776 | |||
| 1931 | rootH1_10062200 | |||
| 1932 | JGI25160J50197_1000447 | |||
| 1933 | JGI25160J50197_1007409 | |||
| 1934 | Ga0006562J51391_1006335 | |||
| 1935 | Ga0055538_1000007 | |||
| 1936 | Ga0055538_1000024 | |||
| 1937 | Ga0055538_1000305 | |||
| 1938 | Ga0055539_1000011 | |||
| 1939 | Ga0055539_1000031 | |||
| 1940 | Ga0055539_1000073 | |||
| 1941 | Ga0055539_1000324 | |||
| 1942 | Ga0055533_1000014 | |||
| 1943 | Ga0055533_1000041 | |||
| 1944 | Ga0055533_1000305 | |||
| 1945 | Ga0055533_1002148 | |||
| 1946 | Ga0055533_1002294 | |||
| 1947 | Ga0055532_1000009 | |||
| 1948 | Ga0055532_1000090 | |||
| 1949 | Ga0055525_1000016 | |||
| 1950 | Ga0055525_1000049 | |||
| 1951 | Ga0055525_1000439 | |||
| 1952 | Ga0055525_1000938 | |||
| 1953 | Ga0055527_1000900 | |||
| 1954 | Ga0055535_1000085 | |||
| 1955 | Ga0055529_1000134 | |||
| 1956 | Ga0055526_1008653 | |||
| 1957 | Ga0055526_1009460 | |||
| 1958 | Ga0055526_1012176 | |||
| 1959 | Ga0055524_1000413 | |||
| 1960 | Ga0055536_1000059 | |||
| 1961 | Ga0055536_1000061 | |||
| 1962 | Ga0055536_1000154 | |||
| 1963 | Ga0055536_1002544 | |||
| 1964 | Ga0055536_1002620 | |||
| 1965 | Ga0055534_1001757 | |||
| 1966 | Ga0055534_1002165 | |||
| 1967 | Ga0055534_1006164 | |||
| 1968 | Ga0055528_1001944 | |||
| 1969 | Ga0055530_10000096 | |||
| 1970 | Ga0055530_10000171 | |||
| 1971 | Ga0055530_10000874 | |||
| 1972 | Ga0055530_10002302 | |||
| 1973 | Ga0055540_1000084 | |||
| 1974 | Ga0055540_1000214 | |||
| 1975 | Ga0055540_1000648 | |||
| 1976 | Ga0055540_1001741 | |||
| 1977 | Ga0055531_10000266 | |||
| 1978 | Ga0055541_1000008 | |||
| 1979 | Ga0055541_1000022 | |||
| 1980 | Ga0055541_1000213 | |||
| 1981 | Ga0055541_1000346 | |||
| 1982 | Ga0055541_1006842 | |||
| 1983 | Ga0058692_1000014 | |||
| 1984 | Ga0055543_1004552 | |||
| 1985 | Ga0065165_1000244 | |||
| 1986 | Ga0065165_1000368 | |||
| 1987 | Ga0065165_1001437 | |||
| 1988 | Ga0065714_10000085 | |||
| 1989 | Ga0065714_10005412 | |||
| 1990 | Ga0065714_10006886 | |||
| 1991 | Ga0065704_10018874 | |||
| 1992 | Ga0065704_10084484 | |||
| 1993 | Ga0065704_10091819 | |||
| 1994 | Ga0065704_10150193 | |||
| 1995 | Ga0070658_10017560 | |||
| 1996 | Ga0070658_10018393 | |||
| 1997 | Ga0070658_10092389 | |||
| 1998 | Ga0070658_10143166 | |||
| 1999 | Ga0070683_100138178 | |||
| 2000 | Ga0070670_100005474 | |||
| 2001 | Ga0070670_100145170 | |||
| 2002 | Ga0070666_10012949 | |||
| 2003 | Ga0070680_100019559 | |||
| 2004 | Ga0070660_100001445 | |||
| 2005 | Ga0070660_100001741 | |||
| 2006 | Ga0070660_100019883 | |||
| 2007 | Ga0070691_10027029 | |||
| 2008 | Ga0070661_100000683 | |||
| 2009 | Ga0070661_100000829 | |||
| 2010 | Ga0070668_100036478 | |||
| 2011 | Ga0070668_100055824 | |||
| 2012 | Ga0070669_100001270 | |||
| 2013 | Ga0070669_100006569 | |||
| 2014 | Ga0070669_100018381 | |||
| 2015 | Ga0070675_100139551 | |||
| 2016 | Ga0070659_100000035 | |||
| 2017 | Ga0070659_100001478 | |||
| 2018 | Ga0070667_100002744 | |||
| 2019 | Ga0070667_100019966 | |||
| 2020 | Ga0070667_100022517 | |||
| 2021 | Ga0070709_10000407 | |||
| 2022 | Ga0070709_10027331 | |||
| 2023 | Ga0070714_100185287 | |||
| 2024 | Ga0070714_100235201 | |||
| 2025 | Ga0070713_100047323 | |||
| 2026 | Ga0070713_100053812 | |||
| 2027 | Ga0070710_10006310 | |||
| 2028 | Ga0070710_10035406 | |||
| 2029 | Ga0070711_100006265 | |||
| 2030 | Ga0070663_100000251 | |||
| 2031 | Ga0070663_100003477 | |||
| 2032 | Ga0070663_100045511 | |||
| 2033 | Ga0070663_100160335 | |||
| 2034 | Ga0070678_100005891 | |||
| 2035 | Ga0070662_100116271 | |||
| 2036 | Ga0068867_100074043 | |||
| 2037 | Ga0070706_100074209 | |||
| 2038 | Ga0070698_100122056 | |||
| 2039 | Ga0070684_100048880 | |||
| 2040 | Ga0070697_100154854 | |||
| 2041 | Ga0068853_100034377 | |||
| 2042 | Ga0068853_100069502 | |||
| 2043 | Ga0070665_100007326 | |||
| 2044 | Ga0070665_100021701 | |||
| 2045 | Ga0068855_100000366 | |||
| 2046 | Ga0068855_100004438 | |||
| 2047 | Ga0068855_100024563 | |||
| 2048 | Ga0068855_100145412 | |||
| 2049 | Ga0068855_100159275 | |||
| 2050 | Ga0070664_100000623 | |||
| 2051 | Ga0070664_100000878 | |||
| 2052 | Ga0068857_100013415 | |||
| 2053 | Ga0068857_100024577 | |||
| 2054 | Ga0068857_100085485 | |||
| 2055 | Ga0068857_100101512 | |||
| 2056 | Ga0068857_100209200 | |||
| 2057 | Ga0068854_100000308 | |||
| 2058 | Ga0068854_100093960 | |||
| 2059 | Ga0068856_100001206 | |||
| 2060 | Ga0068856_100021342 | |||
| 2061 | Ga0068856_100069364 | |||
| 2062 | Ga0068856_100160460 | |||
| 2063 | Ga0068852_100017907 | |||
| 2064 | Ga0068852_100021423 | |||
| 2065 | Ga0068852_100054812 | |||
| 2066 | Ga0068859_100080918 | |||
| 2067 | Ga0068859_100334951 | |||
| 2068 | Ga0068851_10000316 | |||
| 2069 | Ga0068851_10019934 | |||
| 2070 | Ga0068863_100083044 | |||
| 2071 | Ga0068858_100240812 | |||
| 2072 | Ga0068860_100019238 | |||
| 2073 | Ga0081455_10010447 | |||
| 2074 | Ga0081455_10010813 | |||
| 2075 | Ga0081540_1003649 | |||
| 2076 | Ga0081540_1006563 | |||
| 2077 | Ga0081540_1032672 | |||
| 2078 | Ga0081540_1038988 | |||
| 2079 | Ga0081540_1055583 | |||
| 2080 | Ga0075365_10017044 | |||
| 2081 | Ga0075365_10033426 | |||
| 2082 | Ga0075368_10002670 | |||
| 2083 | Ga0075368_10032589 | |||
| 2084 | Ga0075363_100017395 | |||
| 2085 | Ga0075364_10041753 | |||
| 2086 | Ga0075364_10060885 | |||
| 2087 | Ga0075364_10132837 | |||
| 2088 | Ga0070715_10061041 | |||
| 2089 | Ga0070716_100007807 | |||
| 2090 | Ga0070716_100036500 | |||
| 2091 | Ga0070716_100043300 | |||
| 2092 | Ga0075362_10009652 | |||
| 2093 | Ga0075367_10039150 | |||
| 2094 | Ga0075367_10059488 | |||
| 2095 | Ga0075369_10039897 | |||
| 2096 | Ga0075366_10004392 | |||
| 2097 | Ga0075366_10012373 | |||
| 2098 | Ga0097621_100104136 | |||
| 2099 | Ga0075370_10008865 | |||
| 2100 | Ga0075370_10041818 | |||
| 2101 | Ga0068871_100070465 | |||
| 2102 | Ga0075430_100009079 | |||
| 2103 | Ga0075429_100011122 | |||
| 2104 | Ga0097620_100080913 | |||
| 2105 | Ga0097620_100334939 | |||
| 2106 | Ga0099824_1011829 | |||
| 2107 | Ga0099822_1005398 | |||
| 2108 | Ga0099823_1000091 | |||
| 2109 | Ga0079104_1000008 | |||
| 2110 | Ga0079104_1000707 | |||
| 2111 | Ga0079104_1003900 | |||
| 2112 | Ga0099826_10000022 | |||
| 2113 | Ga0099826_10013588 | |||
| 2114 | Ga0075435_100196129 | |||
| 2115 | Ga0105251_10000016 | |||
| 2116 | Ga0105251_10000756 | |||
| 2117 | Ga0105251_10001655 | |||
| 2118 | Ga0105251_10001720 | |||
| 2119 | Ga0105251_10007644 | |||
| 2120 | Ga0105251_10014969 | |||
| 2121 | Ga0105251_10031596 | |||
| 2122 | Ga0105251_10037622 | |||
| 2123 | Ga0105251_10055820 | |||
| 2124 | Ga0105251_10072451 | |||
| 2125 | Ga0105244_10000445 | |||
| 2126 | Ga0105244_10000722 | |||
| 2127 | Ga0105244_10000848 | |||
| 2128 | Ga0105244_10004788 | |||
| 2129 | Ga0105244_10005113 | |||
| 2130 | Ga0105244_10005282 | |||
| 2131 | Ga0105244_10007991 | |||
| 2132 | Ga0105244_10010257 | |||
| 2133 | Ga0105244_10022095 | |||
| 2134 | Ga0105244_10023508 | |||
| 2135 | Ga0105244_10032773 | |||
| 2136 | Ga0105244_10032791 | |||
| 2137 | Ga0105244_10050878 | |||
| 2138 | Ga0105250_10000327 | |||
| 2139 | Ga0105250_10000871 | |||
| 2140 | Ga0105250_10003137 | |||
| 2141 | Ga0105250_10004372 | |||
| 2142 | Ga0105250_10008745 | |||
| 2143 | Ga0105250_10051581 | |||
| 2144 | Ga0105250_10052821 | |||
| 2145 | Ga0105250_10068048 | |||
| 2146 | Ga0105240_10001168 | |||
| 2147 | Ga0105240_10007353 | |||
| 2148 | Ga0105240_10013962 | |||
| 2149 | Ga0105240_10019503 | |||
| 2150 | Ga0105240_10096984 | |||
| 2151 | Ga0105240_10146644 | |||
| 2152 | Ga0105240_10159931 | |||
| 2153 | Ga0105240_10276454 | |||
| 2154 | Ga0105245_10035213 | |||
| 2155 | Ga0105245_10122928 | |||
| 2156 | Ga0105247_10000727 | |||
| 2157 | Ga0105243_10000115 | |||
| 2158 | Ga0105243_10000163 | |||
| 2159 | Ga0105243_10001544 | |||
| 2160 | Ga0105243_10001757 | |||
| 2161 | Ga0105243_10001924 | |||
| 2162 | Ga0105243_10002556 | |||
| 2163 | Ga0105243_10025527 | |||
| 2164 | Ga0105243_10025925 | |||
| 2165 | Ga0105241_10006488 | |||
| 2166 | Ga0105241_10123341 | |||
| 2167 | Ga0105237_10000093 | |||
| 2168 | Ga0105237_10003198 | |||
| 2169 | Ga0105237_10006810 | |||
| 2170 | Ga0105237_10022053 | |||
| 2171 | Ga0105237_10025336 | |||
| 2172 | Ga0105237_10048393 | |||
| 2173 | Ga0105237_10104263 | |||
| 2174 | Ga0105237_10125223 | |||
| 2175 | Ga0105238_10000031 | |||
| 2176 | Ga0105238_10040672 | |||
| 2177 | Ga0105238_10053968 | |||
| 2178 | Ga0105238_10085629 | |||
| 2179 | Ga0105238_10123118 | |||
| 2180 | Ga0105238_10126943 | |||
| 2181 | Ga0105249_10022548 | |||
| 2182 | Ga0099796_10020287 | |||
| 2183 | Ga0105239_10001806 | |||
| 2184 | Ga0105239_10002893 | |||
| 2185 | Ga0105239_10024933 | |||
| 2186 | Ga0105239_10034894 | |||
| 2187 | Ga0105239_10042348 | |||
| 2188 | Ga0105239_10079968 | |||
| 2189 | Ga0105246_10001153 | |||
| 2190 | Ga0105246_10001933 | |||
| 2191 | Ga0105246_10029137 | |||
| 2192 | Ga0105246_10177467 | |||
| 2193 | Ga0157345_1000154 | |||
| 2194 | Ga0157345_1002204 | |||
| 2195 | Ga0157373_10005588 | |||
| 2196 | Ga0157373_10005943 | |||
| 2197 | Ga0157373_10006624 | |||
| 2198 | Ga0157373_10016497 | |||
| 2199 | Ga0157373_10021291 | |||
| 2200 | Ga0157373_10109989 | |||
| 2201 | Ga0157373_10112505 | |||
| 2202 | Ga0157371_10001237 | |||
| 2203 | Ga0157371_10009792 | |||
| 2204 | Ga0157371_10016290 | |||
| 2205 | Ga0157371_10023424 | |||
| 2206 | Ga0157371_10172865 | |||
| 2207 | Ga0157370_10000930 | |||
| 2208 | Ga0157370_10003240 | |||
| 2209 | Ga0157370_10019712 | |||
| 2210 | Ga0157370_10022770 | |||
| 2211 | Ga0157369_10000067 | |||
| 2212 | Ga0157369_10000622 | |||
| 2213 | Ga0157369_10004182 | |||
| 2214 | Ga0157369_10013986 | |||
| 2215 | Ga0157369_10030355 | |||
| 2216 | Ga0157369_10034300 | |||
| 2217 | Ga0157369_10056554 | |||
| 2218 | Ga0157369_10057580 | |||
| 2219 | Ga0157369_10065958 | |||
| 2220 | Ga0157369_10166955 | |||
| 2221 | Ga0157374_10000219 | |||
| 2222 | Ga0163162_10001053 | |||
| 2223 | Ga0163162_10001780 | |||
| 2224 | Ga0163162_10060633 | |||
| 2225 | Ga0157372_10001285 | |||
| 2226 | Ga0157372_10002581 | |||
| 2227 | Ga0157372_10011859 | |||
| 2228 | Ga0157372_10033148 | |||
| 2229 | Ga0157372_10054493 | |||
| 2230 | Ga0157375_10008932 | |||
| 2231 | Ga0157375_10333976 | |||
| 2232 | Ga0182008_10005238 | |||
| 2233 | Ga0182008_10006760 | |||
| 2234 | Ga0182008_10013195 | |||
| 2235 | Ga0182008_10017485 | |||
| 2236 | Ga0157376_10046771 | |||
| 2237 | Ga0182006_1001712 | |||
| 2238 | Ga0182006_1007656 | |||
| 2239 | Ga0182006_1009278 | |||
| 2240 | Ga0182006_1011378 | |||
| 2241 | Ga0182006_1012197 | |||
| 2242 | Ga0182006_1013028 | |||
| 2243 | Ga0182006_1016766 | |||
| 2244 | Ga0182006_1018078 | |||
| 2245 | Ga0182006_1018576 | |||
| 2246 | Ga0182006_1040422 | |||
| 2247 | Ga0182006_1041211 | |||
| 2248 | Ga0182007_10001412 | |||
| 2249 | Ga0182007_10019156 | |||
| 2250 | Ga0182005_1000500 | |||
| 2251 | Ga0182005_1004949 | |||
| 2252 | Ga0182005_1014535 | |||
| 2253 | Ga0182005_1021236 | |||
| 2254 | Ga0183362_10003 | |||
| 2255 | Ga0183361_10012 | |||
| 2256 | Ga0163161_10006169 | |||
| 2257 | Ga0163161_10047143 | |||
| 2258 | Ga0163161_10051253 | |||
| 2259 | Ga0163161_10210036 | |||
| 2260 | Ga0206351_10815903 | |||
| 2261 | Ga0154015_1153479 | |||
| 2262 | Ga0214542_1010499 | |||
| 2263 | Ga0214543_1000005 | |||
| 2264 | Ga0213875_10024758 | |||
| 2265 | Ga0224712_10000086 | |||
| 2266 | Ga0209435_100305 | |||
| 2267 | Ga0209760_100009 | |||
| 2268 | Ga0209760_100157 | |||
| 2269 | Ga0209760_100772 | |||
| 2270 | Ga0209784_100006 | |||
| 2271 | Ga0209784_100018 | |||
| 2272 | Ga0209784_100023 | |||
| 2273 | Ga0209784_100323 | |||
| 2274 | Ga0209784_100428 | |||
| 2275 | Ga0209566_100002 | |||
| 2276 | Ga0209566_100016 | |||
| 2277 | Ga0209566_100019 | |||
| 2278 | Ga0209566_100555 | |||
| 2279 | Ga0209566_100562 | |||
| 2280 | Ga0209566_100572 | |||
| 2281 | Ga0209674_100010 | |||
| 2282 | Ga0209674_100030 | |||
| 2283 | Ga0209674_100034 | |||
| 2284 | Ga0209674_100355 | |||
| 2285 | Ga0209674_100374 | |||
| 2286 | Ga0209674_101472 | |||
| 2287 | Ga0209674_103235 | |||
| 2288 | Ga0209672_100028 | |||
| 2289 | Ga0209672_100038 | |||
| 2290 | Ga0209672_100110 | |||
| 2291 | Ga0209672_100175 | |||
| 2292 | Ga0209672_100806 | |||
| 2293 | Ga0209147_100018 | |||
| 2294 | Ga0209147_100027 | |||
| 2295 | Ga0209147_100235 | |||
| 2296 | Ga0209147_100277 | |||
| 2297 | Ga0209147_100294 | |||
| 2298 | Ga0209563_100034 | |||
| 2299 | Ga0209563_100037 | |||
| 2300 | Ga0209563_100041 | |||
| 2301 | Ga0209563_100258 | |||
| 2302 | Ga0209563_101545 | |||
| 2303 | Ga0207427_100016 | |||
| 2304 | Ga0207427_100092 | |||
| 2305 | Ga0207427_101010 | |||
| 2306 | Ga0209437_100011 | |||
| 2307 | Ga0209437_100065 | |||
| 2308 | Ga0209437_100565 | |||
| 2309 | Ga0209437_109964 | |||
| 2310 | Ga0209258_100028 | |||
| 2311 | Ga0209258_100191 | |||
| 2312 | Ga0209258_100268 | |||
| 2313 | Ga0209258_100289 | |||
| 2314 | Ga0207425_1002758 | |||
| 2315 | Ga0209646_1000120 | |||
| 2316 | Ga0209646_1000153 | |||
| 2317 | Ga0209646_1002598 | |||
| 2318 | Ga0209026_1010400 | |||
| 2319 | Ga0209677_100007 | |||
| 2320 | Ga0209677_100019 | |||
| 2321 | Ga0209677_100021 | |||
| 2322 | Ga0209677_100438 | |||
| 2323 | Ga0209148_1000081 | |||
| 2324 | Ga0209148_1000224 | |||
| 2325 | Ga0209148_1000297 | |||
| 2326 | Ga0209148_1003390 | |||
| 2327 | Ga0209759_1000406 | |||
| 2328 | Ga0209759_1001683 | |||
| 2329 | Ga0209759_1011208 | |||
| 2330 | Ga0209233_1000019 | |||
| 2331 | Ga0209233_1000085 | |||
| 2332 | Ga0209233_1000483 | |||
| 2333 | Ga0209233_1013553 | |||
| 2334 | Ga0209565_1000257 | |||
| 2335 | Ga0209565_1000987 | |||
| 2336 | Ga0209455_1000050 | |||
| 2337 | Ga0209455_1000107 | |||
| 2338 | Ga0209455_1000879 | |||
| 2339 | Ga0209673_1000038 | |||
| 2340 | Ga0209675_1000302 | |||
| 2341 | Ga0209675_1000645 | |||
| 2342 | Ga0209675_1003576 | |||
| 2343 | Ga0209675_1007019 | |||
| 2344 | Ga0209675_1009151 | |||
| 2345 | Ga0209676_1000076 | |||
| 2346 | Ga0209676_1000147 | |||
| 2347 | Ga0209676_1000183 | |||
| 2348 | Ga0209676_1000264 | |||
| 2349 | Ga0209676_1000313 | |||
| 2350 | Ga0209676_1001123 | |||
| 2351 | Ga0209676_1001708 | |||
| 2352 | Ga0209676_1010886 | |||
| 2353 | Ga0209676_1020041 | |||
| 2354 | Ga0209025_1000229 | |||
| 2355 | Ga0209025_1000256 | |||
| 2356 | Ga0209025_1000508 | |||
| 2357 | Ga0209025_1000610 | |||
| 2358 | Ga0209025_1001636 | |||
| 2359 | Ga0209025_1004445 | |||
| 2360 | Ga0209564_1000310 | |||
| 2361 | Ga0209564_1001587 | |||
| 2362 | Ga0209564_1002607 | |||
| 2363 | Ga0209564_1003460 | |||
| 2364 | Ga0209564_1004695 | |||
| 2365 | Ga0209564_1011300 | |||
| 2366 | Ga0209758_1000423 | |||
| 2367 | Ga0209758_1003740 | |||
| 2368 | Ga0209758_1006087 | |||
| 2369 | Ga0209758_1008604 | |||
| 2370 | Ga0209758_1025788 | |||
| 2371 | Ga0209050_1000062 | |||
| 2372 | Ga0209050_1000063 | |||
| 2373 | Ga0209050_1000106 | |||
| 2374 | Ga0209050_1000701 | |||
| 2375 | Ga0209050_1002668 | |||
| 2376 | Ga0209256_1000248 | |||
| 2377 | Ga0209256_1000300 | |||
| 2378 | Ga0207426_1000037 | |||
| 2379 | Ga0207426_1000289 | |||
| 2380 | Ga0207426_1000312 | |||
| 2381 | Ga0207426_1004510 | |||
| 2382 | Ga0207426_1007390 | |||
| 2383 | Ga0209051_1000045 | |||
| 2384 | Ga0209051_1000139 | |||
| 2385 | Ga0209051_1000409 | |||
| 2386 | Ga0209051_1000499 | |||
| 2387 | Ga0209051_1006094 | |||
| 2388 | Ga0209257_1000539 | |||
| 2389 | Ga0209257_1009014 | |||
| 2390 | Ga0209257_1016143 | |||
| 2391 | Ga0207656_10003183 | |||
| 2392 | Ga0207696_1000023 | |||
| 2393 | Ga0207696_1000047 | |||
| 2394 | Ga0207696_1000091 | |||
| 2395 | Ga0207696_1002016 | |||
| 2396 | Ga0207696_1002515 | |||
| 2397 | Ga0207696_1013608 | |||
| 2398 | Ga0207696_1015388 | |||
| 2399 | Ga0207655_1000015 | |||
| 2400 | Ga0207655_1000118 | |||
| 2401 | Ga0207655_1000302 | |||
| 2402 | Ga0207655_1000327 | |||
| 2403 | Ga0207655_1000339 | |||
| 2404 | Ga0207655_1000658 | |||
| 2405 | Ga0207655_1001444 | |||
| 2406 | Ga0207655_1003450 | |||
| 2407 | Ga0207655_1003542 | |||
| 2408 | Ga0207655_1005682 | |||
| 2409 | Ga0207655_1009464 | |||
| 2410 | Ga0207655_1010065 | |||
| 2411 | Ga0207655_1014108 | |||
| 2412 | Ga0207655_1014236 | |||
| 2413 | Ga0207655_1016444 | |||
| 2414 | Ga0207655_1018839 | |||
| 2415 | Ga0207655_1021378 | |||
| 2416 | Ga0207655_1023774 | |||
| 2417 | Ga0207713_1000041 | |||
| 2418 | Ga0207713_1000060 | |||
| 2419 | Ga0207713_1000348 | |||
| 2420 | Ga0207713_1001043 | |||
| 2421 | Ga0207713_1001161 | |||
| 2422 | Ga0207713_1001267 | |||
| 2423 | Ga0207713_1002181 | |||
| 2424 | Ga0207713_1004039 | |||
| 2425 | Ga0207713_1008860 | |||
| 2426 | Ga0207713_1014647 | |||
| 2427 | Ga0207713_1041877 | |||
| 2428 | Ga0207713_1041888 | |||
| 2429 | Ga0207692_10004858 | |||
| 2430 | Ga0207692_10058195 | |||
| 2431 | Ga0207710_10000122 | |||
| 2432 | Ga0207710_10070892 | |||
| 2433 | Ga0207688_10050778 | |||
| 2434 | Ga0207647_10003182 | |||
| 2435 | Ga0207647_10005156 | |||
| 2436 | Ga0207647_10008176 | |||
| 2437 | Ga0207647_10009659 | |||
| 2438 | Ga0207699_10000826 | |||
| 2439 | Ga0207699_10064608 | |||
| 2440 | Ga0207699_10071546 | |||
| 2441 | Ga0207705_10000771 | |||
| 2442 | Ga0207705_10135394 | |||
| 2443 | Ga0207684_10071066 | |||
| 2444 | Ga0207684_10074537 | |||
| 2445 | Ga0207654_10010475 | |||
| 2446 | Ga0207654_10087703 | |||
| 2447 | Ga0207707_10032404 | |||
| 2448 | Ga0207695_10000240 | |||
| 2449 | Ga0207695_10008368 | |||
| 2450 | Ga0207695_10021034 | |||
| 2451 | Ga0207695_10049593 | |||
| 2452 | Ga0207695_10097448 | |||
| 2453 | Ga0207671_10000604 | |||
| 2454 | Ga0207671_10007182 | |||
| 2455 | Ga0207671_10008177 | |||
| 2456 | Ga0207671_10023233 | |||
| 2457 | Ga0207671_10112512 | |||
| 2458 | Ga0207671_10119778 | |||
| 2459 | Ga0207693_10006908 | |||
| 2460 | Ga0207693_10074546 | |||
| 2461 | Ga0207663_10030874 | |||
| 2462 | Ga0207663_10111723 | |||
| 2463 | Ga0207657_10000595 | |||
| 2464 | Ga0207657_10003541 | |||
| 2465 | Ga0207657_10030614 | |||
| 2466 | Ga0207657_10082545 | |||
| 2467 | Ga0207649_10000639 | |||
| 2468 | Ga0207649_10000668 | |||
| 2469 | Ga0207681_10006411 | |||
| 2470 | Ga0207681_10014158 | |||
| 2471 | Ga0207694_10000236 | |||
| 2472 | Ga0207694_10056478 | |||
| 2473 | Ga0207694_10083220 | |||
| 2474 | Ga0207694_10099663 | |||
| 2475 | Ga0207650_10000248 | |||
| 2476 | Ga0207650_10001140 | |||
| 2477 | Ga0207650_10001620 | |||
| 2478 | Ga0207650_10259834 | |||
| 2479 | Ga0207687_10034082 | |||
| 2480 | Ga0207700_10057984 | |||
| 2481 | Ga0207700_10132142 | |||
| 2482 | Ga0207700_10165808 | |||
| 2483 | Ga0207664_10117055 | |||
| 2484 | Ga0207664_10149876 | |||
| 2485 | Ga0207690_10000034 | |||
| 2486 | Ga0207690_10001619 | |||
| 2487 | Ga0207690_10071507 | |||
| 2488 | Ga0207706_10002708 | |||
| 2489 | Ga0207706_10006523 | |||
| 2490 | Ga0207706_10014066 | |||
| 2491 | Ga0207706_10074628 | |||
| 2492 | Ga0207709_10000001 | |||
| 2493 | Ga0207709_10000030 | |||
| 2494 | Ga0207709_10000070 | |||
| 2495 | Ga0207709_10000127 | |||
| 2496 | Ga0207709_10000610 | |||
| 2497 | Ga0207709_10004847 | |||
| 2498 | Ga0207709_10005912 | |||
| 2499 | Ga0207709_10024205 | |||
| 2500 | Ga0207709_10068348 | |||
| 2501 | Ga0207665_10001950 | |||
| 2502 | Ga0207665_10012034 | |||
| 2503 | Ga0207661_10012230 | |||
| 2504 | Ga0207679_10000021 | |||
| 2505 | Ga0207679_10000349 | |||
| 2506 | Ga0207667_10000044 | |||
| 2507 | Ga0207667_10000347 | |||
| 2508 | Ga0207667_10007034 | |||
| 2509 | Ga0207667_10024451 | |||
| 2510 | Ga0207667_10034699 | |||
| 2511 | Ga0207667_10156943 | |||
| 2512 | Ga0207651_10151706 | |||
| 2513 | Ga0207668_10149151 | |||
| 2514 | Ga0207640_10000490 | |||
| 2515 | Ga0207658_10000701 | |||
| 2516 | Ga0207658_10035321 | |||
| 2517 | Ga0207703_10244121 | |||
| 2518 | Ga0207639_10019471 | |||
| 2519 | Ga0207678_10000419 | |||
| 2520 | Ga0207678_10000911 | |||
| 2521 | Ga0207678_10004582 | |||
| 2522 | Ga0207678_10037826 | |||
| 2523 | Ga0207678_10041614 | |||
| 2524 | Ga0207678_10067645 | |||
| 2525 | Ga0207708_10207132 | |||
| 2526 | Ga0207702_10006736 | |||
| 2527 | Ga0207702_10093167 | |||
| 2528 | Ga0207674_10027513 | |||
| 2529 | Ga0207674_10056006 | |||
| 2530 | Ga0207675_100250766 | |||
| 2531 | Ga0207683_10030261 | |||
| 2532 | Ga0207683_10135168 | |||
| 2533 | Ga0207698_10069769 | |||
| 2534 | Ga0209281_1000029 | |||
| 2535 | Ga0209281_1000070 | |||
| 2536 | Ga0209281_1000249 | |||
| 2537 | Ga0209389_1000078 | |||
| 2538 | Ga0209389_1000210 | |||
| 2539 | Ga0209371_1000040 | |||
| 2540 | Ga0209371_1000114 | |||
| 2541 | Ga0209371_1004048 | |||
| 2542 | Ga0209589_1000011 | |||
| 2543 | Ga0209589_1001190 | |||
| 2544 | Ga0209489_100012 | |||
| 2545 | Ga0209489_100192 | |||
| 2546 | Ga0209700_100019 | |||
| 2547 | Ga0209282_1000074 | |||
| 2548 | Ga0209282_1018720 | |||
| 2549 | Ga0209588_1013766 | |||
| 2550 | Ga0207428_10026308 | |||
| 2551 | Ga0268266_10007711 | |||
| 2552 | Ga0268264_10000194 | |||
| 2553 | Ga0265319_1023195 | |||
| 2554 | Ga0265334_10003980 | |||
| 2555 | Ga0265318_10008391 | |||
| 2556 | Ga0265323_10000516 | |||
| 2557 | Ga0265322_10002082 | |||
| 2558 | Ga0265336_10000456 | |||
| 2559 | Ga0265338_10000065 | |||
| 2560 | Ga0265324_10007686 | |||
| 2561 | Ga0268256_1000041 | |||
| 2562 | Ga0268256_1000218 | |||
| 2563 | Ga0268256_1003598 | |||
| 2564 | Ga0316179_1034064 | |||
| 2565 | Ga0316178_1152882 | |||
| 2566 | Ga0265760_10022728 | |||
| 2567 | Ga0265332_10026610 | |||
| 2568 | Ga0265325_10037169 | |||
| 2569 | Ga0265339_10075563 | |||
| 2570 | Ga0265331_10019239 | |||
| 2571 | Ga0265327_10007366 | |||
| 2572 | Ga0265327_10012518 | |||
| 2573 | Ga0265316_10047668 | |||
| 2574 | Ga0265316_10219946 | |||
| 2575 | Ga0307509_10161097 | |||
| 2576 | Ga0307408_100023917 | |||
| 2577 | Ga0307408_100027855 | |||
| 2578 | Ga0307508_10000001 | |||
| 2579 | Ga0307508_10034274 | |||
| 2580 | Ga0307508_10095256 | |||
| 2581 | Ga0307508_10185720 | |||
| 2582 | Ga0265314_10011314 | |||
| 2583 | Ga0307516_10000859 | |||
| 2584 | Ga0307516_10012610 | |||
| 2585 | Ga0307405_10056842 | |||
| 2586 | Ga0307407_10085133 | |||
| 2587 | Ga0307412_10000044 | |||
| 2588 | Ga0307412_10006504 | |||
| 2589 | Ga0307412_10070442 | |||
| 2590 | Ga0307409_100069835 | |||
| 2591 | Ga0307415_100087092 | |||
| 2592 | Ga0307507_10010371 | |||
| 2593 | Ga0307510_10003141 | |||
| 2594 | Ga0307510_10034158 | |||
| 2595 | Ga0307510_10052649 | |||
| 2596 | Ga0307510_10178511 | |||
| 2597 | Ga0373934_0026823 | |||
| 2598 | Ga0373923_0003759 | |||
| 2599 | Ga0373936_0049770 | |||
| 2600 | Ga0373945_0013272 | |||
| 2601 | Ga0373953_0002356 | |||
| 2602 | Ga0373943_0003856 | |||
| 2603 | Ga0373943_0006295 | |||
| 2604 | Ga0373955_0016136 | |||
| 2605 | Ga0373924_0024858 | |||
| 2606 | Ga0373935_0003793 | |||
| 2607 | Ga0373935_0073663 | |||
| 2608 | Ga0373927_0001305 | |||
| 2609 | Ga0373927_0046440 | |||
| 2610 | Ga0373947_0001572 | |||
| 2611 | Ga0373947_0020287 | |||
| 2612 | Ga0373947_0124690 | |||
| 2613 | Ga0373937_0055490 | |||
| 2614 | Ga0373925_0000676 | |||
| 2615 | Ga0373925_0014327 | |||
| 2616 | Ga0395899_0000029 | |||
| 2617 | Ga0395899_0022392 | |||
| 2618 | Ga0395899_0055223 | |||
| 2619 | Ga0395900_0000098 | |||
| 2620 | Ga0395900_0000196 | |||
| 2621 | Ga0395900_0048824 | |||
| 2622 | Ga0395900_0090030 | |||
| 2623 | Ga0395900_0097693 | |||
| 2624 | Ga0395900_0111219 | |||
| 2625 | Ga0395900_0114223 | |||
| 2626 | Ga0395900_0126587 | |||
| 2627 | Ga0395900_0177638 | |||
| 2628 | Ga0395900_0197752 | |||
| 2629 | Ga0395900_0291642 | |||
| 2630 | Ga0395898_0000086 | |||
| 2631 | Ga0395898_0000577 | |||
| 2632 | Ga0395898_0010898 | |||
| 2633 | Ga0395898_0032583 | |||
| 2634 | Ga0395898_0115359 | |||
| 2635 | Ga0395905_0000201 | |||
| 2636 | Ga0395905_0004566 | |||
| 2637 | Ga0395905_0072502 | |||
| 2638 | Ga0395905_0077342 | |||
| 2639 | Ga0395905_0132714 | |||
| 2640 | Ga0436364_1144417 | |||
| 2641 | Ga0395901_0000104 | |||
| 2642 | Ga0395901_0000137 | |||
| 2643 | Ga0395901_0000231 | |||
| 2644 | Ga0395901_0155286 | |||
| 2645 | Ga0395901_0340447 | |||
| 2646 | Ga0237819_01466 | |||
| 2647 | Ga0436365_0473945 | |||
| 2648 | Ga0436360_0304504 | |||
| 2649 | Ga0436360_0536580 | |||
| 2650 | Ga0436360_0755309 | |||
| 2651 | Ga0436361_0138725 | |||
| 2652 | Ga0436361_0246054 | |||
| 2653 | Ga0436361_0512633 | |||
| 2654 | Ga0436363_0561374 | |||
| 2655 | Ga0439436_0006431 | |||
| 2656 | Ga0439438_000199 | |||
| 2657 | Ga0439438_005671 | |||
| 2658 | Ga0439438_006276 | |||
| 2659 | Ga0439438_006309 | |||
| 2660 | Ga0439438_011933 | |||
| 2661 | Ga0439447_000909 | |||
| 2662 | Ga0439447_004721 | |||
| 2663 | Ga0439447_007300 | |||
| 2664 | Ga0439447_011535 | |||
| 2665 | Ga0439466_0002213 | |||
| 2666 | Ga0439466_0004939 | |||
| 2667 | Ga0439466_0005069 | |||
| 2668 | Ga0439466_0016378 | |||
| 2669 | Ga0439466_0018526 | |||
| 2670 | Ga0439431_0004281 | |||
| 2671 | Ga0439448_0000169 | |||
| 2672 | Ga0439432_000453 | |||
| 2673 | Ga0439432_000827 | |||
| 2674 | Ga0439432_006423 | |||
| 2675 | Ga0439432_038933 | |||
| 2676 | Ga0439451_003268 | |||
| 2677 | Ga0439451_011933 | |||
| 2678 | Ga0439452_000581 | |||
| 2679 | Ga0439452_001230 | |||
| 2680 | Ga0439452_001923 | |||
| 2681 | Ga0439452_005307 | |||
| 2682 | Ga0439452_007817 | |||
| 2683 | Ga0439452_008357 | |||
| 2684 | Ga0439456_000063 | |||
| 2685 | Ga0439456_001296 | |||
| 2686 | Ga0439456_003137 | |||
| 2687 | Ga0439463_003980 | |||
| 2688 | Ga0450920_001220 | |||
| 2689 | Ga0450922_000404 | |||
| 2690 | Ga0450902_000643 | |||
| 2691 | Ga0450902_000756 | |||
| 2692 | Ga0450907_000025 | |||
| 2693 | Ga0450907_003669 | |||
| 2694 | Ga0450910_000561 | |||
| 2695 | Ga0439434_0001115 | |||
| 2696 | Ga0439460_0006661 | |||
| 2697 | Ga0439460_0007288 | |||
| 2698 | Ga0466969_0000226 | |||
| 2699 | Ga0466969_0003247 | |||
| 2700 | Ga0466969_0008544 | |||
| 2701 | Ga0466969_0012351 | |||
| 2702 | Ga0466969_0030975 | |||
| 2703 | Ga0466972_0005663 | |||
| 2704 | Ga0466977_0008418 | |||
| 2705 | Ga0466965_0005365 | |||
| 2706 | Ga0466965_0010859 | |||
| 2707 | Ga0466965_0027306 | |||
| 2708 | Ga0466965_0038803 | |||
| 2709 | Ga0466966_0000005 | |||
| 2710 | Ga0466966_0002330 | |||
| 2711 | Ga0466961_0000656 | |||
| 2712 | Ga0466961_0000908 | |||
| 2713 | Ga0466961_0002934 | |||
| 2714 | Ga0466961_0039867 | |||
| 2715 | Ga0466963_0001778 | |||
| 2716 | Ga0466963_0007803 | |||
| 2717 | Ga0466963_0110019 | |||
| 2718 | Ga0466964_0062504 | |||
| 2719 | Ga0466971_0000225 | |||
| 2720 | Ga0466971_0022608 | |||
| 2721 | Ga0466971_0049325 | |||
| 2722 | Ga0466968_0004192 | |||
| 2723 | Ga0466970_0003203 | |||
| 2724 | Ga0466970_0003629 | |||
| 2725 | Ga0466970_0024106 | |||
| 2726 | Ga0466957_0004704 | |||
| 2727 | Ga0466957_0005749 | |||
| 2728 | Ga0466957_0013067 | |||
| 2729 | Ga0466957_0153471 | |||
| 2730 | Ga0466960_0014731 | |||
| 2731 | Ga0466959_0004419 | |||
| 2732 | Ga0466959_0016104 | |||
| 2733 | Ga0466959_0045224 | |||
| 2734 | Ga0466959_0045299 | |||
| 2735 | Ga0466959_0132757 | |||
| 2736 | Ga0466958_0000956 | |||
| 2737 | Ga0466958_0053171 | |||
| 2738 | Ga0466967_0027405 | |||
| 2739 | Ga0466967_0139369 | |||
| 2740 | Ga0495617_000479 | |||
| 2741 | Ga0495617_004457 | |||
| 2742 | Ga0495627_001494 | |||
| 2743 | Ga0495592_0020729 | |||
| 2744 | Ga0495592_0057295 | |||
| 2745 | Ga0495592_0097075 | |||
| 2746 | Ga0495603_0000003 | |||
| 2747 | Ga0495603_0067662 | |||
| 2748 | Ga0495590_0000005 | |||
| 2749 | Ga0495590_0009816 | |||
| 2750 | Ga0495590_0012583 | |||
| 2751 | Ga0495591_000165 | |||
| 2752 | Ga0495591_000387 | |||
| 2753 | Ga0495591_001132 | |||
| 2754 | Ga0495591_002013 | |||
| 2755 | Ga0495591_003323 | |||
| 2756 | Ga0495591_004232 | |||
| 2757 | Ga0495591_015106 | |||
| 2758 | Ga0495591_034200 | |||
| 2759 | Ga0495629_0000105 | |||
| 2760 | Ga0495629_0000133 | |||
| 2761 | Ga0495629_0002853 | |||
| 2762 | Ga0495629_0002887 | |||
| 2763 | Ga0495629_0003517 | |||
| 2764 | Ga0495629_0020285 | |||
| 2765 | Ga0495638_0005386 | |||
| 2766 | Ga0495638_0011092 | |||
| 2767 | Ga0495638_0018018 | |||
| 2768 | Ga0495638_0019977 | |||
| 2769 | Ga0495638_0029251 | |||
| 2770 | Ga0495638_0048476 | |||
| 2771 | Ga0495638_0055785 | |||
| 2772 | Ga0495641_0011455 | |||
| 2773 | Ga0495651_0001898 | |||
| 2774 | Ga0495651_0005111 | |||
| 2775 | Ga0495653_0004087 | |||
| 2776 | Ga0495653_0011821 | |||
| 2777 | Ga0495653_0036791 | |||
| 2778 | Ga0495653_0108648 | |||
| 2779 | Ga0495650_0000710 | |||
| 2780 | Ga0495650_0003689 | |||
| 2781 | Ga0495650_0010859 | |||
| 2782 | Ga0495650_0017508 | |||
| 2783 | Ga0495650_0018394 | |||
| 2784 | Ga0495650_0029283 | |||
| 2785 | Ga0495580_0008949 | |||
| 2786 | Ga0495580_0027216 | |||
| 2787 | Ga0495580_0031628 | |||
| 2788 | Ga0495580_0038848 | |||
| 2789 | Ga0495580_0041966 | |||
| 2790 | Ga0495582_0000016 | |||
| 2791 | Ga0495582_0015213 | |||
| 2792 | Ga0495582_0061015 | |||
| 2793 | Ga0495605_0000124 | |||
| 2794 | Ga0495605_0004497 | |||
| 2795 | Ga0495605_0006881 | |||
| 2796 | Ga0495605_0013089 | |||
| 2797 | Ga0495605_0019294 | |||
| 2798 | Ga0495605_0075352 | |||
| 2799 | Ga0495639_0000014 | |||
| 2800 | Ga0495662_0002084 | |||
| 2801 | Ga0495664_0005109 | |||
| 2802 | Ga0495664_0024757 | |||
| 2803 | Ga0495664_0029656 | |||
| 2804 | Ga0495584_0001735 | |||
| 2805 | Ga0495584_0020821 | |||
| 2806 | Ga0495584_0056498 | |||
| 2807 | Ga0495585_0004287 | |||
| 2808 | Ga0495585_0013257 | |||
| 2809 | Ga0495585_0026629 | |||
| 2810 | Ga0495594_0000051 | |||
| 2811 | Ga0495596_0005234 | |||
| 2812 | Ga0495596_0023490 | |||
| 2813 | Ga0495596_0031980 | |||
| 2814 | Ga0495607_0001371 | |||
| 2815 | Ga0495607_0024161 | |||
| 2816 | Ga0495607_0074335 | |||
| 2817 | Ga0495607_0076806 | |||
| 2818 | Ga0495607_0105546 | |||
| 2819 | Ga0495583_0001112 | |||
| 2820 | Ga0495583_0001552 | |||
| 2821 | Ga0495583_0009174 | |||
| 2822 | Ga0495583_0010184 | |||
| 2823 | Ga0495583_0020079 | |||
| 2824 | Ga0495583_0023951 | |||
| 2825 | Ga0495606_0000032 | |||
| 2826 | Ga0495606_0000042 | |||
| 2827 | Ga0495606_0002242 | |||
| 2828 | Ga0495606_0007911 | |||
| 2829 | Ga0495606_0008338 | |||
| 2830 | Ga0495606_0011843 | |||
| 2831 | Ga0495606_0023220 | |||
| 2832 | Ga0495606_0024810 | |||
| 2833 | Ga0495606_0029806 | |||
| 2834 | Ga0495606_0053148 | |||
| 2835 | Ga0495606_0121034 | |||
| 2836 | Ga0495608_0038590 | |||
| 2837 | Ga0495608_0053734 | |||
| 2838 | Ga0495610_0003579 | |||
| 2839 | Ga0495610_0006567 | |||
| 2840 | Ga0495610_0007629 | |||
| 2841 | Ga0495610_0012101 | |||
| 2842 | Ga0495616_0019156 | |||
| 2843 | Ga0495616_0033914 | |||
| 2844 | Ga0495618_0013194 | |||
| 2845 | Ga0495618_0033388 | |||
| 2846 | Ga0495618_0071878 | |||
| 2847 | Ga0495620_0000004 | |||
| 2848 | Ga0495620_0025065 | |||
| 2849 | Ga0495620_0033355 | |||
| 2850 | Ga0495628_0002656 | |||
| 2851 | Ga0495628_0008450 | |||
| 2852 | Ga0495628_0013006 | |||
| 2853 | Ga0495628_0039809 | |||
| 2854 | Ga0495630_0022261 | |||
| 2855 | Ga0495630_0023055 | |||
| 2856 | Ga0495630_0034082 | |||
| 2857 | Ga0495630_0035570 | |||
| 2858 | Ga0495630_0046608 | |||
| 2859 | Ga0495630_0074543 | |||
| 2860 | Ga0495631_0000953 | |||
| 2861 | Ga0495631_0003004 | |||
| 2862 | Ga0495631_0005227 | |||
| 2863 | Ga0495632_0001439 | |||
| 2864 | Ga0495632_0001542 | |||
| 2865 | Ga0495632_0005956 | |||
| 2866 | Ga0495632_0014688 | |||
| 2867 | Ga0495632_0018769 | |||
| 2868 | Ga0495637_0000171 | |||
| 2869 | Ga0495637_0000931 | |||
| 2870 | Ga0495637_0005318 | |||
| 2871 | Ga0495637_0010013 | |||
| 2872 | Ga0495637_0012785 | |||
| 2873 | Ga0495643_0000297 | |||
| 2874 | Ga0495643_0002410 | |||
| 2875 | Ga0495643_0009717 | |||
| 2876 | Ga0495643_0010056 | |||
| 2877 | Ga0495643_0010572 | |||
| 2878 | Ga0495643_0033537 | |||
| 2879 | Ga0495644_0001175 | |||
| 2880 | Ga0495644_0002862 | |||
| 2881 | Ga0495644_0016424 | |||
| 2882 | Ga0495648_0000188 | |||
| 2883 | Ga0495648_0001828 | |||
| 2884 | Ga0495648_0010069 | |||
| 2885 | Ga0495648_0019703 | |||
| 2886 | Ga0495648_0038878 | |||
| 2887 | Ga0495648_0060170 | |||
| 2888 | Ga0495648_0062533 | |||
| 2889 | Ga0495663_0001152 | |||
| 2890 | Ga0495666_0007152 | |||
| 2891 | Ga0495666_0017365 | |||
| 2892 | Ga0495666_0040284 | |||
| 2893 | Ga0495642_0000276 | |||
| 2894 | Ga0495652_0007000 | |||
| 2895 | Ga0495652_0026204 | |||
| 2896 | Ga0495652_0058154 | |||
| 2897 | Ga0495652_0062651 | |||
| 2898 | Ga0495654_0000878 | |||
| 2899 | Ga0495654_0005444 | |||
| 2900 | Ga0495654_0005926 | |||
| 2901 | Ga0495654_0007926 | |||
| 2902 | Ga0495654_0018888 | |||
| 2903 | Ga0495654_0038697 | |||
| 2904 | Ga0495665_0000270 | |||
| 2905 | Ga0495665_0032847 | |||
| 2906 | Ga0495665_0036946 | |||
| 2907 | Ga0495640_0015373 | |||
| 2908 | Ga0495640_0028712 | |||
| 2909 | Ga0495586_0001447 | |||
| 2910 | Ga0495587_0005433 | |||
| 2911 | Ga0495587_0006220 | |||
| 2912 | Ga0495587_0011069 | |||
| 2913 | Ga0495587_0027077 | |||
| 2914 | Ga0495609_0000456 | |||
| 2915 | Ga0495609_0003025 | |||
| 2916 | Ga0495609_0008086 | |||
| 2917 | Ga0495609_0009745 | |||
| 2918 | Ga0495597_0009516 | |||
| 2919 | Ga0495597_0010021 | |||
| 2920 | Ga0495597_0053325 | |||
| 2921 | Ga0495645_0001550 | |||
| 2922 | Ga0495645_0007057 | |||
| 2923 | Ga0495645_0010772 | |||
| 2924 | Ga0495645_0014623 | |||
| 2925 | Ga0495645_0078236 | |||
| 2926 | Ga0495645_0101017 | |||
| 2927 | Ga0495622_0001439 | |||
| 2928 | Ga0495622_0001690 | |||
| 2929 | Ga0495622_0005935 | |||
| 2930 | Ga0495622_0011047 | |||
| 2931 | Ga0495622_0020971 | |||
| 2932 | Ga0495622_0039348 | |||
| 2933 | Ga0495622_0040666 | |||
| 2934 | Ga0495622_0058480 | |||
| 2935 | Ga0495633_0000896 | |||
| 2936 | Ga0495667_0033070 | |||
| 2937 | Ga0495667_0046874 | |||
| 2938 | Ga0495667_0051787 | |||
| 2939 | Ga0495656_0010985 | |||
| 2940 | Ga0495668_0000096 | |||
| 2941 | Ga0495668_0012211 | |||
| 2942 | Ga0495668_0069304 | |||
| 2943 | Ga0495634_0000064 | |||
| 2944 | Ga0495634_0012589 | |||
| 2945 | Ga0495634_0014826 | |||
| 2946 | Ga0495611_0002721 | |||
| 2947 | Ga0495611_0008969 | |||
| 2948 | Ga0495625_0000010 | |||
| 2949 | Ga0495625_0003810 | |||
| 2950 | Ga0495625_0005012 | |||
| 2951 | Ga0495625_0100211 | |||
| 2952 | Ga0495635_0001480 | |||
| 2953 | Ga0495635_0006440 | |||
| 2954 | Ga0495635_0019099 | |||
| 2955 | Ga0495635_0025503 | |||
| 2956 | Ga0495635_0042289 | |||
| 2957 | Ga0495635_0042546 | |||
| 2958 | Ga0495659_0000457 | |||
| 2959 | Ga0495661_0000790 | |||
| 2960 | Ga0495661_0001455 | |||
| 2961 | Ga0495661_0005867 | |||
| 2962 | Ga0495661_0016543 | |||
| 2963 | Ga0495588_0058054 | |||
| 2964 | Ga0495657_0008807 | |||
| 2965 | Ga0495599_0000823 | |||
| 2966 | Ga0495599_0019978 | |||
| 2967 | Ga0495599_0085027 | |||
| 2968 | Ga0495623_0007544 | |||
| 2969 | Ga0495623_0036727 | |||
| 2970 | Ga0495646_0010120 | |||
| 2971 | Ga0495646_0023117 | |||
| 2972 | Ga0495646_0024091 | |||
| 2973 | Ga0495646_0024315 | |||
| 2974 | Ga0495646_0030608 | |||
| 2975 | Ga0495646_0071739 | |||
| 2976 | Ga0495647_0060641 | |||
| 2977 | Ga0495658_0001546 | |||
| 2978 | Ga0495669_0007735 | |||
| 2979 | Ga0495613_0001602 | |||
| 2980 | Ga0495613_0017809 | |||
| 2981 | Ga0495613_0060922 | |||
| 2982 | Ga0495624_0000201 | |||
| 2983 | Ga0495624_0003503 | |||
| 2984 | Ga0495624_0014549 | |||
| 2985 | Ga0495624_0015332 | |||
| 2986 | Ga0495624_0050733 | |||
| 2987 | Ga0495670_0018076 | |||
| 2988 | Ga0495670_0022050 | |||
| 2989 | Ga0495671_0026716 | |||
| 2990 | Ga0495671_0029088 | |||
| 2991 | Ga0495671_0039935 | |||
| 2992 | Ga0495649_0001000 | |||
| 2993 | Ga0495649_0008348 | |||
| 2994 | Ga0495649_0017672 | |||
| 2995 | Ga0495649_0037014 | |||
| 2996 | Ga0495649_0058384 | |||
| 2997 | Ga0495649_0066481 | |||
| 2998 | Ga0495589_0001771 | |||
| 2999 | Ga0495589_0004057 | |||
| 3000 | Ga0495589_0006766 | |||
| 3001 | Ga0495589_0012759 | |||
| 3002 | Ga0495600_0010359 | |||
| 3003 | Ga0495600_0027469 | |||
| 3004 | Ga0495600_0122816 | |||
| 3005 | Ga0495660_0013447 | |||
| 3006 | Ga0495660_0037615 | |||
| 3007 | Ga0495660_0075272 | |||
| 3008 | Ga0495581_0000014 | |||
| 3009 | Ga0495581_0021153 | |||
| 3010 | Ga0495604_0001045 | |||
| 3011 | Ga0495604_0012911 | |||
| 3012 | Ga0495604_0015866 | |||
| 3013 | Ga0495604_0017993 | |||
| 3014 | Ga0495604_0059746 | |||
| 3015 | Ga0495674_0013843 | |||
| 3016 | Ga0495674_0037786 | |||
| 3017 | Ga0495674_0046100 | |||
| 3018 | Ga0495674_0048125 | |||
| 3019 | Ga0495674_0063784 | |||
| 3020 | Ga0495672_0004532 | |||
| 3021 | Ga0495672_0009651 | |||
| 3022 | Ga0495672_0013081 | |||
| 3023 | Ga0495672_0017425 | |||
| 3024 | Ga0495672_0018025 | |||
| 3025 | Ga0495672_0018797 | |||
| 3026 | Ga0495672_0020229 | |||
| 3027 | Ga0495672_0030535 | |||
| 3028 | Ga0495672_0032208 | |||
| 3029 | Ga0495672_0060533 | |||
| 3030 | Ga0495676_0000002 | |||
| 3031 | Ga0495676_0008340 | |||
| 3032 | Ga0495676_0017761 | |||
| 3033 | Ga0495676_0049156 | |||
| 3034 | Ga0495676_0059463 | |||
| 3035 | Ga0495680_0001894 | |||
| 3036 | Ga0495680_0005126 | |||
| 3037 | Ga0495680_0087224 | |||
| 3038 | Ga0495680_0091270 | |||
| 3039 | Ga0495683_0001174 | |||
| 3040 | Ga0495683_0001446 | |||
| 3041 | Ga0495683_0003592 | |||
| 3042 | Ga0495683_0009570 | |||
| 3043 | Ga0495683_0014270 | |||
| 3044 | Ga0495683_0018159 | |||
| 3045 | Ga0495683_0068421 | |||
| 3046 | Ga0495687_005784 | |||
| 3047 | Ga0495687_021419 | |||
| 3048 | Ga0495675_0012153 | |||
| 3049 | Ga0495675_0045850 | |||
| 3050 | Ga0495675_0047451 | |||
| 3051 | Ga0495675_0055414 | |||
| 3052 | Ga0495675_0064304 | |||
| 3053 | Ga0495677_0027531 | |||
| 3054 | Ga0495679_000243 | |||
| 3055 | Ga0495679_000498 | |||
| 3056 | Ga0495679_000540 | |||
| 3057 | Ga0495679_002453 | |||
| 3058 | Ga0495679_003917 | |||
| 3059 | Ga0495679_008749 | |||
| 3060 | Ga0495673_0001376 | |||
| 3061 | Ga0495673_0001555 | |||
| 3062 | Ga0495673_0001654 | |||
| 3063 | Ga0495673_0009282 | |||
| 3064 | Ga0495673_0014320 | |||
| 3065 | Ga0495673_0040678 | |||
| 3066 | Ga0495673_0045778 | |||
| 3067 | Ga0495681_0002070 | |||
| 3068 | Ga0495681_0003032 | |||
| 3069 | Ga0495681_0008069 | |||
| 3070 | Ga0495681_0013937 | |||
| 3071 | Ga0495681_0022735 | |||
| 3072 | Ga0495681_0024250 | |||
| 3073 | Ga0495681_0082596 | |||
| 3074 | Ga0495684_0031468 | |||
| 3075 | Ga0495684_0108536 | |||
| 3076 | Ga0495686_0028914 | |||
| 3077 | Ga0495593_0000003 | |||
| 3078 | Ga0495593_0013772 | |||
| 3079 | Ga0495593_0032489 | |||
| 3080 | Ga0495602_0004392 | |||
| 3081 | Ga0495602_0019904 | |||
| 3082 | Ga0495602_0027496 | |||
| 3083 | Ga0495602_0032356 | |||
| 3084 | Ga0495602_0056054 | |||
| 3085 | Ga0495614_0001273 | |||
| 3086 | Ga0495614_0009420 | |||
| 3087 | Ga0495614_0049336 | |||
| 3088 | Ga0495626_0000319 | |||
| 3089 | Ga0495626_0001455 | |||
| 3090 | Ga0495626_0001872 | |||
| 3091 | Ga0495626_0005066 | |||
| 3092 | Ga0495626_0006702 | |||
| 3093 | Ga0495626_0008178 | |||
| 3094 | Ga0496100_0000770 | |||
| 3095 | Ga0496100_0036563 | |||
| 3096 | Ga0496100_0049984 | |||
| 3097 | Ga0496101_0003605 | |||
| 3098 | Ga0496101_0062499 | |||
| 3099 | Ga0496101_0120761 | |||
| 3100 | Ga0496102_0001989 | |||
| 3101 | Ga0496102_0002699 | |||
| 3102 | Ga0496102_0044305 | |||
| 3103 | Ga0496102_0110231 | |||
| 3104 | Ga0496102_0130940 | |||
| 3105 | Ga0496103_0000854 | |||
| 3106 | Ga0496103_0002629 | |||
| 3107 | Ga0496103_0019548 | |||
| 3108 | Ga0496103_0024009 | |||
| 3109 | Ga0496104_0043929 | |||
| 3110 | Ga0496104_0061727 | |||
| 3111 | Ga0496105_0159600 | |||
| 3112 | Ga0496106_0000152 | |||
| 3113 | Ga0496106_0003247 | |||
| 3114 | Ga0496107_0030056 | |||
| 3115 | Ga0496108_0083230 | |||
| 3116 | Ga0496108_0140914 | |||
| 3117 | Ga0496110_0114659 | |||
| 3118 | Ga0496110_0130468 | |||
| 3119 | Ga0496110_0143978 | |||
| 3120 | Ga0496110_0252289 | |||
| 3121 | Ga0496111_0026372 | |||
| 3122 | Ga0496111_0168103 | |||
| 3123 | Ga0496112_0000101 | |||
| 3124 | Ga0496112_0034008 | |||
| 3125 | Ga0496113_0043290 | |||
| 3126 | Ga0496114_0002669 | |||
| 3127 | Ga0496114_0157507 | |||
| 3128 | Ga0496115_0099049 | |||
| 3129 | Ga0496115_0102345 | |||
| 3130 | Ga0496115_0181310 | |||
| 3131 | Ga0496116_0000267 | |||
| 3132 | Ga0496116_0087204 | |||
| 3133 | Ga0496117_0001021 | |||
| 3134 | Ga0496117_0003014 | |||
| 3135 | Ga0496117_0003521 | |||
| 3136 | Ga0496117_0020845 | |||
| 3137 | Ga0496117_0023031 | |||
| 3138 | Ga0496117_0023500 | |||
| 3139 | Ga0496117_0031790 | |||
| 3140 | Ga0496117_0049041 | |||
| 3141 | Ga0496117_0053870 | |||
| 3142 | Ga0496117_0090442 | |||
| 3143 | Ga0496117_0106074 | |||
| 3144 | Ga0496118_0001205 | |||
| 3145 | Ga0496118_0002131 | |||
| 3146 | Ga0496118_0003163 | |||
| 3147 | Ga0496118_0007073 | |||
| 3148 | Ga0496118_0009055 | |||
| 3149 | Ga0496118_0011650 | |||
| 3150 | Ga0496118_0022178 | |||
| 3151 | Ga0496118_0030612 | |||
| 3152 | Ga0496118_0037948 | |||
| 3153 | Ga0496118_0044984 | |||
| 3154 | Ga0496118_0052309 | |||
| 3155 | Ga0496118_0103556 | |||
| 3156 | Ga0496118_0138795 | |||
| 3157 | Ga0496119_0000046 | |||
| 3158 | Ga0496119_0024863 | |||
| 3159 | Ga0496119_0058364 | |||
| 3160 | Ga0496120_0002213 | |||
| 3161 | Ga0496121_0000041 | |||
| 3162 | Ga0496121_0000366 | |||
| 3163 | Ga0496121_0000824 | |||
| 3164 | Ga0496121_0001446 | |||
| 3165 | Ga0496121_0002599 | |||
| 3166 | Ga0496121_0003643 | |||
| 3167 | Ga0496121_0004448 | |||
| 3168 | Ga0496121_0012188 | |||
| 3169 | Ga0496121_0014389 | |||
| 3170 | Ga0496121_0025746 | |||
| 3171 | Ga0496121_0029189 | |||
| 3172 | Ga0496121_0033209 | |||
| 3173 | Ga0496121_0034546 | |||
| 3174 | Ga0496121_0044568 | |||
| 3175 | Ga0496121_0160259 | |||
| 3176 | Ga0496122_0000167 | |||
| 3177 | Ga0496122_0001027 | |||
| 3178 | Ga0496122_0012761 | |||
| 3179 | Ga0496122_0041991 | |||
| 3180 | Ga0496122_0070884 | |||
| 3181 | Ga0496123_0000127 | |||
| 3182 | Ga0496123_0000240 | |||
| 3183 | Ga0496123_0015663 | |||
| 3184 | Ga0496123_0018849 | |||
| 3185 | Ga0496123_0032067 | |||
| 3186 | Ga0496123_0032885 | |||
| 3187 | Ga0496124_0000261 | |||
| 3188 | Ga0496124_0001966 | |||
| 3189 | Ga0496124_0003100 | |||
| 3190 | Ga0496124_0003299 | |||
| 3191 | Ga0496124_0004055 | |||
| 3192 | Ga0496124_0019838 | |||
| 3193 | Ga0496124_0118373 | |||
| 3194 | Ga0496125_0000944 | |||
| 3195 | Ga0496125_0002606 | |||
| 3196 | Ga0496125_0003132 | |||
| 3197 | Ga0496125_0007271 | |||
| 3198 | Ga0496125_0008276 | |||
| 3199 | Ga0496125_0015617 | |||
| 3200 | Ga0496125_0026562 | |||
| 3201 | Ga0496125_0026953 | |||
| 3202 | Ga0496125_0031343 | |||
| 3203 | Ga0496125_0056609 | |||
| 3204 | Ga0496126_0000603 | |||
| 3205 | Ga0496126_0005095 | |||
| 3206 | Ga0496126_0011447 | |||
| 3207 | Ga0496126_0011697 | |||
| 3208 | Ga0496126_0013263 | |||
| 3209 | Ga0496126_0022380 | |||
| 3210 | Ga0496126_0032972 | |||
| 3211 | Ga0495678_003902 | |||
| 3212 | Ga0495678_006155 | |||
| 3213 | Ga0495678_006531 | |||
| 3214 | Ga0495678_008431 | |||
| 3215 | Ga0495678_009281 | |||
| 3216 | Ga0495678_015960 | |||
| 3217 | Ga0495682_0000234 | |||
| 3218 | Ga0501032_0005184 | |||
| 3219 | Ga0501034_0000260 | |||
| 3220 | Ga0501034_0001389 | |||
| 3221 | Ga0501034_0100213 | |||
| 3222 | Ga0501038_0178113 | |||
| 3223 | nmdc:mga00v17_22677_c1 | |||
| 3224 | nmdc:mga0yw44_12450_c1 | |||
| 3225 | nmdc:mga0k408_2812_c1 | |||
| 3226 | nmdc:mga06z11_21475_c1 | |||
| 3227 | nmdc:mga06z11_24614_c1 | |||
| 3228 | nmdc:mga06z11_42430_c1 | |||
| 3229 | nmdc:mga04h51_18623_c1 | |||
| 3230 | nmdc:mga07m45_4272_c1 | |||
| 3231 | nmdc:mga09592_49041_c1 | |||
| 3232 | nmdc:mga0sz30_23955_c1 | |||
| 3233 | nmdc:mga0sz30_25723_c1 | |||
| 3234 | nmdc:mga0sz30_34829_c1 | |||
| 3235 | nmdc:mga0sz30_5037_c1 | |||
| 3236 | Ga0495601_0012258 | |||
| 3237 | Ga0495601_0015749 | |||
| 3238 | Ga0495601_0034735 | |||
| 3239 | Ga0495601_0078238 | |||
| 3240 | Ga0495601_0080234 | |||
| 3241 | Ga0500635_0009073 | |||
| 3242 | Ga0495655_0015207 | |||
| 3243 | Ga0495619_0005097 | |||
| 3244 | Ga0495619_0021762 | |||
| 3245 | Ga0495619_0173567 | |||
| 3246 | Ga0500643_000037 | |||
| 3247 | Ga0500581_039952 | |||
| 3248 | Ga0500647_0015495 | |||
| 3249 | Ga0500566_0000367 | |||
| 3250 | Ga0500566_0001124 | |||
| 3251 | Ga0500566_0002925 | |||
| 3252 | Ga0500566_0013595 | |||
| 3253 | Ga0500640_021741 | |||
| 3254 | Ga0500641_0010054 | |||
| 3255 | Ga0500556_0000015 | |||
| 3256 | Ga0500557_000014 | |||
| 3257 | Ga0500562_002831 | |||
| 3258 | Ga0500562_016822 | |||
| 3259 | Ga0500569_006860 | |||
| 3260 | Ga0500569_039970 | |||
| 3261 | Ga0500572_002314 | |||
| 3262 | Ga0500595_001223 | |||
| 3263 | Ga0500595_003517 | |||
| 3264 | Ga0500595_004674 | |||
| 3265 | Ga0500595_024288 | |||
| 3266 | Ga0500608_018564 | |||
| 3267 | Ga0500614_003104 | |||
| 3268 | Ga0500642_0000044 | |||
| 3269 | Ga0500642_0000332 | |||
| 3270 | Ga0500652_000397 | |||
| 3271 | Ga0500658_0063432 | |||
| 3272 | Ga0500559_0000146 | |||
| 3273 | Ga0500568_0000729 | |||
| 3274 | Ga0500577_0001065 | |||
| 3275 | Ga0500589_065107 | |||
| 3276 | Ga0500590_074679 | |||
| 3277 | Ga0500603_001248 | |||
| 3278 | Ga0500604_0013015 | |||
| 3279 | Ga0500616_0000041 | |||
| 3280 | Ga0500616_0024588 | |||
| 3281 | Ga0500619_002481 | |||
| 3282 | Ga0500622_0001128 | |||
| 3283 | Ga0500634_0007703 | |||
| 3284 | Ga0500638_076420 | |||
| 3285 | Ga0500639_000085 | |||
| 3286 | Ga0500636_0003535 | |||
| 3287 | Ga0500637_0000231 | |||
| 3288 | Ga0500645_023268 | |||
| 3289 | Ga0500599_000271 | |||
| 3290 | Ga0500601_000073 | |||
| 3291 | Ga0466962_0000559 | |||
| 3292 | Ga0466962_0010024 | |||
| 3293 | 2501070895 | |||
| 3294 | 2501084874 | |||
| 3295 | 2501413723 | |||
| 3296 | 2507510665 | |||
| 3297 | 2508544468 | |||
| 3298 | 2508697388 | |||
| 3299 | 2509152063 | |||
| 3300 | 2510252339 | |||
| 3301 | 2511089598 | |||
| 3302 | 2511095007 | |||
| 3303 | 2511104663 | |||
| 3304 | 2511251717 | |||
| 3305 | 2511252915 | |||
| 3306 | 2511267771 | |||
| 3307 | 2511271352 | |||
| 3308 | 2511271848 | |||
| 3309 | 2511295287 | |||
| 3310 | 2511299610 | |||
| 3311 | 2511323225 | |||
| 3312 | 2511329440 | |||
| 3313 | 2511335019 | |||
| 3314 | 2511338315 | |||
| 3315 | 2511344554 | |||
| 3316 | 2511351658 | |||
| 3317 | 2511356019 | |||
| 3318 | 2511363405 | |||
| 3319 | 2511367322 | |||
| 3320 | 2511372869 | |||
| 3321 | 2511393692 | |||
| 3322 | 2511827062 | |||
| 3323 | 2512324672 | |||
| 3324 | 2512327719 | |||
| 3325 | 2512344737 | |||
| 3326 | 2513551472 | |||
| 3327 | 2513560122 | |||
| 3328 | 2513627858 | |||
| 3329 | 2513650686 | |||
| 3330 | 2513661776 | |||
| 3331 | 2513672608 | |||
| 3332 | 2513715802 | |||
| 3333 | 2513856985 | |||
| 3334 | 2513877823 | |||
| 3335 | 2513888252 | |||
| 3336 | 2513923423 | |||
| 3337 | 2513956978 | |||
| 3338 | 2513963043 | |||
| 3339 | 2514014974 | |||
| 3340 | 2514043142 | |||
| 3341 | 2514046188 | |||
| 3342 | 2515630243 | |||
| 3343 | 2515682520 | |||
| 3344 | 2515688740 | |||
| 3345 | 2516016879 | |||
| 3346 | 2517106869 | |||
| 3347 | 2517891195 | |||
| 3348 | 2519457789 | |||
| 3349 | 2521560464 | |||
| 3350 | 2524437054 | |||
| 3351 | 2524468792 | |||
| 3352 | 2524533618 | |||
| 3353 | 2527080649 | |||
| 3354 | 2528856325 | |||
| 3355 | 2550694140 | |||
| 3356 | 2552746373 | |||
| 3357 | 2553005585 | |||
| 3358 | 2554812470 | |||
| 3359 | 2555248218 | |||
| 3360 | 2555672264 | |||
| 3361 | 2563061803 | |||
| 3362 | 2583792770 | |||
| 3363 | 2583794769 | |||
| 3364 | 2585294525 | |||
| 3365 | 2596373449 | |||
| 3366 | 2597032383 | |||
| 3367 | 2597860343 | |||
| 3368 | 2597863619 | |||
| 3369 | 2597869579 | |||
| 3370 | 2599358300 | |||
| 3371 | 2599364649 | |||
| 3372 | 2599370815 | |||
| 3373 | 2599376837 | |||
| 3374 | 2599383465 | |||
| 3375 | 2599389912 | |||
| 3376 | 2599396195 | |||
| 3377 | 2599398609 | |||
| 3378 | 2599408035 | |||
| 3379 | 2599448469 | |||
| 3380 | 2599450663 | |||
| 3381 | 2599465115 | |||
| 3382 | 2599471424 | |||
| 3383 | 2599486815 | |||
| 3384 | 2599487013 | |||
| 3385 | 2599493970 | |||
| 3386 | 2599505355 | |||
| 3387 | 2599507090 | |||
| 3388 | 2599513097 | |||
| 3389 | 2599520786 | |||
| 3390 | 2599736919 | |||
| 3391 | 2599742968 | |||
| 3392 | 2599807061 | |||
| 3393 | 2599880251 | |||
| 3394 | 2599891774 | |||
| 3395 | 2599934533 | |||
| 3396 | 2599947038 | |||
| 3397 | 2599997666 | |||
| 3398 | 2600196576 | |||
| 3399 | 2600205086 | |||
| 3400 | 2600217849 | |||
| 3401 | 2600367143 | |||
| 3402 | 2600813689 | |||
| 3403 | 2601691721 | |||
| 3404 | 2601778016 | |||
| 3405 | 2601800442 | |||
| 3406 | 2603860738 | |||
| 3407 | 2606078750 | |||
| 3408 | 2606125590 | |||
| 3409 | 2608384783 | |||
| 3410 | 2617352646 | |||
| 3411 | 2621300109 | |||
| 3412 | 2624482857 | |||
| 3413 | 2624494398 | |||
| 3414 | 2640733327 | |||
| 3415 | 2643870462 | |||
| 3416 | 2643957544 | |||
| 3417 | 2644025658 | |||
| 3418 | 2644187769 | |||
| 3419 | 2644286016 | |||
| 3420 | 2644620945 | |||
| 3421 | 2652546489 | |||
| 3422 | 2671100821 | |||
| 3423 | 2671123198 | |||
| 3424 | 2671773381 | |||
| 3425 | 2676742075 | |||
| 3426 | 2677896142 | |||
| 3427 | 2678230358 | |||
| 3428 | 2678265435 | |||
| 3429 | 2713478362 | |||
| 3430 | 2715752293 | |||
| 3431 | 2715759032 | |||
| 3432 | 2718636071 | |||
| 3433 | 2719641431 | |||
| 3434 | 2723248548 | |||
| 3435 | 2723876852 | |||
| 3436 | 2728755563 | |||
| 3437 | 2738670118 | |||
| 3438 | 2738747478 | |||
| 3439 | 2738748511 | |||
| 3440 | 2738806472 | |||
| 3441 | 2738821679 | |||
| 3442 | 2738834161 | |||
| 3443 | 2738857553 | |||
| 3444 | 2738875365 | |||
| 3445 | 2738893832 | |||
| 3446 | 2739187318 | |||
| 3447 | 2739198203 | |||
| 3448 | 2739221963 | |||
| 3449 | 2739260967 | |||
| 3450 | 2739316604 | |||
| 3451 | 2739356760 | |||
| 3452 | 2743739885 | |||
| 3453 | 2745005889 | |||
| 3454 | 2745076265 | |||
| 3455 | 2746088626 | |||
| 3456 | 2746092665 | |||
| 3457 | 2753569568 | |||
| 3458 | 2765568384 | |||
| 3459 | 2765585051 | |||
| 3460 | 2774121769 | |||
| 3461 | 2774137010 | |||
| 3462 | 2774389083 | |||
| 3463 | 2774439282 | |||
| 3464 | 2784262363 | |||
| 3465 | 2784314432 | |||
| 3466 | 2792835730 | |||
| 3467 | 2793066538 | |||
| 3468 | 2793076444 | |||
| 3469 | 2794598424 | |||
| 3470 | 2805917048 | |||
| 3471 | 2807409124 | |||
| 3472 | 2807457460 | |||
| 3473 | 2808857989 | |||
| 3474 | 2808926603 | |||
| 3475 | 2808930823 | |||
| 3476 | 2808937483 | |||
| 3477 | 2808948764 | |||
| 3478 | 2808952945 | |||
| 3479 | 2808959275 | |||
| 3480 | 2808966474 | |||
| 3481 | 2808971679 | |||
| 3482 | 2808978809 | |||
| 3483 | 2808994541 | |||
| 3484 | 2809001357 | |||
| 3485 | 2809006508 | |||
| 3486 | 2809013574 | |||
| 3487 | 2809219320 | |||
| 3488 | 2812365946 | |||
| 3489 | 2817259975 | |||
| 3490 | 2817277638 | |||
| 3491 | 2817456949 | |||
| 3492 | 2817491456 | |||
| 3493 | 2818242545 | |||
| 3494 | 2819545352 | |||
| 3495 | 2819591891 | |||
| 3496 | 2819617133 | |||
| 3497 | 2819632420 | |||
| 3498 | 2819659149 | |||
| 3499 | 2819706489 | |||
| 3500 | 2823421333 | |||
| 3501 | 2824662494 | |||
| 3502 | 2824675296 | |||
| 3503 | 2824681171 | |||
| 3504 | 2824691529 | |||
| 3505 | 2824697389 | |||
| 3506 | 2824705587 | |||
| 3507 | 2824756315 | |||
| 3508 | 2824763999 | |||
| 3509 | 2824780255 | |||
| 3510 | 2825655671 | |||
| 3511 | 2829750805 | |||
| 3512 | 2834033508 | |||
| 3513 | 2834643852 | |||
| 3514 | 2838125323 | |||
| 3515 | 2839094729 | |||
| 3516 | 2841942024 | |||
| 3517 | 2841951436 | |||
| 3518 | 2841958886 | |||
| 3519 | 2841968549 | |||
| 3520 | 2841976250 | |||
| 3521 | 2841987615 | |||
| 3522 | 2842324598 | |||
| 3523 | 2842348877 | |||
| 3524 | 2842457417 | |||
| 3525 | 2842701310 | |||
| 3526 | 2842827179 | |||
| 3527 | 2842837009 | |||
| 3528 | 2842843270 | |||
| 3529 | 2842847748 | |||
| 3530 | 2844666436 | |||
| 3531 | 2847944618 | |||
| 3532 | 2849081147 | |||
| 3533 | 2852614196 | |||
| 3534 | 2852660982 | |||
| 3535 | 2852668067 | |||
| 3536 | 2857524823 | |||
| 3537 | 2858697851 | |||
| 3538 | 2860343842 | |||
| 3539 | 2860870355 | |||
| 3540 | 2861694362 | |||
| 3541 | 2863421460 | |||
| 3542 | 2870069115 | |||
| 3543 | 2874634662 | |||
| 3544 | 2874649980 | |||
| 3545 | 2876775494 | |||
| 3546 | 2876826154 | |||
| 3547 | 2878034790 | |||
| 3548 | 2879079419 | |||
| 3549 | 2879109696 | |||
| 3550 | 2880235439 | |||
| 3551 | 2881667671 | |||
| 3552 | 2883094639 | |||
| 3553 | 2884816851 | |||
| 3554 | 2884837720 | |||
| 3555 | 2884854012 | |||
| 3556 | 2885268788 | |||
| 3557 | 2885279763 | |||
| 3558 | 2885382926 | |||
| 3559 | 2888381938 | |||
| 3560 | 2888388706 | |||
| 3561 | 2889310086 | |||
| 3562 | 2893069337 | |||
| 3563 | 2896154871 | |||
| 3564 | 2900637315 | |||
| 3565 | 2901310331 | |||
| 3566 | 2902335314 | |||
| 3567 | 2902691213 | |||
| 3568 | 2903749683 | |||
| 3569 | 2903768483 | |||
| 3570 | 2904425814 | |||
| 3571 | 2904442763 | |||
| 3572 | 2904522997 | |||
| 3573 | 2904535024 | |||
| 3574 | 2904555906 | |||
| 3575 | 2904565638 | |||
| 3576 | 2904572681 | |||
| 3577 | 2904588638 | |||
| 3578 | 2904594288 | |||
| 3579 | 2904604870 | |||
| 3580 | 2904618979 | |||
| 3581 | 2904698894 | |||
| 3582 | 2904701082 | |||
| 3583 | 2904720417 | |||
| 3584 | 2906616379 | |||
| 3585 | 2906630520 | |||
| 3586 | 2906638167 | |||
| 3587 | 2906648302 | |||
| 3588 | 2906662842 | |||
| 3589 | 2908449357 | |||
| 3590 | 2908741515 | |||
| 3591 | 2908758690 | |||
| 3592 | 2909044301 | |||
| 3593 | 2912967314 | |||
| 3594 | 2913041983 | |||
| 3595 | 2917076145 | |||
| 3596 | 2919067828 | |||
| 3597 | 2919078709 | |||
| 3598 | 2919083108 | |||
| 3599 | 2919156997 | |||
| 3600 | 2919185346 | |||
| 3601 | 2919390716 | |||
| 3602 | 2919461788 | |||
| 3603 | 2919490995 | |||
| 3604 | 2919502954 | |||
| 3605 | 2919701501 | |||
| 3606 | 2921651754 | |||
| 3607 | 2922371887 | |||
| 3608 | 2922399395 | |||
| 3609 | 2922431625 | |||
| 3610 | 2923158975 | |||
| 3611 | 2923514254 | |||
| 3612 | 2923519967 | |||
| 3613 | 2923592039 | |||
| 3614 | 2926064627 | |||
| 3615 | 2928060545 | |||
| 3616 | 2928113569 | |||
| 3617 | 2928127025 | |||
| 3618 | 2928132965 | |||
| 3619 | 2928140718 | |||
| 3620 | 2928159957 | |||
| 3621 | 2928164002 | |||
| 3622 | 2928177132 | |||
| 3623 | 2928506165 | |||
| 3624 | 2928538796 | |||
| 3625 | 2929149362 | |||
| 3626 | 2929192855 | |||
| 3627 | 2929616762 | |||
| 3628 | 2929625506 | |||
| 3629 | 2931373221 | |||
| 3630 | 2931393647 | |||
| 3631 | 2931397512 | |||
| 3632 | 2932791215 | |||
| 3633 | 2932799262 | |||
| 3634 | 2932803743 | |||
| 3635 | 2932811602 | |||
| 3636 | 2932826481 | |||
| 3637 | 2932834173 | |||
| 3638 | 2933577955 | |||
| 3639 | 2935359569 | |||
| 3640 | 2935610601 | |||
| 3641 | 2935624003 | |||
| 3642 | 2935635821 | |||
| 3643 | 2935647049 | |||
| 3644 | 2935656209 | |||
| 3645 | 2935665081 | |||
| 3646 | 2935674259 | |||
| 3647 | 2935682431 | |||
| 3648 | 2935691646 | |||
| 3649 | 2935699520 | |||
| 3650 | 2935707749 | |||
| 3651 | 2935719480 | |||
| 3652 | 2935728920 | |||
| 3653 | 2935737839 | |||
| 3654 | 2935747215 | |||
| 3655 | 2935757985 | |||
| 3656 | 2935766623 | |||
| 3657 | 2935770613 | |||
| 3658 | 2935787102 | |||
| 3659 | 2935795150 | |||
| 3660 | 2935809496 | |||
| 3661 | 2935817745 | |||
| 3662 | 2935820098 | |||
| 3663 | 2935836316 | |||
| 3664 | 2935845227 | |||
| 3665 | 2935849891 | |||
| 3666 | 2935862147 | |||
| 3667 | 2935870926 | |||
| 3668 | 2935881319 | |||
| 3669 | 2935884379 | |||
| 3670 | 2935914421 | |||
| 3671 | 2935918971 | |||
| 3672 | 2935932198 | |||
| 3673 | 2935940796 | |||
| 3674 | 2935948617 | |||
| 3675 | 2935957276 | |||
| 3676 | 2935963705 | |||
| 3677 | 2935973752 | |||
| 3678 | 2935979591 | |||
| 3679 | 2935991446 | |||
| 3680 | 2936001066 | |||
| 3681 | 2936005507 | |||
| 3682 | 2936019051 | |||
| 3683 | 2936023156 | |||
| 3684 | 2936032391 | |||
| 3685 | 2936042038 | |||
| 3686 | 2936050252 | |||
| 3687 | 2936061040 | |||
| 3688 | 2939641782 | |||
| 3689 | 2939654813 | |||
| 3690 | 2940564104 | |||
| 3691 | 2941512342 | |||
| 3692 | 2941520153 | |||
| 3693 | 2941528302 | |||
| 3694 | 2941535088 | |||
| 3695 | 2941545554 | |||
| 3696 | 2945933193 | |||
| 3697 | 2945938132 | |||
| 3698 | 2945964169 | |||
| 3699 | 2946009422 | |||
| 3700 | 2946030598 | |||
| 3701 | 2947238085 | |||
| 3702 | 2954768657 | |||
| 3703 | 2969309608 | |||
| 3704 | 2974294659 | |||
| 3705 | 2981994395 | |||
| 3706 | 2984287193 | |||
| 3707 | 2984288840 | |||
| 3708 | 2988730907 | |||
| 3709 | 2989350406 | |||
| 3710 | 2990705151 | |||
| 3711 | 2998144859 | |||
| 3712 | 3005481420 | |||
| 3713 | 3005596954 | |||
| 3714 | 3005712985 | |||
| 3715 | 3007398599 | |||
| 3716 | 3007420403 | |||
| 3717 | 3007615237 | |||
| 3718 | 3007722248 | |||
| 3719 | 3007805579 | |||
| 3720 | 3007860066 | |||
| 3721 | 3007866316 | |||
| 3722 | 3007875826 | |||
| 3723 | 637322682 | |||
| 3724 | 641337799 | |||
| 3725 | 642426204 | |||
| 3726 | 642418069 | |||
| 3727 | 642594385 | |||
| 3728 | 642622962 | |||
| 3729 | 643392226 | |||
| 3730 | 644749367 | |||
| 3731 | 8002395155 | |||
| 3732 | 8003404808 | |||
| 3733 | 8003957387 | |||
| 3734 | 8006978949 | |||
| 3735 | 8006984758 | |||
| 3736 | 8015691454 | |||
| 3737 | 8015693061 | |||
| 3738 | 8016515794 | |||
| 3739 | 8016590007 | |||
| 3740 | 8016633442 | |||
| 3741 | 8017060710 | |||
| 3742 | 8018850683 | |||
| 3743 | 8019565157 | |||
| 3744 | 8019575258 | |||
| 3745 | 8019587945 | |||
| 3746 | 8019603385 | |||
| 3747 | 8019625695 | |||
| 3748 | 8019636598 | |||
| 3749 | 8019655918 | |||
| 3750 | 8019664394 | |||
| 3751 | 8019673988 | |||
| 3752 | 8019682137 | |||
| 3753 | 8019687915 | |||
| 3754 | 8019771402 | |||
| 3755 | 8019781882 | |||
| 3756 | 8020808528 | |||
| 3757 | 8020939546 | |||
| 3758 | 8020947590 | |||
| 3759 | 8020953868 | |||
| 3760 | 8021126839 | |||
| 3761 | 8029996036 | |||
| 3762 | 8034965501 | |||
| 3763 | 8039099099 | |||
| 3764 | 8040170898 | |||
| 3765 | 8040175189 | |||
| 3766 | 8052496445 | |||
| 3767 | 8054287003 | |||
| 3768 | 8054352507 | |||
| 3769 | 8054506606 | |||
| 3770 | 8054932440 | |||
| 3771 | 8055267438 | |||
| 3772 | 8055748408 | |||
| 3773 | 8055774627 | |||
| 3774 | 8055776308 | |||
| 3775 | 8055821390 | |||
| 3776 | 8055882006 | |||
| 3777 | 8056119491 | |||
| 3778 | 8056122578 | |||
| 3779 | 8056131072 | |||
| 3780 | 8056134487 | |||
| 3781 | 8056139304 | |||
| 3782 | 8056154876 | |||
| 3783 | 8056158178 | |||
| 3784 | 8056165834 | |||
| 3785 | 8056171709 | |||
| 3786 | 8056172388 | |||
| 3787 | 8056179134 | |||
| 3788 | 8056571888 | |||
| 3789 | 8056687265 | |||
| 3790 | 8056690650 | |||
| 3791 | 8056976201 | |||
| 3792 | 8057805148 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3v8g-assembly1.cif.gz_C | crystal structure of an asymmetric trimer of a glutamate transporter homologue (gltph) | 0.8316 | 2 | 373 |
| 7ngh-assembly1.cif.gz_C | structure of glutamate transporter homologue in complex with sybody | 0.8294 | 1 | 381 |
| 6wyj-assembly1.cif.gz_A | cryo-em structure of the gltph l152c-g321c mutant in the intermediate state | 0.8198 | 1 | 373 |
| 6uwl-assembly1.cif.gz_A | gltph in complex with l-aspartate and sodium ions in intermediate outward-facing state | 0.8174 | 2 | 373 |
| 2nwx-assembly1.cif.gz_A | crystal structure of gltph in complex with l-aspartate and sodium ions | 0.8148 | 2 | 373 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P0A830_1_408_1.10.3860.10 | Mainly Alpha;Orthogonal Bundle;Proton glutamate symport protein;Sodium:dicarboxylate symporter | 0.9076 | 1 | 378 | 1.10.3860.10 |
| af_P71906_20_424_1.10.3860.10 | Mainly Alpha;Orthogonal Bundle;Proton glutamate symport protein;Sodium:dicarboxylate symporter | 0.9022 | 1 | 378 | 1.10.3860.10 |
| af_P21345_1_417_1.10.3860.10 | Mainly Alpha;Orthogonal Bundle;Proton glutamate symport protein;Sodium:dicarboxylate symporter | 0.8832 | 1 | 378 | 1.10.3860.10 |
| af_P71906_20_424_1.10.3860.10 | Mainly Alpha;Orthogonal Bundle;Proton glutamate symport protein;Sodium:dicarboxylate symporter | 0.8436 | 1 | 378 | 1.10.3860.10 |
| af_Q9UAY8_3_451_1.10.3860.10 | Mainly Alpha;Orthogonal Bundle;Proton glutamate symport protein;Sodium:dicarboxylate symporter | 0.8317 | 2 | 376 | 1.10.3860.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A8B3G339-F1-model_v4 | Efflux pump membrane transporter | 0.9478 | 2 | 323 |
GO:0005886
GO:0015293 GO:0015562 GO:0042910 GO:0046942 |
| AF-A0A2R7QME8-F1-model_v4 | C4-dicarboxylate transporter DctA | 0.9457 | 2 | 254 |
GO:0005886
GO:0015138 GO:0015141 GO:0015366 GO:0070778 |
| AF-A0A2V8D4W6-F1-model_v4 | C4-dicarboxylate transporter DctA | 0.9435 | 4 | 219 |
GO:0005886
GO:0015138 GO:0015141 GO:0015366 GO:0070778 |
| AF-A0A519XQT8-F1-model_v4 | deleted | 0.9429 | 1 | 206 |
|
| AF-A0A3M3T398-F1-model_v4 | deleted | 0.936 | 2 | 208 |
|