F496003

General Info

Members Datasets Scaffolds Average Seq Length
1896 539 3792 233

Family's Representative Sequence

Representative Sequence 3300031344|Ga0265316_10018043|Ga0265316_100180434
Length 254
Sequence MRSGVIAQKVGMTRLFTEQGEHVPVTVLRLAQCQVVGHRSKDKNGYVALQLGAGPRRANNMSKADRGYFAKASVEPKRKLAEFRVTDDAMIPVGAEITADHFVAGQFVDVCGITIGKGFAGAMKRWNFAGLRASHGVSISHRSIGGTGGRQDPGKTFKNKKMPGHLGVDRVTTLNLRVVSTDVERGLLLVEGSVPGAKGGWITVRDAVKKSLPKGAPKPGKFRLADAGAKIDPSQPQVQPAEPAAAEASKTEGA

Samples

Sample ID Description Type Environment
1 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
2 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
3 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
4 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
5 3300000045 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere Metagenome Rhizosphere
6 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
7 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
8 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
9 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
10 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
11 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
12 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
13 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
14 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
15 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
16 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
17 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
18 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
19 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
20 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
21 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
22 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
23 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
24 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
25 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
26 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
27 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
28 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
29 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
30 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
31 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
32 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
33 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
34 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
35 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
36 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
37 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
38 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
39 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
40 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
41 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
42 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
43 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
44 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
45 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
46 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
47 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
48 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
49 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
50 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
51 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
52 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
53 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
54 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
55 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
56 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
57 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
58 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
59 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
60 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
61 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
62 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
63 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
64 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
65 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
66 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
67 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
68 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
69 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
70 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
71 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
72 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
73 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
74 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
75 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
76 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
77 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
78 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
79 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
80 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
81 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
82 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
83 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
84 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
85 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
86 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
87 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
88 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
89 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
90 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
91 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
92 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
93 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
94 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
95 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
96 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
97 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
98 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
99 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
100 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
101 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
102 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
103 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
104 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
105 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
106 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
107 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
108 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
109 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
110 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
111 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
112 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
113 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
114 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
115 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
116 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
117 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
118 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
119 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
120 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
121 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
122 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
123 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
124 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
125 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
126 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
127 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
128 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
129 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
130 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
131 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
132 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
133 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
134 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
135 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
136 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
137 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
138 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
139 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
140 3300012477 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.3.yng.040610 Metagenome Rhizosphere
141 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
142 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
143 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
144 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
145 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
146 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
147 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
148 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
149 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
150 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
151 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
152 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
153 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
154 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
155 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
156 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
157 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
158 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
159 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
160 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
162 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
163 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
164 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
165 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
166 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
231 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
232 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
233 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
234 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
235 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
236 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
238 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
239 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
240 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
241 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
242 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
243 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
244 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
245 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
246 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
247 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
248 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
249 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
250 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
251 3300030763 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
252 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
253 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
254 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
255 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
256 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
257 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
258 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
259 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
260 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
261 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
262 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
263 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
264 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
265 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
266 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
267 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
268 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
269 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
270 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
271 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
272 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
273 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
274 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
275 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
276 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
277 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
278 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
279 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
280 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
281 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
282 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
283 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
284 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
285 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
286 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
287 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
288 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
289 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
290 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
291 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
292 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
293 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
294 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
295 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
296 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
297 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
298 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
299 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
300 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
301 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
302 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
303 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
304 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
305 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
306 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
307 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
308 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
309 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
310 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
311 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
312 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
313 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
314 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
315 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
316 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
317 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
318 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
319 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
320 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
321 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
322 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
323 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
324 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
325 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
326 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
327 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
328 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
329 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
330 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
331 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
332 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
333 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
334 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
335 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
336 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
337 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
338 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
339 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
340 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
341 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
342 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
343 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
344 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
345 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
346 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
347 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
348 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
349 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
350 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
351 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
352 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
353 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
354 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
355 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
356 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
357 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
358 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
359 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
360 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
361 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
362 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
363 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
364 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
365 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
366 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
367 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
368 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
369 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
370 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
371 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
372 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
373 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
374 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
375 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
376 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
377 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
378 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
379 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
380 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
381 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
382 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
383 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
384 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
385 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
386 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
387 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
388 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
389 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
390 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
391 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
392 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
393 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
394 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
395 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
396 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
397 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
398 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
399 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
400 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
401 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
402 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
403 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
404 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
405 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
406 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
407 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
408 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
409 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
410 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
411 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
412 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
413 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
414 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
415 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
416 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
417 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
418 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
419 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
420 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
421 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
422 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
423 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
424 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
425 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
426 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
427 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
428 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
429 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
430 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
431 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
432 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
433 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
434 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
435 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
436 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
437 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
438 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
439 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
440 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
441 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
442 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
443 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
444 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
445 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
446 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
447 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
448 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
449 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
450 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
451 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
452 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
453 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
454 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
455 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
456 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
457 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
458 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
459 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
460 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
461 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
462 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
463 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
464 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
465 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
466 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
467 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
468 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
469 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
470 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
471 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
472 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
473 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
474 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
475 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
476 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
477 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
478 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
479 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
480 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
481 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
482 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
483 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
484 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
485 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
486 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
487 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
488 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
489 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
490 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
491 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
492 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
493 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
494 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
495 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
496 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
497 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
498 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
499 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
500 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
501 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
502 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
503 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
504 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
505 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
506 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
507 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
508 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
509 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
510 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
511 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
512 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
513 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
514 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
515 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
516 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
517 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
518 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
519 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
520 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
521 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
522 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
523 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
524 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
525 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
526 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
527 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
528 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
529 2643221651 Afipia sp. Root123D2 Isolate Unclassified
530 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
531 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
532 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
533 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
534 2904699407
535 2906610324
536 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
537 2922425934
538 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
539 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 99.1
Metatranscriptomes 0.26
Isolates 0.63

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.69
Nodule 0.26
Rhizoplane 4.38
Rhizosphere 87.5
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265316_10018043 3300031344 Bacteria 6080
2 ARcpr5oldR_c000035 3300000041 Bacteria 26838
3 ARcpr5yngRDRAFT_c000212 3300000043 Bacteria 8945
4 ARcpr5yngRDRAFT_c001457 3300000043 Bacteria 2608
5 ARSoilOldRDRAFT_c000208 3300000044 Bacteria 9345
6 ARSoilOldRDRAFT_c001089 3300000044 Bacteria 2613
7 ARCol0oldRDRAFT_c00767 3300000045 Bacteria 2705
8 LJQas_1006294 3300000549 Bacteria 1482
9 ARCol0yngRDRAFT_1000025 3300000652 Bacteria 26845
10 JGI24747J21853_1003301 3300001978 Bacteria 1388
11 JGI24739J22299_10001271 3300001989 Bacteria 9474
12 JGI24737J22298_10002998 3300001990 Bacteria 5985
13 JGI24737J22298_10007299 3300001990 Bacteria 3735
14 JGI24737J22298_10020339 3300001990 Bacteria 2119
15 JGI24735J21928_10012540 3300002067 Bacteria 2677
16 JGI24750J21931_1001136 3300002070 Bacteria 3432
17 JGI24745J21846_1000034 3300002073 Bacteria 9049
18 JGI24745J21846_1000277 3300002073 Bacteria 4362
19 JGI24748J21848_1000741 3300002074 Bacteria 3527
20 JGI24738J21930_10001754 3300002075 Bacteria 5922
21 JGI24749J21850_1002096 3300002076 Bacteria 2811
22 JGI24744J21845_10000241 3300002077 Bacteria 8837
23 JGI24742J22300_10000465 3300002244 Bacteria 6004
24 JGI25406J46586_10002015 3300003203 Bacteria 9596
25 JGI25165J46597_1001315 3300003214 Bacteria 14050
26 JGI25153J46596_10010402 3300003215 Bacteria 4210
27 Ga0007410J51695_1034900 3300003574 Bacteria 1895
28 JGI25404J52841_10015726 3300003659 Bacteria 1642
29 Ga0058862_12808773 3300004803 Bacteria 3691
30 Ga0065712_10138949 3300005290 Bacteria 1468
31 Ga0065715_10002813 3300005293 Bacteria 5934
32 Ga0065715_10009083 3300005293 Bacteria 5124
33 Ga0070658_10018691 3300005327 Bacteria 5551
34 Ga0070658_10021396 3300005327 Bacteria 5184
35 Ga0070658_10059824 3300005327 Bacteria 3102
36 Ga0070658_10416724 3300005327 Bacteria 1154
37 Ga0070676_10001242 3300005328 Bacteria 12829
38 Ga0070676_10018760 3300005328 Bacteria 3838
39 Ga0070676_10200933 3300005328 Bacteria 1306
40 Ga0070676_10201179 3300005328 Bacteria 1306
41 Ga0070676_10406381 3300005328 Bacteria 949
42 Ga0070683_100002064 3300005329 Bacteria 15853
43 Ga0070683_100404282 3300005329 Bacteria 1302
44 Ga0070683_100678487 3300005329 Bacteria 987
45 Ga0070690_100020216 3300005330 Bacteria 4054
46 Ga0070690_100027028 3300005330 Bacteria 3544
47 Ga0070690_100064067 3300005330 Bacteria 2373
48 Ga0070670_100006103 3300005331 Bacteria 10185
49 Ga0070670_100036557 3300005331 Bacteria 4226
50 Ga0070670_100305757 3300005331 Bacteria 1391
51 Ga0070670_100356512 3300005331 Bacteria 1285
52 Ga0070677_10003234 3300005333 Bacteria 5245
53 Ga0070677_10211984 3300005333 Bacteria 941
54 Ga0068869_100000755 3300005334 Bacteria 18338
55 Ga0068869_100049348 3300005334 Bacteria 3046
56 Ga0068869_100336424 3300005334 Bacteria 1228
57 Ga0070666_10044127 3300005335 Bacteria 2986
58 Ga0070666_10071615 3300005335 Bacteria 2359
59 Ga0070666_10087332 3300005335 Bacteria 2137
60 Ga0070666_10115779 3300005335 Bacteria 1856
61 Ga0070680_100013921 3300005336 Bacteria 6276
62 Ga0070680_100020347 3300005336 Bacteria 5268
63 Ga0070680_100046330 3300005336 Bacteria 3537
64 Ga0070680_100052990 3300005336 Bacteria 3311
65 Ga0070680_100062663 3300005336 Bacteria 3045
66 Ga0070680_100089957 3300005336 Bacteria 2540
67 Ga0070680_100137909 3300005336 Bacteria 2044
68 Ga0070680_100138570 3300005336 Bacteria 2039
69 Ga0070680_100143239 3300005336 Bacteria 2004
70 Ga0070680_100225377 3300005336 Bacteria 1582
71 Ga0070680_100232973 3300005336 Bacteria 1556
72 Ga0070682_100000693 3300005337 Bacteria 20306
73 Ga0070682_100067778 3300005337 Bacteria 2273
74 Ga0070682_100304094 3300005337 Bacteria 1171
75 Ga0068868_100043374 3300005338 Bacteria 3513
76 Ga0068868_100044894 3300005338 Bacteria 3456
77 Ga0068868_100201743 3300005338 Bacteria 1658
78 Ga0070660_100001324 3300005339 Bacteria 16829
79 Ga0070660_100004264 3300005339 Bacteria 9871
80 Ga0070660_100088013 3300005339 Bacteria 2445
81 Ga0070660_100233572 3300005339 Bacteria 1496
82 Ga0070660_100297578 3300005339 Bacteria 1322
83 Ga0070660_100387271 3300005339 Bacteria 1154
84 Ga0070660_100459760 3300005339 Bacteria 1056
85 Ga0070689_100031007 3300005340 Bacteria 4061
86 Ga0070689_100051095 3300005340 Bacteria 3195
87 Ga0070689_100051585 3300005340 Bacteria 3180
88 Ga0070691_10000386 3300005341 Bacteria 16019
89 Ga0070691_10000795 3300005341 Bacteria 12588
90 Ga0070691_10078003 3300005341 Bacteria 1617
91 Ga0070687_100000768 3300005343 Bacteria 10675
92 Ga0070687_100017582 3300005343 Bacteria 3291
93 Ga0070661_100005946 3300005344 Bacteria 8403
94 Ga0070661_100006236 3300005344 Bacteria 8222
95 Ga0070661_100197586 3300005344 Bacteria 1536
96 Ga0070692_10011093 3300005345 Bacteria 4127
97 Ga0070668_100002043 3300005347 Bacteria 14764
98 Ga0070668_100277534 3300005347 Bacteria 1399
99 Ga0070668_100330482 3300005347 Bacteria 1285
100 Ga0070669_100004204 3300005353 Bacteria 10419
101 Ga0070669_100056953 3300005353 Bacteria 2866
102 Ga0070669_100147551 3300005353 Bacteria 1818
103 Ga0070675_100004033 3300005354 Bacteria 11145
104 Ga0070675_100142778 3300005354 Bacteria 2047
105 Ga0070671_100029434 3300005355 Bacteria 4528
106 Ga0070671_100223769 3300005355 Bacteria 1596
107 Ga0070671_100514334 3300005355 Bacteria 1030
108 Ga0070674_100001294 3300005356 Bacteria 13164
109 Ga0070674_100031711 3300005356 Bacteria 3504
110 Ga0070674_100058873 3300005356 Bacteria 2672
111 Ga0070674_100379629 3300005356 Bacteria 1149
112 Ga0070673_100002364 3300005364 Bacteria 11471
113 Ga0070673_100026334 3300005364 Bacteria 4294
114 Ga0070673_100101196 3300005364 Bacteria 2373
115 Ga0070673_100786292 3300005364 Bacteria 878
116 Ga0070688_100035071 3300005365 Bacteria 3045
117 Ga0070688_100100102 3300005365 Bacteria 1909
118 Ga0070688_100200154 3300005365 Bacteria 1397
119 Ga0070688_100219310 3300005365 Bacteria 1340
120 Ga0070688_100233871 3300005365 Bacteria 1301
121 Ga0070659_100005048 3300005366 Bacteria 9461
122 Ga0070659_100018128 3300005366 Bacteria 5309
123 Ga0070659_100046184 3300005366 Bacteria 3414
124 Ga0070667_100010781 3300005367 Bacteria 7552
125 Ga0070667_100052294 3300005367 Bacteria 3446
126 Ga0070667_100214012 3300005367 Bacteria 1714
127 Ga0070667_100251409 3300005367 Bacteria 1580
128 Ga0070667_100339918 3300005367 Bacteria 1357
129 Ga0070667_100489645 3300005367 Bacteria 1126
130 Ga0070709_10003511 3300005434 Bacteria 8423
131 Ga0070709_10022452 3300005434 Bacteria 3691
132 Ga0070709_10048294 3300005434 Bacteria 2655
133 Ga0070709_10064061 3300005434 Bacteria 2350
134 Ga0070709_10308544 3300005434 Bacteria 1157
135 Ga0070709_10385642 3300005434 Bacteria 1043
136 Ga0070714_100009083 3300005435 Bacteria 7794
137 Ga0070714_100011419 3300005435 Bacteria 7044
138 Ga0070714_100017244 3300005435 Bacteria 5847
139 Ga0070714_100027595 3300005435 Bacteria 4703
140 Ga0070714_100107950 3300005435 Bacteria 2461
141 Ga0070714_100142833 3300005435 Bacteria 2150
142 Ga0070714_100148074 3300005435 Bacteria 2113
143 Ga0070714_100305726 3300005435 Bacteria 1483
144 Ga0070714_100339019 3300005435 Bacteria 1410
145 Ga0070714_100731402 3300005435 Bacteria 956
146 Ga0070713_100000012 3300005436 Bacteria 137708
147 Ga0070713_100042539 3300005436 Bacteria 3709
148 Ga0070713_100051698 3300005436 Bacteria 3399
149 Ga0070713_100060535 3300005436 Bacteria 3165
150 Ga0070713_100103102 3300005436 Bacteria 2475
151 Ga0070713_100617693 3300005436 Bacteria 1031
152 Ga0070710_10005644 3300005437 Bacteria 5958
153 Ga0070710_10014954 3300005437 Bacteria 3916
154 Ga0070710_10052773 3300005437 Bacteria 2287
155 Ga0070710_10103973 3300005437 Bacteria 1696
156 Ga0070710_10146698 3300005437 Bacteria 1452
157 Ga0070701_10318394 3300005438 Bacteria 962
158 Ga0070711_100004304 3300005439 Bacteria 8381
159 Ga0070711_100027798 3300005439 Bacteria 3716
160 Ga0070711_100079027 3300005439 Bacteria 2339
161 Ga0070711_100140078 3300005439 Bacteria 1812
162 Ga0070711_100145188 3300005439 Bacteria 1783
163 Ga0070711_100286851 3300005439 Bacteria 1304
164 Ga0070711_100746895 3300005439 Bacteria 827
165 Ga0070705_100001981 3300005440 Bacteria 10455
166 Ga0070705_100068685 3300005440 Bacteria 2133
167 Ga0070700_100017413 3300005441 Bacteria 4108
168 Ga0070694_100007138 3300005444 Bacteria 6802
169 Ga0070694_100010924 3300005444 Bacteria 5618
170 Ga0070708_100060973 3300005445 Bacteria 3368
171 Ga0070708_100469201 3300005445 Bacteria 1188
172 Ga0070663_100010153 3300005455 Bacteria 5859
173 Ga0070663_100028446 3300005455 Bacteria 3805
174 Ga0070663_100150267 3300005455 Bacteria 1785
175 Ga0070663_100290596 3300005455 Bacteria 1305
176 Ga0070678_100004700 3300005456 Bacteria 7775
177 Ga0070678_100006525 3300005456 Bacteria 6852
178 Ga0070678_100010048 3300005456 Bacteria 5761
179 Ga0070678_100202402 3300005456 Bacteria 1639
180 Ga0070678_100492298 3300005456 Bacteria 1081
181 Ga0070678_100677019 3300005456 Bacteria 927
182 Ga0070678_100720491 3300005456 Bacteria 900
183 Ga0070662_100007011 3300005457 Bacteria 7290
184 Ga0070662_100049113 3300005457 Bacteria 3042
185 Ga0070662_100464192 3300005457 Bacteria 1052
186 Ga0070681_10000037 3300005458 Bacteria 96087
187 Ga0070681_10010029 3300005458 Bacteria 9338
188 Ga0070681_10029025 3300005458 Bacteria 5554
189 Ga0070681_10029349 3300005458 Bacteria 5523
190 Ga0070681_10066848 3300005458 Bacteria 3563
191 Ga0070681_10078949 3300005458 Bacteria 3248
192 Ga0070681_10111364 3300005458 Bacteria 2676
193 Ga0070681_10218303 3300005458 Bacteria 1823
194 Ga0070681_10410685 3300005458 Bacteria 1265
195 Ga0070681_10598653 3300005458 Bacteria 1017
196 Ga0070681_10867119 3300005458 Bacteria 821
197 Ga0068867_100003543 3300005459 Bacteria 10976
198 Ga0068867_100040232 3300005459 Bacteria 3410
199 Ga0068867_100137801 3300005459 Bacteria 1904
200 Ga0068867_100820916 3300005459 Bacteria 831
201 Ga0070685_10222405 3300005466 Bacteria 1238
202 Ga0070699_100265743 3300005518 Bacteria 1535
203 Ga0070679_100008411 3300005530 Bacteria 9712
204 Ga0070679_100035943 3300005530 Bacteria 4915
205 Ga0070679_100058331 3300005530 Bacteria 3846
206 Ga0070679_100069873 3300005530 Bacteria 3503
207 Ga0070679_100186092 3300005530 Bacteria 2047
208 Ga0070679_100255070 3300005530 Bacteria 1709
209 Ga0070684_100007624 3300005535 Bacteria 8437
210 Ga0070684_100276337 3300005535 Bacteria 1538
211 Ga0070684_100470348 3300005535 Bacteria 1163
212 Ga0068853_100002020 3300005539 Bacteria 15004
213 Ga0068853_100002660 3300005539 Bacteria 13466
214 Ga0068853_100023191 3300005539 Bacteria 5193
215 Ga0068853_100117767 3300005539 Bacteria 2366
216 Ga0068853_100125502 3300005539 Bacteria 2292
217 Ga0070672_100002637 3300005543 Bacteria 11467
218 Ga0070672_100003392 3300005543 Bacteria 10324
219 Ga0070672_100286596 3300005543 Bacteria 1394
220 Ga0070686_100004029 3300005544 Bacteria 8075
221 Ga0070686_100202066 3300005544 Bacteria 1425
222 Ga0070686_100351558 3300005544 Bacteria 1107
223 Ga0070695_100003098 3300005545 Bacteria 9679
224 Ga0070695_100014423 3300005545 Bacteria 4764
225 Ga0070695_100039405 3300005545 Bacteria 2986
226 Ga0070696_100010916 3300005546 Bacteria 6087
227 Ga0070693_100051681 3300005547 Bacteria 2354
228 Ga0070693_100054219 3300005547 Bacteria 2305
229 Ga0070693_100214218 3300005547 Bacteria 1258
230 Ga0070693_100251057 3300005547 Bacteria 1172
231 Ga0070665_100014624 3300005548 Bacteria 7876
232 Ga0070665_100128255 3300005548 Bacteria 2539
233 Ga0070665_100174797 3300005548 Bacteria 2148
234 Ga0070665_100271609 3300005548 Bacteria 1697
235 Ga0070665_100291751 3300005548 Bacteria 1633
236 Ga0070665_100377545 3300005548 Bacteria 1425
237 Ga0070665_100675610 3300005548 Bacteria 1046
238 Ga0070704_100004936 3300005549 Bacteria 7744
239 Ga0068855_100012001 3300005563 Bacteria 10474
240 Ga0068855_100047378 3300005563 Bacteria 5078
241 Ga0068855_100057023 3300005563 Bacteria 4580
242 Ga0068855_100093513 3300005563 Bacteria 3467
243 Ga0068855_100149068 3300005563 Bacteria 2660
244 Ga0068855_100285728 3300005563 Bacteria 1830
245 Ga0068855_100296783 3300005563 Bacteria 1790
246 Ga0068855_100349371 3300005563 Bacteria 1629
247 Ga0068855_101093999 3300005563 Bacteria 833
248 Ga0070664_100004534 3300005564 Bacteria 11145
249 Ga0070664_100066218 3300005564 Bacteria 3084
250 Ga0070664_100290295 3300005564 Bacteria 1476
251 Ga0068857_100006037 3300005577 Bacteria 10344
252 Ga0068857_100007896 3300005577 Bacteria 9178
253 Ga0068857_100115785 3300005577 Bacteria 2411
254 Ga0068857_100180341 3300005577 Bacteria 1922
255 Ga0068857_100198674 3300005577 Bacteria 1828
256 Ga0068857_100338159 3300005577 Bacteria 1392
257 Ga0068857_100431518 3300005577 Bacteria 1230
258 Ga0068854_100329508 3300005578 Bacteria 1244
259 Ga0068854_100630810 3300005578 Bacteria 918
260 Ga0068856_100001032 3300005614 Bacteria 29659
261 Ga0068856_100008706 3300005614 Bacteria 9874
262 Ga0068856_100034393 3300005614 Bacteria 4964
263 Ga0068856_100154116 3300005614 Bacteria 2307
264 Ga0068856_100344995 3300005614 Bacteria 1507
265 Ga0068856_100941438 3300005614 Bacteria 882
266 Ga0070702_100000378 3300005615 Bacteria 15718
267 Ga0070702_100148776 3300005615 Bacteria 1500
268 Ga0068852_100006800 3300005616 Bacteria 8301
269 Ga0068852_100017082 3300005616 Bacteria 5683
270 Ga0068852_100022852 3300005616 Bacteria 5023
271 Ga0068852_100025730 3300005616 Bacteria 4773
272 Ga0068852_100142141 3300005616 Bacteria 2222
273 Ga0068852_100400874 3300005616 Bacteria 1349
274 Ga0068852_100515820 3300005616 Bacteria 1192
275 Ga0068859_100007402 3300005617 Bacteria 11142
276 Ga0068859_100391446 3300005617 Bacteria 1485
277 Ga0068859_100622809 3300005617 Bacteria 1172
278 Ga0068864_100000595 3300005618 Bacteria 30701
279 Ga0068864_100521538 3300005618 Bacteria 1145
280 Ga0068861_100002973 3300005719 Bacteria 11183
281 Ga0068861_100098923 3300005719 Bacteria 2316
282 Ga0068861_100189622 3300005719 Bacteria 1718
283 Ga0068851_10037994 3300005834 Bacteria 2414
284 Ga0068851_10102652 3300005834 Bacteria 1519
285 Ga0068851_10374922 3300005834 Bacteria 832
286 Ga0068870_10000216 3300005840 Bacteria 20877
287 Ga0068863_100022557 3300005841 Bacteria 6011
288 Ga0068863_100254929 3300005841 Bacteria 1695
289 Ga0068863_100755481 3300005841 Bacteria 968
290 Ga0068863_100908860 3300005841 Bacteria 881
291 Ga0068858_100024760 3300005842 Bacteria 5589
292 Ga0068858_100144437 3300005842 Bacteria 2234
293 Ga0068860_100007174 3300005843 Bacteria 11145
294 Ga0068860_100583209 3300005843 Bacteria 1122
295 Ga0068862_100017504 3300005844 Bacteria 5970
296 Ga0068862_100018639 3300005844 Bacteria 5781
297 Ga0068862_100057395 3300005844 Bacteria 3339
298 Ga0068862_100192379 3300005844 Bacteria 1836
299 Ga0068862_100723989 3300005844 Bacteria 966
300 Ga0081455_10000048 3300005937 Bacteria 126551
301 Ga0081455_10012767 3300005937 Bacteria 8353
302 Ga0081538_10001041 3300005981 Bacteria 29562
303 Ga0081538_10006728 3300005981 Bacteria 10055
304 Ga0081540_1001166 3300005983 Bacteria 23099
305 Ga0081540_1002979 3300005983 Bacteria 13570
306 Ga0081539_10004794 3300005985 Bacteria 14563
307 Ga0070717_10039765 3300006028 Bacteria 3828
308 Ga0070717_10130640 3300006028 Bacteria 2159
309 Ga0070717_10519040 3300006028 Bacteria 1077
310 Ga0075365_10103453 3300006038 Bacteria 1951
311 Ga0075368_10034503 3300006042 Bacteria 1971
312 Ga0075368_10037933 3300006042 Bacteria 1885
313 Ga0075363_100060337 3300006048 Bacteria 2042
314 Ga0075363_100118875 3300006048 Bacteria 1474
315 Ga0075364_10019516 3300006051 Bacteria 4256
316 Ga0075364_10063494 3300006051 Bacteria 2424
317 Ga0075364_10101082 3300006051 Bacteria 1919
318 Ga0070715_10056436 3300006163 Bacteria 1708
319 Ga0070716_100205070 3300006173 Bacteria 1313
320 Ga0070716_100207272 3300006173 Bacteria 1307
321 Ga0070716_100448776 3300006173 Bacteria 940
322 Ga0070712_100000902 3300006175 Bacteria 17764
323 Ga0070712_100004052 3300006175 Bacteria 8996
324 Ga0070712_100024878 3300006175 Bacteria 3973
325 Ga0070712_100092034 3300006175 Bacteria 2223
326 Ga0070712_100160466 3300006175 Bacteria 1736
327 Ga0070712_100186908 3300006175 Bacteria 1618
328 Ga0075367_10131800 3300006178 Bacteria 1545
329 Ga0075367_10225760 3300006178 Bacteria 1172
330 Ga0075367_10445522 3300006178 Bacteria 820
331 Ga0075369_10005925 3300006186 Bacteria 4597
332 Ga0075369_10026380 3300006186 Bacteria 2421
333 Ga0075369_10064996 3300006186 Bacteria 1598
334 Ga0075366_10013189 3300006195 Bacteria 4700
335 Ga0097621_100000600 3300006237 Bacteria 25393
336 Ga0097621_100069869 3300006237 Bacteria 2900
337 Ga0097621_100127391 3300006237 Bacteria 2164
338 Ga0097621_100205433 3300006237 Bacteria 1711
339 Ga0097621_100587859 3300006237 Bacteria 1016
340 Ga0075370_10046577 3300006353 Bacteria 2454
341 Ga0075370_10111572 3300006353 Bacteria 1588
342 Ga0075370_10114641 3300006353 Bacteria 1566
343 Ga0068871_100000118 3300006358 Bacteria 49211
344 Ga0068871_100080549 3300006358 Bacteria 2696
345 Ga0068871_100317268 3300006358 Bacteria 1371
346 Ga0068871_100625611 3300006358 Bacteria 981
347 Ga0068871_100833779 3300006358 Bacteria 852
348 Ga0075428_100012701 3300006844 Bacteria 9365
349 Ga0075428_100048564 3300006844 Bacteria 4657
350 Ga0075428_100195979 3300006844 Bacteria 2184
351 Ga0075430_100000196 3300006846 Bacteria 40930
352 Ga0075430_100038858 3300006846 Bacteria 4030
353 Ga0075430_100294749 3300006846 Bacteria 1342
354 Ga0075431_100132984 3300006847 Bacteria 2565
355 Ga0075431_100443591 3300006847 Bacteria 1294
356 Ga0075431_101046779 3300006847 Bacteria 782
357 Ga0075433_10029412 3300006852 Bacteria 4680
358 Ga0075433_10104991 3300006852 Bacteria 2503
359 Ga0075434_100003094 3300006871 Bacteria 14813
360 Ga0075434_100051111 3300006871 Bacteria 4106
361 Ga0075434_100153113 3300006871 Bacteria 2326
362 Ga0075434_100160681 3300006871 Bacteria 2266
363 Ga0075429_100000573 3300006880 Bacteria 28269
364 Ga0075429_100107524 3300006880 Bacteria 2437
365 Ga0068865_100007181 3300006881 Bacteria 6840
366 Ga0068865_100039028 3300006881 Bacteria 3218
367 Ga0068865_100527421 3300006881 Bacteria 988
368 Ga0075436_100002564 3300006914 Bacteria 12509
369 Ga0075436_100019157 3300006914 Bacteria 4689
370 Ga0075436_100216753 3300006914 Bacteria 1358
371 Ga0097620_100007402 3300006931 Bacteria 11142
372 Ga0097620_100391445 3300006931 Bacteria 1485
373 Ga0097620_100622778 3300006931 Bacteria 1172
374 Ga0075435_100014955 3300007076 Bacteria 5821
375 Ga0075435_100017968 3300007076 Bacteria 5362
376 Ga0075435_100032499 3300007076 Bacteria 4121
377 Ga0075435_100140132 3300007076 Bacteria 2029
378 Ga0099795_10001950 3300007788 Bacteria 4691
379 Ga0105240_10004696 3300009093 Bacteria 20647
380 Ga0105240_10011051 3300009093 Bacteria 12622
381 Ga0105240_10017473 3300009093 Bacteria 9666
382 Ga0105240_10133003 3300009093 Bacteria 2981
383 Ga0105240_10455624 3300009093 Bacteria 1430
384 Ga0105240_10493821 3300009093 Bacteria 1362
385 Ga0105240_10652311 3300009093 Bacteria 1153
386 Ga0105240_10753714 3300009093 Bacteria 1058
387 Ga0111539_10000683 3300009094 Bacteria 43914
388 Ga0111539_10010079 3300009094 Bacteria 11909
389 Ga0111539_10070545 3300009094 Bacteria 4125
390 Ga0111539_10080440 3300009094 Bacteria 3833
391 Ga0111539_10303887 3300009094 Bacteria 1857
392 Ga0111539_10326450 3300009094 Bacteria 1786
393 Ga0105245_10003702 3300009098 Bacteria 13642
394 Ga0105245_10017665 3300009098 Bacteria 6226
395 Ga0105245_10030667 3300009098 Bacteria 4755
396 Ga0105245_10042887 3300009098 Bacteria 4035
397 Ga0105245_10072236 3300009098 Bacteria 3134
398 Ga0105245_10481226 3300009098 Bacteria 1255
399 Ga0105245_10590586 3300009098 Bacteria 1136
400 Ga0105245_10622355 3300009098 Bacteria 1108
401 Ga0105247_10151400 3300009101 Bacteria 1529
402 Ga0105247_10234068 3300009101 Bacteria 1249
403 Ga0114129_10005890 3300009147 Bacteria 17359
404 Ga0114129_10008352 3300009147 Bacteria 14760
405 Ga0114129_10030751 3300009147 Bacteria 7593
406 Ga0114129_10481451 3300009147 Bacteria 1624
407 Ga0114129_10783469 3300009147 Bacteria 1218
408 Ga0114129_10961834 3300009147 Bacteria 1078
409 Ga0105243_10009969 3300009148 Bacteria 7221
410 Ga0105243_10037311 3300009148 Bacteria 3776
411 Ga0105243_10068588 3300009148 Bacteria 2858
412 Ga0105243_10251410 3300009148 Bacteria 1578
413 Ga0105243_10348082 3300009148 Bacteria 1360
414 Ga0105241_10142659 3300009174 Bacteria 1952
415 Ga0105241_10159833 3300009174 Bacteria 1851
416 Ga0105241_10211682 3300009174 Bacteria 1624
417 Ga0105241_10336211 3300009174 Bacteria 1307
418 Ga0105242_10016828 3300009176 Bacteria 5691
419 Ga0105242_10044757 3300009176 Bacteria 3585
420 Ga0105242_10122649 3300009176 Bacteria 2233
421 Ga0105242_10154742 3300009176 Bacteria 2002
422 Ga0105242_10313029 3300009176 Bacteria 1437
423 Ga0105248_10000005 3300009177 Bacteria 673111
424 Ga0105248_10056191 3300009177 Bacteria 4415
425 Ga0105248_10114304 3300009177 Bacteria 3044
426 Ga0105248_10405807 3300009177 Bacteria 1534
427 Ga0105237_10027530 3300009545 Bacteria 5801
428 Ga0105237_10032303 3300009545 Bacteria 5300
429 Ga0105237_10053645 3300009545 Bacteria 4043
430 Ga0105237_10382504 3300009545 Bacteria 1412
431 Ga0105237_10469967 3300009545 Bacteria 1264
432 Ga0105238_10001939 3300009551 Bacteria 20807
433 Ga0105238_10035831 3300009551 Bacteria 5044
434 Ga0105238_10173207 3300009551 Bacteria 2134
435 Ga0105238_10176816 3300009551 Bacteria 2111
436 Ga0105238_10177982 3300009551 Bacteria 2104
437 Ga0105238_10303270 3300009551 Bacteria 1581
438 Ga0105238_10324246 3300009551 Bacteria 1526
439 Ga0105238_10652931 3300009551 Bacteria 1062
440 Ga0105238_11065567 3300009551 Bacteria 830
441 Ga0105249_10002122 3300009553 Bacteria 17209
442 Ga0105249_10023350 3300009553 Bacteria 5549
443 Ga0105249_10161429 3300009553 Bacteria 2166
444 Ga0105249_10257311 3300009553 Bacteria 1733
445 Ga0099796_10001539 3300010159 Bacteria 4696
446 Ga0099796_10077406 3300010159 Bacteria 1213
447 Ga0105239_10028473 3300010375 Bacteria 6145
448 Ga0105239_10052904 3300010375 Bacteria 4454
449 Ga0105239_10057391 3300010375 Bacteria 4270
450 Ga0105239_10090514 3300010375 Bacteria 3375
451 Ga0105239_10115685 3300010375 Bacteria 2975
452 Ga0105239_10162951 3300010375 Bacteria 2492
453 Ga0105239_10220454 3300010375 Bacteria 2127
454 Ga0105239_10343841 3300010375 Bacteria 1684
455 Ga0105239_10413340 3300010375 Bacteria 1528
456 Ga0105246_10002558 3300011119 Bacteria 10995
457 Ga0105246_10140380 3300011119 Bacteria 1816
458 Ga0105246_10154831 3300011119 Bacteria 1740
459 Ga0105246_10305930 3300011119 Bacteria 1286
460 Ga0105246_10536917 3300011119 Bacteria 1000
461 Ga0157336_1001006 3300012477 Bacteria 1389
462 Ga0157373_10000820 3300013100 Bacteria 24076
463 Ga0157371_10057710 3300013102 Bacteria 2753
464 Ga0157371_10303390 3300013102 Bacteria 1156
465 Ga0157371_10428607 3300013102 Bacteria 970
466 Ga0157370_10058956 3300013104 Bacteria 3649
467 Ga0157370_10082927 3300013104 Bacteria 3015
468 Ga0157370_10089027 3300013104 Bacteria 2899
469 Ga0157370_10187647 3300013104 Bacteria 1919
470 Ga0157370_10477886 3300013104 Bacteria 1145
471 Ga0157369_10001535 3300013105 Bacteria 28280
472 Ga0157369_10132262 3300013105 Bacteria 2643
473 Ga0157369_10153459 3300013105 Bacteria 2434
474 Ga0157369_10171228 3300013105 Bacteria 2288
475 Ga0157369_10447677 3300013105 Bacteria 1337
476 Ga0157374_10018401 3300013296 Bacteria 6164
477 Ga0157374_10115150 3300013296 Bacteria 2589
478 Ga0157378_10015153 3300013297 Bacteria 6749
479 Ga0157378_10112197 3300013297 Bacteria 2501
480 Ga0163162_10028695 3300013306 Bacteria 5508
481 Ga0163162_10046698 3300013306 Bacteria 4341
482 Ga0163162_10241481 3300013306 Bacteria 1937
483 Ga0163162_10770557 3300013306 Bacteria 1081
484 Ga0157372_10023820 3300013307 Bacteria 6641
485 Ga0157372_10059581 3300013307 Bacteria 4270
486 Ga0157372_10437922 3300013307 Bacteria 1524
487 Ga0157372_10468546 3300013307 Bacteria 1468
488 Ga0157372_10893284 3300013307 Bacteria 1031
489 Ga0157372_11042959 3300013307 Bacteria 946
490 Ga0157372_11160265 3300013307 Bacteria 893
491 Ga0157375_10007178 3300013308 Bacteria 9737
492 Ga0157375_10037143 3300013308 Bacteria 4665
493 Ga0157375_10154210 3300013308 Bacteria 2435
494 Ga0157375_10418092 3300013308 Bacteria 1507
495 Ga0157375_10776327 3300013308 Bacteria 1108
496 Ga0157375_10921856 3300013308 Bacteria 1017
497 Ga0163163_10008003 3300014325 Bacteria 9355
498 Ga0163163_10113766 3300014325 Bacteria 2736
499 Ga0163163_10159978 3300014325 Bacteria 2297
500 Ga0163163_10400600 3300014325 Bacteria 1430
501 Ga0163163_10664643 3300014325 Bacteria 1105
502 Ga0163163_10718688 3300014325 Bacteria 1062
503 Ga0157380_10021174 3300014326 Bacteria 4874
504 Ga0157380_10641176 3300014326 Bacteria 1058
505 Ga0157380_10762508 3300014326 Bacteria 980
506 Ga0157377_10000628 3300014745 Bacteria 14665
507 Ga0157377_10384529 3300014745 Bacteria 951
508 Ga0157379_10018151 3300014968 Bacteria 6200
509 Ga0157379_10018171 3300014968 Bacteria 6195
510 Ga0157379_10038101 3300014968 Bacteria 4289
511 Ga0157379_10071200 3300014968 Bacteria 3111
512 Ga0157379_10073976 3300014968 Bacteria 3050
513 Ga0157379_10307604 3300014968 Bacteria 1445
514 Ga0157379_10564259 3300014968 Bacteria 1060
515 Ga0157379_10874642 3300014968 Bacteria 851
516 Ga0157376_10006966 3300014969 Bacteria 8018
517 Ga0157376_10273159 3300014969 Bacteria 1589
518 Ga0157376_10478212 3300014969 Bacteria 1220
519 Ga0163161_10009359 3300017792 Bacteria 6779
520 Ga0163161_10049613 3300017792 Bacteria 3034
521 Ga0213876_10000421 3300021384 Bacteria 35344
522 Ga0213876_10002961 3300021384 Bacteria 9840
523 Ga0213876_10003189 3300021384 Bacteria 9433
524 Ga0213876_10046760 3300021384 Bacteria 2288
525 Ga0213875_10000089 3300021388 Bacteria 105772
526 Ga0224712_10120152 3300022467 Bacteria 1137
527 Ga0209233_1000013 3300025261 Bacteria 1013785
528 Ga0209233_1003250 3300025261 Bacteria 5762
529 Ga0207666_1000185 3300025271 Bacteria 9376
530 Ga0209455_1009081 3300025272 Bacteria 2639
531 Ga0209130_1036140 3300025284 Bacteria 983
532 Ga0209564_1002708 3300025295 Bacteria 13379
533 Ga0209758_1000548 3300025297 Bacteria 59657
534 Ga0209758_1006193 3300025297 Bacteria 8738
535 Ga0207426_1026172 3300025302 Bacteria 1957
536 Ga0207697_10003861 3300025315 Bacteria 7309
537 Ga0207697_10034987 3300025315 Bacteria 2056
538 Ga0207656_10025078 3300025321 Bacteria 2418
539 Ga0207682_10000350 3300025893 Bacteria 21096
540 Ga0207682_10038677 3300025893 Bacteria 1937
541 Ga0207682_10076484 3300025893 Bacteria 1427
542 Ga0207692_10105360 3300025898 Bacteria 1555
543 Ga0207692_10201717 3300025898 Bacteria 1170
544 Ga0207692_10224858 3300025898 Bacteria 1114
545 Ga0207692_10236709 3300025898 Bacteria 1089
546 Ga0207710_10014061 3300025900 Bacteria 3371
547 Ga0207688_10007287 3300025901 Bacteria 6019
548 Ga0207688_10037550 3300025901 Bacteria 2687
549 Ga0207688_10283760 3300025901 Bacteria 1009
550 Ga0207680_10005899 3300025903 Bacteria 5882
551 Ga0207680_10129058 3300025903 Bacteria 1664
552 Ga0207680_10182716 3300025903 Bacteria 1419
553 Ga0207680_10531538 3300025903 Bacteria 839
554 Ga0207647_10030675 3300025904 Bacteria 3466
555 Ga0207647_10033853 3300025904 Bacteria 3267
556 Ga0207647_10055947 3300025904 Bacteria 2422
557 Ga0207647_10278971 3300025904 Bacteria 954
558 Ga0207685_10053068 3300025905 Bacteria 1573
559 Ga0207699_10000164 3300025906 Bacteria 41177
560 Ga0207699_10008214 3300025906 Bacteria 5139
561 Ga0207699_10043634 3300025906 Bacteria 2606
562 Ga0207699_10347377 3300025906 Bacteria 1046
563 Ga0207645_10010484 3300025907 Bacteria 6361
564 Ga0207645_10089754 3300025907 Bacteria 1976
565 Ga0207645_10091158 3300025907 Bacteria 1960
566 Ga0207645_10096386 3300025907 Bacteria 1906
567 Ga0207645_10099195 3300025907 Bacteria 1878
568 Ga0207645_10111940 3300025907 Bacteria 1768
569 Ga0207645_10150084 3300025907 Bacteria 1521
570 Ga0207643_10000009 3300025908 Bacteria 160496
571 Ga0207643_10268780 3300025908 Bacteria 1054
572 Ga0207705_10000180 3300025909 Bacteria 66404
573 Ga0207705_10004720 3300025909 Bacteria 10265
574 Ga0207705_10034426 3300025909 Bacteria 3621
575 Ga0207705_10039818 3300025909 Bacteria 3368
576 Ga0207705_10104145 3300025909 Bacteria 2090
577 Ga0207705_10151482 3300025909 Bacteria 1738
578 Ga0207654_10074102 3300025911 Bacteria 2031
579 Ga0207654_10077388 3300025911 Bacteria 1994
580 Ga0207654_10193933 3300025911 Bacteria 1333
581 Ga0207707_10000011 3300025912 Bacteria 282857
582 Ga0207707_10002211 3300025912 Bacteria 17599
583 Ga0207707_10004335 3300025912 Bacteria 12560
584 Ga0207707_10006091 3300025912 Bacteria 10552
585 Ga0207707_10168245 3300025912 Bacteria 1915
586 Ga0207707_10537382 3300025912 Bacteria 994
587 Ga0207695_10000018 3300025913 Bacteria 766611
588 Ga0207695_10001032 3300025913 Bacteria 48974
589 Ga0207695_10029506 3300025913 Bacteria 6057
590 Ga0207695_10047727 3300025913 Bacteria 4528
591 Ga0207695_10063576 3300025913 Bacteria 3804
592 Ga0207695_10163030 3300025913 Bacteria 2159
593 Ga0207695_10215806 3300025913 Bacteria 1827
594 Ga0207695_10323348 3300025913 Bacteria 1432
595 Ga0207671_10016535 3300025914 Bacteria 5730
596 Ga0207671_10144760 3300025914 Bacteria 1833
597 Ga0207671_10200053 3300025914 Bacteria 1560
598 Ga0207671_10248016 3300025914 Bacteria 1400
599 Ga0207693_10001210 3300025915 Bacteria 23009
600 Ga0207693_10001929 3300025915 Bacteria 18163
601 Ga0207693_10004752 3300025915 Bacteria 11421
602 Ga0207693_10015635 3300025915 Bacteria 6084
603 Ga0207693_10032195 3300025915 Bacteria 4139
604 Ga0207693_10036016 3300025915 Bacteria 3899
605 Ga0207693_10037608 3300025915 Bacteria 3814
606 Ga0207693_10100265 3300025915 Bacteria 2270
607 Ga0207693_10116216 3300025915 Bacteria 2101
608 Ga0207693_10157406 3300025915 Bacteria 1787
609 Ga0207693_10190644 3300025915 Bacteria 1613
610 Ga0207693_10307449 3300025915 Bacteria 1241
611 Ga0207663_10011662 3300025916 Bacteria 4728
612 Ga0207663_10061935 3300025916 Bacteria 2376
613 Ga0207663_10100658 3300025916 Bacteria 1940
614 Ga0207663_10127095 3300025916 Bacteria 1755
615 Ga0207663_10161620 3300025916 Bacteria 1582
616 Ga0207663_10178070 3300025916 Bacteria 1516
617 Ga0207660_10000110 3300025917 Bacteria 46792
618 Ga0207660_10000197 3300025917 Bacteria 38486
619 Ga0207660_10003537 3300025917 Bacteria 10180
620 Ga0207660_10013609 3300025917 Bacteria 5334
621 Ga0207660_10058863 3300025917 Bacteria 2756
622 Ga0207660_10073136 3300025917 Bacteria 2498
623 Ga0207660_10228082 3300025917 Bacteria 1464
624 Ga0207662_10010568 3300025918 Bacteria 5102
625 Ga0207662_10019357 3300025918 Bacteria 3872
626 Ga0207662_10122304 3300025918 Bacteria 1633
627 Ga0207662_10377440 3300025918 Bacteria 957
628 Ga0207657_10000241 3300025919 Bacteria 57958
629 Ga0207657_10028527 3300025919 Bacteria 5090
630 Ga0207657_10043533 3300025919 Bacteria 3954
631 Ga0207657_10058646 3300025919 Bacteria 3311
632 Ga0207657_10262648 3300025919 Bacteria 1374
633 Ga0207649_10000052 3300025920 Bacteria 106800
634 Ga0207649_10000194 3300025920 Bacteria 50112
635 Ga0207649_10057815 3300025920 Bacteria 2426
636 Ga0207652_10001654 3300025921 Bacteria 19554
637 Ga0207652_10004826 3300025921 Bacteria 10919
638 Ga0207652_10007272 3300025921 Bacteria 8921
639 Ga0207652_10063586 3300025921 Bacteria 3191
640 Ga0207652_10071225 3300025921 Bacteria 3020
641 Ga0207652_10093381 3300025921 Bacteria 2648
642 Ga0207652_10117970 3300025921 Bacteria 2358
643 Ga0207652_10122811 3300025921 Bacteria 2311
644 Ga0207652_10190259 3300025921 Bacteria 1846
645 Ga0207652_10204028 3300025921 Bacteria 1779
646 Ga0207652_10349150 3300025921 Bacteria 1335
647 Ga0207652_10453660 3300025921 Bacteria 1156
648 Ga0207681_10001135 3300025923 Bacteria 17191
649 Ga0207681_10161561 3300025923 Bacteria 1689
650 Ga0207681_10340311 3300025923 Bacteria 1198
651 Ga0207694_10000010 3300025924 Bacteria 439722
652 Ga0207694_10008694 3300025924 Bacteria 7666
653 Ga0207694_10031812 3300025924 Bacteria 4033
654 Ga0207694_10066558 3300025924 Bacteria 2811
655 Ga0207694_10203444 3300025924 Bacteria 1611
656 Ga0207694_10257958 3300025924 Bacteria 1428
657 Ga0207650_10002693 3300025925 Bacteria 12270
658 Ga0207650_10141681 3300025925 Bacteria 1891
659 Ga0207650_10569902 3300025925 Bacteria 950
660 Ga0207659_10002396 3300025926 Bacteria 11152
661 Ga0207659_10012855 3300025926 Bacteria 5345
662 Ga0207659_10188772 3300025926 Bacteria 1639
663 Ga0207687_10008117 3300025927 Bacteria 6871
664 Ga0207687_10019725 3300025927 Bacteria 4469
665 Ga0207687_10025014 3300025927 Bacteria 3994
666 Ga0207687_10033978 3300025927 Bacteria 3461
667 Ga0207687_10128166 3300025927 Bacteria 1908
668 Ga0207687_10401890 3300025927 Bacteria 1127
669 Ga0207687_10461060 3300025927 Bacteria 1055
670 Ga0207700_10000295 3300025928 Bacteria 29631
671 Ga0207700_10090974 3300025928 Bacteria 2409
672 Ga0207700_10118748 3300025928 Bacteria 2140
673 Ga0207700_10124100 3300025928 Bacteria 2098
674 Ga0207700_10227054 3300025928 Bacteria 1585
675 Ga0207700_10533990 3300025928 Bacteria 1040
676 Ga0207664_10028891 3300025929 Bacteria 4219
677 Ga0207664_10035779 3300025929 Bacteria 3834
678 Ga0207664_10071514 3300025929 Bacteria 2795
679 Ga0207664_10151608 3300025929 Bacteria 1970
680 Ga0207664_10235849 3300025929 Bacteria 1592
681 Ga0207664_10244868 3300025929 Bacteria 1562
682 Ga0207664_10307466 3300025929 Bacteria 1396
683 Ga0207664_10437790 3300025929 Bacteria 1166
684 Ga0207664_10490126 3300025929 Bacteria 1100
685 Ga0207664_10595171 3300025929 Bacteria 993
686 Ga0207644_10000212 3300025931 Bacteria 40175
687 Ga0207644_10181448 3300025931 Bacteria 1650
688 Ga0207690_10001288 3300025932 Bacteria 15841
689 Ga0207706_10016311 3300025933 Bacteria 6707
690 Ga0207706_10040241 3300025933 Bacteria 4142
691 Ga0207706_10054725 3300025933 Bacteria 3521
692 Ga0207706_10288771 3300025933 Bacteria 1430
693 Ga0207686_10002314 3300025934 Bacteria 10431
694 Ga0207686_10202258 3300025934 Bacteria 1423
695 Ga0207709_10000530 3300025935 Bacteria 33097
696 Ga0207709_10022766 3300025935 Bacteria 3557
697 Ga0207709_10083247 3300025935 Bacteria 2068
698 Ga0207709_10096959 3300025935 Bacteria 1941
699 Ga0207670_10015207 3300025936 Bacteria 4592
700 Ga0207670_10044307 3300025936 Bacteria 2943
701 Ga0207669_10000235 3300025937 Bacteria 25138
702 Ga0207669_10151320 3300025937 Bacteria 1626
703 Ga0207669_10294524 3300025937 Bacteria 1230
704 Ga0207704_10000198 3300025938 Bacteria 31182
705 Ga0207704_10019711 3300025938 Bacteria 3549
706 Ga0207704_10195247 3300025938 Bacteria 1476
707 Ga0207665_10020388 3300025939 Bacteria 4356
708 Ga0207665_10141171 3300025939 Bacteria 1718
709 Ga0207691_10013970 3300025940 Bacteria 7661
710 Ga0207691_10028811 3300025940 Bacteria 5196
711 Ga0207691_10364602 3300025940 Bacteria 1235
712 Ga0207711_10000002 3300025941 Bacteria 1228676
713 Ga0207711_10180040 3300025941 Bacteria 1922
714 Ga0207689_10000031 3300025942 Bacteria 97131
715 Ga0207689_10071871 3300025942 Bacteria 2842
716 Ga0207689_10088891 3300025942 Bacteria 2538
717 Ga0207689_10261105 3300025942 Bacteria 1433
718 Ga0207661_10003727 3300025944 Bacteria 10622
719 Ga0207661_10065582 3300025944 Bacteria 2948
720 Ga0207661_10089596 3300025944 Bacteria 2560
721 Ga0207661_10186929 3300025944 Bacteria 1814
722 Ga0207661_10457124 3300025944 Bacteria 1163
723 Ga0207661_10476054 3300025944 Bacteria 1139
724 Ga0207679_10000183 3300025945 Bacteria 51645
725 Ga0207679_10100904 3300025945 Bacteria 2257
726 Ga0207667_10000388 3300025949 Bacteria 59263
727 Ga0207667_10004001 3300025949 Bacteria 18104
728 Ga0207667_10006198 3300025949 Bacteria 14519
729 Ga0207667_10013025 3300025949 Bacteria 9546
730 Ga0207667_10024994 3300025949 Bacteria 6548
731 Ga0207667_10027381 3300025949 Bacteria 6205
732 Ga0207667_10030652 3300025949 Bacteria 5815
733 Ga0207667_10250942 3300025949 Bacteria 1810
734 Ga0207667_10339043 3300025949 Bacteria 1534
735 Ga0207667_10964608 3300025949 Bacteria 841
736 Ga0207651_10000051 3300025960 Bacteria 54163
737 Ga0207651_10690770 3300025960 Bacteria 898
738 Ga0207712_10001703 3300025961 Bacteria 14771
739 Ga0207712_10494081 3300025961 Bacteria 1045
740 Ga0207668_10001674 3300025972 Bacteria 12959
741 Ga0207668_10361289 3300025972 Bacteria 1217
742 Ga0207640_10000343 3300025981 Bacteria 30767
743 Ga0207640_10024133 3300025981 Bacteria 3664
744 Ga0207640_10515244 3300025981 Bacteria 999
745 Ga0207658_10066787 3300025986 Bacteria 2706
746 Ga0207658_10154989 3300025986 Bacteria 1871
747 Ga0207658_10157925 3300025986 Bacteria 1855
748 Ga0207658_10341525 3300025986 Bacteria 1301
749 Ga0207658_10561565 3300025986 Bacteria 1022
750 Ga0207677_10081022 3300026023 Bacteria 2328
751 Ga0207677_10278125 3300026023 Bacteria 1373
752 Ga0207677_10728325 3300026023 Bacteria 882
753 Ga0207703_10010733 3300026035 Bacteria 7151
754 Ga0207703_10044546 3300026035 Bacteria 3567
755 Ga0207703_10172911 3300026035 Bacteria 1901
756 Ga0207703_10175184 3300026035 Bacteria 1889
757 Ga0207703_10332748 3300026035 Bacteria 1393
758 Ga0207639_10000867 3300026041 Bacteria 20545
759 Ga0207639_10003883 3300026041 Bacteria 10074
760 Ga0207639_10010763 3300026041 Bacteria 6339
761 Ga0207639_10033916 3300026041 Bacteria 3769
762 Ga0207639_10227024 3300026041 Bacteria 1616
763 Ga0207678_10024280 3300026067 Bacteria 5295
764 Ga0207678_10043860 3300026067 Bacteria 3869
765 Ga0207678_10100765 3300026067 Bacteria 2467
766 Ga0207678_10142928 3300026067 Bacteria 2042
767 Ga0207678_10368921 3300026067 Bacteria 1240
768 Ga0207708_10014839 3300026075 Bacteria 5830
769 Ga0207708_10102376 3300026075 Bacteria 2217
770 Ga0207708_10397909 3300026075 Bacteria 1138
771 Ga0207702_10000005 3300026078 Bacteria 420296
772 Ga0207702_10000315 3300026078 Bacteria 55383
773 Ga0207702_10004643 3300026078 Bacteria 12151
774 Ga0207702_10009824 3300026078 Bacteria 8022
775 Ga0207702_10048646 3300026078 Bacteria 3576
776 Ga0207702_10229342 3300026078 Bacteria 1735
777 Ga0207702_10350900 3300026078 Bacteria 1412
778 Ga0207641_10001831 3300026088 Bacteria 20447
779 Ga0207641_10062870 3300026088 Bacteria 3169
780 Ga0207648_10025743 3300026089 Bacteria 5237
781 Ga0207648_10154550 3300026089 Bacteria 2025
782 Ga0207648_10221620 3300026089 Bacteria 1681
783 Ga0207648_10706873 3300026089 Bacteria 934
784 Ga0207676_10000124 3300026095 Bacteria 67747
785 Ga0207676_10217418 3300026095 Bacteria 1699
786 Ga0207676_10634474 3300026095 Bacteria 1029
787 Ga0207674_10001605 3300026116 Bacteria 29115
788 Ga0207674_10016004 3300026116 Bacteria 8216
789 Ga0207674_10145542 3300026116 Bacteria 2328
790 Ga0207674_10363573 3300026116 Bacteria 1399
791 Ga0207674_10588472 3300026116 Bacteria 1075
792 Ga0207674_10821416 3300026116 Bacteria 897
793 Ga0207675_100029702 3300026118 Bacteria 5090
794 Ga0207675_100440578 3300026118 Bacteria 1289
795 Ga0207675_100811797 3300026118 Bacteria 949
796 Ga0207683_10000242 3300026121 Bacteria 48576
797 Ga0207683_10001846 3300026121 Bacteria 18729
798 Ga0207683_10079317 3300026121 Bacteria 2911
799 Ga0207683_10081510 3300026121 Bacteria 2872
800 Ga0207683_10213762 3300026121 Bacteria 1756
801 Ga0207683_10233042 3300026121 Bacteria 1679
802 Ga0207683_10533217 3300026121 Bacteria 1085
803 Ga0207698_10010960 3300026142 Bacteria 5857
804 Ga0207698_10036626 3300026142 Bacteria 3604
805 Ga0207698_10040510 3300026142 Bacteria 3463
806 Ga0207698_10072790 3300026142 Bacteria 2733
807 Ga0207698_10391941 3300026142 Bacteria 1324
808 Ga0209982_1002370 3300027552 Bacteria 2649
809 Ga0210002_1001035 3300027617 Bacteria 3838
810 Ga0209966_1008822 3300027695 Bacteria 1793
811 Ga0209998_10010491 3300027717 Bacteria 1918
812 Ga0209813_10002687 3300027866 Bacteria 4096
813 Ga0209813_10009253 3300027866 Bacteria 2514
814 Ga0209813_10017408 3300027866 Bacteria 1973
815 Ga0207428_10000037 3300027907 Bacteria 218857
816 Ga0207428_10002442 3300027907 Bacteria 18563
817 Ga0207428_10013074 3300027907 Bacteria 7269
818 Ga0268266_10000557 3300028379 Bacteria 51935
819 Ga0268266_10813652 3300028379 Bacteria 902
820 Ga0268265_10016165 3300028380 Bacteria 5122
821 Ga0268265_10050585 3300028380 Bacteria 3131
822 Ga0268265_10162265 3300028380 Bacteria 1900
823 Ga0268265_10214183 3300028380 Bacteria 1681
824 Ga0268264_10003234 3300028381 Bacteria 14103
825 Ga0268264_10140651 3300028381 Bacteria 2152
826 Ga0268264_10391464 3300028381 Bacteria 1333
827 Ga0268264_10562834 3300028381 Bacteria 1119
828 Ga0265337_1019347 3300028556 Bacteria 2147
829 Ga0265326_10002138 3300028558 Bacteria 6717
830 Ga0265319_1001825 3300028563 Bacteria 12143
831 Ga0265334_10000469 3300028573 Bacteria 20809
832 Ga0265334_10001106 3300028573 Bacteria 13201
833 Ga0265334_10016312 3300028573 Bacteria 3074
834 Ga0265334_10065129 3300028573 Bacteria 1367
835 Ga0265318_10000037 3300028577 Bacteria 138223
836 Ga0265318_10001354 3300028577 Bacteria 14601
837 Ga0265318_10004765 3300028577 Bacteria 6501
838 Ga0265323_10001237 3300028653 Bacteria 12839
839 Ga0265322_10008354 3300028654 Bacteria 3017
840 Ga0265336_10000535 3300028666 Bacteria 21804
841 Ga0307515_10040807 3300028794 Bacteria 7326
842 Ga0265338_10000017 3300028800 Bacteria 344481
843 Ga0265338_10000131 3300028800 Bacteria 137627
844 Ga0265338_10005387 3300028800 Bacteria 16717
845 Ga0265338_10023435 3300028800 Bacteria 6346
846 Ga0265338_10023604 3300028800 Bacteria 6316
847 Ga0265338_10033513 3300028800 Bacteria 4981
848 Ga0265338_10065293 3300028800 Bacteria 3158
849 Ga0265338_10098917 3300028800 Bacteria 2385
850 Ga0265338_10149487 3300028800 Bacteria 1816
851 Ga0265338_10153758 3300028800 Bacteria 1784
852 Ga0265338_10211121 3300028800 Bacteria 1457
853 Ga0265338_10314147 3300028800 Bacteria 1136
854 Ga0265338_10419399 3300028800 Bacteria 951
855 Ga0265338_10455780 3300028800 Bacteria 905
856 Ga0265324_10001269 3300029957 Bacteria 14862
857 Ga0265762_1007126 3300030760 Bacteria 1996
858 Ga0265763_1000228 3300030763 Bacteria 3100
859 Ga0265330_10013605 3300031235 Bacteria 3790
860 Ga0265330_10028450 3300031235 Bacteria 2519
861 Ga0265330_10033745 3300031235 Bacteria 2287
862 Ga0265330_10081849 3300031235 Bacteria 1390
863 Ga0265330_10085850 3300031235 Bacteria 1353
864 Ga0265330_10129990 3300031235 Bacteria 1072
865 Ga0265332_10003525 3300031238 Bacteria 7524
866 Ga0265332_10011436 3300031238 Bacteria 3947
867 Ga0265332_10038320 3300031238 Bacteria 2077
868 Ga0265332_10080505 3300031238 Bacteria 1382
869 Ga0265320_10002069 3300031240 Bacteria 14126
870 Ga0265320_10016123 3300031240 Bacteria 4197
871 Ga0265325_10000014 3300031241 Bacteria 131579
872 Ga0265325_10000449 3300031241 Bacteria 29667
873 Ga0265325_10000820 3300031241 Bacteria 22557
874 Ga0265325_10001071 3300031241 Bacteria 19727
875 Ga0265325_10001732 3300031241 Bacteria 15146
876 Ga0265325_10001769 3300031241 Bacteria 14972
877 Ga0265325_10012680 3300031241 Bacteria 4814
878 Ga0265325_10031434 3300031241 Bacteria 2841
879 Ga0265325_10034463 3300031241 Bacteria 2692
880 Ga0265325_10042427 3300031241 Bacteria 2378
881 Ga0265325_10064283 3300031241 Bacteria 1855
882 Ga0265325_10066787 3300031241 Bacteria 1813
883 Ga0265329_10034806 3300031242 Bacteria 1626
884 Ga0265329_10039168 3300031242 Bacteria 1524
885 Ga0265340_10002810 3300031247 Bacteria 9907
886 Ga0265340_10003857 3300031247 Bacteria 8447
887 Ga0265340_10008522 3300031247 Bacteria 5533
888 Ga0265340_10025043 3300031247 Bacteria 3025
889 Ga0265340_10042895 3300031247 Bacteria 2219
890 Ga0265340_10056838 3300031247 Bacteria 1882
891 Ga0265340_10063149 3300031247 Bacteria 1768
892 Ga0265340_10074553 3300031247 Bacteria 1604
893 Ga0265340_10163807 3300031247 Bacteria 1009
894 Ga0265340_10217733 3300031247 Bacteria 856
895 Ga0265340_10251950 3300031247 Bacteria 787
896 Ga0265339_10000053 3300031249 Bacteria 101277
897 Ga0265339_10000256 3300031249 Bacteria 42839
898 Ga0265339_10003063 3300031249 Bacteria 11761
899 Ga0265339_10005687 3300031249 Bacteria 8275
900 Ga0265339_10006973 3300031249 Bacteria 7344
901 Ga0265339_10009282 3300031249 Bacteria 6196
902 Ga0265339_10020355 3300031249 Bacteria 3877
903 Ga0265339_10051695 3300031249 Bacteria 2241
904 Ga0265339_10078048 3300031249 Bacteria 1754
905 Ga0265339_10108339 3300031249 Bacteria 1440
906 Ga0265331_10014841 3300031250 Bacteria 4132
907 Ga0265331_10019323 3300031250 Bacteria 3519
908 Ga0265331_10039963 3300031250 Bacteria 2284
909 Ga0265331_10065184 3300031250 Bacteria 1713
910 Ga0265331_10227999 3300031250 Bacteria 837
911 Ga0265327_10001297 3300031251 Bacteria 32731
912 Ga0265316_10050012 3300031344 Bacteria 3290
913 Ga0265316_10088313 3300031344 Bacteria 2367
914 Ga0265316_10104722 3300031344 Bacteria 2147
915 Ga0265316_10108470 3300031344 Bacteria 2104
916 Ga0265316_10183202 3300031344 Bacteria 1558
917 Ga0265316_10241243 3300031344 Bacteria 1329
918 Ga0265316_10280165 3300031344 Bacteria 1218
919 Ga0265316_10302428 3300031344 Bacteria 1165
920 Ga0265316_10303173 3300031344 Bacteria 1163
921 Ga0265316_10345735 3300031344 Bacteria 1077
922 Ga0265316_10616217 3300031344 Bacteria 769
923 Ga0265313_10000098 3300031595 Bacteria 89130
924 Ga0265313_10001315 3300031595 Bacteria 23436
925 Ga0265313_10001884 3300031595 Bacteria 19075
926 Ga0265313_10006263 3300031595 Bacteria 8479
927 Ga0265313_10008423 3300031595 Bacteria 6847
928 Ga0265313_10012279 3300031595 Bacteria 5242
929 Ga0265313_10015578 3300031595 Bacteria 4416
930 Ga0265313_10047949 3300031595 Bacteria 2064
931 Ga0265313_10054715 3300031595 Bacteria 1894
932 Ga0265313_10060934 3300031595 Bacteria 1768
933 Ga0265313_10061872 3300031595 Bacteria 1750
934 Ga0265313_10071098 3300031595 Bacteria 1602
935 Ga0265313_10079819 3300031595 Bacteria 1489
936 Ga0265313_10133140 3300031595 Bacteria 1075
937 Ga0265314_10004347 3300031711 Bacteria 13204
938 Ga0265314_10004460 3300031711 Bacteria 12990
939 Ga0265314_10009081 3300031711 Bacteria 8445
940 Ga0265314_10011365 3300031711 Bacteria 7357
941 Ga0265314_10012121 3300031711 Bacteria 7061
942 Ga0265314_10021119 3300031711 Bacteria 5015
943 Ga0265314_10027636 3300031711 Bacteria 4246
944 Ga0265314_10031643 3300031711 Bacteria 3902
945 Ga0265314_10033470 3300031711 Bacteria 3768
946 Ga0265314_10037529 3300031711 Bacteria 3510
947 Ga0265314_10038656 3300031711 Bacteria 3444
948 Ga0265314_10056950 3300031711 Bacteria 2688
949 Ga0265314_10094782 3300031711 Bacteria 1934
950 Ga0265314_10128118 3300031711 Bacteria 1587
951 Ga0265314_10191417 3300031711 Bacteria 1217
952 Ga0265314_10207814 3300031711 Bacteria 1152
953 Ga0265314_10272117 3300031711 Bacteria 962
954 Ga0265342_10000448 3300031712 Bacteria 44982
955 Ga0265342_10000677 3300031712 Bacteria 35579
956 Ga0265342_10008087 3300031712 Bacteria 7602
957 Ga0265342_10025101 3300031712 Bacteria 3752
958 Ga0265342_10031129 3300031712 Bacteria 3301
959 Ga0265342_10059470 3300031712 Bacteria 2257
960 Ga0265342_10227272 3300031712 Bacteria 1003
961 Ga0265342_10287707 3300031712 Bacteria 868
962 Ga0307516_10038268 3300031730 Bacteria 4788
963 Ga0307516_10231301 3300031730 Bacteria 1552
964 Ga0307516_10264719 3300031730 Bacteria 1408
965 Ga0307410_10512358 3300031852 Bacteria 989
966 Ga0307412_10394045 3300031911 Bacteria 1125
967 Ga0307409_100145672 3300031995 Bacteria 2048
968 Ga0307416_100674159 3300032002 Bacteria 1121
969 Ga0307415_100224377 3300032126 Bacteria 1509
970 Ga0373930_0003008 3300034816 Bacteria 2651
971 Ga0373948_0002824 3300034817 Bacteria 2607
972 Ga0373950_0005337 3300034818 Bacteria 1917
973 Ga0373950_0007127 3300034818 Bacteria 1727
974 Ga0373950_0017039 3300034818 Bacteria 1248
975 Ga0373958_0001566 3300034819 Bacteria 3095
976 Ga0373958_0002620 3300034819 Bacteria 2538
977 Ga0373959_0003005 3300034820 Bacteria 2682
978 Ga0373938_0000343 3300034957 Bacteria 7374
979 Ga0373938_0001532 3300034957 Bacteria 3712
980 Ga0373926_0008207 3300035083 Bacteria 3475
981 Ga0373928_0001369 3300035084 Bacteria 4772
982 Ga0373934_0052439 3300035086 Bacteria 1617
983 Ga0373934_0119053 3300035086 Bacteria 1074
984 Ga0373934_0208429 3300035086 Bacteria 805
985 Ga0373940_0003702 3300035088 Bacteria 3150
986 Ga0373940_0021279 3300035088 Bacteria 1656
987 Ga0373940_0054129 3300035088 Bacteria 1134
988 Ga0373940_0087214 3300035088 Bacteria 930
989 Ga0373944_0002736 3300035089 Bacteria 4504
990 Ga0373949_0001707 3300035090 Bacteria 6092
991 Ga0373949_0003940 3300035090 Bacteria 3447
992 Ga0373952_0001963 3300035092 Bacteria 3719
993 Ga0373923_0065885 3300035111 Bacteria 1547
994 Ga0373932_0004128 3300035112 Bacteria 3451
995 Ga0373932_0006364 3300035112 Bacteria 2791
996 Ga0373932_0007842 3300035112 Bacteria 2547
997 Ga0373932_0030106 3300035112 Bacteria 1502
998 Ga0373936_0021903 3300035113 Bacteria 2487
999 Ga0373936_0078578 3300035113 Bacteria 1370
1000 Ga0373939_0001965 3300035114 Bacteria 4916
1001 Ga0373939_0021734 3300035114 Bacteria 1760
1002 Ga0373941_0003378 3300035115 Bacteria 3612
1003 Ga0373945_0008514 3300035116 Bacteria 3344
1004 Ga0373945_0034692 3300035116 Bacteria 1799
1005 Ga0373953_0001370 3300035117 Bacteria 7005
1006 Ga0373953_0019434 3300035117 Bacteria 2527
1007 Ga0373953_0038626 3300035117 Bacteria 1889
1008 Ga0373954_0001371 3300035118 Bacteria 9830
1009 Ga0373954_0014718 3300035118 Bacteria 3490
1010 Ga0373954_0020580 3300035118 Bacteria 2986
1011 Ga0373956_0013664 3300035119 Bacteria 3379
1012 Ga0373956_0041543 3300035119 Bacteria 2042
1013 Ga0373957_0008557 3300035120 Bacteria 3320
1014 Ga0373957_0018776 3300035120 Bacteria 2425
1015 Ga0373957_0088922 3300035120 Bacteria 1226
1016 Ga0373960_0049044 3300035121 Bacteria 1247
1017 Ga0373943_0000918 3300035170 Bacteria 12966
1018 Ga0373943_0006231 3300035170 Bacteria 5358
1019 Ga0373943_0011453 3300035170 Bacteria 3990
1020 Ga0373943_0024465 3300035170 Bacteria 2815
1021 Ga0373943_0092935 3300035170 Bacteria 1565
1022 Ga0373946_0004396 3300035171 Bacteria 5047
1023 Ga0373946_0016833 3300035171 Bacteria 2790
1024 Ga0373946_0056677 3300035171 Bacteria 1655
1025 Ga0373955_0001179 3300035172 Bacteria 11123
1026 Ga0373955_0017677 3300035172 Bacteria 3533
1027 Ga0373955_0032229 3300035172 Bacteria 2750
1028 Ga0373955_0094771 3300035172 Bacteria 1706
1029 Ga0373955_0135259 3300035172 Bacteria 1441
1030 Ga0373942_0001142 3300035207 Bacteria 7047
1031 Ga0373961_0017751 3300035241 Bacteria 1850
1032 Ga0373961_0019036 3300035241 Bacteria 1799
1033 Ga0373962_0001106 3300035242 Bacteria 6274
1034 Ga0316574_0388472 3300035398 Bacteria 880
1035 Ga0373924_0014977 3300035410 Bacteria 2938
1036 Ga0373924_0093130 3300035410 Bacteria 1290
1037 Ga0373931_0000305 3300035691 Bacteria 20657
1038 Ga0373931_0020150 3300035691 Bacteria 3334
1039 Ga0373931_0033067 3300035691 Bacteria 2678
1040 Ga0373931_0217256 3300035691 Bacteria 1149
1041 Ga0373935_0003403 3300035692 Bacteria 9238
1042 Ga0373935_0014201 3300035692 Bacteria 4806
1043 Ga0373935_0021874 3300035692 Bacteria 3915
1044 Ga0373935_0213221 3300035692 Bacteria 1339
1045 Ga0373935_0248291 3300035692 Bacteria 1244
1046 Ga0373927_0017421 3300035695 Bacteria 4727
1047 Ga0373927_0017892 3300035695 Bacteria 4660
1048 Ga0373927_0103791 3300035695 Bacteria 1850
1049 Ga0373927_0252607 3300035695 Bacteria 1159
1050 Ga0373933_0012634 3300035724 Bacteria 4666
1051 Ga0373933_0018034 3300035724 Bacteria 3965
1052 Ga0373933_0030576 3300035724 Bacteria 3118
1053 Ga0373947_0006238 3300035725 Bacteria 6931
1054 Ga0373947_0009172 3300035725 Bacteria 5687
1055 Ga0373947_0062903 3300035725 Bacteria 2260
1056 Ga0373947_0398055 3300035725 Bacteria 928
1057 Ga0373937_0007608 3300036401 Bacteria 9383
1058 Ga0373937_0025062 3300036401 Bacteria 5384
1059 Ga0373937_0039941 3300036401 Bacteria 4277
1060 Ga0373937_0072988 3300036401 Bacteria 3165
1061 Ga0373937_0077479 3300036401 Bacteria 3072
1062 Ga0373937_0126066 3300036401 Bacteria 2388
1063 Ga0373937_0411316 3300036401 Bacteria 1283
1064 Ga0373937_0422939 3300036401 Bacteria 1264
1065 Ga0373937_0666658 3300036401 Bacteria 986
1066 Ga0373937_0731608 3300036401 Bacteria 936
1067 Ga0373937_0744705 3300036401 Bacteria 927
1068 Ga0316582_0312479 3300036647 Bacteria 1080
1069 Ga0373925_0002514 3300037068 Bacteria 14651
1070 Ga0373925_0011485 3300037068 Bacteria 6409
1071 Ga0373925_0020892 3300037068 Bacteria 4771
1072 Ga0373925_0022203 3300037068 Bacteria 4627
1073 Ga0373925_0051088 3300037068 Bacteria 3085
1074 Ga0373925_0156062 3300037068 Bacteria 1795
1075 Ga0373925_0300431 3300037068 Bacteria 1296
1076 Ga0395899_0032920 3300037312 Bacteria 3895
1077 Ga0395899_0053109 3300037312 Bacteria 3001
1078 Ga0395900_0022401 3300037418 Bacteria 6461
1079 Ga0395900_0104393 3300037418 Bacteria 2911
1080 Ga0395900_0233159 3300037418 Bacteria 1850
1081 Ga0395900_0298709 3300037418 Bacteria 1597
1082 Ga0395900_0419468 3300037418 Bacteria 1299
1083 Ga0395900_0607650 3300037418 Bacteria 1033
1084 Ga0395898_0021752 3300037466 Bacteria 6499
1085 Ga0395898_0021940 3300037466 Bacteria 6467
1086 Ga0395898_0047384 3300037466 Bacteria 4218
1087 Ga0395898_0139246 3300037466 Bacteria 2323
1088 Ga0395898_0222431 3300037466 Bacteria 1800
1089 Ga0436364_0333324 3300037853 Bacteria 10396
1090 Ga0395901_0015561 3300038443 Bacteria 7748
1091 Ga0395901_0057654 3300038443 Bacteria 4039
1092 Ga0395901_0105438 3300038443 Bacteria 2958
1093 Ga0395901_0196440 3300038443 Bacteria 2115
1094 Ga0395901_0425885 3300038443 Bacteria 1360
1095 Ga0395901_0454020 3300038443 Bacteria 1310
1096 Ga0395901_0829599 3300038443 Bacteria 911
1097 Ga0400483_117124 3300039062 Bacteria 6760
1098 Ga0436365_0032540 3300039437 Bacteria 1867
1099 Ga0436365_0152711 3300039437 Bacteria 1231
1100 Ga0436365_0680520 3300039437 Bacteria 2305
1101 Ga0436365_1138385 3300039437 Bacteria 908
1102 Ga0436365_1200736 3300039437 Bacteria 1999
1103 Ga0436365_1245822 3300039437 Bacteria 2312
1104 Ga0436365_1505093 3300039437 Bacteria 2918
1105 Ga0436365_1637588 3300039437 Bacteria 49130
1106 Ga0436365_1682615 3300039437 Bacteria 4267
1107 Ga0436365_1870318 3300039437 Bacteria 5247
1108 Ga0436360_0155882 3300039438 Bacteria 1317
1109 Ga0436360_0174767 3300039438 Bacteria 1232
1110 Ga0436360_0842897 3300039438 Bacteria 1330
1111 Ga0436361_0057811 3300039447 Bacteria 854
1112 Ga0436363_0402877 3300039450 Bacteria 3022
1113 Ga0436362_0451203 3300039453 Bacteria 919
1114 Ga0436362_0808711 3300039453 Bacteria 2134
1115 Ga0439453_0002481 3300041408 Bacteria 2553
1116 Ga0439443_002060 3300042003 Bacteria 2347
1117 Ga0450923_011089 3300042125 Bacteria 1614
1118 Ga0439458_0077397 3300042157 Bacteria 845
1119 Ga0439435_0021439 3300042436 Bacteria 1677
1120 Ga0439435_0042295 3300042436 Bacteria 1279
1121 Ga0439440_0012161 3300042993 Bacteria 1826
1122 Ga0466966_0191039 3300044684 Bacteria 1241
1123 Ga0466963_0019290 3300044694 Bacteria 4274
1124 Ga0466957_0014805 3300044842 Bacteria 4545
1125 Ga0466957_0033087 3300044842 Bacteria 3100
1126 Ga0466957_0075585 3300044842 Bacteria 2090
1127 Ga0451576_0024106 3300045051 Bacteria 6574
1128 Ga0451576_0043660 3300045051 Bacteria 4729
1129 Ga0466967_0011664 3300045976 Bacteria 6675
1130 Ga0466967_0031236 3300045976 Bacteria 4481
1131 Ga0495627_065240 3300046453 Bacteria 1070
1132 Ga0495592_0001138 3300046454 Bacteria 18507
1133 Ga0495592_0043997 3300046454 Bacteria 3338
1134 Ga0495592_0123999 3300046454 Bacteria 1814
1135 Ga0495603_0000644 3300046455 Bacteria 19646
1136 Ga0495603_0012514 3300046455 Bacteria 5137
1137 Ga0495603_0013543 3300046455 Bacteria 4933
1138 Ga0495629_0000177 3300046459 Bacteria 56906
1139 Ga0495629_0000317 3300046459 Bacteria 41238
1140 Ga0495629_0029090 3300046459 Bacteria 3921
1141 Ga0495629_0473847 3300046459 Bacteria 846
1142 Ga0495629_0550137 3300046459 Bacteria 775
1143 Ga0495641_0009769 3300046461 Bacteria 5662
1144 Ga0495641_0035126 3300046461 Bacteria 2366
1145 Ga0495641_0129595 3300046461 Bacteria 1126
1146 Ga0495651_0003129 3300046462 Bacteria 12760
1147 Ga0495651_0004850 3300046462 Bacteria 10291
1148 Ga0495653_0000149 3300046463 Bacteria 58288
1149 Ga0495653_0061894 3300046463 Bacteria 2829
1150 Ga0495653_0072344 3300046463 Bacteria 2574
1151 Ga0495653_0275613 3300046463 Bacteria 1106
1152 Ga0495653_0405121 3300046463 Bacteria 866
1153 Ga0495580_0000498 3300046472 Bacteria 32908
1154 Ga0495580_0036721 3300046472 Bacteria 3517
1155 Ga0495580_0046764 3300046472 Bacteria 3069
1156 Ga0495580_0074442 3300046472 Bacteria 2370
1157 Ga0495580_0088638 3300046472 Bacteria 2154
1158 Ga0495582_0000185 3300046473 Bacteria 34065
1159 Ga0495582_0013082 3300046473 Bacteria 4570
1160 Ga0495582_0044051 3300046473 Bacteria 2458
1161 Ga0495582_0170090 3300046473 Bacteria 1240
1162 Ga0495582_0314423 3300046473 Bacteria 901
1163 Ga0495605_0138713 3300046474 Bacteria 1092
1164 Ga0495639_0001788 3300046475 Bacteria 9521
1165 Ga0495639_0009268 3300046475 Bacteria 4218
1166 Ga0495639_0092685 3300046475 Bacteria 1419
1167 Ga0495662_0015062 3300046476 Bacteria 3757
1168 Ga0495662_0069984 3300046476 Bacteria 1700
1169 Ga0495662_0093593 3300046476 Bacteria 1467
1170 Ga0495664_0033507 3300046477 Bacteria 3018
1171 Ga0495664_0076784 3300046477 Bacteria 1999
1172 Ga0495664_0132628 3300046477 Bacteria 1509
1173 Ga0495664_0386270 3300046477 Bacteria 841
1174 Ga0495584_0020723 3300046491 Bacteria 3339
1175 Ga0495584_0063797 3300046491 Bacteria 1852
1176 Ga0495585_0004711 3300046492 Bacteria 8786
1177 Ga0495585_0178166 3300046492 Bacteria 1094
1178 Ga0495594_0000023 3300046499 Bacteria 70363
1179 Ga0495594_0053830 3300046499 Bacteria 2217
1180 Ga0495607_0008511 3300046501 Bacteria 7013
1181 Ga0495607_0193664 3300046501 Bacteria 1011
1182 Ga0495606_0050237 3300046507 Bacteria 2729
1183 Ga0495608_0007771 3300046511 Bacteria 7551
1184 Ga0495608_0016548 3300046511 Bacteria 5103
1185 Ga0495608_0071471 3300046511 Bacteria 2264
1186 Ga0495608_0189523 3300046511 Bacteria 1299
1187 Ga0495610_0046787 3300046512 Bacteria 2132
1188 Ga0495616_0035835 3300046513 Bacteria 2564
1189 Ga0495616_0174155 3300046513 Bacteria 960
1190 Ga0495618_0086295 3300046514 Bacteria 2007
1191 Ga0495618_0086821 3300046514 Bacteria 2000
1192 Ga0495618_0121557 3300046514 Bacteria 1672
1193 Ga0495620_0083704 3300046515 Bacteria 1287
1194 Ga0495628_0005831 3300046516 Bacteria 10790
1195 Ga0495630_0106670 3300046517 Bacteria 2122
1196 Ga0495630_0264712 3300046517 Bacteria 1313
1197 Ga0495630_0301723 3300046517 Bacteria 1224
1198 Ga0495632_0062625 3300046519 Bacteria 1803
1199 Ga0495643_0086414 3300046522 Bacteria 1624
1200 Ga0495644_0000713 3300046523 Bacteria 13759
1201 Ga0495648_0008251 3300046524 Bacteria 8213
1202 Ga0495666_0038494 3300046526 Bacteria 2325
1203 Ga0495652_0026006 3300046529 Bacteria 5172
1204 Ga0495652_0138777 3300046529 Bacteria 1914
1205 Ga0495652_0228765 3300046529 Bacteria 1392
1206 Ga0495654_0144998 3300046530 Bacteria 1055
1207 Ga0495665_0004028 3300046531 Bacteria 7928
1208 Ga0495665_0004234 3300046531 Bacteria 7745
1209 Ga0495665_0020621 3300046531 Bacteria 3539
1210 Ga0495665_0137795 3300046531 Bacteria 1276
1211 Ga0495640_0036039 3300046533 Bacteria 3498
1212 Ga0495640_0062400 3300046533 Bacteria 2527
1213 Ga0495640_0068878 3300046533 Bacteria 2380
1214 Ga0495640_0096857 3300046533 Bacteria 1940
1215 Ga0495640_0162175 3300046533 Bacteria 1432
1216 Ga0495640_0292638 3300046533 Bacteria 1012
1217 Ga0495586_0047555 3300046535 Bacteria 2316
1218 Ga0495587_0001671 3300046536 Bacteria 14800
1219 Ga0495587_0031176 3300046536 Bacteria 3230
1220 Ga0495587_0128938 3300046536 Bacteria 1446
1221 Ga0495587_0161457 3300046536 Bacteria 1275
1222 Ga0495598_0006692 3300046537 Bacteria 2613
1223 Ga0495598_0015543 3300046537 Bacteria 1924
1224 Ga0495609_0050263 3300046538 Bacteria 1859
1225 Ga0495609_0092341 3300046538 Bacteria 1316
1226 Ga0495609_0230676 3300046538 Bacteria 767
1227 Ga0495645_0005350 3300046543 Bacteria 8799
1228 Ga0495645_0017640 3300046543 Bacteria 5115
1229 Ga0495645_0041803 3300046543 Bacteria 3342
1230 Ga0495645_0050307 3300046543 Bacteria 3034
1231 Ga0495622_0000916 3300046557 Bacteria 15986
1232 Ga0495622_0026496 3300046557 Bacteria 2706
1233 Ga0495622_0148504 3300046557 Bacteria 1061
1234 Ga0495633_0000941 3300046558 Bacteria 24412
1235 Ga0495667_0004251 3300046559 Bacteria 9648
1236 Ga0495667_0006602 3300046559 Bacteria 7875
1237 Ga0495667_0011743 3300046559 Bacteria 5932
1238 Ga0495667_0057695 3300046559 Bacteria 2551
1239 Ga0495667_0355294 3300046559 Bacteria 925
1240 Ga0495656_0000589 3300046615 Bacteria 11760
1241 Ga0495634_0036751 3300046642 Bacteria 3348
1242 Ga0495634_0050361 3300046642 Bacteria 2797
1243 Ga0495634_0126421 3300046642 Bacteria 1633
1244 Ga0495634_0215317 3300046642 Bacteria 1188
1245 Ga0495611_0106226 3300046648 Bacteria 1306
1246 Ga0495611_0192766 3300046648 Bacteria 951
1247 Ga0495625_0028714 3300046660 Bacteria 4167
1248 Ga0495625_0475799 3300046660 Bacteria 768
1249 Ga0495635_0007513 3300046663 Bacteria 7606
1250 Ga0495635_0008691 3300046663 Bacteria 7094
1251 Ga0495635_0102078 3300046663 Bacteria 1960
1252 Ga0495635_0146883 3300046663 Bacteria 1605
1253 Ga0495635_0263989 3300046663 Bacteria 1159
1254 Ga0495635_0340540 3300046663 Bacteria 1002
1255 Ga0495635_0398521 3300046663 Bacteria 914
1256 Ga0495659_0003548 3300046664 Bacteria 4967
1257 Ga0495661_0011421 3300046665 Bacteria 6028
1258 Ga0495661_0027406 3300046665 Bacteria 3658
1259 Ga0495588_0005432 3300046674 Bacteria 5672
1260 Ga0495588_0011242 3300046674 Bacteria 4195
1261 Ga0495588_0041790 3300046674 Bacteria 2342
1262 Ga0495657_0011421 3300046675 Bacteria 6638
1263 Ga0495657_0019703 3300046675 Bacteria 4863
1264 Ga0495657_0026745 3300046675 Bacteria 4083
1265 Ga0495657_0037526 3300046675 Bacteria 3339
1266 Ga0495657_0053216 3300046675 Bacteria 2710
1267 Ga0495657_0121577 3300046675 Bacteria 1644
1268 Ga0495657_0307333 3300046675 Bacteria 945
1269 Ga0495599_0018700 3300046678 Bacteria 4317
1270 Ga0495599_0067022 3300046678 Bacteria 2242
1271 Ga0495599_0211321 3300046678 Bacteria 1189
1272 Ga0495623_0000858 3300046679 Bacteria 20593
1273 Ga0495623_0002372 3300046679 Bacteria 12521
1274 Ga0495623_0400881 3300046679 Bacteria 738
1275 Ga0495646_0007260 3300046680 Bacteria 7040
1276 Ga0495646_0013907 3300046680 Bacteria 5115
1277 Ga0495646_0293914 3300046680 Bacteria 861
1278 Ga0495647_0006380 3300046681 Bacteria 3902
1279 Ga0495647_0009980 3300046681 Bacteria 3227
1280 Ga0495647_0093629 3300046681 Bacteria 1235
1281 Ga0495658_0001492 3300046683 Bacteria 12268
1282 Ga0495658_0002288 3300046683 Bacteria 9659
1283 Ga0495658_0007902 3300046683 Bacteria 5265
1284 Ga0495658_0017238 3300046683 Bacteria 3728
1285 Ga0495658_0021417 3300046683 Bacteria 3408
1286 Ga0495658_0037194 3300046683 Bacteria 2689
1287 Ga0495669_0092584 3300046684 Bacteria 1397
1288 Ga0495669_0111866 3300046684 Bacteria 1275
1289 Ga0495613_0013711 3300046689 Bacteria 6013
1290 Ga0495613_0024584 3300046689 Bacteria 4488
1291 Ga0495613_0045423 3300046689 Bacteria 3249
1292 Ga0495613_0056840 3300046689 Bacteria 2873
1293 Ga0495624_0048203 3300046690 Bacteria 2704
1294 Ga0495624_0190045 3300046690 Bacteria 1249
1295 Ga0495670_0001016 3300046691 Bacteria 13619
1296 Ga0495671_0058073 3300046692 Bacteria 1914
1297 Ga0495671_0066432 3300046692 Bacteria 1775
1298 Ga0495649_0066314 3300046694 Bacteria 1937
1299 Ga0495589_0032579 3300046794 Bacteria 2620
1300 Ga0495589_0146279 3300046794 Bacteria 1130
1301 Ga0495600_0002535 3300046809 Bacteria 10511
1302 Ga0495600_0004858 3300046809 Bacteria 8070
1303 Ga0495600_0057702 3300046809 Bacteria 2535
1304 Ga0495600_0100175 3300046809 Bacteria 1888
1305 Ga0495600_0118459 3300046809 Bacteria 1722
1306 Ga0495600_0272229 3300046809 Bacteria 1074
1307 Ga0495660_0060594 3300046810 Bacteria 2032
1308 Ga0495581_0001042 3300047315 Bacteria 15004
1309 Ga0495581_0137501 3300047315 Bacteria 1424
1310 Ga0495604_0007851 3300047317 Bacteria 8446
1311 Ga0495604_0007934 3300047317 Bacteria 8408
1312 Ga0495604_0072089 3300047317 Bacteria 2611
1313 Ga0495636_0076801 3300047318 Bacteria 1433
1314 Ga0495674_0100641 3300047319 Bacteria 2459
1315 Ga0495674_0134805 3300047319 Bacteria 2079
1316 Ga0495674_0153457 3300047319 Bacteria 1930
1317 Ga0495674_0225067 3300047319 Bacteria 1549
1318 Ga0495672_0059536 3300047320 Bacteria 2209
1319 Ga0495672_0113453 3300047320 Bacteria 1451
1320 Ga0495672_0167802 3300047320 Bacteria 1122
1321 Ga0495676_0008691 3300047321 Bacteria 9296
1322 Ga0495676_0013652 3300047321 Bacteria 7289
1323 Ga0495676_0069481 3300047321 Bacteria 2717
1324 Ga0495680_0019366 3300047322 Bacteria 5745
1325 Ga0495680_0026170 3300047322 Bacteria 4814
1326 Ga0495680_0047015 3300047322 Bacteria 3398
1327 Ga0495680_0058793 3300047322 Bacteria 2969
1328 Ga0495680_0068123 3300047322 Bacteria 2720
1329 Ga0495680_0106939 3300047322 Bacteria 2078
1330 Ga0495680_0144944 3300047322 Bacteria 1735
1331 Ga0495680_0312289 3300047322 Bacteria 1101
1332 Ga0495675_0006492 3300047444 Bacteria 7157
1333 Ga0495675_0169775 3300047444 Bacteria 1340
1334 Ga0495675_0207164 3300047444 Bacteria 1192
1335 Ga0495677_0142461 3300047445 Bacteria 921
1336 Ga0495679_024983 3300047446 Bacteria 2004
1337 Ga0495684_0082884 3300047471 Bacteria 2433
1338 Ga0495684_0176675 3300047471 Bacteria 1585
1339 Ga0495684_0281160 3300047471 Bacteria 1201
1340 Ga0495686_0077376 3300047472 Bacteria 2037
1341 Ga0495593_0001943 3300047673 Bacteria 12328
1342 Ga0495593_0012417 3300047673 Bacteria 4870
1343 Ga0495593_0022296 3300047673 Bacteria 3531
1344 Ga0495593_0059926 3300047673 Bacteria 1993
1345 Ga0495602_0007161 3300048088 Bacteria 11684
1346 Ga0495602_0074205 3300048088 Bacteria 2892
1347 Ga0495602_0163605 3300048088 Bacteria 1734
1348 Ga0495614_0000618 3300048089 Bacteria 14895
1349 Ga0495614_0031857 3300048089 Bacteria 2269
1350 Ga0495626_0097869 3300048091 Bacteria 1282
1351 Ga0496100_0116994 3300048903 Bacteria 1860
1352 Ga0496100_0175028 3300048903 Bacteria 1548
1353 Ga0496100_0257045 3300048903 Bacteria 1294
1354 Ga0496101_0000969 3300048904 Bacteria 16936
1355 Ga0496101_0014870 3300048904 Bacteria 5237
1356 Ga0496101_0019543 3300048904 Bacteria 4625
1357 Ga0496101_0049050 3300048904 Bacteria 3035
1358 Ga0496102_0004376 3300048905 Bacteria 11928
1359 Ga0496102_0062325 3300048905 Bacteria 3414
1360 Ga0496102_0067172 3300048905 Bacteria 3288
1361 Ga0496102_0158448 3300048905 Bacteria 2129
1362 Ga0496102_0569399 3300048905 Bacteria 1055
1363 Ga0496102_0614555 3300048905 Bacteria 1010
1364 Ga0496103_0001732 3300048906 Bacteria 14251
1365 Ga0496103_0023227 3300048906 Bacteria 3738
1366 Ga0496103_0061364 3300048906 Bacteria 2338
1367 Ga0496103_0100733 3300048906 Bacteria 1828
1368 Ga0496104_0000399 3300048907 Bacteria 38066
1369 Ga0496104_0101217 3300048907 Bacteria 2758
1370 Ga0496104_0108172 3300048907 Bacteria 2664
1371 Ga0496104_0174623 3300048907 Bacteria 2059
1372 Ga0496104_0189398 3300048907 Bacteria 1968
1373 Ga0496104_0251879 3300048907 Bacteria 1678
1374 Ga0496105_0002417 3300048908 Bacteria 13529
1375 Ga0496105_0035470 3300048908 Bacteria 4104
1376 Ga0496105_0316563 3300048908 Bacteria 1251
1377 Ga0496105_0342805 3300048908 Bacteria 1194
1378 Ga0496105_0345285 3300048908 Bacteria 1189
1379 Ga0496106_0015788 3300048909 Bacteria 5584
1380 Ga0496106_0036410 3300048909 Bacteria 3681
1381 Ga0496106_0278742 3300048909 Bacteria 1339
1382 Ga0496106_0316134 3300048909 Bacteria 1253
1383 Ga0496106_0822784 3300048909 Bacteria 736
1384 Ga0496107_0005598 3300048910 Bacteria 8604
1385 Ga0496107_0020535 3300048910 Bacteria 4667
1386 Ga0496107_0091546 3300048910 Bacteria 2223
1387 Ga0496107_0092306 3300048910 Bacteria 2213
1388 Ga0496107_0135855 3300048910 Bacteria 1816
1389 Ga0496107_0205055 3300048910 Bacteria 1466
1390 Ga0496107_0345267 3300048910 Bacteria 1107
1391 Ga0496108_0007368 3300048911 Bacteria 8919
1392 Ga0496108_0167448 3300048911 Bacteria 1900
1393 Ga0496108_0543052 3300048911 Bacteria 1014
1394 Ga0496109_0005949 3300048912 Bacteria 10237
1395 Ga0496109_0012139 3300048912 Bacteria 7430
1396 Ga0496109_0054198 3300048912 Bacteria 3658
1397 Ga0496109_0133489 3300048912 Bacteria 2318
1398 Ga0496109_0367124 3300048912 Bacteria 1360
1399 Ga0496110_0054594 3300048913 Bacteria 3514
1400 Ga0496110_0106807 3300048913 Bacteria 2512
1401 Ga0496110_0121916 3300048913 Bacteria 2349
1402 Ga0496110_0253605 3300048913 Bacteria 1601
1403 Ga0496110_0608904 3300048913 Bacteria 990
1404 Ga0496110_0834079 3300048913 Bacteria 827
1405 Ga0496111_0037153 3300048914 Bacteria 3486
1406 Ga0496111_0043921 3300048914 Bacteria 3213
1407 Ga0496112_0070213 3300048915 Bacteria 3461
1408 Ga0496112_0139286 3300048915 Bacteria 2395
1409 Ga0496112_0178648 3300048915 Bacteria 2086
1410 Ga0496112_0273206 3300048915 Bacteria 1638
1411 Ga0496112_0336823 3300048915 Bacteria 1452
1412 Ga0496113_0043476 3300048916 Bacteria 3325
1413 Ga0496113_0045614 3300048916 Bacteria 3251
1414 Ga0496113_0049357 3300048916 Bacteria 3133
1415 Ga0496113_0129113 3300048916 Bacteria 1982
1416 Ga0496113_0182482 3300048916 Bacteria 1664
1417 Ga0496113_0347681 3300048916 Bacteria 1189
1418 Ga0496113_0487029 3300048916 Bacteria 990
1419 Ga0496113_0529394 3300048916 Bacteria 946
1420 Ga0496114_0002647 3300048917 Bacteria 13668
1421 Ga0496114_0048435 3300048917 Bacteria 3535
1422 Ga0496114_0069593 3300048917 Bacteria 2955
1423 Ga0496114_0106109 3300048917 Bacteria 2403
1424 Ga0496114_0126273 3300048917 Bacteria 2205
1425 Ga0496115_0024784 3300048918 Bacteria 4665
1426 Ga0496115_0030807 3300048918 Bacteria 4223
1427 Ga0496115_0047461 3300048918 Bacteria 3435
1428 Ga0496115_0082945 3300048918 Bacteria 2612
1429 Ga0496115_0117368 3300048918 Bacteria 2189
1430 Ga0496115_0215818 3300048918 Bacteria 1584
1431 Ga0496115_0262717 3300048918 Bacteria 1419
1432 Ga0496115_0349341 3300048918 Bacteria 1206
1433 Ga0496116_0047218 3300048919 Bacteria 2899
1434 Ga0496117_0128671 3300048920 Bacteria 1539
1435 Ga0496118_0271882 3300048921 Bacteria 949
1436 Ga0496119_0040092 3300048922 Bacteria 3000
1437 Ga0496119_0105536 3300048922 Bacteria 1574
1438 Ga0496119_0242680 3300048922 Bacteria 912
1439 Ga0496120_0019667 3300048923 Bacteria 4313
1440 Ga0496120_0072566 3300048923 Bacteria 1886
1441 Ga0496121_0003067 3300048924 Bacteria 24202
1442 Ga0496121_0006108 3300048924 Bacteria 15150
1443 Ga0496121_0036137 3300048924 Bacteria 4407
1444 Ga0496121_0203792 3300048924 Bacteria 1408
1445 Ga0496121_0219426 3300048924 Bacteria 1340
1446 Ga0496122_0043087 3300048925 Bacteria 3540
1447 Ga0496122_0164998 3300048925 Bacteria 1344
1448 Ga0496123_0048593 3300048926 Bacteria 2853
1449 Ga0496123_0094491 3300048926 Bacteria 1761
1450 Ga0496124_0217321 3300048927 Bacteria 1440
1451 Ga0496125_0001858 3300048928 Bacteria 29110
1452 Ga0496125_0115218 3300048928 Bacteria 1933
1453 Ga0496125_0168911 3300048928 Bacteria 1473
1454 Ga0496126_0000480 3300048929 Bacteria 79257
1455 Ga0496126_0040052 3300048929 Bacteria 4345
1456 Ga0496126_0090979 3300048929 Bacteria 2684
1457 Ga0496126_0110380 3300048929 Bacteria 2396
1458 Ga0496126_0117141 3300048929 Bacteria 2314
1459 Ga0496126_0150833 3300048929 Bacteria 1992
1460 Ga0496126_0341974 3300048929 Bacteria 1225
1461 Ga0496126_0392309 3300048929 Bacteria 1128
1462 Ga0495682_0013068 3300049460 Bacteria 3166
1463 Ga0501031_0044398 3300049568 Bacteria 2900
1464 Ga0501031_0070573 3300049568 Bacteria 2275
1465 Ga0501031_0074807 3300049568 Bacteria 2205
1466 Ga0501031_0085878 3300049568 Bacteria 2051
1467 Ga0501031_0090980 3300049568 Bacteria 1990
1468 Ga0501032_0008814 3300049569 Bacteria 7337
1469 Ga0501032_0040734 3300049569 Bacteria 3156
1470 Ga0501032_0042811 3300049569 Bacteria 3070
1471 Ga0501032_0058423 3300049569 Bacteria 2589
1472 Ga0501032_0118749 3300049569 Bacteria 1748
1473 Ga0501032_0163537 3300049569 Bacteria 1461
1474 Ga0501032_0238250 3300049569 Bacteria 1182
1475 Ga0501032_0270312 3300049569 Bacteria 1101
1476 Ga0501033_0000094 3300049570 Bacteria 84669
1477 Ga0501033_0021359 3300049570 Bacteria 4883
1478 Ga0501033_0033508 3300049570 Bacteria 3856
1479 Ga0501033_0086738 3300049570 Bacteria 2291
1480 Ga0501033_0101453 3300049570 Bacteria 2099
1481 Ga0501033_0139045 3300049570 Bacteria 1756
1482 Ga0501033_0216760 3300049570 Bacteria 1363
1483 Ga0501033_0222912 3300049570 Bacteria 1341
1484 Ga0501033_0392054 3300049570 Bacteria 969
1485 Ga0501034_0000021 3300049571 Bacteria 266023
1486 Ga0501034_0000482 3300049571 Bacteria 65380
1487 Ga0501034_0002673 3300049571 Bacteria 21040
1488 Ga0501034_0024772 3300049571 Bacteria 6104
1489 Ga0501034_0046023 3300049571 Bacteria 4408
1490 Ga0501034_0060811 3300049571 Bacteria 3794
1491 Ga0501034_0062644 3300049571 Bacteria 3735
1492 Ga0501034_0134254 3300049571 Bacteria 2456
1493 Ga0501034_0164332 3300049571 Bacteria 2189
1494 Ga0501034_0167276 3300049571 Bacteria 2167
1495 Ga0501034_0212658 3300049571 Bacteria 1888
1496 Ga0501034_0240132 3300049571 Bacteria 1758
1497 Ga0501034_0247867 3300049571 Bacteria 1726
1498 Ga0501034_0269164 3300049571 Bacteria 1645
1499 Ga0501034_0339036 3300049571 Bacteria 1433
1500 Ga0501034_0349858 3300049571 Bacteria 1406
1501 Ga0501034_0464352 3300049571 Bacteria 1182
1502 Ga0501036_0001704 3300049572 Bacteria 17077
1503 Ga0501036_0005563 3300049572 Bacteria 10220
1504 Ga0501036_0005653 3300049572 Bacteria 10145
1505 Ga0501036_0076536 3300049572 Bacteria 2830
1506 Ga0501036_0091111 3300049572 Bacteria 2575
1507 Ga0501036_0091320 3300049572 Bacteria 2572
1508 Ga0501036_0177505 3300049572 Bacteria 1793
1509 Ga0501037_0000450 3300049573 Bacteria 33712
1510 Ga0501037_0046720 3300049573 Bacteria 3175
1511 Ga0501037_0050986 3300049573 Bacteria 3027
1512 Ga0501037_0056591 3300049573 Bacteria 2863
1513 Ga0501037_0063759 3300049573 Bacteria 2686
1514 Ga0501037_0095843 3300049573 Bacteria 2144
1515 Ga0501037_0108992 3300049573 Bacteria 1995
1516 Ga0501037_0141799 3300049573 Bacteria 1719
1517 Ga0501037_0290529 3300049573 Bacteria 1137
1518 Ga0501038_0000052 3300049574 Bacteria 94841
1519 Ga0501038_0037384 3300049574 Bacteria 4256
1520 Ga0501038_0046533 3300049574 Bacteria 3761
1521 Ga0501038_0058047 3300049574 Bacteria 3319
1522 Ga0501038_0071577 3300049574 Bacteria 2941
1523 Ga0501038_0071986 3300049574 Bacteria 2930
1524 Ga0501038_0079573 3300049574 Bacteria 2763
1525 Ga0501038_0083447 3300049574 Bacteria 2690
1526 Ga0501038_0098475 3300049574 Bacteria 2438
1527 Ga0501038_0108148 3300049574 Bacteria 2306
1528 Ga0501038_0113532 3300049574 Bacteria 2242
1529 Ga0501038_0115212 3300049574 Bacteria 2222
1530 Ga0501038_0134728 3300049574 Bacteria 2025
1531 Ga0501038_0146399 3300049574 Bacteria 1928
1532 Ga0501038_0158446 3300049574 Bacteria 1841
1533 Ga0501038_0355974 3300049574 Bacteria 1139
1534 Ga0501039_0000549 3300049575 Bacteria 27168
1535 Ga0501039_0039657 3300049575 Bacteria 3637
1536 Ga0501039_0094100 3300049575 Bacteria 2335
1537 Ga0501039_0116277 3300049575 Bacteria 2093
1538 Ga0501039_0151389 3300049575 Bacteria 1822
1539 Ga0501039_0179242 3300049575 Bacteria 1666
1540 Ga0501039_0273189 3300049575 Bacteria 1329
1541 Ga0501039_0293386 3300049575 Bacteria 1278
1542 Ga0501040_0038034 3300049576 Bacteria 3271
1543 Ga0501040_0271288 3300049576 Bacteria 1211
1544 Ga0501040_0358231 3300049576 Bacteria 1045
1545 Ga0501041_0021685 3300049577 Bacteria 3847
1546 Ga0501041_0111333 3300049577 Bacteria 1698
1547 Ga0501042_0014227 3300049578 Bacteria 5429
1548 Ga0501042_0030132 3300049578 Bacteria 3831
1549 Ga0501042_0090650 3300049578 Bacteria 2194
1550 Ga0501042_0094589 3300049578 Bacteria 2146
1551 Ga0501042_0191226 3300049578 Bacteria 1476
1552 Ga0501043_0005051 3300049579 Bacteria 10670
1553 Ga0501043_0012919 3300049579 Bacteria 6526
1554 Ga0501043_0037798 3300049579 Bacteria 3797
1555 Ga0501043_0042971 3300049579 Bacteria 3552
1556 Ga0501043_0093452 3300049579 Bacteria 2364
1557 Ga0501043_0116039 3300049579 Bacteria 2101
1558 Ga0501043_0117710 3300049579 Bacteria 2084
1559 Ga0501043_0129223 3300049579 Bacteria 1980
1560 Ga0501043_0138567 3300049579 Bacteria 1905
1561 Ga0501043_0142315 3300049579 Bacteria 1878
1562 Ga0501043_0230224 3300049579 Bacteria 1431
1563 Ga0501043_0377564 3300049579 Bacteria 1073
1564 Ga0501046_0002237 3300049580 Bacteria 18256
1565 Ga0501046_0024393 3300049580 Bacteria 4963
1566 Ga0501046_0101892 3300049580 Bacteria 2202
1567 Ga0501046_0111685 3300049580 Bacteria 2087
1568 Ga0501046_0154028 3300049580 Bacteria 1733
1569 Ga0501046_0156128 3300049580 Bacteria 1718
1570 Ga0501046_0162788 3300049580 Bacteria 1677
1571 Ga0501046_0175873 3300049580 Bacteria 1603
1572 Ga0501046_0202042 3300049580 Bacteria 1478
1573 Ga0501046_0545747 3300049580 Bacteria 827
1574 Ga0501047_0000235 3300049581 Bacteria 65603
1575 Ga0501047_0017348 3300049581 Bacteria 6894
1576 Ga0501047_0024757 3300049581 Bacteria 5762
1577 Ga0501047_0025781 3300049581 Bacteria 5653
1578 Ga0501047_0044775 3300049581 Bacteria 4277
1579 Ga0501047_0050813 3300049581 Bacteria 4003
1580 Ga0501047_0079255 3300049581 Bacteria 3158
1581 Ga0501047_0095267 3300049581 Bacteria 2855
1582 Ga0501047_0099459 3300049581 Bacteria 2787
1583 Ga0501047_0133502 3300049581 Bacteria 2362
1584 Ga0501047_0134755 3300049581 Bacteria 2350
1585 Ga0501047_0147338 3300049581 Bacteria 2230
1586 Ga0501047_0159685 3300049581 Bacteria 2126
1587 Ga0501047_0223963 3300049581 Bacteria 1736
1588 Ga0501047_0250701 3300049581 Bacteria 1619
1589 Ga0501047_0262622 3300049581 Bacteria 1574
1590 Ga0501047_0277985 3300049581 Bacteria 1519
1591 Ga0501047_0303139 3300049581 Bacteria 1439
1592 Ga0501047_0410524 3300049581 Bacteria 1186
1593 Ga0501047_0592950 3300049581 Bacteria 930
1594 Ga0501047_0697831 3300049581 Bacteria 832
1595 Ga0501048_0001862 3300049582 Bacteria 16006
1596 Ga0501048_0006738 3300049582 Bacteria 8727
1597 Ga0501048_0020705 3300049582 Bacteria 4821
1598 Ga0501048_0041101 3300049582 Bacteria 3312
1599 Ga0501048_0103199 3300049582 Bacteria 2012
1600 Ga0501048_0138183 3300049582 Bacteria 1722
1601 Ga0501048_0341260 3300049582 Bacteria 1068
1602 Ga0501067_0001776 3300049583 Bacteria 11844
1603 Ga0501067_0005350 3300049583 Bacteria 7126
1604 Ga0501067_0006170 3300049583 Bacteria 6642
1605 Ga0501067_0033573 3300049583 Bacteria 2846
1606 Ga0501067_0051199 3300049583 Bacteria 2289
1607 Ga0501068_0001049 3300049584 Bacteria 14641
1608 Ga0501068_0035313 3300049584 Bacteria 2983
1609 Ga0501069_0001817 3300049585 Bacteria 10655
1610 Ga0501069_0005996 3300049585 Bacteria 6340
1611 Ga0501069_0008119 3300049585 Bacteria 5516
1612 Ga0501069_0030545 3300049585 Bacteria 2959
1613 Ga0501069_0155458 3300049585 Bacteria 1315
1614 Ga0501069_0212034 3300049585 Bacteria 1124
1615 Ga0501070_0001611 3300049586 Bacteria 20025
1616 Ga0501070_0003398 3300049586 Bacteria 13819
1617 Ga0501070_0033678 3300049586 Bacteria 4287
1618 Ga0501070_0069151 3300049586 Bacteria 2923
1619 Ga0501070_0095592 3300049586 Bacteria 2458
1620 Ga0501070_0126129 3300049586 Bacteria 2115
1621 Ga0501070_0163525 3300049586 Bacteria 1834
1622 Ga0501070_0175198 3300049586 Bacteria 1766
1623 Ga0501070_0196271 3300049586 Bacteria 1658
1624 Ga0501070_0258564 3300049586 Bacteria 1423
1625 Ga0501070_0270302 3300049586 Bacteria 1388
1626 Ga0501070_0302330 3300049586 Bacteria 1303
1627 Ga0501070_0417463 3300049586 Bacteria 1084
1628 Ga0501071_0057085 3300049587 Bacteria 2821
1629 Ga0501071_0070423 3300049587 Bacteria 2547
1630 Ga0501071_0088539 3300049587 Bacteria 2272
1631 Ga0501071_0095538 3300049587 Bacteria 2187
1632 Ga0501071_0176824 3300049587 Bacteria 1598
1633 Ga0501071_0228560 3300049587 Bacteria 1401
1634 Ga0501071_0260600 3300049587 Bacteria 1309
1635 Ga0501071_0534980 3300049587 Bacteria 899
1636 Ga0501072_0005670 3300049588 Bacteria 9507
1637 Ga0501072_0013154 3300049588 Bacteria 6335
1638 Ga0501072_0072626 3300049588 Bacteria 2719
1639 Ga0501072_0088285 3300049588 Bacteria 2460
1640 Ga0501072_0158132 3300049588 Bacteria 1807
1641 Ga0501072_0680190 3300049588 Bacteria 809
1642 Ga0501073_0000597 3300049589 Bacteria 25445
1643 Ga0501073_0004494 3300049589 Bacteria 10476
1644 Ga0501073_0028618 3300049589 Bacteria 3981
1645 Ga0501073_0040649 3300049589 Bacteria 3289
1646 Ga0501073_0048979 3300049589 Bacteria 2963
1647 Ga0501073_0085962 3300049589 Bacteria 2187
1648 Ga0501073_0215286 3300049589 Bacteria 1327
1649 Ga0501073_0222782 3300049589 Bacteria 1303
1650 Ga0501073_0436380 3300049589 Bacteria 905
1651 Ga0501074_0008250 3300049590 Bacteria 7550
1652 Ga0501074_0010906 3300049590 Bacteria 6595
1653 Ga0501074_0058520 3300049590 Bacteria 2777
1654 Ga0501074_0169846 3300049590 Bacteria 1557
1655 Ga0501074_0174752 3300049590 Bacteria 1533
1656 Ga0501074_0297540 3300049590 Bacteria 1146
1657 Ga0501074_0556438 3300049590 Bacteria 812
1658 Ga0501075_0095302 3300049591 Bacteria 2258
1659 Ga0501075_0114552 3300049591 Bacteria 2050
1660 Ga0501076_0017899 3300049592 Bacteria 5388
1661 Ga0501076_0054065 3300049592 Bacteria 3182
1662 Ga0501076_0094419 3300049592 Bacteria 2408
1663 Ga0501076_0188244 3300049592 Bacteria 1684
1664 Ga0501076_0382548 3300049592 Bacteria 1157
1665 Ga0501077_0196207 3300049593 Bacteria 1282
1666 Ga0501077_0211172 3300049593 Bacteria 1233
1667 Ga0501079_0001478 3300049741 Bacteria 16629
1668 Ga0501079_0011059 3300049741 Bacteria 6882
1669 Ga0501079_0018448 3300049741 Bacteria 5331
1670 Ga0501079_0037891 3300049741 Bacteria 3717
1671 Ga0501079_0056415 3300049741 Bacteria 3031
1672 Ga0501079_0081804 3300049741 Bacteria 2497
1673 Ga0501079_0142053 3300049741 Bacteria 1870
1674 Ga0501079_0356873 3300049741 Bacteria 1145
1675 Ga0501080_0006960 3300049742 Bacteria 10202
1676 Ga0501080_0028291 3300049742 Bacteria 5213
1677 Ga0501080_0064957 3300049742 Bacteria 3395
1678 Ga0501080_0081520 3300049742 Bacteria 3006
1679 Ga0501080_0247437 3300049742 Bacteria 1626
1680 Ga0501080_0254414 3300049742 Bacteria 1601
1681 Ga0501080_0278784 3300049742 Bacteria 1520
1682 Ga0501080_0279412 3300049742 Bacteria 1518
1683 Ga0501080_0294504 3300049742 Bacteria 1473
1684 Ga0501080_0325595 3300049742 Bacteria 1390
1685 Ga0501080_0361098 3300049742 Bacteria 1310
1686 Ga0501080_0394041 3300049742 Bacteria 1246
1687 Ga0501081_0029037 3300049743 Bacteria 3735
1688 Ga0501081_0089635 3300049743 Bacteria 2161
1689 Ga0501083_0008114 3300049744 Bacteria 7426
1690 Ga0501083_0028991 3300049744 Bacteria 3811
1691 Ga0501083_0069494 3300049744 Bacteria 2343
1692 Ga0501083_0071786 3300049744 Bacteria 2301
1693 Ga0501083_0095282 3300049744 Bacteria 1964
1694 Ga0501083_0163629 3300049744 Bacteria 1455
1695 Ga0501083_0167731 3300049744 Bacteria 1435
1696 Ga0501083_0170624 3300049744 Bacteria 1422
1697 Ga0501083_0393089 3300049744 Bacteria 902
1698 Ga0501035_0000255 3300049822 Bacteria 63841
1699 Ga0501035_0005931 3300049822 Bacteria 11499
1700 Ga0501035_0013364 3300049822 Bacteria 7579
1701 Ga0501035_0024934 3300049822 Bacteria 5484
1702 Ga0501035_0043569 3300049822 Bacteria 4043
1703 Ga0501035_0051927 3300049822 Bacteria 3668
1704 Ga0501035_0055903 3300049822 Bacteria 3523
1705 Ga0501035_0066191 3300049822 Bacteria 3207
1706 Ga0501035_0073482 3300049822 Bacteria 3025
1707 Ga0501035_0079965 3300049822 Bacteria 2886
1708 Ga0501035_0082602 3300049822 Bacteria 2835
1709 Ga0501035_0158311 3300049822 Bacteria 1962
1710 Ga0501035_0224354 3300049822 Bacteria 1603
1711 Ga0501035_0227016 3300049822 Bacteria 1592
1712 Ga0501035_0249041 3300049822 Bacteria 1509
1713 Ga0501035_0322372 3300049822 Bacteria 1298
1714 Ga0501044_0014028 3300049823 Bacteria 8651
1715 Ga0501044_0028702 3300049823 Bacteria 5870
1716 Ga0501044_0038683 3300049823 Bacteria 4980
1717 Ga0501044_0044447 3300049823 Bacteria 4609
1718 Ga0501044_0062058 3300049823 Bacteria 3821
1719 Ga0501044_0107934 3300049823 Bacteria 2794
1720 Ga0501044_0118786 3300049823 Bacteria 2646
1721 Ga0501044_0119255 3300049823 Bacteria 2641
1722 Ga0501044_0134695 3300049823 Bacteria 2462
1723 Ga0501044_0138736 3300049823 Bacteria 2421
1724 Ga0501044_0141817 3300049823 Bacteria 2391
1725 Ga0501044_0225504 3300049823 Bacteria 1823
1726 Ga0501044_0233773 3300049823 Bacteria 1784
1727 Ga0501044_0238198 3300049823 Bacteria 1764
1728 Ga0501044_0270633 3300049823 Bacteria 1634
1729 Ga0501044_0275130 3300049823 Bacteria 1618
1730 Ga0501044_0278859 3300049823 Bacteria 1605
1731 Ga0501044_0343028 3300049823 Bacteria 1414
1732 Ga0501044_0381449 3300049823 Bacteria 1324
1733 Ga0501044_0398557 3300049823 Bacteria 1289
1734 Ga0501044_0410246 3300049823 Bacteria 1266
1735 Ga0501044_0451214 3300049823 Bacteria 1192
1736 Ga0501044_0824870 3300049823 Bacteria 805
1737 Ga0501045_0070801 3300049824 Bacteria 2566
1738 Ga0501045_0087751 3300049824 Bacteria 2297
1739 Ga0501045_0142155 3300049824 Bacteria 1784
1740 Ga0501045_0461578 3300049824 Bacteria 944
1741 nmdc:mga03683_51131_c1 3300050489 Bacteria 1724
1742 nmdc:mga03n38_189102_c1 3300050490 Bacteria 1060
1743 nmdc:mga03n38_59041_c1 3300050490 Bacteria 1740
1744 nmdc:mga00v17_255849_c1 3300050491 Bacteria 1136
1745 nmdc:mga00v17_6230_c1 3300050491 Bacteria 6326
1746 nmdc:mga0yw44_19482_c1 3300050492 Bacteria 3743
1747 nmdc:mga0yw44_46317_c1 3300050492 Bacteria 2611
1748 nmdc:mga0k408_25101_c1 3300050493 Bacteria 3373
1749 nmdc:mga06z11_171341_c1 3300050494 Bacteria 1247
1750 nmdc:mga06z11_7008_c1 3300050494 Bacteria 4623
1751 nmdc:mga07m45_120105_c1 3300050496 Bacteria 1518
1752 nmdc:mga07m45_28689_c1 3300050496 Bacteria 3072
1753 nmdc:mga05p37_1004186_c1 3300050507 Bacteria 886
1754 nmdc:mga05p37_1773_c1 3300050507 Bacteria 25196
1755 nmdc:mga05p37_2437_c1 3300050507 Bacteria 21635
1756 nmdc:mga05p37_36180_c1 3300050507 Bacteria 6059
1757 nmdc:mga09592_1370_c1 3300050508 Bacteria 19524
1758 nmdc:mga0qj67_2465_c1 3300050509 Bacteria 13183
1759 nmdc:mga06r32_591663_c1 3300050510 Bacteria 1081
1760 nmdc:mga06r32_638_c1 3300050510 Bacteria 30472
1761 nmdc:mga08y16_319763_c1 3300050511 Bacteria 1598
1762 nmdc:mga08y16_35725_c1 3300050511 Bacteria 5219
1763 nmdc:mga08y16_413994_c1 3300050511 Bacteria 1378
1764 nmdc:mga08y16_44765_c1 3300050511 Bacteria 4639
1765 nmdc:mga08y16_549_c1 3300050511 Bacteria 34756
1766 nmdc:mga08y16_95891_c1 3300050511 Bacteria 3089
1767 nmdc:mga0n895_158795_c1 3300050512 Bacteria 2292
1768 nmdc:mga0n895_19785_c1 3300050512 Bacteria 6264
1769 nmdc:mga0n895_256768_c1 3300050512 Bacteria 1774
1770 nmdc:mga0n895_283_c1 3300050512 Bacteria 33340
1771 nmdc:mga0n895_343834_c1 3300050512 Bacteria 1511
1772 nmdc:mga0n895_6552_c1 3300050512 Bacteria 9908
1773 nmdc:mga0rr50_127821_c1 3300050513 Bacteria 2031
1774 nmdc:mga0rr50_142937_c1 3300050513 Bacteria 1926
1775 nmdc:mga0rr50_15656_c1 3300050513 Bacteria 5011
1776 nmdc:mga0rr50_21738_c1 3300050513 Bacteria 4387
1777 nmdc:mga0rr50_579135_c1 3300050513 Bacteria 956
1778 nmdc:mga08x19_14934_c1 3300050514 Bacteria 4717
1779 nmdc:mga08x19_177_c1 3300050514 Bacteria 51482
1780 nmdc:mga08x19_195316_c1 3300050514 Bacteria 1386
1781 nmdc:mga08x19_67568_c1 3300050514 Bacteria 2325
1782 nmdc:mga08x19_91478_c1 3300050514 Bacteria 2008
1783 nmdc:mga0a205_136415_c1 3300050515 Bacteria 2354
1784 nmdc:mga0a205_171385_c1 3300050515 Bacteria 2066
1785 nmdc:mga0a205_19999_c1 3300050515 Bacteria 6316
1786 nmdc:mga0a205_387_c1 3300050515 Bacteria 33459
1787 nmdc:mga0a205_8273_c1 3300050515 Bacteria 9459
1788 nmdc:mga0sz30_104861_c1 3300050516 Bacteria 1236
1789 nmdc:mga0sz30_11705_c1 3300050516 Bacteria 3395
1790 nmdc:mga0sz30_8120_c1 3300050516 Bacteria 3954
1791 Ga0495601_0001193 3300053077 Bacteria 14223
1792 Ga0495601_0002336 3300053077 Bacteria 10730
1793 Ga0495601_0004742 3300053077 Bacteria 7882
1794 Ga0495601_0005274 3300053077 Bacteria 7518
1795 Ga0495601_0005651 3300053077 Bacteria 7293
1796 Ga0495601_0007365 3300053077 Bacteria 6453
1797 Ga0495601_0032855 3300053077 Bacteria 3232
1798 Ga0495601_0050869 3300053077 Bacteria 2614
1799 Ga0495601_0181136 3300053077 Bacteria 1377
1800 Ga0495612_0017871 3300053078 Bacteria 2838
1801 Ga0495612_0047295 3300053078 Bacteria 1763
1802 Ga0495612_0063092 3300053078 Bacteria 1536
1803 Ga0495595_0000532 3300053084 Bacteria 14535
1804 Ga0495595_0001637 3300053084 Bacteria 8760
1805 Ga0495595_0022326 3300053084 Bacteria 2777
1806 Ga0495595_0050071 3300053084 Bacteria 1933
1807 Ga0495595_0080343 3300053084 Bacteria 1552
1808 Ga0495595_0085816 3300053084 Bacteria 1505
1809 Ga0495619_0001164 3300053085 Bacteria 17272
1810 Ga0495619_0001481 3300053085 Bacteria 15481
1811 Ga0495619_0002710 3300053085 Bacteria 11582
1812 Ga0495619_0015650 3300053085 Bacteria 4801
1813 Ga0495619_0041602 3300053085 Bacteria 3006
1814 Ga0495619_0043000 3300053085 Bacteria 2960
1815 Ga0495619_0060862 3300053085 Bacteria 2511
1816 Ga0495619_0125863 3300053085 Bacteria 1758
1817 Ga0495619_0480959 3300053085 Bacteria 855
1818 Ga0500578_0236727 3300053086 Bacteria 1104
1819 Ga0500643_005061 3300053087 Bacteria 5766
1820 Ga0500643_052533 3300053087 Bacteria 1161
1821 Ga0500644_0008929 3300053088 Bacteria 2662
1822 Ga0500644_0032371 3300053088 Bacteria 1670
1823 Ga0500646_0003562 3300053090 Bacteria 3987
1824 Ga0500646_0016450 3300053090 Bacteria 1932
1825 Ga0500651_0045191 3300053093 Bacteria 2771
1826 Ga0500651_0115831 3300053093 Bacteria 1631
1827 Ga0500641_0005677 3300053096 Bacteria 4421
1828 Ga0500641_0021719 3300053096 Bacteria 2451
1829 Ga0500650_0001523 3300053098 Bacteria 7063
1830 Ga0500654_112898 3300053099 Bacteria 1104
1831 Ga0500556_0000125 3300053104 Bacteria 65777
1832 Ga0500593_174969 3300053117 Bacteria 804
1833 Ga0500595_000016 3300053119 Bacteria 211397
1834 Ga0500595_010713 3300053119 Bacteria 3628
1835 Ga0500595_018990 3300053119 Bacteria 2501
1836 Ga0500608_027463 3300053122 Bacteria 2682
1837 Ga0500642_0000105 3300053130 Bacteria 40593
1838 Ga0500642_0009901 3300053130 Bacteria 3335
1839 Ga0500642_0127103 3300053130 Bacteria 1194
1840 Ga0500652_019736 3300053131 Bacteria 2509
1841 Ga0500652_051493 3300053131 Bacteria 1682
1842 Ga0500655_006775 3300053133 Bacteria 2061
1843 Ga0500658_0086249 3300053134 Bacteria 1350
1844 Ga0500559_0062898 3300053136 Bacteria 1658
1845 Ga0500559_0277986 3300053136 Bacteria 787
1846 Ga0500568_0014095 3300053139 Bacteria 3622
1847 Ga0500568_0041603 3300053139 Bacteria 1846
1848 Ga0500568_0159862 3300053139 Bacteria 831
1849 Ga0500573_0000452 3300053140 Bacteria 17648
1850 Ga0500573_0006745 3300053140 Bacteria 6228
1851 Ga0500586_007745 3300053145 Bacteria 2885
1852 Ga0500616_0000085 3300053153 Bacteria 193192
1853 Ga0500616_0000876 3300053153 Bacteria 33191
1854 Ga0500616_0070843 3300053153 Bacteria 1778
1855 Ga0500619_033505 3300053154 Bacteria 1581
1856 Ga0500622_0013118 3300053156 Bacteria 4473
1857 Ga0500624_007708 3300053157 Bacteria 1489
1858 Ga0500627_0046797 3300053158 Bacteria 1875
1859 Ga0500567_130262 3300053723 Bacteria 985
1860 Ga0500645_001772 3300053730 Bacteria 10420
1861 Ga0501084_0000175 3300054114 Bacteria 50123
1862 Ga0501084_0028118 3300054114 Bacteria 4698
1863 Ga0501084_0030163 3300054114 Bacteria 4535
1864 Ga0501084_0034419 3300054114 Bacteria 4236
1865 Ga0501084_0044330 3300054114 Bacteria 3724
1866 Ga0501084_0059035 3300054114 Bacteria 3210
1867 Ga0501084_0311314 3300054114 Bacteria 1330
1868 Ga0501084_0393799 3300054114 Bacteria 1171
1869 Ga0501082_0000653 3300060353 Bacteria 30577
1870 Ga0501082_0004728 3300060353 Bacteria 11876
1871 Ga0501082_0027700 3300060353 Bacteria 4878
1872 Ga0501082_0032834 3300060353 Bacteria 4477
1873 Ga0501082_0093597 3300060353 Bacteria 2597
1874 Ga0501082_0108585 3300060353 Bacteria 2401
1875 Ga0501082_0131205 3300060353 Bacteria 2174
1876 Ga0501082_0160690 3300060353 Bacteria 1952
1877 Ga0501082_0181935 3300060353 Bacteria 1828
1878 Ga0501082_0230867 3300060353 Bacteria 1610
1879 Ga0501082_0308123 3300060353 Bacteria 1379
1880 Ga0530510_0179127 3300061734 Bacteria 1571
1881 Ga0530510_0268027 3300061734 Bacteria 1274
1882 2513857536 2513237137 Bacteria 9558895
1883 2524537994 2524023228 Bacteria 10118060
1884 2603859871 2602042107 Bacteria 6226103
1885 2643755779 2643221547 Bacteria 4740017
1886 2644287952 2643221651 Bacteria 4798932
1887 2793071754 2791355197 Bacteria 8420563
1888 2857528519 2857524615 Bacteria 6615449
1889 2893070165 2893066018 Bacteria 6158120
1890 2903758267 2903748898 Bacteria 9972761
1891 2904701654
1892 2906610374
1893 2919076116 2919073203 Bacteria 6531949
1894 2922428987
1895 8006942216 8006933436 Bacteria 10410654
1896 8006981950 8006973647 Bacteria 10679141
1897 Ga0265316_10018043
1898 ARcpr5oldR_c000035
1899 ARcpr5yngRDRAFT_c000212
1900 ARcpr5yngRDRAFT_c001457
1901 ARSoilOldRDRAFT_c000208
1902 ARSoilOldRDRAFT_c001089
1903 ARCol0oldRDRAFT_c00767
1904 LJQas_1006294
1905 ARCol0yngRDRAFT_1000025
1906 JGI24747J21853_1003301
1907 JGI24739J22299_10001271
1908 JGI24737J22298_10002998
1909 JGI24737J22298_10007299
1910 JGI24737J22298_10020339
1911 JGI24735J21928_10012540
1912 JGI24750J21931_1001136
1913 JGI24745J21846_1000034
1914 JGI24745J21846_1000277
1915 JGI24748J21848_1000741
1916 JGI24738J21930_10001754
1917 JGI24749J21850_1002096
1918 JGI24744J21845_10000241
1919 JGI24742J22300_10000465
1920 JGI25406J46586_10002015
1921 JGI25165J46597_1001315
1922 JGI25153J46596_10010402
1923 Ga0007410J51695_1034900
1924 JGI25404J52841_10015726
1925 Ga0058862_12808773
1926 Ga0065712_10138949
1927 Ga0065715_10002813
1928 Ga0065715_10009083
1929 Ga0070658_10018691
1930 Ga0070658_10021396
1931 Ga0070658_10059824
1932 Ga0070658_10416724
1933 Ga0070676_10001242
1934 Ga0070676_10018760
1935 Ga0070676_10200933
1936 Ga0070676_10201179
1937 Ga0070676_10406381
1938 Ga0070683_100002064
1939 Ga0070683_100404282
1940 Ga0070683_100678487
1941 Ga0070690_100020216
1942 Ga0070690_100027028
1943 Ga0070690_100064067
1944 Ga0070670_100006103
1945 Ga0070670_100036557
1946 Ga0070670_100305757
1947 Ga0070670_100356512
1948 Ga0070677_10003234
1949 Ga0070677_10211984
1950 Ga0068869_100000755
1951 Ga0068869_100049348
1952 Ga0068869_100336424
1953 Ga0070666_10044127
1954 Ga0070666_10071615
1955 Ga0070666_10087332
1956 Ga0070666_10115779
1957 Ga0070680_100013921
1958 Ga0070680_100020347
1959 Ga0070680_100046330
1960 Ga0070680_100052990
1961 Ga0070680_100062663
1962 Ga0070680_100089957
1963 Ga0070680_100137909
1964 Ga0070680_100138570
1965 Ga0070680_100143239
1966 Ga0070680_100225377
1967 Ga0070680_100232973
1968 Ga0070682_100000693
1969 Ga0070682_100067778
1970 Ga0070682_100304094
1971 Ga0068868_100043374
1972 Ga0068868_100044894
1973 Ga0068868_100201743
1974 Ga0070660_100001324
1975 Ga0070660_100004264
1976 Ga0070660_100088013
1977 Ga0070660_100233572
1978 Ga0070660_100297578
1979 Ga0070660_100387271
1980 Ga0070660_100459760
1981 Ga0070689_100031007
1982 Ga0070689_100051095
1983 Ga0070689_100051585
1984 Ga0070691_10000386
1985 Ga0070691_10000795
1986 Ga0070691_10078003
1987 Ga0070687_100000768
1988 Ga0070687_100017582
1989 Ga0070661_100005946
1990 Ga0070661_100006236
1991 Ga0070661_100197586
1992 Ga0070692_10011093
1993 Ga0070668_100002043
1994 Ga0070668_100277534
1995 Ga0070668_100330482
1996 Ga0070669_100004204
1997 Ga0070669_100056953
1998 Ga0070669_100147551
1999 Ga0070675_100004033
2000 Ga0070675_100142778
2001 Ga0070671_100029434
2002 Ga0070671_100223769
2003 Ga0070671_100514334
2004 Ga0070674_100001294
2005 Ga0070674_100031711
2006 Ga0070674_100058873
2007 Ga0070674_100379629
2008 Ga0070673_100002364
2009 Ga0070673_100026334
2010 Ga0070673_100101196
2011 Ga0070673_100786292
2012 Ga0070688_100035071
2013 Ga0070688_100100102
2014 Ga0070688_100200154
2015 Ga0070688_100219310
2016 Ga0070688_100233871
2017 Ga0070659_100005048
2018 Ga0070659_100018128
2019 Ga0070659_100046184
2020 Ga0070667_100010781
2021 Ga0070667_100052294
2022 Ga0070667_100214012
2023 Ga0070667_100251409
2024 Ga0070667_100339918
2025 Ga0070667_100489645
2026 Ga0070709_10003511
2027 Ga0070709_10022452
2028 Ga0070709_10048294
2029 Ga0070709_10064061
2030 Ga0070709_10308544
2031 Ga0070709_10385642
2032 Ga0070714_100009083
2033 Ga0070714_100011419
2034 Ga0070714_100017244
2035 Ga0070714_100027595
2036 Ga0070714_100107950
2037 Ga0070714_100142833
2038 Ga0070714_100148074
2039 Ga0070714_100305726
2040 Ga0070714_100339019
2041 Ga0070714_100731402
2042 Ga0070713_100000012
2043 Ga0070713_100042539
2044 Ga0070713_100051698
2045 Ga0070713_100060535
2046 Ga0070713_100103102
2047 Ga0070713_100617693
2048 Ga0070710_10005644
2049 Ga0070710_10014954
2050 Ga0070710_10052773
2051 Ga0070710_10103973
2052 Ga0070710_10146698
2053 Ga0070701_10318394
2054 Ga0070711_100004304
2055 Ga0070711_100027798
2056 Ga0070711_100079027
2057 Ga0070711_100140078
2058 Ga0070711_100145188
2059 Ga0070711_100286851
2060 Ga0070711_100746895
2061 Ga0070705_100001981
2062 Ga0070705_100068685
2063 Ga0070700_100017413
2064 Ga0070694_100007138
2065 Ga0070694_100010924
2066 Ga0070708_100060973
2067 Ga0070708_100469201
2068 Ga0070663_100010153
2069 Ga0070663_100028446
2070 Ga0070663_100150267
2071 Ga0070663_100290596
2072 Ga0070678_100004700
2073 Ga0070678_100006525
2074 Ga0070678_100010048
2075 Ga0070678_100202402
2076 Ga0070678_100492298
2077 Ga0070678_100677019
2078 Ga0070678_100720491
2079 Ga0070662_100007011
2080 Ga0070662_100049113
2081 Ga0070662_100464192
2082 Ga0070681_10000037
2083 Ga0070681_10010029
2084 Ga0070681_10029025
2085 Ga0070681_10029349
2086 Ga0070681_10066848
2087 Ga0070681_10078949
2088 Ga0070681_10111364
2089 Ga0070681_10218303
2090 Ga0070681_10410685
2091 Ga0070681_10598653
2092 Ga0070681_10867119
2093 Ga0068867_100003543
2094 Ga0068867_100040232
2095 Ga0068867_100137801
2096 Ga0068867_100820916
2097 Ga0070685_10222405
2098 Ga0070699_100265743
2099 Ga0070679_100008411
2100 Ga0070679_100035943
2101 Ga0070679_100058331
2102 Ga0070679_100069873
2103 Ga0070679_100186092
2104 Ga0070679_100255070
2105 Ga0070684_100007624
2106 Ga0070684_100276337
2107 Ga0070684_100470348
2108 Ga0068853_100002020
2109 Ga0068853_100002660
2110 Ga0068853_100023191
2111 Ga0068853_100117767
2112 Ga0068853_100125502
2113 Ga0070672_100002637
2114 Ga0070672_100003392
2115 Ga0070672_100286596
2116 Ga0070686_100004029
2117 Ga0070686_100202066
2118 Ga0070686_100351558
2119 Ga0070695_100003098
2120 Ga0070695_100014423
2121 Ga0070695_100039405
2122 Ga0070696_100010916
2123 Ga0070693_100051681
2124 Ga0070693_100054219
2125 Ga0070693_100214218
2126 Ga0070693_100251057
2127 Ga0070665_100014624
2128 Ga0070665_100128255
2129 Ga0070665_100174797
2130 Ga0070665_100271609
2131 Ga0070665_100291751
2132 Ga0070665_100377545
2133 Ga0070665_100675610
2134 Ga0070704_100004936
2135 Ga0068855_100012001
2136 Ga0068855_100047378
2137 Ga0068855_100057023
2138 Ga0068855_100093513
2139 Ga0068855_100149068
2140 Ga0068855_100285728
2141 Ga0068855_100296783
2142 Ga0068855_100349371
2143 Ga0068855_101093999
2144 Ga0070664_100004534
2145 Ga0070664_100066218
2146 Ga0070664_100290295
2147 Ga0068857_100006037
2148 Ga0068857_100007896
2149 Ga0068857_100115785
2150 Ga0068857_100180341
2151 Ga0068857_100198674
2152 Ga0068857_100338159
2153 Ga0068857_100431518
2154 Ga0068854_100329508
2155 Ga0068854_100630810
2156 Ga0068856_100001032
2157 Ga0068856_100008706
2158 Ga0068856_100034393
2159 Ga0068856_100154116
2160 Ga0068856_100344995
2161 Ga0068856_100941438
2162 Ga0070702_100000378
2163 Ga0070702_100148776
2164 Ga0068852_100006800
2165 Ga0068852_100017082
2166 Ga0068852_100022852
2167 Ga0068852_100025730
2168 Ga0068852_100142141
2169 Ga0068852_100400874
2170 Ga0068852_100515820
2171 Ga0068859_100007402
2172 Ga0068859_100391446
2173 Ga0068859_100622809
2174 Ga0068864_100000595
2175 Ga0068864_100521538
2176 Ga0068861_100002973
2177 Ga0068861_100098923
2178 Ga0068861_100189622
2179 Ga0068851_10037994
2180 Ga0068851_10102652
2181 Ga0068851_10374922
2182 Ga0068870_10000216
2183 Ga0068863_100022557
2184 Ga0068863_100254929
2185 Ga0068863_100755481
2186 Ga0068863_100908860
2187 Ga0068858_100024760
2188 Ga0068858_100144437
2189 Ga0068860_100007174
2190 Ga0068860_100583209
2191 Ga0068862_100017504
2192 Ga0068862_100018639
2193 Ga0068862_100057395
2194 Ga0068862_100192379
2195 Ga0068862_100723989
2196 Ga0081455_10000048
2197 Ga0081455_10012767
2198 Ga0081538_10001041
2199 Ga0081538_10006728
2200 Ga0081540_1001166
2201 Ga0081540_1002979
2202 Ga0081539_10004794
2203 Ga0070717_10039765
2204 Ga0070717_10130640
2205 Ga0070717_10519040
2206 Ga0075365_10103453
2207 Ga0075368_10034503
2208 Ga0075368_10037933
2209 Ga0075363_100060337
2210 Ga0075363_100118875
2211 Ga0075364_10019516
2212 Ga0075364_10063494
2213 Ga0075364_10101082
2214 Ga0070715_10056436
2215 Ga0070716_100205070
2216 Ga0070716_100207272
2217 Ga0070716_100448776
2218 Ga0070712_100000902
2219 Ga0070712_100004052
2220 Ga0070712_100024878
2221 Ga0070712_100092034
2222 Ga0070712_100160466
2223 Ga0070712_100186908
2224 Ga0075367_10131800
2225 Ga0075367_10225760
2226 Ga0075367_10445522
2227 Ga0075369_10005925
2228 Ga0075369_10026380
2229 Ga0075369_10064996
2230 Ga0075366_10013189
2231 Ga0097621_100000600
2232 Ga0097621_100069869
2233 Ga0097621_100127391
2234 Ga0097621_100205433
2235 Ga0097621_100587859
2236 Ga0075370_10046577
2237 Ga0075370_10111572
2238 Ga0075370_10114641
2239 Ga0068871_100000118
2240 Ga0068871_100080549
2241 Ga0068871_100317268
2242 Ga0068871_100625611
2243 Ga0068871_100833779
2244 Ga0075428_100012701
2245 Ga0075428_100048564
2246 Ga0075428_100195979
2247 Ga0075430_100000196
2248 Ga0075430_100038858
2249 Ga0075430_100294749
2250 Ga0075431_100132984
2251 Ga0075431_100443591
2252 Ga0075431_101046779
2253 Ga0075433_10029412
2254 Ga0075433_10104991
2255 Ga0075434_100003094
2256 Ga0075434_100051111
2257 Ga0075434_100153113
2258 Ga0075434_100160681
2259 Ga0075429_100000573
2260 Ga0075429_100107524
2261 Ga0068865_100007181
2262 Ga0068865_100039028
2263 Ga0068865_100527421
2264 Ga0075436_100002564
2265 Ga0075436_100019157
2266 Ga0075436_100216753
2267 Ga0097620_100007402
2268 Ga0097620_100391445
2269 Ga0097620_100622778
2270 Ga0075435_100014955
2271 Ga0075435_100017968
2272 Ga0075435_100032499
2273 Ga0075435_100140132
2274 Ga0099795_10001950
2275 Ga0105240_10004696
2276 Ga0105240_10011051
2277 Ga0105240_10017473
2278 Ga0105240_10133003
2279 Ga0105240_10455624
2280 Ga0105240_10493821
2281 Ga0105240_10652311
2282 Ga0105240_10753714
2283 Ga0111539_10000683
2284 Ga0111539_10010079
2285 Ga0111539_10070545
2286 Ga0111539_10080440
2287 Ga0111539_10303887
2288 Ga0111539_10326450
2289 Ga0105245_10003702
2290 Ga0105245_10017665
2291 Ga0105245_10030667
2292 Ga0105245_10042887
2293 Ga0105245_10072236
2294 Ga0105245_10481226
2295 Ga0105245_10590586
2296 Ga0105245_10622355
2297 Ga0105247_10151400
2298 Ga0105247_10234068
2299 Ga0114129_10005890
2300 Ga0114129_10008352
2301 Ga0114129_10030751
2302 Ga0114129_10481451
2303 Ga0114129_10783469
2304 Ga0114129_10961834
2305 Ga0105243_10009969
2306 Ga0105243_10037311
2307 Ga0105243_10068588
2308 Ga0105243_10251410
2309 Ga0105243_10348082
2310 Ga0105241_10142659
2311 Ga0105241_10159833
2312 Ga0105241_10211682
2313 Ga0105241_10336211
2314 Ga0105242_10016828
2315 Ga0105242_10044757
2316 Ga0105242_10122649
2317 Ga0105242_10154742
2318 Ga0105242_10313029
2319 Ga0105248_10000005
2320 Ga0105248_10056191
2321 Ga0105248_10114304
2322 Ga0105248_10405807
2323 Ga0105237_10027530
2324 Ga0105237_10032303
2325 Ga0105237_10053645
2326 Ga0105237_10382504
2327 Ga0105237_10469967
2328 Ga0105238_10001939
2329 Ga0105238_10035831
2330 Ga0105238_10173207
2331 Ga0105238_10176816
2332 Ga0105238_10177982
2333 Ga0105238_10303270
2334 Ga0105238_10324246
2335 Ga0105238_10652931
2336 Ga0105238_11065567
2337 Ga0105249_10002122
2338 Ga0105249_10023350
2339 Ga0105249_10161429
2340 Ga0105249_10257311
2341 Ga0099796_10001539
2342 Ga0099796_10077406
2343 Ga0105239_10028473
2344 Ga0105239_10052904
2345 Ga0105239_10057391
2346 Ga0105239_10090514
2347 Ga0105239_10115685
2348 Ga0105239_10162951
2349 Ga0105239_10220454
2350 Ga0105239_10343841
2351 Ga0105239_10413340
2352 Ga0105246_10002558
2353 Ga0105246_10140380
2354 Ga0105246_10154831
2355 Ga0105246_10305930
2356 Ga0105246_10536917
2357 Ga0157336_1001006
2358 Ga0157373_10000820
2359 Ga0157371_10057710
2360 Ga0157371_10303390
2361 Ga0157371_10428607
2362 Ga0157370_10058956
2363 Ga0157370_10082927
2364 Ga0157370_10089027
2365 Ga0157370_10187647
2366 Ga0157370_10477886
2367 Ga0157369_10001535
2368 Ga0157369_10132262
2369 Ga0157369_10153459
2370 Ga0157369_10171228
2371 Ga0157369_10447677
2372 Ga0157374_10018401
2373 Ga0157374_10115150
2374 Ga0157378_10015153
2375 Ga0157378_10112197
2376 Ga0163162_10028695
2377 Ga0163162_10046698
2378 Ga0163162_10241481
2379 Ga0163162_10770557
2380 Ga0157372_10023820
2381 Ga0157372_10059581
2382 Ga0157372_10437922
2383 Ga0157372_10468546
2384 Ga0157372_10893284
2385 Ga0157372_11042959
2386 Ga0157372_11160265
2387 Ga0157375_10007178
2388 Ga0157375_10037143
2389 Ga0157375_10154210
2390 Ga0157375_10418092
2391 Ga0157375_10776327
2392 Ga0157375_10921856
2393 Ga0163163_10008003
2394 Ga0163163_10113766
2395 Ga0163163_10159978
2396 Ga0163163_10400600
2397 Ga0163163_10664643
2398 Ga0163163_10718688
2399 Ga0157380_10021174
2400 Ga0157380_10641176
2401 Ga0157380_10762508
2402 Ga0157377_10000628
2403 Ga0157377_10384529
2404 Ga0157379_10018151
2405 Ga0157379_10018171
2406 Ga0157379_10038101
2407 Ga0157379_10071200
2408 Ga0157379_10073976
2409 Ga0157379_10307604
2410 Ga0157379_10564259
2411 Ga0157379_10874642
2412 Ga0157376_10006966
2413 Ga0157376_10273159
2414 Ga0157376_10478212
2415 Ga0163161_10009359
2416 Ga0163161_10049613
2417 Ga0213876_10000421
2418 Ga0213876_10002961
2419 Ga0213876_10003189
2420 Ga0213876_10046760
2421 Ga0213875_10000089
2422 Ga0224712_10120152
2423 Ga0209233_1000013
2424 Ga0209233_1003250
2425 Ga0207666_1000185
2426 Ga0209455_1009081
2427 Ga0209130_1036140
2428 Ga0209564_1002708
2429 Ga0209758_1000548
2430 Ga0209758_1006193
2431 Ga0207426_1026172
2432 Ga0207697_10003861
2433 Ga0207697_10034987
2434 Ga0207656_10025078
2435 Ga0207682_10000350
2436 Ga0207682_10038677
2437 Ga0207682_10076484
2438 Ga0207692_10105360
2439 Ga0207692_10201717
2440 Ga0207692_10224858
2441 Ga0207692_10236709
2442 Ga0207710_10014061
2443 Ga0207688_10007287
2444 Ga0207688_10037550
2445 Ga0207688_10283760
2446 Ga0207680_10005899
2447 Ga0207680_10129058
2448 Ga0207680_10182716
2449 Ga0207680_10531538
2450 Ga0207647_10030675
2451 Ga0207647_10033853
2452 Ga0207647_10055947
2453 Ga0207647_10278971
2454 Ga0207685_10053068
2455 Ga0207699_10000164
2456 Ga0207699_10008214
2457 Ga0207699_10043634
2458 Ga0207699_10347377
2459 Ga0207645_10010484
2460 Ga0207645_10089754
2461 Ga0207645_10091158
2462 Ga0207645_10096386
2463 Ga0207645_10099195
2464 Ga0207645_10111940
2465 Ga0207645_10150084
2466 Ga0207643_10000009
2467 Ga0207643_10268780
2468 Ga0207705_10000180
2469 Ga0207705_10004720
2470 Ga0207705_10034426
2471 Ga0207705_10039818
2472 Ga0207705_10104145
2473 Ga0207705_10151482
2474 Ga0207654_10074102
2475 Ga0207654_10077388
2476 Ga0207654_10193933
2477 Ga0207707_10000011
2478 Ga0207707_10002211
2479 Ga0207707_10004335
2480 Ga0207707_10006091
2481 Ga0207707_10168245
2482 Ga0207707_10537382
2483 Ga0207695_10000018
2484 Ga0207695_10001032
2485 Ga0207695_10029506
2486 Ga0207695_10047727
2487 Ga0207695_10063576
2488 Ga0207695_10163030
2489 Ga0207695_10215806
2490 Ga0207695_10323348
2491 Ga0207671_10016535
2492 Ga0207671_10144760
2493 Ga0207671_10200053
2494 Ga0207671_10248016
2495 Ga0207693_10001210
2496 Ga0207693_10001929
2497 Ga0207693_10004752
2498 Ga0207693_10015635
2499 Ga0207693_10032195
2500 Ga0207693_10036016
2501 Ga0207693_10037608
2502 Ga0207693_10100265
2503 Ga0207693_10116216
2504 Ga0207693_10157406
2505 Ga0207693_10190644
2506 Ga0207693_10307449
2507 Ga0207663_10011662
2508 Ga0207663_10061935
2509 Ga0207663_10100658
2510 Ga0207663_10127095
2511 Ga0207663_10161620
2512 Ga0207663_10178070
2513 Ga0207660_10000110
2514 Ga0207660_10000197
2515 Ga0207660_10003537
2516 Ga0207660_10013609
2517 Ga0207660_10058863
2518 Ga0207660_10073136
2519 Ga0207660_10228082
2520 Ga0207662_10010568
2521 Ga0207662_10019357
2522 Ga0207662_10122304
2523 Ga0207662_10377440
2524 Ga0207657_10000241
2525 Ga0207657_10028527
2526 Ga0207657_10043533
2527 Ga0207657_10058646
2528 Ga0207657_10262648
2529 Ga0207649_10000052
2530 Ga0207649_10000194
2531 Ga0207649_10057815
2532 Ga0207652_10001654
2533 Ga0207652_10004826
2534 Ga0207652_10007272
2535 Ga0207652_10063586
2536 Ga0207652_10071225
2537 Ga0207652_10093381
2538 Ga0207652_10117970
2539 Ga0207652_10122811
2540 Ga0207652_10190259
2541 Ga0207652_10204028
2542 Ga0207652_10349150
2543 Ga0207652_10453660
2544 Ga0207681_10001135
2545 Ga0207681_10161561
2546 Ga0207681_10340311
2547 Ga0207694_10000010
2548 Ga0207694_10008694
2549 Ga0207694_10031812
2550 Ga0207694_10066558
2551 Ga0207694_10203444
2552 Ga0207694_10257958
2553 Ga0207650_10002693
2554 Ga0207650_10141681
2555 Ga0207650_10569902
2556 Ga0207659_10002396
2557 Ga0207659_10012855
2558 Ga0207659_10188772
2559 Ga0207687_10008117
2560 Ga0207687_10019725
2561 Ga0207687_10025014
2562 Ga0207687_10033978
2563 Ga0207687_10128166
2564 Ga0207687_10401890
2565 Ga0207687_10461060
2566 Ga0207700_10000295
2567 Ga0207700_10090974
2568 Ga0207700_10118748
2569 Ga0207700_10124100
2570 Ga0207700_10227054
2571 Ga0207700_10533990
2572 Ga0207664_10028891
2573 Ga0207664_10035779
2574 Ga0207664_10071514
2575 Ga0207664_10151608
2576 Ga0207664_10235849
2577 Ga0207664_10244868
2578 Ga0207664_10307466
2579 Ga0207664_10437790
2580 Ga0207664_10490126
2581 Ga0207664_10595171
2582 Ga0207644_10000212
2583 Ga0207644_10181448
2584 Ga0207690_10001288
2585 Ga0207706_10016311
2586 Ga0207706_10040241
2587 Ga0207706_10054725
2588 Ga0207706_10288771
2589 Ga0207686_10002314
2590 Ga0207686_10202258
2591 Ga0207709_10000530
2592 Ga0207709_10022766
2593 Ga0207709_10083247
2594 Ga0207709_10096959
2595 Ga0207670_10015207
2596 Ga0207670_10044307
2597 Ga0207669_10000235
2598 Ga0207669_10151320
2599 Ga0207669_10294524
2600 Ga0207704_10000198
2601 Ga0207704_10019711
2602 Ga0207704_10195247
2603 Ga0207665_10020388
2604 Ga0207665_10141171
2605 Ga0207691_10013970
2606 Ga0207691_10028811
2607 Ga0207691_10364602
2608 Ga0207711_10000002
2609 Ga0207711_10180040
2610 Ga0207689_10000031
2611 Ga0207689_10071871
2612 Ga0207689_10088891
2613 Ga0207689_10261105
2614 Ga0207661_10003727
2615 Ga0207661_10065582
2616 Ga0207661_10089596
2617 Ga0207661_10186929
2618 Ga0207661_10457124
2619 Ga0207661_10476054
2620 Ga0207679_10000183
2621 Ga0207679_10100904
2622 Ga0207667_10000388
2623 Ga0207667_10004001
2624 Ga0207667_10006198
2625 Ga0207667_10013025
2626 Ga0207667_10024994
2627 Ga0207667_10027381
2628 Ga0207667_10030652
2629 Ga0207667_10250942
2630 Ga0207667_10339043
2631 Ga0207667_10964608
2632 Ga0207651_10000051
2633 Ga0207651_10690770
2634 Ga0207712_10001703
2635 Ga0207712_10494081
2636 Ga0207668_10001674
2637 Ga0207668_10361289
2638 Ga0207640_10000343
2639 Ga0207640_10024133
2640 Ga0207640_10515244
2641 Ga0207658_10066787
2642 Ga0207658_10154989
2643 Ga0207658_10157925
2644 Ga0207658_10341525
2645 Ga0207658_10561565
2646 Ga0207677_10081022
2647 Ga0207677_10278125
2648 Ga0207677_10728325
2649 Ga0207703_10010733
2650 Ga0207703_10044546
2651 Ga0207703_10172911
2652 Ga0207703_10175184
2653 Ga0207703_10332748
2654 Ga0207639_10000867
2655 Ga0207639_10003883
2656 Ga0207639_10010763
2657 Ga0207639_10033916
2658 Ga0207639_10227024
2659 Ga0207678_10024280
2660 Ga0207678_10043860
2661 Ga0207678_10100765
2662 Ga0207678_10142928
2663 Ga0207678_10368921
2664 Ga0207708_10014839
2665 Ga0207708_10102376
2666 Ga0207708_10397909
2667 Ga0207702_10000005
2668 Ga0207702_10000315
2669 Ga0207702_10004643
2670 Ga0207702_10009824
2671 Ga0207702_10048646
2672 Ga0207702_10229342
2673 Ga0207702_10350900
2674 Ga0207641_10001831
2675 Ga0207641_10062870
2676 Ga0207648_10025743
2677 Ga0207648_10154550
2678 Ga0207648_10221620
2679 Ga0207648_10706873
2680 Ga0207676_10000124
2681 Ga0207676_10217418
2682 Ga0207676_10634474
2683 Ga0207674_10001605
2684 Ga0207674_10016004
2685 Ga0207674_10145542
2686 Ga0207674_10363573
2687 Ga0207674_10588472
2688 Ga0207674_10821416
2689 Ga0207675_100029702
2690 Ga0207675_100440578
2691 Ga0207675_100811797
2692 Ga0207683_10000242
2693 Ga0207683_10001846
2694 Ga0207683_10079317
2695 Ga0207683_10081510
2696 Ga0207683_10213762
2697 Ga0207683_10233042
2698 Ga0207683_10533217
2699 Ga0207698_10010960
2700 Ga0207698_10036626
2701 Ga0207698_10040510
2702 Ga0207698_10072790
2703 Ga0207698_10391941
2704 Ga0209982_1002370
2705 Ga0210002_1001035
2706 Ga0209966_1008822
2707 Ga0209998_10010491
2708 Ga0209813_10002687
2709 Ga0209813_10009253
2710 Ga0209813_10017408
2711 Ga0207428_10000037
2712 Ga0207428_10002442
2713 Ga0207428_10013074
2714 Ga0268266_10000557
2715 Ga0268266_10813652
2716 Ga0268265_10016165
2717 Ga0268265_10050585
2718 Ga0268265_10162265
2719 Ga0268265_10214183
2720 Ga0268264_10003234
2721 Ga0268264_10140651
2722 Ga0268264_10391464
2723 Ga0268264_10562834
2724 Ga0265337_1019347
2725 Ga0265326_10002138
2726 Ga0265319_1001825
2727 Ga0265334_10000469
2728 Ga0265334_10001106
2729 Ga0265334_10016312
2730 Ga0265334_10065129
2731 Ga0265318_10000037
2732 Ga0265318_10001354
2733 Ga0265318_10004765
2734 Ga0265323_10001237
2735 Ga0265322_10008354
2736 Ga0265336_10000535
2737 Ga0307515_10040807
2738 Ga0265338_10000017
2739 Ga0265338_10000131
2740 Ga0265338_10005387
2741 Ga0265338_10023435
2742 Ga0265338_10023604
2743 Ga0265338_10033513
2744 Ga0265338_10065293
2745 Ga0265338_10098917
2746 Ga0265338_10149487
2747 Ga0265338_10153758
2748 Ga0265338_10211121
2749 Ga0265338_10314147
2750 Ga0265338_10419399
2751 Ga0265338_10455780
2752 Ga0265324_10001269
2753 Ga0265762_1007126
2754 Ga0265763_1000228
2755 Ga0265330_10013605
2756 Ga0265330_10028450
2757 Ga0265330_10033745
2758 Ga0265330_10081849
2759 Ga0265330_10085850
2760 Ga0265330_10129990
2761 Ga0265332_10003525
2762 Ga0265332_10011436
2763 Ga0265332_10038320
2764 Ga0265332_10080505
2765 Ga0265320_10002069
2766 Ga0265320_10016123
2767 Ga0265325_10000014
2768 Ga0265325_10000449
2769 Ga0265325_10000820
2770 Ga0265325_10001071
2771 Ga0265325_10001732
2772 Ga0265325_10001769
2773 Ga0265325_10012680
2774 Ga0265325_10031434
2775 Ga0265325_10034463
2776 Ga0265325_10042427
2777 Ga0265325_10064283
2778 Ga0265325_10066787
2779 Ga0265329_10034806
2780 Ga0265329_10039168
2781 Ga0265340_10002810
2782 Ga0265340_10003857
2783 Ga0265340_10008522
2784 Ga0265340_10025043
2785 Ga0265340_10042895
2786 Ga0265340_10056838
2787 Ga0265340_10063149
2788 Ga0265340_10074553
2789 Ga0265340_10163807
2790 Ga0265340_10217733
2791 Ga0265340_10251950
2792 Ga0265339_10000053
2793 Ga0265339_10000256
2794 Ga0265339_10003063
2795 Ga0265339_10005687
2796 Ga0265339_10006973
2797 Ga0265339_10009282
2798 Ga0265339_10020355
2799 Ga0265339_10051695
2800 Ga0265339_10078048
2801 Ga0265339_10108339
2802 Ga0265331_10014841
2803 Ga0265331_10019323
2804 Ga0265331_10039963
2805 Ga0265331_10065184
2806 Ga0265331_10227999
2807 Ga0265327_10001297
2808 Ga0265316_10050012
2809 Ga0265316_10088313
2810 Ga0265316_10104722
2811 Ga0265316_10108470
2812 Ga0265316_10183202
2813 Ga0265316_10241243
2814 Ga0265316_10280165
2815 Ga0265316_10302428
2816 Ga0265316_10303173
2817 Ga0265316_10345735
2818 Ga0265316_10616217
2819 Ga0265313_10000098
2820 Ga0265313_10001315
2821 Ga0265313_10001884
2822 Ga0265313_10006263
2823 Ga0265313_10008423
2824 Ga0265313_10012279
2825 Ga0265313_10015578
2826 Ga0265313_10047949
2827 Ga0265313_10054715
2828 Ga0265313_10060934
2829 Ga0265313_10061872
2830 Ga0265313_10071098
2831 Ga0265313_10079819
2832 Ga0265313_10133140
2833 Ga0265314_10004347
2834 Ga0265314_10004460
2835 Ga0265314_10009081
2836 Ga0265314_10011365
2837 Ga0265314_10012121
2838 Ga0265314_10021119
2839 Ga0265314_10027636
2840 Ga0265314_10031643
2841 Ga0265314_10033470
2842 Ga0265314_10037529
2843 Ga0265314_10038656
2844 Ga0265314_10056950
2845 Ga0265314_10094782
2846 Ga0265314_10128118
2847 Ga0265314_10191417
2848 Ga0265314_10207814
2849 Ga0265314_10272117
2850 Ga0265342_10000448
2851 Ga0265342_10000677
2852 Ga0265342_10008087
2853 Ga0265342_10025101
2854 Ga0265342_10031129
2855 Ga0265342_10059470
2856 Ga0265342_10227272
2857 Ga0265342_10287707
2858 Ga0307516_10038268
2859 Ga0307516_10231301
2860 Ga0307516_10264719
2861 Ga0307410_10512358
2862 Ga0307412_10394045
2863 Ga0307409_100145672
2864 Ga0307416_100674159
2865 Ga0307415_100224377
2866 Ga0373930_0003008
2867 Ga0373948_0002824
2868 Ga0373950_0005337
2869 Ga0373950_0007127
2870 Ga0373950_0017039
2871 Ga0373958_0001566
2872 Ga0373958_0002620
2873 Ga0373959_0003005
2874 Ga0373938_0000343
2875 Ga0373938_0001532
2876 Ga0373926_0008207
2877 Ga0373928_0001369
2878 Ga0373934_0052439
2879 Ga0373934_0119053
2880 Ga0373934_0208429
2881 Ga0373940_0003702
2882 Ga0373940_0021279
2883 Ga0373940_0054129
2884 Ga0373940_0087214
2885 Ga0373944_0002736
2886 Ga0373949_0001707
2887 Ga0373949_0003940
2888 Ga0373952_0001963
2889 Ga0373923_0065885
2890 Ga0373932_0004128
2891 Ga0373932_0006364
2892 Ga0373932_0007842
2893 Ga0373932_0030106
2894 Ga0373936_0021903
2895 Ga0373936_0078578
2896 Ga0373939_0001965
2897 Ga0373939_0021734
2898 Ga0373941_0003378
2899 Ga0373945_0008514
2900 Ga0373945_0034692
2901 Ga0373953_0001370
2902 Ga0373953_0019434
2903 Ga0373953_0038626
2904 Ga0373954_0001371
2905 Ga0373954_0014718
2906 Ga0373954_0020580
2907 Ga0373956_0013664
2908 Ga0373956_0041543
2909 Ga0373957_0008557
2910 Ga0373957_0018776
2911 Ga0373957_0088922
2912 Ga0373960_0049044
2913 Ga0373943_0000918
2914 Ga0373943_0006231
2915 Ga0373943_0011453
2916 Ga0373943_0024465
2917 Ga0373943_0092935
2918 Ga0373946_0004396
2919 Ga0373946_0016833
2920 Ga0373946_0056677
2921 Ga0373955_0001179
2922 Ga0373955_0017677
2923 Ga0373955_0032229
2924 Ga0373955_0094771
2925 Ga0373955_0135259
2926 Ga0373942_0001142
2927 Ga0373961_0017751
2928 Ga0373961_0019036
2929 Ga0373962_0001106
2930 Ga0316574_0388472
2931 Ga0373924_0014977
2932 Ga0373924_0093130
2933 Ga0373931_0000305
2934 Ga0373931_0020150
2935 Ga0373931_0033067
2936 Ga0373931_0217256
2937 Ga0373935_0003403
2938 Ga0373935_0014201
2939 Ga0373935_0021874
2940 Ga0373935_0213221
2941 Ga0373935_0248291
2942 Ga0373927_0017421
2943 Ga0373927_0017892
2944 Ga0373927_0103791
2945 Ga0373927_0252607
2946 Ga0373933_0012634
2947 Ga0373933_0018034
2948 Ga0373933_0030576
2949 Ga0373947_0006238
2950 Ga0373947_0009172
2951 Ga0373947_0062903
2952 Ga0373947_0398055
2953 Ga0373937_0007608
2954 Ga0373937_0025062
2955 Ga0373937_0039941
2956 Ga0373937_0072988
2957 Ga0373937_0077479
2958 Ga0373937_0126066
2959 Ga0373937_0411316
2960 Ga0373937_0422939
2961 Ga0373937_0666658
2962 Ga0373937_0731608
2963 Ga0373937_0744705
2964 Ga0316582_0312479
2965 Ga0373925_0002514
2966 Ga0373925_0011485
2967 Ga0373925_0020892
2968 Ga0373925_0022203
2969 Ga0373925_0051088
2970 Ga0373925_0156062
2971 Ga0373925_0300431
2972 Ga0395899_0032920
2973 Ga0395899_0053109
2974 Ga0395900_0022401
2975 Ga0395900_0104393
2976 Ga0395900_0233159
2977 Ga0395900_0298709
2978 Ga0395900_0419468
2979 Ga0395900_0607650
2980 Ga0395898_0021752
2981 Ga0395898_0021940
2982 Ga0395898_0047384
2983 Ga0395898_0139246
2984 Ga0395898_0222431
2985 Ga0436364_0333324
2986 Ga0395901_0015561
2987 Ga0395901_0057654
2988 Ga0395901_0105438
2989 Ga0395901_0196440
2990 Ga0395901_0425885
2991 Ga0395901_0454020
2992 Ga0395901_0829599
2993 Ga0400483_117124
2994 Ga0436365_0032540
2995 Ga0436365_0152711
2996 Ga0436365_0680520
2997 Ga0436365_1138385
2998 Ga0436365_1200736
2999 Ga0436365_1245822
3000 Ga0436365_1505093
3001 Ga0436365_1637588
3002 Ga0436365_1682615
3003 Ga0436365_1870318
3004 Ga0436360_0155882
3005 Ga0436360_0174767
3006 Ga0436360_0842897
3007 Ga0436361_0057811
3008 Ga0436363_0402877
3009 Ga0436362_0451203
3010 Ga0436362_0808711
3011 Ga0439453_0002481
3012 Ga0439443_002060
3013 Ga0450923_011089
3014 Ga0439458_0077397
3015 Ga0439435_0021439
3016 Ga0439435_0042295
3017 Ga0439440_0012161
3018 Ga0466966_0191039
3019 Ga0466963_0019290
3020 Ga0466957_0014805
3021 Ga0466957_0033087
3022 Ga0466957_0075585
3023 Ga0451576_0024106
3024 Ga0451576_0043660
3025 Ga0466967_0011664
3026 Ga0466967_0031236
3027 Ga0495627_065240
3028 Ga0495592_0001138
3029 Ga0495592_0043997
3030 Ga0495592_0123999
3031 Ga0495603_0000644
3032 Ga0495603_0012514
3033 Ga0495603_0013543
3034 Ga0495629_0000177
3035 Ga0495629_0000317
3036 Ga0495629_0029090
3037 Ga0495629_0473847
3038 Ga0495629_0550137
3039 Ga0495641_0009769
3040 Ga0495641_0035126
3041 Ga0495641_0129595
3042 Ga0495651_0003129
3043 Ga0495651_0004850
3044 Ga0495653_0000149
3045 Ga0495653_0061894
3046 Ga0495653_0072344
3047 Ga0495653_0275613
3048 Ga0495653_0405121
3049 Ga0495580_0000498
3050 Ga0495580_0036721
3051 Ga0495580_0046764
3052 Ga0495580_0074442
3053 Ga0495580_0088638
3054 Ga0495582_0000185
3055 Ga0495582_0013082
3056 Ga0495582_0044051
3057 Ga0495582_0170090
3058 Ga0495582_0314423
3059 Ga0495605_0138713
3060 Ga0495639_0001788
3061 Ga0495639_0009268
3062 Ga0495639_0092685
3063 Ga0495662_0015062
3064 Ga0495662_0069984
3065 Ga0495662_0093593
3066 Ga0495664_0033507
3067 Ga0495664_0076784
3068 Ga0495664_0132628
3069 Ga0495664_0386270
3070 Ga0495584_0020723
3071 Ga0495584_0063797
3072 Ga0495585_0004711
3073 Ga0495585_0178166
3074 Ga0495594_0000023
3075 Ga0495594_0053830
3076 Ga0495607_0008511
3077 Ga0495607_0193664
3078 Ga0495606_0050237
3079 Ga0495608_0007771
3080 Ga0495608_0016548
3081 Ga0495608_0071471
3082 Ga0495608_0189523
3083 Ga0495610_0046787
3084 Ga0495616_0035835
3085 Ga0495616_0174155
3086 Ga0495618_0086295
3087 Ga0495618_0086821
3088 Ga0495618_0121557
3089 Ga0495620_0083704
3090 Ga0495628_0005831
3091 Ga0495630_0106670
3092 Ga0495630_0264712
3093 Ga0495630_0301723
3094 Ga0495632_0062625
3095 Ga0495643_0086414
3096 Ga0495644_0000713
3097 Ga0495648_0008251
3098 Ga0495666_0038494
3099 Ga0495652_0026006
3100 Ga0495652_0138777
3101 Ga0495652_0228765
3102 Ga0495654_0144998
3103 Ga0495665_0004028
3104 Ga0495665_0004234
3105 Ga0495665_0020621
3106 Ga0495665_0137795
3107 Ga0495640_0036039
3108 Ga0495640_0062400
3109 Ga0495640_0068878
3110 Ga0495640_0096857
3111 Ga0495640_0162175
3112 Ga0495640_0292638
3113 Ga0495586_0047555
3114 Ga0495587_0001671
3115 Ga0495587_0031176
3116 Ga0495587_0128938
3117 Ga0495587_0161457
3118 Ga0495598_0006692
3119 Ga0495598_0015543
3120 Ga0495609_0050263
3121 Ga0495609_0092341
3122 Ga0495609_0230676
3123 Ga0495645_0005350
3124 Ga0495645_0017640
3125 Ga0495645_0041803
3126 Ga0495645_0050307
3127 Ga0495622_0000916
3128 Ga0495622_0026496
3129 Ga0495622_0148504
3130 Ga0495633_0000941
3131 Ga0495667_0004251
3132 Ga0495667_0006602
3133 Ga0495667_0011743
3134 Ga0495667_0057695
3135 Ga0495667_0355294
3136 Ga0495656_0000589
3137 Ga0495634_0036751
3138 Ga0495634_0050361
3139 Ga0495634_0126421
3140 Ga0495634_0215317
3141 Ga0495611_0106226
3142 Ga0495611_0192766
3143 Ga0495625_0028714
3144 Ga0495625_0475799
3145 Ga0495635_0007513
3146 Ga0495635_0008691
3147 Ga0495635_0102078
3148 Ga0495635_0146883
3149 Ga0495635_0263989
3150 Ga0495635_0340540
3151 Ga0495635_0398521
3152 Ga0495659_0003548
3153 Ga0495661_0011421
3154 Ga0495661_0027406
3155 Ga0495588_0005432
3156 Ga0495588_0011242
3157 Ga0495588_0041790
3158 Ga0495657_0011421
3159 Ga0495657_0019703
3160 Ga0495657_0026745
3161 Ga0495657_0037526
3162 Ga0495657_0053216
3163 Ga0495657_0121577
3164 Ga0495657_0307333
3165 Ga0495599_0018700
3166 Ga0495599_0067022
3167 Ga0495599_0211321
3168 Ga0495623_0000858
3169 Ga0495623_0002372
3170 Ga0495623_0400881
3171 Ga0495646_0007260
3172 Ga0495646_0013907
3173 Ga0495646_0293914
3174 Ga0495647_0006380
3175 Ga0495647_0009980
3176 Ga0495647_0093629
3177 Ga0495658_0001492
3178 Ga0495658_0002288
3179 Ga0495658_0007902
3180 Ga0495658_0017238
3181 Ga0495658_0021417
3182 Ga0495658_0037194
3183 Ga0495669_0092584
3184 Ga0495669_0111866
3185 Ga0495613_0013711
3186 Ga0495613_0024584
3187 Ga0495613_0045423
3188 Ga0495613_0056840
3189 Ga0495624_0048203
3190 Ga0495624_0190045
3191 Ga0495670_0001016
3192 Ga0495671_0058073
3193 Ga0495671_0066432
3194 Ga0495649_0066314
3195 Ga0495589_0032579
3196 Ga0495589_0146279
3197 Ga0495600_0002535
3198 Ga0495600_0004858
3199 Ga0495600_0057702
3200 Ga0495600_0100175
3201 Ga0495600_0118459
3202 Ga0495600_0272229
3203 Ga0495660_0060594
3204 Ga0495581_0001042
3205 Ga0495581_0137501
3206 Ga0495604_0007851
3207 Ga0495604_0007934
3208 Ga0495604_0072089
3209 Ga0495636_0076801
3210 Ga0495674_0100641
3211 Ga0495674_0134805
3212 Ga0495674_0153457
3213 Ga0495674_0225067
3214 Ga0495672_0059536
3215 Ga0495672_0113453
3216 Ga0495672_0167802
3217 Ga0495676_0008691
3218 Ga0495676_0013652
3219 Ga0495676_0069481
3220 Ga0495680_0019366
3221 Ga0495680_0026170
3222 Ga0495680_0047015
3223 Ga0495680_0058793
3224 Ga0495680_0068123
3225 Ga0495680_0106939
3226 Ga0495680_0144944
3227 Ga0495680_0312289
3228 Ga0495675_0006492
3229 Ga0495675_0169775
3230 Ga0495675_0207164
3231 Ga0495677_0142461
3232 Ga0495679_024983
3233 Ga0495684_0082884
3234 Ga0495684_0176675
3235 Ga0495684_0281160
3236 Ga0495686_0077376
3237 Ga0495593_0001943
3238 Ga0495593_0012417
3239 Ga0495593_0022296
3240 Ga0495593_0059926
3241 Ga0495602_0007161
3242 Ga0495602_0074205
3243 Ga0495602_0163605
3244 Ga0495614_0000618
3245 Ga0495614_0031857
3246 Ga0495626_0097869
3247 Ga0496100_0116994
3248 Ga0496100_0175028
3249 Ga0496100_0257045
3250 Ga0496101_0000969
3251 Ga0496101_0014870
3252 Ga0496101_0019543
3253 Ga0496101_0049050
3254 Ga0496102_0004376
3255 Ga0496102_0062325
3256 Ga0496102_0067172
3257 Ga0496102_0158448
3258 Ga0496102_0569399
3259 Ga0496102_0614555
3260 Ga0496103_0001732
3261 Ga0496103_0023227
3262 Ga0496103_0061364
3263 Ga0496103_0100733
3264 Ga0496104_0000399
3265 Ga0496104_0101217
3266 Ga0496104_0108172
3267 Ga0496104_0174623
3268 Ga0496104_0189398
3269 Ga0496104_0251879
3270 Ga0496105_0002417
3271 Ga0496105_0035470
3272 Ga0496105_0316563
3273 Ga0496105_0342805
3274 Ga0496105_0345285
3275 Ga0496106_0015788
3276 Ga0496106_0036410
3277 Ga0496106_0278742
3278 Ga0496106_0316134
3279 Ga0496106_0822784
3280 Ga0496107_0005598
3281 Ga0496107_0020535
3282 Ga0496107_0091546
3283 Ga0496107_0092306
3284 Ga0496107_0135855
3285 Ga0496107_0205055
3286 Ga0496107_0345267
3287 Ga0496108_0007368
3288 Ga0496108_0167448
3289 Ga0496108_0543052
3290 Ga0496109_0005949
3291 Ga0496109_0012139
3292 Ga0496109_0054198
3293 Ga0496109_0133489
3294 Ga0496109_0367124
3295 Ga0496110_0054594
3296 Ga0496110_0106807
3297 Ga0496110_0121916
3298 Ga0496110_0253605
3299 Ga0496110_0608904
3300 Ga0496110_0834079
3301 Ga0496111_0037153
3302 Ga0496111_0043921
3303 Ga0496112_0070213
3304 Ga0496112_0139286
3305 Ga0496112_0178648
3306 Ga0496112_0273206
3307 Ga0496112_0336823
3308 Ga0496113_0043476
3309 Ga0496113_0045614
3310 Ga0496113_0049357
3311 Ga0496113_0129113
3312 Ga0496113_0182482
3313 Ga0496113_0347681
3314 Ga0496113_0487029
3315 Ga0496113_0529394
3316 Ga0496114_0002647
3317 Ga0496114_0048435
3318 Ga0496114_0069593
3319 Ga0496114_0106109
3320 Ga0496114_0126273
3321 Ga0496115_0024784
3322 Ga0496115_0030807
3323 Ga0496115_0047461
3324 Ga0496115_0082945
3325 Ga0496115_0117368
3326 Ga0496115_0215818
3327 Ga0496115_0262717
3328 Ga0496115_0349341
3329 Ga0496116_0047218
3330 Ga0496117_0128671
3331 Ga0496118_0271882
3332 Ga0496119_0040092
3333 Ga0496119_0105536
3334 Ga0496119_0242680
3335 Ga0496120_0019667
3336 Ga0496120_0072566
3337 Ga0496121_0003067
3338 Ga0496121_0006108
3339 Ga0496121_0036137
3340 Ga0496121_0203792
3341 Ga0496121_0219426
3342 Ga0496122_0043087
3343 Ga0496122_0164998
3344 Ga0496123_0048593
3345 Ga0496123_0094491
3346 Ga0496124_0217321
3347 Ga0496125_0001858
3348 Ga0496125_0115218
3349 Ga0496125_0168911
3350 Ga0496126_0000480
3351 Ga0496126_0040052
3352 Ga0496126_0090979
3353 Ga0496126_0110380
3354 Ga0496126_0117141
3355 Ga0496126_0150833
3356 Ga0496126_0341974
3357 Ga0496126_0392309
3358 Ga0495682_0013068
3359 Ga0501031_0044398
3360 Ga0501031_0070573
3361 Ga0501031_0074807
3362 Ga0501031_0085878
3363 Ga0501031_0090980
3364 Ga0501032_0008814
3365 Ga0501032_0040734
3366 Ga0501032_0042811
3367 Ga0501032_0058423
3368 Ga0501032_0118749
3369 Ga0501032_0163537
3370 Ga0501032_0238250
3371 Ga0501032_0270312
3372 Ga0501033_0000094
3373 Ga0501033_0021359
3374 Ga0501033_0033508
3375 Ga0501033_0086738
3376 Ga0501033_0101453
3377 Ga0501033_0139045
3378 Ga0501033_0216760
3379 Ga0501033_0222912
3380 Ga0501033_0392054
3381 Ga0501034_0000021
3382 Ga0501034_0000482
3383 Ga0501034_0002673
3384 Ga0501034_0024772
3385 Ga0501034_0046023
3386 Ga0501034_0060811
3387 Ga0501034_0062644
3388 Ga0501034_0134254
3389 Ga0501034_0164332
3390 Ga0501034_0167276
3391 Ga0501034_0212658
3392 Ga0501034_0240132
3393 Ga0501034_0247867
3394 Ga0501034_0269164
3395 Ga0501034_0339036
3396 Ga0501034_0349858
3397 Ga0501034_0464352
3398 Ga0501036_0001704
3399 Ga0501036_0005563
3400 Ga0501036_0005653
3401 Ga0501036_0076536
3402 Ga0501036_0091111
3403 Ga0501036_0091320
3404 Ga0501036_0177505
3405 Ga0501037_0000450
3406 Ga0501037_0046720
3407 Ga0501037_0050986
3408 Ga0501037_0056591
3409 Ga0501037_0063759
3410 Ga0501037_0095843
3411 Ga0501037_0108992
3412 Ga0501037_0141799
3413 Ga0501037_0290529
3414 Ga0501038_0000052
3415 Ga0501038_0037384
3416 Ga0501038_0046533
3417 Ga0501038_0058047
3418 Ga0501038_0071577
3419 Ga0501038_0071986
3420 Ga0501038_0079573
3421 Ga0501038_0083447
3422 Ga0501038_0098475
3423 Ga0501038_0108148
3424 Ga0501038_0113532
3425 Ga0501038_0115212
3426 Ga0501038_0134728
3427 Ga0501038_0146399
3428 Ga0501038_0158446
3429 Ga0501038_0355974
3430 Ga0501039_0000549
3431 Ga0501039_0039657
3432 Ga0501039_0094100
3433 Ga0501039_0116277
3434 Ga0501039_0151389
3435 Ga0501039_0179242
3436 Ga0501039_0273189
3437 Ga0501039_0293386
3438 Ga0501040_0038034
3439 Ga0501040_0271288
3440 Ga0501040_0358231
3441 Ga0501041_0021685
3442 Ga0501041_0111333
3443 Ga0501042_0014227
3444 Ga0501042_0030132
3445 Ga0501042_0090650
3446 Ga0501042_0094589
3447 Ga0501042_0191226
3448 Ga0501043_0005051
3449 Ga0501043_0012919
3450 Ga0501043_0037798
3451 Ga0501043_0042971
3452 Ga0501043_0093452
3453 Ga0501043_0116039
3454 Ga0501043_0117710
3455 Ga0501043_0129223
3456 Ga0501043_0138567
3457 Ga0501043_0142315
3458 Ga0501043_0230224
3459 Ga0501043_0377564
3460 Ga0501046_0002237
3461 Ga0501046_0024393
3462 Ga0501046_0101892
3463 Ga0501046_0111685
3464 Ga0501046_0154028
3465 Ga0501046_0156128
3466 Ga0501046_0162788
3467 Ga0501046_0175873
3468 Ga0501046_0202042
3469 Ga0501046_0545747
3470 Ga0501047_0000235
3471 Ga0501047_0017348
3472 Ga0501047_0024757
3473 Ga0501047_0025781
3474 Ga0501047_0044775
3475 Ga0501047_0050813
3476 Ga0501047_0079255
3477 Ga0501047_0095267
3478 Ga0501047_0099459
3479 Ga0501047_0133502
3480 Ga0501047_0134755
3481 Ga0501047_0147338
3482 Ga0501047_0159685
3483 Ga0501047_0223963
3484 Ga0501047_0250701
3485 Ga0501047_0262622
3486 Ga0501047_0277985
3487 Ga0501047_0303139
3488 Ga0501047_0410524
3489 Ga0501047_0592950
3490 Ga0501047_0697831
3491 Ga0501048_0001862
3492 Ga0501048_0006738
3493 Ga0501048_0020705
3494 Ga0501048_0041101
3495 Ga0501048_0103199
3496 Ga0501048_0138183
3497 Ga0501048_0341260
3498 Ga0501067_0001776
3499 Ga0501067_0005350
3500 Ga0501067_0006170
3501 Ga0501067_0033573
3502 Ga0501067_0051199
3503 Ga0501068_0001049
3504 Ga0501068_0035313
3505 Ga0501069_0001817
3506 Ga0501069_0005996
3507 Ga0501069_0008119
3508 Ga0501069_0030545
3509 Ga0501069_0155458
3510 Ga0501069_0212034
3511 Ga0501070_0001611
3512 Ga0501070_0003398
3513 Ga0501070_0033678
3514 Ga0501070_0069151
3515 Ga0501070_0095592
3516 Ga0501070_0126129
3517 Ga0501070_0163525
3518 Ga0501070_0175198
3519 Ga0501070_0196271
3520 Ga0501070_0258564
3521 Ga0501070_0270302
3522 Ga0501070_0302330
3523 Ga0501070_0417463
3524 Ga0501071_0057085
3525 Ga0501071_0070423
3526 Ga0501071_0088539
3527 Ga0501071_0095538
3528 Ga0501071_0176824
3529 Ga0501071_0228560
3530 Ga0501071_0260600
3531 Ga0501071_0534980
3532 Ga0501072_0005670
3533 Ga0501072_0013154
3534 Ga0501072_0072626
3535 Ga0501072_0088285
3536 Ga0501072_0158132
3537 Ga0501072_0680190
3538 Ga0501073_0000597
3539 Ga0501073_0004494
3540 Ga0501073_0028618
3541 Ga0501073_0040649
3542 Ga0501073_0048979
3543 Ga0501073_0085962
3544 Ga0501073_0215286
3545 Ga0501073_0222782
3546 Ga0501073_0436380
3547 Ga0501074_0008250
3548 Ga0501074_0010906
3549 Ga0501074_0058520
3550 Ga0501074_0169846
3551 Ga0501074_0174752
3552 Ga0501074_0297540
3553 Ga0501074_0556438
3554 Ga0501075_0095302
3555 Ga0501075_0114552
3556 Ga0501076_0017899
3557 Ga0501076_0054065
3558 Ga0501076_0094419
3559 Ga0501076_0188244
3560 Ga0501076_0382548
3561 Ga0501077_0196207
3562 Ga0501077_0211172
3563 Ga0501079_0001478
3564 Ga0501079_0011059
3565 Ga0501079_0018448
3566 Ga0501079_0037891
3567 Ga0501079_0056415
3568 Ga0501079_0081804
3569 Ga0501079_0142053
3570 Ga0501079_0356873
3571 Ga0501080_0006960
3572 Ga0501080_0028291
3573 Ga0501080_0064957
3574 Ga0501080_0081520
3575 Ga0501080_0247437
3576 Ga0501080_0254414
3577 Ga0501080_0278784
3578 Ga0501080_0279412
3579 Ga0501080_0294504
3580 Ga0501080_0325595
3581 Ga0501080_0361098
3582 Ga0501080_0394041
3583 Ga0501081_0029037
3584 Ga0501081_0089635
3585 Ga0501083_0008114
3586 Ga0501083_0028991
3587 Ga0501083_0069494
3588 Ga0501083_0071786
3589 Ga0501083_0095282
3590 Ga0501083_0163629
3591 Ga0501083_0167731
3592 Ga0501083_0170624
3593 Ga0501083_0393089
3594 Ga0501035_0000255
3595 Ga0501035_0005931
3596 Ga0501035_0013364
3597 Ga0501035_0024934
3598 Ga0501035_0043569
3599 Ga0501035_0051927
3600 Ga0501035_0055903
3601 Ga0501035_0066191
3602 Ga0501035_0073482
3603 Ga0501035_0079965
3604 Ga0501035_0082602
3605 Ga0501035_0158311
3606 Ga0501035_0224354
3607 Ga0501035_0227016
3608 Ga0501035_0249041
3609 Ga0501035_0322372
3610 Ga0501044_0014028
3611 Ga0501044_0028702
3612 Ga0501044_0038683
3613 Ga0501044_0044447
3614 Ga0501044_0062058
3615 Ga0501044_0107934
3616 Ga0501044_0118786
3617 Ga0501044_0119255
3618 Ga0501044_0134695
3619 Ga0501044_0138736
3620 Ga0501044_0141817
3621 Ga0501044_0225504
3622 Ga0501044_0233773
3623 Ga0501044_0238198
3624 Ga0501044_0270633
3625 Ga0501044_0275130
3626 Ga0501044_0278859
3627 Ga0501044_0343028
3628 Ga0501044_0381449
3629 Ga0501044_0398557
3630 Ga0501044_0410246
3631 Ga0501044_0451214
3632 Ga0501044_0824870
3633 Ga0501045_0070801
3634 Ga0501045_0087751
3635 Ga0501045_0142155
3636 Ga0501045_0461578
3637 nmdc:mga03683_51131_c1
3638 nmdc:mga03n38_189102_c1
3639 nmdc:mga03n38_59041_c1
3640 nmdc:mga00v17_255849_c1
3641 nmdc:mga00v17_6230_c1
3642 nmdc:mga0yw44_19482_c1
3643 nmdc:mga0yw44_46317_c1
3644 nmdc:mga0k408_25101_c1
3645 nmdc:mga06z11_171341_c1
3646 nmdc:mga06z11_7008_c1
3647 nmdc:mga07m45_120105_c1
3648 nmdc:mga07m45_28689_c1
3649 nmdc:mga05p37_1004186_c1
3650 nmdc:mga05p37_1773_c1
3651 nmdc:mga05p37_2437_c1
3652 nmdc:mga05p37_36180_c1
3653 nmdc:mga09592_1370_c1
3654 nmdc:mga0qj67_2465_c1
3655 nmdc:mga06r32_591663_c1
3656 nmdc:mga06r32_638_c1
3657 nmdc:mga08y16_319763_c1
3658 nmdc:mga08y16_35725_c1
3659 nmdc:mga08y16_413994_c1
3660 nmdc:mga08y16_44765_c1
3661 nmdc:mga08y16_549_c1
3662 nmdc:mga08y16_95891_c1
3663 nmdc:mga0n895_158795_c1
3664 nmdc:mga0n895_19785_c1
3665 nmdc:mga0n895_256768_c1
3666 nmdc:mga0n895_283_c1
3667 nmdc:mga0n895_343834_c1
3668 nmdc:mga0n895_6552_c1
3669 nmdc:mga0rr50_127821_c1
3670 nmdc:mga0rr50_142937_c1
3671 nmdc:mga0rr50_15656_c1
3672 nmdc:mga0rr50_21738_c1
3673 nmdc:mga0rr50_579135_c1
3674 nmdc:mga08x19_14934_c1
3675 nmdc:mga08x19_177_c1
3676 nmdc:mga08x19_195316_c1
3677 nmdc:mga08x19_67568_c1
3678 nmdc:mga08x19_91478_c1
3679 nmdc:mga0a205_136415_c1
3680 nmdc:mga0a205_171385_c1
3681 nmdc:mga0a205_19999_c1
3682 nmdc:mga0a205_387_c1
3683 nmdc:mga0a205_8273_c1
3684 nmdc:mga0sz30_104861_c1
3685 nmdc:mga0sz30_11705_c1
3686 nmdc:mga0sz30_8120_c1
3687 Ga0495601_0001193
3688 Ga0495601_0002336
3689 Ga0495601_0004742
3690 Ga0495601_0005274
3691 Ga0495601_0005651
3692 Ga0495601_0007365
3693 Ga0495601_0032855
3694 Ga0495601_0050869
3695 Ga0495601_0181136
3696 Ga0495612_0017871
3697 Ga0495612_0047295
3698 Ga0495612_0063092
3699 Ga0495595_0000532
3700 Ga0495595_0001637
3701 Ga0495595_0022326
3702 Ga0495595_0050071
3703 Ga0495595_0080343
3704 Ga0495595_0085816
3705 Ga0495619_0001164
3706 Ga0495619_0001481
3707 Ga0495619_0002710
3708 Ga0495619_0015650
3709 Ga0495619_0041602
3710 Ga0495619_0043000
3711 Ga0495619_0060862
3712 Ga0495619_0125863
3713 Ga0495619_0480959
3714 Ga0500578_0236727
3715 Ga0500643_005061
3716 Ga0500643_052533
3717 Ga0500644_0008929
3718 Ga0500644_0032371
3719 Ga0500646_0003562
3720 Ga0500646_0016450
3721 Ga0500651_0045191
3722 Ga0500651_0115831
3723 Ga0500641_0005677
3724 Ga0500641_0021719
3725 Ga0500650_0001523
3726 Ga0500654_112898
3727 Ga0500556_0000125
3728 Ga0500593_174969
3729 Ga0500595_000016
3730 Ga0500595_010713
3731 Ga0500595_018990
3732 Ga0500608_027463
3733 Ga0500642_0000105
3734 Ga0500642_0009901
3735 Ga0500642_0127103
3736 Ga0500652_019736
3737 Ga0500652_051493
3738 Ga0500655_006775
3739 Ga0500658_0086249
3740 Ga0500559_0062898
3741 Ga0500559_0277986
3742 Ga0500568_0014095
3743 Ga0500568_0041603
3744 Ga0500568_0159862
3745 Ga0500573_0000452
3746 Ga0500573_0006745
3747 Ga0500586_007745
3748 Ga0500616_0000085
3749 Ga0500616_0000876
3750 Ga0500616_0070843
3751 Ga0500619_033505
3752 Ga0500622_0013118
3753 Ga0500624_007708
3754 Ga0500627_0046797
3755 Ga0500567_130262
3756 Ga0500645_001772
3757 Ga0501084_0000175
3758 Ga0501084_0028118
3759 Ga0501084_0030163
3760 Ga0501084_0034419
3761 Ga0501084_0044330
3762 Ga0501084_0059035
3763 Ga0501084_0311314
3764 Ga0501084_0393799
3765 Ga0501082_0000653
3766 Ga0501082_0004728
3767 Ga0501082_0027700
3768 Ga0501082_0032834
3769 Ga0501082_0093597
3770 Ga0501082_0108585
3771 Ga0501082_0131205
3772 Ga0501082_0160690
3773 Ga0501082_0181935
3774 Ga0501082_0230867
3775 Ga0501082_0308123
3776 Ga0530510_0179127
3777 Ga0530510_0268027
3778 2513857536
3779 2524537994
3780 2603859871
3781 2643755779
3782 2644287952
3783 2793071754
3784 2857528519
3785 2893070165
3786 2903758267
3787 2904701654
3788 2906610374
3789 2919076116
3790 2922428987
3791 8006942216
3792 8006981950

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00297

Ribosomal_L3

Ribosomal protein L3

74

186

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
8c97-assembly1.cif.gz_D cryo-em captures early ribosome assembly in action 0.8522 2 199
8c93-assembly1.cif.gz_D cryo-em captures early ribosome assembly in action 0.8444 2 198
6pvk-assembly1.cif.gz_D bacterial 45srbga ribosomal particle class a 0.8347 1 198
6ppf-assembly1.cif.gz_D bacterial 45srbga ribosomal particle class b 0.8231 1 198
6hix-assembly1.cif.gz_AE cryo-em structure of the trypanosoma brucei mitochondrial ribosome - this entry contains the large mitoribosomal subunit 0.8164 2 199
ID Description Score Start End Superfamily
af_Q54I61_95_160_3.30.160.810 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.7538 22 77 3.30.160.810
af_Q9P6P6_75_139_3.30.160.810 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.7393 23 83 3.30.160.810
af_P60438_33_95_3.30.160.810 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.7335 23 83 3.30.160.810
af_Q9LIT4_106_169_3.30.160.810 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.7209 24 83 3.30.160.810
1vw3C02 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.7163 22 83 3.30.160.810
ID Description Score Start End GO Terms
AF-A0A836DX71-F1-model_v4 deleted 0.729 1 203
AF-A0A7X6FVD3-F1-model_v4 deleted 0.7256 1 211
AF-A0A7W4CIR4-F1-model_v4 Large ribosomal subunit protein uL3 0.7249 1 212 GO:0003735
GO:0006412
GO:0019843
GO:0022625
AF-Q2RQW0-F1-model_v4 Large ribosomal subunit protein uL3 (50S ribosomal protein L3) 0.7246 2 212 GO:0003735
GO:0006412
GO:0019843
GO:0022625
AF-A0A420WMM9-F1-model_v4 Large ribosomal subunit protein uL3 0.7242 1 211 GO:0003735
GO:0006412
GO:0019843
GO:0022625

Map