F496003
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1896 | 539 | 3792 | 233 |
Family's Representative Sequence
| Representative Sequence | 3300031344|Ga0265316_10018043|Ga0265316_100180434 |
| Length | 254 |
| Sequence | MRSGVIAQKVGMTRLFTEQGEHVPVTVLRLAQCQVVGHRSKDKNGYVALQLGAGPRRANNMSKADRGYFAKASVEPKRKLAEFRVTDDAMIPVGAEITADHFVAGQFVDVCGITIGKGFAGAMKRWNFAGLRASHGVSISHRSIGGTGGRQDPGKTFKNKKMPGHLGVDRVTTLNLRVVSTDVERGLLLVEGSVPGAKGGWITVRDAVKKSLPKGAPKPGKFRLADAGAKIDPSQPQVQPAEPAAAEASKTEGA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 2 | 3300000041 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere | Metagenome | Rhizosphere |
| 3 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 4 | 3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old | Metagenome | Rhizosphere |
| 5 | 3300000045 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere | Metagenome | Rhizosphere |
| 6 | 3300000549 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled | Metagenome | Rhizosphere |
| 7 | 3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Metagenome | Rhizosphere |
| 8 | 3300001978 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 | Metagenome | Rhizosphere |
| 9 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 10 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 11 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 12 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 13 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 14 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 15 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 16 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 17 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 18 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 19 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 20 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 21 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 22 | 3300003574 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 23 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 24 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 25 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 26 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 27 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 31 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 34 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 36 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 38 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 40 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 51 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 61 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 62 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 67 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 68 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 69 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 71 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 72 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 73 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 75 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 76 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 80 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 81 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 83 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 84 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 85 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 87 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 88 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 89 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 90 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 91 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 92 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 93 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 94 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 95 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 96 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 97 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 98 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 99 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 100 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 101 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 102 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 103 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 104 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 105 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 106 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 107 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 108 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 109 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 110 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 111 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 113 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 114 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 115 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 116 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 117 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 118 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 119 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 120 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 121 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 122 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 124 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 125 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 135 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 136 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 137 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 138 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 139 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 140 | 3300012477 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.3.yng.040610 | Metagenome | Rhizosphere |
| 141 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 150 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 151 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 152 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 153 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 154 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 155 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 156 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 157 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 158 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 159 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 160 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 162 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 163 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 164 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 165 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 166 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 235 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 236 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 240 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 241 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 242 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 243 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 244 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 245 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 246 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 247 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 248 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 249 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 250 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 251 | 3300030763 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 252 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 253 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 254 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 255 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 256 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 257 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 258 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 259 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 260 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 261 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 262 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 263 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 264 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 265 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 266 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 267 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 268 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 269 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 270 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 271 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 272 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 273 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 274 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 275 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 276 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 277 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 278 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 279 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 280 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 281 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 282 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 283 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 284 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 285 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 286 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 287 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 288 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 289 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 290 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 291 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 292 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 293 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 294 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 295 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 296 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 297 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 298 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 299 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 300 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 301 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 302 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 303 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 304 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 305 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 306 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 307 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 308 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 309 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 310 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 311 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 312 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 313 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 314 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 315 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 316 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 317 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 318 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 319 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 320 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 321 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 322 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 323 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 324 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 325 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 326 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 327 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 328 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 329 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 330 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 331 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 332 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 414 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 415 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 416 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 417 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 418 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 419 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 420 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 421 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 422 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 423 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 424 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 425 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 426 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 427 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 428 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 429 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 430 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 431 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 432 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 433 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 434 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 435 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 436 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 437 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 438 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 439 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 440 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 441 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 442 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 443 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 444 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 445 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 446 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 447 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 448 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 449 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 450 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 451 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 452 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 453 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 454 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 455 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 456 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 457 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 458 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 459 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 460 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 461 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 462 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 463 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 464 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 465 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 466 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 467 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 468 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 469 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 470 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 471 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 472 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 473 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 474 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 475 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 476 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 477 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 478 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 479 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 480 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 481 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 482 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 483 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 484 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 485 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 486 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 487 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 488 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 489 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 490 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 491 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 492 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 493 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 494 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 495 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 496 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 497 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 498 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 499 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 500 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 501 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 502 | 3300053099 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere | Metagenome | Endosphere |
| 503 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 504 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 505 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 506 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 507 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 508 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 509 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 510 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 511 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 512 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 513 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 514 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 515 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 516 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 517 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 518 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 519 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 520 | 3300053723 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere | Metagenome | Endosphere |
| 521 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 522 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 523 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 524 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 525 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 526 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 527 | 2602042107 | Bradyrhizobium sp. NFR13 | Isolate | Rhizoplane |
| 528 | 2643221547 | Pseudolabrys sp. Root1462 | Isolate | Unclassified |
| 529 | 2643221651 | Afipia sp. Root123D2 | Isolate | Unclassified |
| 530 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 531 | 2857524615 | Tardiphaga sp. R-73074 | Isolate | Unclassified |
| 532 | 2893066018 | Tardiphaga sp. P9-11 | Isolate | Unclassified |
| 533 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 534 | 2904699407 | |||
| 535 | 2906610324 | |||
| 536 | 2919073203 | Tardiphaga robiniae 1155 | Isolate | Unclassified |
| 537 | 2922425934 | |||
| 538 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 539 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.1 |
| Metatranscriptomes | 0.26 |
| Isolates | 0.63 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.69 |
| Nodule | 0.26 |
| Rhizoplane | 4.38 |
| Rhizosphere | 87.5 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0265316_10018043 | 3300031344 | Bacteria | 6080 |
| 2 | ARcpr5oldR_c000035 | 3300000041 | Bacteria | 26838 |
| 3 | ARcpr5yngRDRAFT_c000212 | 3300000043 | Bacteria | 8945 |
| 4 | ARcpr5yngRDRAFT_c001457 | 3300000043 | Bacteria | 2608 |
| 5 | ARSoilOldRDRAFT_c000208 | 3300000044 | Bacteria | 9345 |
| 6 | ARSoilOldRDRAFT_c001089 | 3300000044 | Bacteria | 2613 |
| 7 | ARCol0oldRDRAFT_c00767 | 3300000045 | Bacteria | 2705 |
| 8 | LJQas_1006294 | 3300000549 | Bacteria | 1482 |
| 9 | ARCol0yngRDRAFT_1000025 | 3300000652 | Bacteria | 26845 |
| 10 | JGI24747J21853_1003301 | 3300001978 | Bacteria | 1388 |
| 11 | JGI24739J22299_10001271 | 3300001989 | Bacteria | 9474 |
| 12 | JGI24737J22298_10002998 | 3300001990 | Bacteria | 5985 |
| 13 | JGI24737J22298_10007299 | 3300001990 | Bacteria | 3735 |
| 14 | JGI24737J22298_10020339 | 3300001990 | Bacteria | 2119 |
| 15 | JGI24735J21928_10012540 | 3300002067 | Bacteria | 2677 |
| 16 | JGI24750J21931_1001136 | 3300002070 | Bacteria | 3432 |
| 17 | JGI24745J21846_1000034 | 3300002073 | Bacteria | 9049 |
| 18 | JGI24745J21846_1000277 | 3300002073 | Bacteria | 4362 |
| 19 | JGI24748J21848_1000741 | 3300002074 | Bacteria | 3527 |
| 20 | JGI24738J21930_10001754 | 3300002075 | Bacteria | 5922 |
| 21 | JGI24749J21850_1002096 | 3300002076 | Bacteria | 2811 |
| 22 | JGI24744J21845_10000241 | 3300002077 | Bacteria | 8837 |
| 23 | JGI24742J22300_10000465 | 3300002244 | Bacteria | 6004 |
| 24 | JGI25406J46586_10002015 | 3300003203 | Bacteria | 9596 |
| 25 | JGI25165J46597_1001315 | 3300003214 | Bacteria | 14050 |
| 26 | JGI25153J46596_10010402 | 3300003215 | Bacteria | 4210 |
| 27 | Ga0007410J51695_1034900 | 3300003574 | Bacteria | 1895 |
| 28 | JGI25404J52841_10015726 | 3300003659 | Bacteria | 1642 |
| 29 | Ga0058862_12808773 | 3300004803 | Bacteria | 3691 |
| 30 | Ga0065712_10138949 | 3300005290 | Bacteria | 1468 |
| 31 | Ga0065715_10002813 | 3300005293 | Bacteria | 5934 |
| 32 | Ga0065715_10009083 | 3300005293 | Bacteria | 5124 |
| 33 | Ga0070658_10018691 | 3300005327 | Bacteria | 5551 |
| 34 | Ga0070658_10021396 | 3300005327 | Bacteria | 5184 |
| 35 | Ga0070658_10059824 | 3300005327 | Bacteria | 3102 |
| 36 | Ga0070658_10416724 | 3300005327 | Bacteria | 1154 |
| 37 | Ga0070676_10001242 | 3300005328 | Bacteria | 12829 |
| 38 | Ga0070676_10018760 | 3300005328 | Bacteria | 3838 |
| 39 | Ga0070676_10200933 | 3300005328 | Bacteria | 1306 |
| 40 | Ga0070676_10201179 | 3300005328 | Bacteria | 1306 |
| 41 | Ga0070676_10406381 | 3300005328 | Bacteria | 949 |
| 42 | Ga0070683_100002064 | 3300005329 | Bacteria | 15853 |
| 43 | Ga0070683_100404282 | 3300005329 | Bacteria | 1302 |
| 44 | Ga0070683_100678487 | 3300005329 | Bacteria | 987 |
| 45 | Ga0070690_100020216 | 3300005330 | Bacteria | 4054 |
| 46 | Ga0070690_100027028 | 3300005330 | Bacteria | 3544 |
| 47 | Ga0070690_100064067 | 3300005330 | Bacteria | 2373 |
| 48 | Ga0070670_100006103 | 3300005331 | Bacteria | 10185 |
| 49 | Ga0070670_100036557 | 3300005331 | Bacteria | 4226 |
| 50 | Ga0070670_100305757 | 3300005331 | Bacteria | 1391 |
| 51 | Ga0070670_100356512 | 3300005331 | Bacteria | 1285 |
| 52 | Ga0070677_10003234 | 3300005333 | Bacteria | 5245 |
| 53 | Ga0070677_10211984 | 3300005333 | Bacteria | 941 |
| 54 | Ga0068869_100000755 | 3300005334 | Bacteria | 18338 |
| 55 | Ga0068869_100049348 | 3300005334 | Bacteria | 3046 |
| 56 | Ga0068869_100336424 | 3300005334 | Bacteria | 1228 |
| 57 | Ga0070666_10044127 | 3300005335 | Bacteria | 2986 |
| 58 | Ga0070666_10071615 | 3300005335 | Bacteria | 2359 |
| 59 | Ga0070666_10087332 | 3300005335 | Bacteria | 2137 |
| 60 | Ga0070666_10115779 | 3300005335 | Bacteria | 1856 |
| 61 | Ga0070680_100013921 | 3300005336 | Bacteria | 6276 |
| 62 | Ga0070680_100020347 | 3300005336 | Bacteria | 5268 |
| 63 | Ga0070680_100046330 | 3300005336 | Bacteria | 3537 |
| 64 | Ga0070680_100052990 | 3300005336 | Bacteria | 3311 |
| 65 | Ga0070680_100062663 | 3300005336 | Bacteria | 3045 |
| 66 | Ga0070680_100089957 | 3300005336 | Bacteria | 2540 |
| 67 | Ga0070680_100137909 | 3300005336 | Bacteria | 2044 |
| 68 | Ga0070680_100138570 | 3300005336 | Bacteria | 2039 |
| 69 | Ga0070680_100143239 | 3300005336 | Bacteria | 2004 |
| 70 | Ga0070680_100225377 | 3300005336 | Bacteria | 1582 |
| 71 | Ga0070680_100232973 | 3300005336 | Bacteria | 1556 |
| 72 | Ga0070682_100000693 | 3300005337 | Bacteria | 20306 |
| 73 | Ga0070682_100067778 | 3300005337 | Bacteria | 2273 |
| 74 | Ga0070682_100304094 | 3300005337 | Bacteria | 1171 |
| 75 | Ga0068868_100043374 | 3300005338 | Bacteria | 3513 |
| 76 | Ga0068868_100044894 | 3300005338 | Bacteria | 3456 |
| 77 | Ga0068868_100201743 | 3300005338 | Bacteria | 1658 |
| 78 | Ga0070660_100001324 | 3300005339 | Bacteria | 16829 |
| 79 | Ga0070660_100004264 | 3300005339 | Bacteria | 9871 |
| 80 | Ga0070660_100088013 | 3300005339 | Bacteria | 2445 |
| 81 | Ga0070660_100233572 | 3300005339 | Bacteria | 1496 |
| 82 | Ga0070660_100297578 | 3300005339 | Bacteria | 1322 |
| 83 | Ga0070660_100387271 | 3300005339 | Bacteria | 1154 |
| 84 | Ga0070660_100459760 | 3300005339 | Bacteria | 1056 |
| 85 | Ga0070689_100031007 | 3300005340 | Bacteria | 4061 |
| 86 | Ga0070689_100051095 | 3300005340 | Bacteria | 3195 |
| 87 | Ga0070689_100051585 | 3300005340 | Bacteria | 3180 |
| 88 | Ga0070691_10000386 | 3300005341 | Bacteria | 16019 |
| 89 | Ga0070691_10000795 | 3300005341 | Bacteria | 12588 |
| 90 | Ga0070691_10078003 | 3300005341 | Bacteria | 1617 |
| 91 | Ga0070687_100000768 | 3300005343 | Bacteria | 10675 |
| 92 | Ga0070687_100017582 | 3300005343 | Bacteria | 3291 |
| 93 | Ga0070661_100005946 | 3300005344 | Bacteria | 8403 |
| 94 | Ga0070661_100006236 | 3300005344 | Bacteria | 8222 |
| 95 | Ga0070661_100197586 | 3300005344 | Bacteria | 1536 |
| 96 | Ga0070692_10011093 | 3300005345 | Bacteria | 4127 |
| 97 | Ga0070668_100002043 | 3300005347 | Bacteria | 14764 |
| 98 | Ga0070668_100277534 | 3300005347 | Bacteria | 1399 |
| 99 | Ga0070668_100330482 | 3300005347 | Bacteria | 1285 |
| 100 | Ga0070669_100004204 | 3300005353 | Bacteria | 10419 |
| 101 | Ga0070669_100056953 | 3300005353 | Bacteria | 2866 |
| 102 | Ga0070669_100147551 | 3300005353 | Bacteria | 1818 |
| 103 | Ga0070675_100004033 | 3300005354 | Bacteria | 11145 |
| 104 | Ga0070675_100142778 | 3300005354 | Bacteria | 2047 |
| 105 | Ga0070671_100029434 | 3300005355 | Bacteria | 4528 |
| 106 | Ga0070671_100223769 | 3300005355 | Bacteria | 1596 |
| 107 | Ga0070671_100514334 | 3300005355 | Bacteria | 1030 |
| 108 | Ga0070674_100001294 | 3300005356 | Bacteria | 13164 |
| 109 | Ga0070674_100031711 | 3300005356 | Bacteria | 3504 |
| 110 | Ga0070674_100058873 | 3300005356 | Bacteria | 2672 |
| 111 | Ga0070674_100379629 | 3300005356 | Bacteria | 1149 |
| 112 | Ga0070673_100002364 | 3300005364 | Bacteria | 11471 |
| 113 | Ga0070673_100026334 | 3300005364 | Bacteria | 4294 |
| 114 | Ga0070673_100101196 | 3300005364 | Bacteria | 2373 |
| 115 | Ga0070673_100786292 | 3300005364 | Bacteria | 878 |
| 116 | Ga0070688_100035071 | 3300005365 | Bacteria | 3045 |
| 117 | Ga0070688_100100102 | 3300005365 | Bacteria | 1909 |
| 118 | Ga0070688_100200154 | 3300005365 | Bacteria | 1397 |
| 119 | Ga0070688_100219310 | 3300005365 | Bacteria | 1340 |
| 120 | Ga0070688_100233871 | 3300005365 | Bacteria | 1301 |
| 121 | Ga0070659_100005048 | 3300005366 | Bacteria | 9461 |
| 122 | Ga0070659_100018128 | 3300005366 | Bacteria | 5309 |
| 123 | Ga0070659_100046184 | 3300005366 | Bacteria | 3414 |
| 124 | Ga0070667_100010781 | 3300005367 | Bacteria | 7552 |
| 125 | Ga0070667_100052294 | 3300005367 | Bacteria | 3446 |
| 126 | Ga0070667_100214012 | 3300005367 | Bacteria | 1714 |
| 127 | Ga0070667_100251409 | 3300005367 | Bacteria | 1580 |
| 128 | Ga0070667_100339918 | 3300005367 | Bacteria | 1357 |
| 129 | Ga0070667_100489645 | 3300005367 | Bacteria | 1126 |
| 130 | Ga0070709_10003511 | 3300005434 | Bacteria | 8423 |
| 131 | Ga0070709_10022452 | 3300005434 | Bacteria | 3691 |
| 132 | Ga0070709_10048294 | 3300005434 | Bacteria | 2655 |
| 133 | Ga0070709_10064061 | 3300005434 | Bacteria | 2350 |
| 134 | Ga0070709_10308544 | 3300005434 | Bacteria | 1157 |
| 135 | Ga0070709_10385642 | 3300005434 | Bacteria | 1043 |
| 136 | Ga0070714_100009083 | 3300005435 | Bacteria | 7794 |
| 137 | Ga0070714_100011419 | 3300005435 | Bacteria | 7044 |
| 138 | Ga0070714_100017244 | 3300005435 | Bacteria | 5847 |
| 139 | Ga0070714_100027595 | 3300005435 | Bacteria | 4703 |
| 140 | Ga0070714_100107950 | 3300005435 | Bacteria | 2461 |
| 141 | Ga0070714_100142833 | 3300005435 | Bacteria | 2150 |
| 142 | Ga0070714_100148074 | 3300005435 | Bacteria | 2113 |
| 143 | Ga0070714_100305726 | 3300005435 | Bacteria | 1483 |
| 144 | Ga0070714_100339019 | 3300005435 | Bacteria | 1410 |
| 145 | Ga0070714_100731402 | 3300005435 | Bacteria | 956 |
| 146 | Ga0070713_100000012 | 3300005436 | Bacteria | 137708 |
| 147 | Ga0070713_100042539 | 3300005436 | Bacteria | 3709 |
| 148 | Ga0070713_100051698 | 3300005436 | Bacteria | 3399 |
| 149 | Ga0070713_100060535 | 3300005436 | Bacteria | 3165 |
| 150 | Ga0070713_100103102 | 3300005436 | Bacteria | 2475 |
| 151 | Ga0070713_100617693 | 3300005436 | Bacteria | 1031 |
| 152 | Ga0070710_10005644 | 3300005437 | Bacteria | 5958 |
| 153 | Ga0070710_10014954 | 3300005437 | Bacteria | 3916 |
| 154 | Ga0070710_10052773 | 3300005437 | Bacteria | 2287 |
| 155 | Ga0070710_10103973 | 3300005437 | Bacteria | 1696 |
| 156 | Ga0070710_10146698 | 3300005437 | Bacteria | 1452 |
| 157 | Ga0070701_10318394 | 3300005438 | Bacteria | 962 |
| 158 | Ga0070711_100004304 | 3300005439 | Bacteria | 8381 |
| 159 | Ga0070711_100027798 | 3300005439 | Bacteria | 3716 |
| 160 | Ga0070711_100079027 | 3300005439 | Bacteria | 2339 |
| 161 | Ga0070711_100140078 | 3300005439 | Bacteria | 1812 |
| 162 | Ga0070711_100145188 | 3300005439 | Bacteria | 1783 |
| 163 | Ga0070711_100286851 | 3300005439 | Bacteria | 1304 |
| 164 | Ga0070711_100746895 | 3300005439 | Bacteria | 827 |
| 165 | Ga0070705_100001981 | 3300005440 | Bacteria | 10455 |
| 166 | Ga0070705_100068685 | 3300005440 | Bacteria | 2133 |
| 167 | Ga0070700_100017413 | 3300005441 | Bacteria | 4108 |
| 168 | Ga0070694_100007138 | 3300005444 | Bacteria | 6802 |
| 169 | Ga0070694_100010924 | 3300005444 | Bacteria | 5618 |
| 170 | Ga0070708_100060973 | 3300005445 | Bacteria | 3368 |
| 171 | Ga0070708_100469201 | 3300005445 | Bacteria | 1188 |
| 172 | Ga0070663_100010153 | 3300005455 | Bacteria | 5859 |
| 173 | Ga0070663_100028446 | 3300005455 | Bacteria | 3805 |
| 174 | Ga0070663_100150267 | 3300005455 | Bacteria | 1785 |
| 175 | Ga0070663_100290596 | 3300005455 | Bacteria | 1305 |
| 176 | Ga0070678_100004700 | 3300005456 | Bacteria | 7775 |
| 177 | Ga0070678_100006525 | 3300005456 | Bacteria | 6852 |
| 178 | Ga0070678_100010048 | 3300005456 | Bacteria | 5761 |
| 179 | Ga0070678_100202402 | 3300005456 | Bacteria | 1639 |
| 180 | Ga0070678_100492298 | 3300005456 | Bacteria | 1081 |
| 181 | Ga0070678_100677019 | 3300005456 | Bacteria | 927 |
| 182 | Ga0070678_100720491 | 3300005456 | Bacteria | 900 |
| 183 | Ga0070662_100007011 | 3300005457 | Bacteria | 7290 |
| 184 | Ga0070662_100049113 | 3300005457 | Bacteria | 3042 |
| 185 | Ga0070662_100464192 | 3300005457 | Bacteria | 1052 |
| 186 | Ga0070681_10000037 | 3300005458 | Bacteria | 96087 |
| 187 | Ga0070681_10010029 | 3300005458 | Bacteria | 9338 |
| 188 | Ga0070681_10029025 | 3300005458 | Bacteria | 5554 |
| 189 | Ga0070681_10029349 | 3300005458 | Bacteria | 5523 |
| 190 | Ga0070681_10066848 | 3300005458 | Bacteria | 3563 |
| 191 | Ga0070681_10078949 | 3300005458 | Bacteria | 3248 |
| 192 | Ga0070681_10111364 | 3300005458 | Bacteria | 2676 |
| 193 | Ga0070681_10218303 | 3300005458 | Bacteria | 1823 |
| 194 | Ga0070681_10410685 | 3300005458 | Bacteria | 1265 |
| 195 | Ga0070681_10598653 | 3300005458 | Bacteria | 1017 |
| 196 | Ga0070681_10867119 | 3300005458 | Bacteria | 821 |
| 197 | Ga0068867_100003543 | 3300005459 | Bacteria | 10976 |
| 198 | Ga0068867_100040232 | 3300005459 | Bacteria | 3410 |
| 199 | Ga0068867_100137801 | 3300005459 | Bacteria | 1904 |
| 200 | Ga0068867_100820916 | 3300005459 | Bacteria | 831 |
| 201 | Ga0070685_10222405 | 3300005466 | Bacteria | 1238 |
| 202 | Ga0070699_100265743 | 3300005518 | Bacteria | 1535 |
| 203 | Ga0070679_100008411 | 3300005530 | Bacteria | 9712 |
| 204 | Ga0070679_100035943 | 3300005530 | Bacteria | 4915 |
| 205 | Ga0070679_100058331 | 3300005530 | Bacteria | 3846 |
| 206 | Ga0070679_100069873 | 3300005530 | Bacteria | 3503 |
| 207 | Ga0070679_100186092 | 3300005530 | Bacteria | 2047 |
| 208 | Ga0070679_100255070 | 3300005530 | Bacteria | 1709 |
| 209 | Ga0070684_100007624 | 3300005535 | Bacteria | 8437 |
| 210 | Ga0070684_100276337 | 3300005535 | Bacteria | 1538 |
| 211 | Ga0070684_100470348 | 3300005535 | Bacteria | 1163 |
| 212 | Ga0068853_100002020 | 3300005539 | Bacteria | 15004 |
| 213 | Ga0068853_100002660 | 3300005539 | Bacteria | 13466 |
| 214 | Ga0068853_100023191 | 3300005539 | Bacteria | 5193 |
| 215 | Ga0068853_100117767 | 3300005539 | Bacteria | 2366 |
| 216 | Ga0068853_100125502 | 3300005539 | Bacteria | 2292 |
| 217 | Ga0070672_100002637 | 3300005543 | Bacteria | 11467 |
| 218 | Ga0070672_100003392 | 3300005543 | Bacteria | 10324 |
| 219 | Ga0070672_100286596 | 3300005543 | Bacteria | 1394 |
| 220 | Ga0070686_100004029 | 3300005544 | Bacteria | 8075 |
| 221 | Ga0070686_100202066 | 3300005544 | Bacteria | 1425 |
| 222 | Ga0070686_100351558 | 3300005544 | Bacteria | 1107 |
| 223 | Ga0070695_100003098 | 3300005545 | Bacteria | 9679 |
| 224 | Ga0070695_100014423 | 3300005545 | Bacteria | 4764 |
| 225 | Ga0070695_100039405 | 3300005545 | Bacteria | 2986 |
| 226 | Ga0070696_100010916 | 3300005546 | Bacteria | 6087 |
| 227 | Ga0070693_100051681 | 3300005547 | Bacteria | 2354 |
| 228 | Ga0070693_100054219 | 3300005547 | Bacteria | 2305 |
| 229 | Ga0070693_100214218 | 3300005547 | Bacteria | 1258 |
| 230 | Ga0070693_100251057 | 3300005547 | Bacteria | 1172 |
| 231 | Ga0070665_100014624 | 3300005548 | Bacteria | 7876 |
| 232 | Ga0070665_100128255 | 3300005548 | Bacteria | 2539 |
| 233 | Ga0070665_100174797 | 3300005548 | Bacteria | 2148 |
| 234 | Ga0070665_100271609 | 3300005548 | Bacteria | 1697 |
| 235 | Ga0070665_100291751 | 3300005548 | Bacteria | 1633 |
| 236 | Ga0070665_100377545 | 3300005548 | Bacteria | 1425 |
| 237 | Ga0070665_100675610 | 3300005548 | Bacteria | 1046 |
| 238 | Ga0070704_100004936 | 3300005549 | Bacteria | 7744 |
| 239 | Ga0068855_100012001 | 3300005563 | Bacteria | 10474 |
| 240 | Ga0068855_100047378 | 3300005563 | Bacteria | 5078 |
| 241 | Ga0068855_100057023 | 3300005563 | Bacteria | 4580 |
| 242 | Ga0068855_100093513 | 3300005563 | Bacteria | 3467 |
| 243 | Ga0068855_100149068 | 3300005563 | Bacteria | 2660 |
| 244 | Ga0068855_100285728 | 3300005563 | Bacteria | 1830 |
| 245 | Ga0068855_100296783 | 3300005563 | Bacteria | 1790 |
| 246 | Ga0068855_100349371 | 3300005563 | Bacteria | 1629 |
| 247 | Ga0068855_101093999 | 3300005563 | Bacteria | 833 |
| 248 | Ga0070664_100004534 | 3300005564 | Bacteria | 11145 |
| 249 | Ga0070664_100066218 | 3300005564 | Bacteria | 3084 |
| 250 | Ga0070664_100290295 | 3300005564 | Bacteria | 1476 |
| 251 | Ga0068857_100006037 | 3300005577 | Bacteria | 10344 |
| 252 | Ga0068857_100007896 | 3300005577 | Bacteria | 9178 |
| 253 | Ga0068857_100115785 | 3300005577 | Bacteria | 2411 |
| 254 | Ga0068857_100180341 | 3300005577 | Bacteria | 1922 |
| 255 | Ga0068857_100198674 | 3300005577 | Bacteria | 1828 |
| 256 | Ga0068857_100338159 | 3300005577 | Bacteria | 1392 |
| 257 | Ga0068857_100431518 | 3300005577 | Bacteria | 1230 |
| 258 | Ga0068854_100329508 | 3300005578 | Bacteria | 1244 |
| 259 | Ga0068854_100630810 | 3300005578 | Bacteria | 918 |
| 260 | Ga0068856_100001032 | 3300005614 | Bacteria | 29659 |
| 261 | Ga0068856_100008706 | 3300005614 | Bacteria | 9874 |
| 262 | Ga0068856_100034393 | 3300005614 | Bacteria | 4964 |
| 263 | Ga0068856_100154116 | 3300005614 | Bacteria | 2307 |
| 264 | Ga0068856_100344995 | 3300005614 | Bacteria | 1507 |
| 265 | Ga0068856_100941438 | 3300005614 | Bacteria | 882 |
| 266 | Ga0070702_100000378 | 3300005615 | Bacteria | 15718 |
| 267 | Ga0070702_100148776 | 3300005615 | Bacteria | 1500 |
| 268 | Ga0068852_100006800 | 3300005616 | Bacteria | 8301 |
| 269 | Ga0068852_100017082 | 3300005616 | Bacteria | 5683 |
| 270 | Ga0068852_100022852 | 3300005616 | Bacteria | 5023 |
| 271 | Ga0068852_100025730 | 3300005616 | Bacteria | 4773 |
| 272 | Ga0068852_100142141 | 3300005616 | Bacteria | 2222 |
| 273 | Ga0068852_100400874 | 3300005616 | Bacteria | 1349 |
| 274 | Ga0068852_100515820 | 3300005616 | Bacteria | 1192 |
| 275 | Ga0068859_100007402 | 3300005617 | Bacteria | 11142 |
| 276 | Ga0068859_100391446 | 3300005617 | Bacteria | 1485 |
| 277 | Ga0068859_100622809 | 3300005617 | Bacteria | 1172 |
| 278 | Ga0068864_100000595 | 3300005618 | Bacteria | 30701 |
| 279 | Ga0068864_100521538 | 3300005618 | Bacteria | 1145 |
| 280 | Ga0068861_100002973 | 3300005719 | Bacteria | 11183 |
| 281 | Ga0068861_100098923 | 3300005719 | Bacteria | 2316 |
| 282 | Ga0068861_100189622 | 3300005719 | Bacteria | 1718 |
| 283 | Ga0068851_10037994 | 3300005834 | Bacteria | 2414 |
| 284 | Ga0068851_10102652 | 3300005834 | Bacteria | 1519 |
| 285 | Ga0068851_10374922 | 3300005834 | Bacteria | 832 |
| 286 | Ga0068870_10000216 | 3300005840 | Bacteria | 20877 |
| 287 | Ga0068863_100022557 | 3300005841 | Bacteria | 6011 |
| 288 | Ga0068863_100254929 | 3300005841 | Bacteria | 1695 |
| 289 | Ga0068863_100755481 | 3300005841 | Bacteria | 968 |
| 290 | Ga0068863_100908860 | 3300005841 | Bacteria | 881 |
| 291 | Ga0068858_100024760 | 3300005842 | Bacteria | 5589 |
| 292 | Ga0068858_100144437 | 3300005842 | Bacteria | 2234 |
| 293 | Ga0068860_100007174 | 3300005843 | Bacteria | 11145 |
| 294 | Ga0068860_100583209 | 3300005843 | Bacteria | 1122 |
| 295 | Ga0068862_100017504 | 3300005844 | Bacteria | 5970 |
| 296 | Ga0068862_100018639 | 3300005844 | Bacteria | 5781 |
| 297 | Ga0068862_100057395 | 3300005844 | Bacteria | 3339 |
| 298 | Ga0068862_100192379 | 3300005844 | Bacteria | 1836 |
| 299 | Ga0068862_100723989 | 3300005844 | Bacteria | 966 |
| 300 | Ga0081455_10000048 | 3300005937 | Bacteria | 126551 |
| 301 | Ga0081455_10012767 | 3300005937 | Bacteria | 8353 |
| 302 | Ga0081538_10001041 | 3300005981 | Bacteria | 29562 |
| 303 | Ga0081538_10006728 | 3300005981 | Bacteria | 10055 |
| 304 | Ga0081540_1001166 | 3300005983 | Bacteria | 23099 |
| 305 | Ga0081540_1002979 | 3300005983 | Bacteria | 13570 |
| 306 | Ga0081539_10004794 | 3300005985 | Bacteria | 14563 |
| 307 | Ga0070717_10039765 | 3300006028 | Bacteria | 3828 |
| 308 | Ga0070717_10130640 | 3300006028 | Bacteria | 2159 |
| 309 | Ga0070717_10519040 | 3300006028 | Bacteria | 1077 |
| 310 | Ga0075365_10103453 | 3300006038 | Bacteria | 1951 |
| 311 | Ga0075368_10034503 | 3300006042 | Bacteria | 1971 |
| 312 | Ga0075368_10037933 | 3300006042 | Bacteria | 1885 |
| 313 | Ga0075363_100060337 | 3300006048 | Bacteria | 2042 |
| 314 | Ga0075363_100118875 | 3300006048 | Bacteria | 1474 |
| 315 | Ga0075364_10019516 | 3300006051 | Bacteria | 4256 |
| 316 | Ga0075364_10063494 | 3300006051 | Bacteria | 2424 |
| 317 | Ga0075364_10101082 | 3300006051 | Bacteria | 1919 |
| 318 | Ga0070715_10056436 | 3300006163 | Bacteria | 1708 |
| 319 | Ga0070716_100205070 | 3300006173 | Bacteria | 1313 |
| 320 | Ga0070716_100207272 | 3300006173 | Bacteria | 1307 |
| 321 | Ga0070716_100448776 | 3300006173 | Bacteria | 940 |
| 322 | Ga0070712_100000902 | 3300006175 | Bacteria | 17764 |
| 323 | Ga0070712_100004052 | 3300006175 | Bacteria | 8996 |
| 324 | Ga0070712_100024878 | 3300006175 | Bacteria | 3973 |
| 325 | Ga0070712_100092034 | 3300006175 | Bacteria | 2223 |
| 326 | Ga0070712_100160466 | 3300006175 | Bacteria | 1736 |
| 327 | Ga0070712_100186908 | 3300006175 | Bacteria | 1618 |
| 328 | Ga0075367_10131800 | 3300006178 | Bacteria | 1545 |
| 329 | Ga0075367_10225760 | 3300006178 | Bacteria | 1172 |
| 330 | Ga0075367_10445522 | 3300006178 | Bacteria | 820 |
| 331 | Ga0075369_10005925 | 3300006186 | Bacteria | 4597 |
| 332 | Ga0075369_10026380 | 3300006186 | Bacteria | 2421 |
| 333 | Ga0075369_10064996 | 3300006186 | Bacteria | 1598 |
| 334 | Ga0075366_10013189 | 3300006195 | Bacteria | 4700 |
| 335 | Ga0097621_100000600 | 3300006237 | Bacteria | 25393 |
| 336 | Ga0097621_100069869 | 3300006237 | Bacteria | 2900 |
| 337 | Ga0097621_100127391 | 3300006237 | Bacteria | 2164 |
| 338 | Ga0097621_100205433 | 3300006237 | Bacteria | 1711 |
| 339 | Ga0097621_100587859 | 3300006237 | Bacteria | 1016 |
| 340 | Ga0075370_10046577 | 3300006353 | Bacteria | 2454 |
| 341 | Ga0075370_10111572 | 3300006353 | Bacteria | 1588 |
| 342 | Ga0075370_10114641 | 3300006353 | Bacteria | 1566 |
| 343 | Ga0068871_100000118 | 3300006358 | Bacteria | 49211 |
| 344 | Ga0068871_100080549 | 3300006358 | Bacteria | 2696 |
| 345 | Ga0068871_100317268 | 3300006358 | Bacteria | 1371 |
| 346 | Ga0068871_100625611 | 3300006358 | Bacteria | 981 |
| 347 | Ga0068871_100833779 | 3300006358 | Bacteria | 852 |
| 348 | Ga0075428_100012701 | 3300006844 | Bacteria | 9365 |
| 349 | Ga0075428_100048564 | 3300006844 | Bacteria | 4657 |
| 350 | Ga0075428_100195979 | 3300006844 | Bacteria | 2184 |
| 351 | Ga0075430_100000196 | 3300006846 | Bacteria | 40930 |
| 352 | Ga0075430_100038858 | 3300006846 | Bacteria | 4030 |
| 353 | Ga0075430_100294749 | 3300006846 | Bacteria | 1342 |
| 354 | Ga0075431_100132984 | 3300006847 | Bacteria | 2565 |
| 355 | Ga0075431_100443591 | 3300006847 | Bacteria | 1294 |
| 356 | Ga0075431_101046779 | 3300006847 | Bacteria | 782 |
| 357 | Ga0075433_10029412 | 3300006852 | Bacteria | 4680 |
| 358 | Ga0075433_10104991 | 3300006852 | Bacteria | 2503 |
| 359 | Ga0075434_100003094 | 3300006871 | Bacteria | 14813 |
| 360 | Ga0075434_100051111 | 3300006871 | Bacteria | 4106 |
| 361 | Ga0075434_100153113 | 3300006871 | Bacteria | 2326 |
| 362 | Ga0075434_100160681 | 3300006871 | Bacteria | 2266 |
| 363 | Ga0075429_100000573 | 3300006880 | Bacteria | 28269 |
| 364 | Ga0075429_100107524 | 3300006880 | Bacteria | 2437 |
| 365 | Ga0068865_100007181 | 3300006881 | Bacteria | 6840 |
| 366 | Ga0068865_100039028 | 3300006881 | Bacteria | 3218 |
| 367 | Ga0068865_100527421 | 3300006881 | Bacteria | 988 |
| 368 | Ga0075436_100002564 | 3300006914 | Bacteria | 12509 |
| 369 | Ga0075436_100019157 | 3300006914 | Bacteria | 4689 |
| 370 | Ga0075436_100216753 | 3300006914 | Bacteria | 1358 |
| 371 | Ga0097620_100007402 | 3300006931 | Bacteria | 11142 |
| 372 | Ga0097620_100391445 | 3300006931 | Bacteria | 1485 |
| 373 | Ga0097620_100622778 | 3300006931 | Bacteria | 1172 |
| 374 | Ga0075435_100014955 | 3300007076 | Bacteria | 5821 |
| 375 | Ga0075435_100017968 | 3300007076 | Bacteria | 5362 |
| 376 | Ga0075435_100032499 | 3300007076 | Bacteria | 4121 |
| 377 | Ga0075435_100140132 | 3300007076 | Bacteria | 2029 |
| 378 | Ga0099795_10001950 | 3300007788 | Bacteria | 4691 |
| 379 | Ga0105240_10004696 | 3300009093 | Bacteria | 20647 |
| 380 | Ga0105240_10011051 | 3300009093 | Bacteria | 12622 |
| 381 | Ga0105240_10017473 | 3300009093 | Bacteria | 9666 |
| 382 | Ga0105240_10133003 | 3300009093 | Bacteria | 2981 |
| 383 | Ga0105240_10455624 | 3300009093 | Bacteria | 1430 |
| 384 | Ga0105240_10493821 | 3300009093 | Bacteria | 1362 |
| 385 | Ga0105240_10652311 | 3300009093 | Bacteria | 1153 |
| 386 | Ga0105240_10753714 | 3300009093 | Bacteria | 1058 |
| 387 | Ga0111539_10000683 | 3300009094 | Bacteria | 43914 |
| 388 | Ga0111539_10010079 | 3300009094 | Bacteria | 11909 |
| 389 | Ga0111539_10070545 | 3300009094 | Bacteria | 4125 |
| 390 | Ga0111539_10080440 | 3300009094 | Bacteria | 3833 |
| 391 | Ga0111539_10303887 | 3300009094 | Bacteria | 1857 |
| 392 | Ga0111539_10326450 | 3300009094 | Bacteria | 1786 |
| 393 | Ga0105245_10003702 | 3300009098 | Bacteria | 13642 |
| 394 | Ga0105245_10017665 | 3300009098 | Bacteria | 6226 |
| 395 | Ga0105245_10030667 | 3300009098 | Bacteria | 4755 |
| 396 | Ga0105245_10042887 | 3300009098 | Bacteria | 4035 |
| 397 | Ga0105245_10072236 | 3300009098 | Bacteria | 3134 |
| 398 | Ga0105245_10481226 | 3300009098 | Bacteria | 1255 |
| 399 | Ga0105245_10590586 | 3300009098 | Bacteria | 1136 |
| 400 | Ga0105245_10622355 | 3300009098 | Bacteria | 1108 |
| 401 | Ga0105247_10151400 | 3300009101 | Bacteria | 1529 |
| 402 | Ga0105247_10234068 | 3300009101 | Bacteria | 1249 |
| 403 | Ga0114129_10005890 | 3300009147 | Bacteria | 17359 |
| 404 | Ga0114129_10008352 | 3300009147 | Bacteria | 14760 |
| 405 | Ga0114129_10030751 | 3300009147 | Bacteria | 7593 |
| 406 | Ga0114129_10481451 | 3300009147 | Bacteria | 1624 |
| 407 | Ga0114129_10783469 | 3300009147 | Bacteria | 1218 |
| 408 | Ga0114129_10961834 | 3300009147 | Bacteria | 1078 |
| 409 | Ga0105243_10009969 | 3300009148 | Bacteria | 7221 |
| 410 | Ga0105243_10037311 | 3300009148 | Bacteria | 3776 |
| 411 | Ga0105243_10068588 | 3300009148 | Bacteria | 2858 |
| 412 | Ga0105243_10251410 | 3300009148 | Bacteria | 1578 |
| 413 | Ga0105243_10348082 | 3300009148 | Bacteria | 1360 |
| 414 | Ga0105241_10142659 | 3300009174 | Bacteria | 1952 |
| 415 | Ga0105241_10159833 | 3300009174 | Bacteria | 1851 |
| 416 | Ga0105241_10211682 | 3300009174 | Bacteria | 1624 |
| 417 | Ga0105241_10336211 | 3300009174 | Bacteria | 1307 |
| 418 | Ga0105242_10016828 | 3300009176 | Bacteria | 5691 |
| 419 | Ga0105242_10044757 | 3300009176 | Bacteria | 3585 |
| 420 | Ga0105242_10122649 | 3300009176 | Bacteria | 2233 |
| 421 | Ga0105242_10154742 | 3300009176 | Bacteria | 2002 |
| 422 | Ga0105242_10313029 | 3300009176 | Bacteria | 1437 |
| 423 | Ga0105248_10000005 | 3300009177 | Bacteria | 673111 |
| 424 | Ga0105248_10056191 | 3300009177 | Bacteria | 4415 |
| 425 | Ga0105248_10114304 | 3300009177 | Bacteria | 3044 |
| 426 | Ga0105248_10405807 | 3300009177 | Bacteria | 1534 |
| 427 | Ga0105237_10027530 | 3300009545 | Bacteria | 5801 |
| 428 | Ga0105237_10032303 | 3300009545 | Bacteria | 5300 |
| 429 | Ga0105237_10053645 | 3300009545 | Bacteria | 4043 |
| 430 | Ga0105237_10382504 | 3300009545 | Bacteria | 1412 |
| 431 | Ga0105237_10469967 | 3300009545 | Bacteria | 1264 |
| 432 | Ga0105238_10001939 | 3300009551 | Bacteria | 20807 |
| 433 | Ga0105238_10035831 | 3300009551 | Bacteria | 5044 |
| 434 | Ga0105238_10173207 | 3300009551 | Bacteria | 2134 |
| 435 | Ga0105238_10176816 | 3300009551 | Bacteria | 2111 |
| 436 | Ga0105238_10177982 | 3300009551 | Bacteria | 2104 |
| 437 | Ga0105238_10303270 | 3300009551 | Bacteria | 1581 |
| 438 | Ga0105238_10324246 | 3300009551 | Bacteria | 1526 |
| 439 | Ga0105238_10652931 | 3300009551 | Bacteria | 1062 |
| 440 | Ga0105238_11065567 | 3300009551 | Bacteria | 830 |
| 441 | Ga0105249_10002122 | 3300009553 | Bacteria | 17209 |
| 442 | Ga0105249_10023350 | 3300009553 | Bacteria | 5549 |
| 443 | Ga0105249_10161429 | 3300009553 | Bacteria | 2166 |
| 444 | Ga0105249_10257311 | 3300009553 | Bacteria | 1733 |
| 445 | Ga0099796_10001539 | 3300010159 | Bacteria | 4696 |
| 446 | Ga0099796_10077406 | 3300010159 | Bacteria | 1213 |
| 447 | Ga0105239_10028473 | 3300010375 | Bacteria | 6145 |
| 448 | Ga0105239_10052904 | 3300010375 | Bacteria | 4454 |
| 449 | Ga0105239_10057391 | 3300010375 | Bacteria | 4270 |
| 450 | Ga0105239_10090514 | 3300010375 | Bacteria | 3375 |
| 451 | Ga0105239_10115685 | 3300010375 | Bacteria | 2975 |
| 452 | Ga0105239_10162951 | 3300010375 | Bacteria | 2492 |
| 453 | Ga0105239_10220454 | 3300010375 | Bacteria | 2127 |
| 454 | Ga0105239_10343841 | 3300010375 | Bacteria | 1684 |
| 455 | Ga0105239_10413340 | 3300010375 | Bacteria | 1528 |
| 456 | Ga0105246_10002558 | 3300011119 | Bacteria | 10995 |
| 457 | Ga0105246_10140380 | 3300011119 | Bacteria | 1816 |
| 458 | Ga0105246_10154831 | 3300011119 | Bacteria | 1740 |
| 459 | Ga0105246_10305930 | 3300011119 | Bacteria | 1286 |
| 460 | Ga0105246_10536917 | 3300011119 | Bacteria | 1000 |
| 461 | Ga0157336_1001006 | 3300012477 | Bacteria | 1389 |
| 462 | Ga0157373_10000820 | 3300013100 | Bacteria | 24076 |
| 463 | Ga0157371_10057710 | 3300013102 | Bacteria | 2753 |
| 464 | Ga0157371_10303390 | 3300013102 | Bacteria | 1156 |
| 465 | Ga0157371_10428607 | 3300013102 | Bacteria | 970 |
| 466 | Ga0157370_10058956 | 3300013104 | Bacteria | 3649 |
| 467 | Ga0157370_10082927 | 3300013104 | Bacteria | 3015 |
| 468 | Ga0157370_10089027 | 3300013104 | Bacteria | 2899 |
| 469 | Ga0157370_10187647 | 3300013104 | Bacteria | 1919 |
| 470 | Ga0157370_10477886 | 3300013104 | Bacteria | 1145 |
| 471 | Ga0157369_10001535 | 3300013105 | Bacteria | 28280 |
| 472 | Ga0157369_10132262 | 3300013105 | Bacteria | 2643 |
| 473 | Ga0157369_10153459 | 3300013105 | Bacteria | 2434 |
| 474 | Ga0157369_10171228 | 3300013105 | Bacteria | 2288 |
| 475 | Ga0157369_10447677 | 3300013105 | Bacteria | 1337 |
| 476 | Ga0157374_10018401 | 3300013296 | Bacteria | 6164 |
| 477 | Ga0157374_10115150 | 3300013296 | Bacteria | 2589 |
| 478 | Ga0157378_10015153 | 3300013297 | Bacteria | 6749 |
| 479 | Ga0157378_10112197 | 3300013297 | Bacteria | 2501 |
| 480 | Ga0163162_10028695 | 3300013306 | Bacteria | 5508 |
| 481 | Ga0163162_10046698 | 3300013306 | Bacteria | 4341 |
| 482 | Ga0163162_10241481 | 3300013306 | Bacteria | 1937 |
| 483 | Ga0163162_10770557 | 3300013306 | Bacteria | 1081 |
| 484 | Ga0157372_10023820 | 3300013307 | Bacteria | 6641 |
| 485 | Ga0157372_10059581 | 3300013307 | Bacteria | 4270 |
| 486 | Ga0157372_10437922 | 3300013307 | Bacteria | 1524 |
| 487 | Ga0157372_10468546 | 3300013307 | Bacteria | 1468 |
| 488 | Ga0157372_10893284 | 3300013307 | Bacteria | 1031 |
| 489 | Ga0157372_11042959 | 3300013307 | Bacteria | 946 |
| 490 | Ga0157372_11160265 | 3300013307 | Bacteria | 893 |
| 491 | Ga0157375_10007178 | 3300013308 | Bacteria | 9737 |
| 492 | Ga0157375_10037143 | 3300013308 | Bacteria | 4665 |
| 493 | Ga0157375_10154210 | 3300013308 | Bacteria | 2435 |
| 494 | Ga0157375_10418092 | 3300013308 | Bacteria | 1507 |
| 495 | Ga0157375_10776327 | 3300013308 | Bacteria | 1108 |
| 496 | Ga0157375_10921856 | 3300013308 | Bacteria | 1017 |
| 497 | Ga0163163_10008003 | 3300014325 | Bacteria | 9355 |
| 498 | Ga0163163_10113766 | 3300014325 | Bacteria | 2736 |
| 499 | Ga0163163_10159978 | 3300014325 | Bacteria | 2297 |
| 500 | Ga0163163_10400600 | 3300014325 | Bacteria | 1430 |
| 501 | Ga0163163_10664643 | 3300014325 | Bacteria | 1105 |
| 502 | Ga0163163_10718688 | 3300014325 | Bacteria | 1062 |
| 503 | Ga0157380_10021174 | 3300014326 | Bacteria | 4874 |
| 504 | Ga0157380_10641176 | 3300014326 | Bacteria | 1058 |
| 505 | Ga0157380_10762508 | 3300014326 | Bacteria | 980 |
| 506 | Ga0157377_10000628 | 3300014745 | Bacteria | 14665 |
| 507 | Ga0157377_10384529 | 3300014745 | Bacteria | 951 |
| 508 | Ga0157379_10018151 | 3300014968 | Bacteria | 6200 |
| 509 | Ga0157379_10018171 | 3300014968 | Bacteria | 6195 |
| 510 | Ga0157379_10038101 | 3300014968 | Bacteria | 4289 |
| 511 | Ga0157379_10071200 | 3300014968 | Bacteria | 3111 |
| 512 | Ga0157379_10073976 | 3300014968 | Bacteria | 3050 |
| 513 | Ga0157379_10307604 | 3300014968 | Bacteria | 1445 |
| 514 | Ga0157379_10564259 | 3300014968 | Bacteria | 1060 |
| 515 | Ga0157379_10874642 | 3300014968 | Bacteria | 851 |
| 516 | Ga0157376_10006966 | 3300014969 | Bacteria | 8018 |
| 517 | Ga0157376_10273159 | 3300014969 | Bacteria | 1589 |
| 518 | Ga0157376_10478212 | 3300014969 | Bacteria | 1220 |
| 519 | Ga0163161_10009359 | 3300017792 | Bacteria | 6779 |
| 520 | Ga0163161_10049613 | 3300017792 | Bacteria | 3034 |
| 521 | Ga0213876_10000421 | 3300021384 | Bacteria | 35344 |
| 522 | Ga0213876_10002961 | 3300021384 | Bacteria | 9840 |
| 523 | Ga0213876_10003189 | 3300021384 | Bacteria | 9433 |
| 524 | Ga0213876_10046760 | 3300021384 | Bacteria | 2288 |
| 525 | Ga0213875_10000089 | 3300021388 | Bacteria | 105772 |
| 526 | Ga0224712_10120152 | 3300022467 | Bacteria | 1137 |
| 527 | Ga0209233_1000013 | 3300025261 | Bacteria | 1013785 |
| 528 | Ga0209233_1003250 | 3300025261 | Bacteria | 5762 |
| 529 | Ga0207666_1000185 | 3300025271 | Bacteria | 9376 |
| 530 | Ga0209455_1009081 | 3300025272 | Bacteria | 2639 |
| 531 | Ga0209130_1036140 | 3300025284 | Bacteria | 983 |
| 532 | Ga0209564_1002708 | 3300025295 | Bacteria | 13379 |
| 533 | Ga0209758_1000548 | 3300025297 | Bacteria | 59657 |
| 534 | Ga0209758_1006193 | 3300025297 | Bacteria | 8738 |
| 535 | Ga0207426_1026172 | 3300025302 | Bacteria | 1957 |
| 536 | Ga0207697_10003861 | 3300025315 | Bacteria | 7309 |
| 537 | Ga0207697_10034987 | 3300025315 | Bacteria | 2056 |
| 538 | Ga0207656_10025078 | 3300025321 | Bacteria | 2418 |
| 539 | Ga0207682_10000350 | 3300025893 | Bacteria | 21096 |
| 540 | Ga0207682_10038677 | 3300025893 | Bacteria | 1937 |
| 541 | Ga0207682_10076484 | 3300025893 | Bacteria | 1427 |
| 542 | Ga0207692_10105360 | 3300025898 | Bacteria | 1555 |
| 543 | Ga0207692_10201717 | 3300025898 | Bacteria | 1170 |
| 544 | Ga0207692_10224858 | 3300025898 | Bacteria | 1114 |
| 545 | Ga0207692_10236709 | 3300025898 | Bacteria | 1089 |
| 546 | Ga0207710_10014061 | 3300025900 | Bacteria | 3371 |
| 547 | Ga0207688_10007287 | 3300025901 | Bacteria | 6019 |
| 548 | Ga0207688_10037550 | 3300025901 | Bacteria | 2687 |
| 549 | Ga0207688_10283760 | 3300025901 | Bacteria | 1009 |
| 550 | Ga0207680_10005899 | 3300025903 | Bacteria | 5882 |
| 551 | Ga0207680_10129058 | 3300025903 | Bacteria | 1664 |
| 552 | Ga0207680_10182716 | 3300025903 | Bacteria | 1419 |
| 553 | Ga0207680_10531538 | 3300025903 | Bacteria | 839 |
| 554 | Ga0207647_10030675 | 3300025904 | Bacteria | 3466 |
| 555 | Ga0207647_10033853 | 3300025904 | Bacteria | 3267 |
| 556 | Ga0207647_10055947 | 3300025904 | Bacteria | 2422 |
| 557 | Ga0207647_10278971 | 3300025904 | Bacteria | 954 |
| 558 | Ga0207685_10053068 | 3300025905 | Bacteria | 1573 |
| 559 | Ga0207699_10000164 | 3300025906 | Bacteria | 41177 |
| 560 | Ga0207699_10008214 | 3300025906 | Bacteria | 5139 |
| 561 | Ga0207699_10043634 | 3300025906 | Bacteria | 2606 |
| 562 | Ga0207699_10347377 | 3300025906 | Bacteria | 1046 |
| 563 | Ga0207645_10010484 | 3300025907 | Bacteria | 6361 |
| 564 | Ga0207645_10089754 | 3300025907 | Bacteria | 1976 |
| 565 | Ga0207645_10091158 | 3300025907 | Bacteria | 1960 |
| 566 | Ga0207645_10096386 | 3300025907 | Bacteria | 1906 |
| 567 | Ga0207645_10099195 | 3300025907 | Bacteria | 1878 |
| 568 | Ga0207645_10111940 | 3300025907 | Bacteria | 1768 |
| 569 | Ga0207645_10150084 | 3300025907 | Bacteria | 1521 |
| 570 | Ga0207643_10000009 | 3300025908 | Bacteria | 160496 |
| 571 | Ga0207643_10268780 | 3300025908 | Bacteria | 1054 |
| 572 | Ga0207705_10000180 | 3300025909 | Bacteria | 66404 |
| 573 | Ga0207705_10004720 | 3300025909 | Bacteria | 10265 |
| 574 | Ga0207705_10034426 | 3300025909 | Bacteria | 3621 |
| 575 | Ga0207705_10039818 | 3300025909 | Bacteria | 3368 |
| 576 | Ga0207705_10104145 | 3300025909 | Bacteria | 2090 |
| 577 | Ga0207705_10151482 | 3300025909 | Bacteria | 1738 |
| 578 | Ga0207654_10074102 | 3300025911 | Bacteria | 2031 |
| 579 | Ga0207654_10077388 | 3300025911 | Bacteria | 1994 |
| 580 | Ga0207654_10193933 | 3300025911 | Bacteria | 1333 |
| 581 | Ga0207707_10000011 | 3300025912 | Bacteria | 282857 |
| 582 | Ga0207707_10002211 | 3300025912 | Bacteria | 17599 |
| 583 | Ga0207707_10004335 | 3300025912 | Bacteria | 12560 |
| 584 | Ga0207707_10006091 | 3300025912 | Bacteria | 10552 |
| 585 | Ga0207707_10168245 | 3300025912 | Bacteria | 1915 |
| 586 | Ga0207707_10537382 | 3300025912 | Bacteria | 994 |
| 587 | Ga0207695_10000018 | 3300025913 | Bacteria | 766611 |
| 588 | Ga0207695_10001032 | 3300025913 | Bacteria | 48974 |
| 589 | Ga0207695_10029506 | 3300025913 | Bacteria | 6057 |
| 590 | Ga0207695_10047727 | 3300025913 | Bacteria | 4528 |
| 591 | Ga0207695_10063576 | 3300025913 | Bacteria | 3804 |
| 592 | Ga0207695_10163030 | 3300025913 | Bacteria | 2159 |
| 593 | Ga0207695_10215806 | 3300025913 | Bacteria | 1827 |
| 594 | Ga0207695_10323348 | 3300025913 | Bacteria | 1432 |
| 595 | Ga0207671_10016535 | 3300025914 | Bacteria | 5730 |
| 596 | Ga0207671_10144760 | 3300025914 | Bacteria | 1833 |
| 597 | Ga0207671_10200053 | 3300025914 | Bacteria | 1560 |
| 598 | Ga0207671_10248016 | 3300025914 | Bacteria | 1400 |
| 599 | Ga0207693_10001210 | 3300025915 | Bacteria | 23009 |
| 600 | Ga0207693_10001929 | 3300025915 | Bacteria | 18163 |
| 601 | Ga0207693_10004752 | 3300025915 | Bacteria | 11421 |
| 602 | Ga0207693_10015635 | 3300025915 | Bacteria | 6084 |
| 603 | Ga0207693_10032195 | 3300025915 | Bacteria | 4139 |
| 604 | Ga0207693_10036016 | 3300025915 | Bacteria | 3899 |
| 605 | Ga0207693_10037608 | 3300025915 | Bacteria | 3814 |
| 606 | Ga0207693_10100265 | 3300025915 | Bacteria | 2270 |
| 607 | Ga0207693_10116216 | 3300025915 | Bacteria | 2101 |
| 608 | Ga0207693_10157406 | 3300025915 | Bacteria | 1787 |
| 609 | Ga0207693_10190644 | 3300025915 | Bacteria | 1613 |
| 610 | Ga0207693_10307449 | 3300025915 | Bacteria | 1241 |
| 611 | Ga0207663_10011662 | 3300025916 | Bacteria | 4728 |
| 612 | Ga0207663_10061935 | 3300025916 | Bacteria | 2376 |
| 613 | Ga0207663_10100658 | 3300025916 | Bacteria | 1940 |
| 614 | Ga0207663_10127095 | 3300025916 | Bacteria | 1755 |
| 615 | Ga0207663_10161620 | 3300025916 | Bacteria | 1582 |
| 616 | Ga0207663_10178070 | 3300025916 | Bacteria | 1516 |
| 617 | Ga0207660_10000110 | 3300025917 | Bacteria | 46792 |
| 618 | Ga0207660_10000197 | 3300025917 | Bacteria | 38486 |
| 619 | Ga0207660_10003537 | 3300025917 | Bacteria | 10180 |
| 620 | Ga0207660_10013609 | 3300025917 | Bacteria | 5334 |
| 621 | Ga0207660_10058863 | 3300025917 | Bacteria | 2756 |
| 622 | Ga0207660_10073136 | 3300025917 | Bacteria | 2498 |
| 623 | Ga0207660_10228082 | 3300025917 | Bacteria | 1464 |
| 624 | Ga0207662_10010568 | 3300025918 | Bacteria | 5102 |
| 625 | Ga0207662_10019357 | 3300025918 | Bacteria | 3872 |
| 626 | Ga0207662_10122304 | 3300025918 | Bacteria | 1633 |
| 627 | Ga0207662_10377440 | 3300025918 | Bacteria | 957 |
| 628 | Ga0207657_10000241 | 3300025919 | Bacteria | 57958 |
| 629 | Ga0207657_10028527 | 3300025919 | Bacteria | 5090 |
| 630 | Ga0207657_10043533 | 3300025919 | Bacteria | 3954 |
| 631 | Ga0207657_10058646 | 3300025919 | Bacteria | 3311 |
| 632 | Ga0207657_10262648 | 3300025919 | Bacteria | 1374 |
| 633 | Ga0207649_10000052 | 3300025920 | Bacteria | 106800 |
| 634 | Ga0207649_10000194 | 3300025920 | Bacteria | 50112 |
| 635 | Ga0207649_10057815 | 3300025920 | Bacteria | 2426 |
| 636 | Ga0207652_10001654 | 3300025921 | Bacteria | 19554 |
| 637 | Ga0207652_10004826 | 3300025921 | Bacteria | 10919 |
| 638 | Ga0207652_10007272 | 3300025921 | Bacteria | 8921 |
| 639 | Ga0207652_10063586 | 3300025921 | Bacteria | 3191 |
| 640 | Ga0207652_10071225 | 3300025921 | Bacteria | 3020 |
| 641 | Ga0207652_10093381 | 3300025921 | Bacteria | 2648 |
| 642 | Ga0207652_10117970 | 3300025921 | Bacteria | 2358 |
| 643 | Ga0207652_10122811 | 3300025921 | Bacteria | 2311 |
| 644 | Ga0207652_10190259 | 3300025921 | Bacteria | 1846 |
| 645 | Ga0207652_10204028 | 3300025921 | Bacteria | 1779 |
| 646 | Ga0207652_10349150 | 3300025921 | Bacteria | 1335 |
| 647 | Ga0207652_10453660 | 3300025921 | Bacteria | 1156 |
| 648 | Ga0207681_10001135 | 3300025923 | Bacteria | 17191 |
| 649 | Ga0207681_10161561 | 3300025923 | Bacteria | 1689 |
| 650 | Ga0207681_10340311 | 3300025923 | Bacteria | 1198 |
| 651 | Ga0207694_10000010 | 3300025924 | Bacteria | 439722 |
| 652 | Ga0207694_10008694 | 3300025924 | Bacteria | 7666 |
| 653 | Ga0207694_10031812 | 3300025924 | Bacteria | 4033 |
| 654 | Ga0207694_10066558 | 3300025924 | Bacteria | 2811 |
| 655 | Ga0207694_10203444 | 3300025924 | Bacteria | 1611 |
| 656 | Ga0207694_10257958 | 3300025924 | Bacteria | 1428 |
| 657 | Ga0207650_10002693 | 3300025925 | Bacteria | 12270 |
| 658 | Ga0207650_10141681 | 3300025925 | Bacteria | 1891 |
| 659 | Ga0207650_10569902 | 3300025925 | Bacteria | 950 |
| 660 | Ga0207659_10002396 | 3300025926 | Bacteria | 11152 |
| 661 | Ga0207659_10012855 | 3300025926 | Bacteria | 5345 |
| 662 | Ga0207659_10188772 | 3300025926 | Bacteria | 1639 |
| 663 | Ga0207687_10008117 | 3300025927 | Bacteria | 6871 |
| 664 | Ga0207687_10019725 | 3300025927 | Bacteria | 4469 |
| 665 | Ga0207687_10025014 | 3300025927 | Bacteria | 3994 |
| 666 | Ga0207687_10033978 | 3300025927 | Bacteria | 3461 |
| 667 | Ga0207687_10128166 | 3300025927 | Bacteria | 1908 |
| 668 | Ga0207687_10401890 | 3300025927 | Bacteria | 1127 |
| 669 | Ga0207687_10461060 | 3300025927 | Bacteria | 1055 |
| 670 | Ga0207700_10000295 | 3300025928 | Bacteria | 29631 |
| 671 | Ga0207700_10090974 | 3300025928 | Bacteria | 2409 |
| 672 | Ga0207700_10118748 | 3300025928 | Bacteria | 2140 |
| 673 | Ga0207700_10124100 | 3300025928 | Bacteria | 2098 |
| 674 | Ga0207700_10227054 | 3300025928 | Bacteria | 1585 |
| 675 | Ga0207700_10533990 | 3300025928 | Bacteria | 1040 |
| 676 | Ga0207664_10028891 | 3300025929 | Bacteria | 4219 |
| 677 | Ga0207664_10035779 | 3300025929 | Bacteria | 3834 |
| 678 | Ga0207664_10071514 | 3300025929 | Bacteria | 2795 |
| 679 | Ga0207664_10151608 | 3300025929 | Bacteria | 1970 |
| 680 | Ga0207664_10235849 | 3300025929 | Bacteria | 1592 |
| 681 | Ga0207664_10244868 | 3300025929 | Bacteria | 1562 |
| 682 | Ga0207664_10307466 | 3300025929 | Bacteria | 1396 |
| 683 | Ga0207664_10437790 | 3300025929 | Bacteria | 1166 |
| 684 | Ga0207664_10490126 | 3300025929 | Bacteria | 1100 |
| 685 | Ga0207664_10595171 | 3300025929 | Bacteria | 993 |
| 686 | Ga0207644_10000212 | 3300025931 | Bacteria | 40175 |
| 687 | Ga0207644_10181448 | 3300025931 | Bacteria | 1650 |
| 688 | Ga0207690_10001288 | 3300025932 | Bacteria | 15841 |
| 689 | Ga0207706_10016311 | 3300025933 | Bacteria | 6707 |
| 690 | Ga0207706_10040241 | 3300025933 | Bacteria | 4142 |
| 691 | Ga0207706_10054725 | 3300025933 | Bacteria | 3521 |
| 692 | Ga0207706_10288771 | 3300025933 | Bacteria | 1430 |
| 693 | Ga0207686_10002314 | 3300025934 | Bacteria | 10431 |
| 694 | Ga0207686_10202258 | 3300025934 | Bacteria | 1423 |
| 695 | Ga0207709_10000530 | 3300025935 | Bacteria | 33097 |
| 696 | Ga0207709_10022766 | 3300025935 | Bacteria | 3557 |
| 697 | Ga0207709_10083247 | 3300025935 | Bacteria | 2068 |
| 698 | Ga0207709_10096959 | 3300025935 | Bacteria | 1941 |
| 699 | Ga0207670_10015207 | 3300025936 | Bacteria | 4592 |
| 700 | Ga0207670_10044307 | 3300025936 | Bacteria | 2943 |
| 701 | Ga0207669_10000235 | 3300025937 | Bacteria | 25138 |
| 702 | Ga0207669_10151320 | 3300025937 | Bacteria | 1626 |
| 703 | Ga0207669_10294524 | 3300025937 | Bacteria | 1230 |
| 704 | Ga0207704_10000198 | 3300025938 | Bacteria | 31182 |
| 705 | Ga0207704_10019711 | 3300025938 | Bacteria | 3549 |
| 706 | Ga0207704_10195247 | 3300025938 | Bacteria | 1476 |
| 707 | Ga0207665_10020388 | 3300025939 | Bacteria | 4356 |
| 708 | Ga0207665_10141171 | 3300025939 | Bacteria | 1718 |
| 709 | Ga0207691_10013970 | 3300025940 | Bacteria | 7661 |
| 710 | Ga0207691_10028811 | 3300025940 | Bacteria | 5196 |
| 711 | Ga0207691_10364602 | 3300025940 | Bacteria | 1235 |
| 712 | Ga0207711_10000002 | 3300025941 | Bacteria | 1228676 |
| 713 | Ga0207711_10180040 | 3300025941 | Bacteria | 1922 |
| 714 | Ga0207689_10000031 | 3300025942 | Bacteria | 97131 |
| 715 | Ga0207689_10071871 | 3300025942 | Bacteria | 2842 |
| 716 | Ga0207689_10088891 | 3300025942 | Bacteria | 2538 |
| 717 | Ga0207689_10261105 | 3300025942 | Bacteria | 1433 |
| 718 | Ga0207661_10003727 | 3300025944 | Bacteria | 10622 |
| 719 | Ga0207661_10065582 | 3300025944 | Bacteria | 2948 |
| 720 | Ga0207661_10089596 | 3300025944 | Bacteria | 2560 |
| 721 | Ga0207661_10186929 | 3300025944 | Bacteria | 1814 |
| 722 | Ga0207661_10457124 | 3300025944 | Bacteria | 1163 |
| 723 | Ga0207661_10476054 | 3300025944 | Bacteria | 1139 |
| 724 | Ga0207679_10000183 | 3300025945 | Bacteria | 51645 |
| 725 | Ga0207679_10100904 | 3300025945 | Bacteria | 2257 |
| 726 | Ga0207667_10000388 | 3300025949 | Bacteria | 59263 |
| 727 | Ga0207667_10004001 | 3300025949 | Bacteria | 18104 |
| 728 | Ga0207667_10006198 | 3300025949 | Bacteria | 14519 |
| 729 | Ga0207667_10013025 | 3300025949 | Bacteria | 9546 |
| 730 | Ga0207667_10024994 | 3300025949 | Bacteria | 6548 |
| 731 | Ga0207667_10027381 | 3300025949 | Bacteria | 6205 |
| 732 | Ga0207667_10030652 | 3300025949 | Bacteria | 5815 |
| 733 | Ga0207667_10250942 | 3300025949 | Bacteria | 1810 |
| 734 | Ga0207667_10339043 | 3300025949 | Bacteria | 1534 |
| 735 | Ga0207667_10964608 | 3300025949 | Bacteria | 841 |
| 736 | Ga0207651_10000051 | 3300025960 | Bacteria | 54163 |
| 737 | Ga0207651_10690770 | 3300025960 | Bacteria | 898 |
| 738 | Ga0207712_10001703 | 3300025961 | Bacteria | 14771 |
| 739 | Ga0207712_10494081 | 3300025961 | Bacteria | 1045 |
| 740 | Ga0207668_10001674 | 3300025972 | Bacteria | 12959 |
| 741 | Ga0207668_10361289 | 3300025972 | Bacteria | 1217 |
| 742 | Ga0207640_10000343 | 3300025981 | Bacteria | 30767 |
| 743 | Ga0207640_10024133 | 3300025981 | Bacteria | 3664 |
| 744 | Ga0207640_10515244 | 3300025981 | Bacteria | 999 |
| 745 | Ga0207658_10066787 | 3300025986 | Bacteria | 2706 |
| 746 | Ga0207658_10154989 | 3300025986 | Bacteria | 1871 |
| 747 | Ga0207658_10157925 | 3300025986 | Bacteria | 1855 |
| 748 | Ga0207658_10341525 | 3300025986 | Bacteria | 1301 |
| 749 | Ga0207658_10561565 | 3300025986 | Bacteria | 1022 |
| 750 | Ga0207677_10081022 | 3300026023 | Bacteria | 2328 |
| 751 | Ga0207677_10278125 | 3300026023 | Bacteria | 1373 |
| 752 | Ga0207677_10728325 | 3300026023 | Bacteria | 882 |
| 753 | Ga0207703_10010733 | 3300026035 | Bacteria | 7151 |
| 754 | Ga0207703_10044546 | 3300026035 | Bacteria | 3567 |
| 755 | Ga0207703_10172911 | 3300026035 | Bacteria | 1901 |
| 756 | Ga0207703_10175184 | 3300026035 | Bacteria | 1889 |
| 757 | Ga0207703_10332748 | 3300026035 | Bacteria | 1393 |
| 758 | Ga0207639_10000867 | 3300026041 | Bacteria | 20545 |
| 759 | Ga0207639_10003883 | 3300026041 | Bacteria | 10074 |
| 760 | Ga0207639_10010763 | 3300026041 | Bacteria | 6339 |
| 761 | Ga0207639_10033916 | 3300026041 | Bacteria | 3769 |
| 762 | Ga0207639_10227024 | 3300026041 | Bacteria | 1616 |
| 763 | Ga0207678_10024280 | 3300026067 | Bacteria | 5295 |
| 764 | Ga0207678_10043860 | 3300026067 | Bacteria | 3869 |
| 765 | Ga0207678_10100765 | 3300026067 | Bacteria | 2467 |
| 766 | Ga0207678_10142928 | 3300026067 | Bacteria | 2042 |
| 767 | Ga0207678_10368921 | 3300026067 | Bacteria | 1240 |
| 768 | Ga0207708_10014839 | 3300026075 | Bacteria | 5830 |
| 769 | Ga0207708_10102376 | 3300026075 | Bacteria | 2217 |
| 770 | Ga0207708_10397909 | 3300026075 | Bacteria | 1138 |
| 771 | Ga0207702_10000005 | 3300026078 | Bacteria | 420296 |
| 772 | Ga0207702_10000315 | 3300026078 | Bacteria | 55383 |
| 773 | Ga0207702_10004643 | 3300026078 | Bacteria | 12151 |
| 774 | Ga0207702_10009824 | 3300026078 | Bacteria | 8022 |
| 775 | Ga0207702_10048646 | 3300026078 | Bacteria | 3576 |
| 776 | Ga0207702_10229342 | 3300026078 | Bacteria | 1735 |
| 777 | Ga0207702_10350900 | 3300026078 | Bacteria | 1412 |
| 778 | Ga0207641_10001831 | 3300026088 | Bacteria | 20447 |
| 779 | Ga0207641_10062870 | 3300026088 | Bacteria | 3169 |
| 780 | Ga0207648_10025743 | 3300026089 | Bacteria | 5237 |
| 781 | Ga0207648_10154550 | 3300026089 | Bacteria | 2025 |
| 782 | Ga0207648_10221620 | 3300026089 | Bacteria | 1681 |
| 783 | Ga0207648_10706873 | 3300026089 | Bacteria | 934 |
| 784 | Ga0207676_10000124 | 3300026095 | Bacteria | 67747 |
| 785 | Ga0207676_10217418 | 3300026095 | Bacteria | 1699 |
| 786 | Ga0207676_10634474 | 3300026095 | Bacteria | 1029 |
| 787 | Ga0207674_10001605 | 3300026116 | Bacteria | 29115 |
| 788 | Ga0207674_10016004 | 3300026116 | Bacteria | 8216 |
| 789 | Ga0207674_10145542 | 3300026116 | Bacteria | 2328 |
| 790 | Ga0207674_10363573 | 3300026116 | Bacteria | 1399 |
| 791 | Ga0207674_10588472 | 3300026116 | Bacteria | 1075 |
| 792 | Ga0207674_10821416 | 3300026116 | Bacteria | 897 |
| 793 | Ga0207675_100029702 | 3300026118 | Bacteria | 5090 |
| 794 | Ga0207675_100440578 | 3300026118 | Bacteria | 1289 |
| 795 | Ga0207675_100811797 | 3300026118 | Bacteria | 949 |
| 796 | Ga0207683_10000242 | 3300026121 | Bacteria | 48576 |
| 797 | Ga0207683_10001846 | 3300026121 | Bacteria | 18729 |
| 798 | Ga0207683_10079317 | 3300026121 | Bacteria | 2911 |
| 799 | Ga0207683_10081510 | 3300026121 | Bacteria | 2872 |
| 800 | Ga0207683_10213762 | 3300026121 | Bacteria | 1756 |
| 801 | Ga0207683_10233042 | 3300026121 | Bacteria | 1679 |
| 802 | Ga0207683_10533217 | 3300026121 | Bacteria | 1085 |
| 803 | Ga0207698_10010960 | 3300026142 | Bacteria | 5857 |
| 804 | Ga0207698_10036626 | 3300026142 | Bacteria | 3604 |
| 805 | Ga0207698_10040510 | 3300026142 | Bacteria | 3463 |
| 806 | Ga0207698_10072790 | 3300026142 | Bacteria | 2733 |
| 807 | Ga0207698_10391941 | 3300026142 | Bacteria | 1324 |
| 808 | Ga0209982_1002370 | 3300027552 | Bacteria | 2649 |
| 809 | Ga0210002_1001035 | 3300027617 | Bacteria | 3838 |
| 810 | Ga0209966_1008822 | 3300027695 | Bacteria | 1793 |
| 811 | Ga0209998_10010491 | 3300027717 | Bacteria | 1918 |
| 812 | Ga0209813_10002687 | 3300027866 | Bacteria | 4096 |
| 813 | Ga0209813_10009253 | 3300027866 | Bacteria | 2514 |
| 814 | Ga0209813_10017408 | 3300027866 | Bacteria | 1973 |
| 815 | Ga0207428_10000037 | 3300027907 | Bacteria | 218857 |
| 816 | Ga0207428_10002442 | 3300027907 | Bacteria | 18563 |
| 817 | Ga0207428_10013074 | 3300027907 | Bacteria | 7269 |
| 818 | Ga0268266_10000557 | 3300028379 | Bacteria | 51935 |
| 819 | Ga0268266_10813652 | 3300028379 | Bacteria | 902 |
| 820 | Ga0268265_10016165 | 3300028380 | Bacteria | 5122 |
| 821 | Ga0268265_10050585 | 3300028380 | Bacteria | 3131 |
| 822 | Ga0268265_10162265 | 3300028380 | Bacteria | 1900 |
| 823 | Ga0268265_10214183 | 3300028380 | Bacteria | 1681 |
| 824 | Ga0268264_10003234 | 3300028381 | Bacteria | 14103 |
| 825 | Ga0268264_10140651 | 3300028381 | Bacteria | 2152 |
| 826 | Ga0268264_10391464 | 3300028381 | Bacteria | 1333 |
| 827 | Ga0268264_10562834 | 3300028381 | Bacteria | 1119 |
| 828 | Ga0265337_1019347 | 3300028556 | Bacteria | 2147 |
| 829 | Ga0265326_10002138 | 3300028558 | Bacteria | 6717 |
| 830 | Ga0265319_1001825 | 3300028563 | Bacteria | 12143 |
| 831 | Ga0265334_10000469 | 3300028573 | Bacteria | 20809 |
| 832 | Ga0265334_10001106 | 3300028573 | Bacteria | 13201 |
| 833 | Ga0265334_10016312 | 3300028573 | Bacteria | 3074 |
| 834 | Ga0265334_10065129 | 3300028573 | Bacteria | 1367 |
| 835 | Ga0265318_10000037 | 3300028577 | Bacteria | 138223 |
| 836 | Ga0265318_10001354 | 3300028577 | Bacteria | 14601 |
| 837 | Ga0265318_10004765 | 3300028577 | Bacteria | 6501 |
| 838 | Ga0265323_10001237 | 3300028653 | Bacteria | 12839 |
| 839 | Ga0265322_10008354 | 3300028654 | Bacteria | 3017 |
| 840 | Ga0265336_10000535 | 3300028666 | Bacteria | 21804 |
| 841 | Ga0307515_10040807 | 3300028794 | Bacteria | 7326 |
| 842 | Ga0265338_10000017 | 3300028800 | Bacteria | 344481 |
| 843 | Ga0265338_10000131 | 3300028800 | Bacteria | 137627 |
| 844 | Ga0265338_10005387 | 3300028800 | Bacteria | 16717 |
| 845 | Ga0265338_10023435 | 3300028800 | Bacteria | 6346 |
| 846 | Ga0265338_10023604 | 3300028800 | Bacteria | 6316 |
| 847 | Ga0265338_10033513 | 3300028800 | Bacteria | 4981 |
| 848 | Ga0265338_10065293 | 3300028800 | Bacteria | 3158 |
| 849 | Ga0265338_10098917 | 3300028800 | Bacteria | 2385 |
| 850 | Ga0265338_10149487 | 3300028800 | Bacteria | 1816 |
| 851 | Ga0265338_10153758 | 3300028800 | Bacteria | 1784 |
| 852 | Ga0265338_10211121 | 3300028800 | Bacteria | 1457 |
| 853 | Ga0265338_10314147 | 3300028800 | Bacteria | 1136 |
| 854 | Ga0265338_10419399 | 3300028800 | Bacteria | 951 |
| 855 | Ga0265338_10455780 | 3300028800 | Bacteria | 905 |
| 856 | Ga0265324_10001269 | 3300029957 | Bacteria | 14862 |
| 857 | Ga0265762_1007126 | 3300030760 | Bacteria | 1996 |
| 858 | Ga0265763_1000228 | 3300030763 | Bacteria | 3100 |
| 859 | Ga0265330_10013605 | 3300031235 | Bacteria | 3790 |
| 860 | Ga0265330_10028450 | 3300031235 | Bacteria | 2519 |
| 861 | Ga0265330_10033745 | 3300031235 | Bacteria | 2287 |
| 862 | Ga0265330_10081849 | 3300031235 | Bacteria | 1390 |
| 863 | Ga0265330_10085850 | 3300031235 | Bacteria | 1353 |
| 864 | Ga0265330_10129990 | 3300031235 | Bacteria | 1072 |
| 865 | Ga0265332_10003525 | 3300031238 | Bacteria | 7524 |
| 866 | Ga0265332_10011436 | 3300031238 | Bacteria | 3947 |
| 867 | Ga0265332_10038320 | 3300031238 | Bacteria | 2077 |
| 868 | Ga0265332_10080505 | 3300031238 | Bacteria | 1382 |
| 869 | Ga0265320_10002069 | 3300031240 | Bacteria | 14126 |
| 870 | Ga0265320_10016123 | 3300031240 | Bacteria | 4197 |
| 871 | Ga0265325_10000014 | 3300031241 | Bacteria | 131579 |
| 872 | Ga0265325_10000449 | 3300031241 | Bacteria | 29667 |
| 873 | Ga0265325_10000820 | 3300031241 | Bacteria | 22557 |
| 874 | Ga0265325_10001071 | 3300031241 | Bacteria | 19727 |
| 875 | Ga0265325_10001732 | 3300031241 | Bacteria | 15146 |
| 876 | Ga0265325_10001769 | 3300031241 | Bacteria | 14972 |
| 877 | Ga0265325_10012680 | 3300031241 | Bacteria | 4814 |
| 878 | Ga0265325_10031434 | 3300031241 | Bacteria | 2841 |
| 879 | Ga0265325_10034463 | 3300031241 | Bacteria | 2692 |
| 880 | Ga0265325_10042427 | 3300031241 | Bacteria | 2378 |
| 881 | Ga0265325_10064283 | 3300031241 | Bacteria | 1855 |
| 882 | Ga0265325_10066787 | 3300031241 | Bacteria | 1813 |
| 883 | Ga0265329_10034806 | 3300031242 | Bacteria | 1626 |
| 884 | Ga0265329_10039168 | 3300031242 | Bacteria | 1524 |
| 885 | Ga0265340_10002810 | 3300031247 | Bacteria | 9907 |
| 886 | Ga0265340_10003857 | 3300031247 | Bacteria | 8447 |
| 887 | Ga0265340_10008522 | 3300031247 | Bacteria | 5533 |
| 888 | Ga0265340_10025043 | 3300031247 | Bacteria | 3025 |
| 889 | Ga0265340_10042895 | 3300031247 | Bacteria | 2219 |
| 890 | Ga0265340_10056838 | 3300031247 | Bacteria | 1882 |
| 891 | Ga0265340_10063149 | 3300031247 | Bacteria | 1768 |
| 892 | Ga0265340_10074553 | 3300031247 | Bacteria | 1604 |
| 893 | Ga0265340_10163807 | 3300031247 | Bacteria | 1009 |
| 894 | Ga0265340_10217733 | 3300031247 | Bacteria | 856 |
| 895 | Ga0265340_10251950 | 3300031247 | Bacteria | 787 |
| 896 | Ga0265339_10000053 | 3300031249 | Bacteria | 101277 |
| 897 | Ga0265339_10000256 | 3300031249 | Bacteria | 42839 |
| 898 | Ga0265339_10003063 | 3300031249 | Bacteria | 11761 |
| 899 | Ga0265339_10005687 | 3300031249 | Bacteria | 8275 |
| 900 | Ga0265339_10006973 | 3300031249 | Bacteria | 7344 |
| 901 | Ga0265339_10009282 | 3300031249 | Bacteria | 6196 |
| 902 | Ga0265339_10020355 | 3300031249 | Bacteria | 3877 |
| 903 | Ga0265339_10051695 | 3300031249 | Bacteria | 2241 |
| 904 | Ga0265339_10078048 | 3300031249 | Bacteria | 1754 |
| 905 | Ga0265339_10108339 | 3300031249 | Bacteria | 1440 |
| 906 | Ga0265331_10014841 | 3300031250 | Bacteria | 4132 |
| 907 | Ga0265331_10019323 | 3300031250 | Bacteria | 3519 |
| 908 | Ga0265331_10039963 | 3300031250 | Bacteria | 2284 |
| 909 | Ga0265331_10065184 | 3300031250 | Bacteria | 1713 |
| 910 | Ga0265331_10227999 | 3300031250 | Bacteria | 837 |
| 911 | Ga0265327_10001297 | 3300031251 | Bacteria | 32731 |
| 912 | Ga0265316_10050012 | 3300031344 | Bacteria | 3290 |
| 913 | Ga0265316_10088313 | 3300031344 | Bacteria | 2367 |
| 914 | Ga0265316_10104722 | 3300031344 | Bacteria | 2147 |
| 915 | Ga0265316_10108470 | 3300031344 | Bacteria | 2104 |
| 916 | Ga0265316_10183202 | 3300031344 | Bacteria | 1558 |
| 917 | Ga0265316_10241243 | 3300031344 | Bacteria | 1329 |
| 918 | Ga0265316_10280165 | 3300031344 | Bacteria | 1218 |
| 919 | Ga0265316_10302428 | 3300031344 | Bacteria | 1165 |
| 920 | Ga0265316_10303173 | 3300031344 | Bacteria | 1163 |
| 921 | Ga0265316_10345735 | 3300031344 | Bacteria | 1077 |
| 922 | Ga0265316_10616217 | 3300031344 | Bacteria | 769 |
| 923 | Ga0265313_10000098 | 3300031595 | Bacteria | 89130 |
| 924 | Ga0265313_10001315 | 3300031595 | Bacteria | 23436 |
| 925 | Ga0265313_10001884 | 3300031595 | Bacteria | 19075 |
| 926 | Ga0265313_10006263 | 3300031595 | Bacteria | 8479 |
| 927 | Ga0265313_10008423 | 3300031595 | Bacteria | 6847 |
| 928 | Ga0265313_10012279 | 3300031595 | Bacteria | 5242 |
| 929 | Ga0265313_10015578 | 3300031595 | Bacteria | 4416 |
| 930 | Ga0265313_10047949 | 3300031595 | Bacteria | 2064 |
| 931 | Ga0265313_10054715 | 3300031595 | Bacteria | 1894 |
| 932 | Ga0265313_10060934 | 3300031595 | Bacteria | 1768 |
| 933 | Ga0265313_10061872 | 3300031595 | Bacteria | 1750 |
| 934 | Ga0265313_10071098 | 3300031595 | Bacteria | 1602 |
| 935 | Ga0265313_10079819 | 3300031595 | Bacteria | 1489 |
| 936 | Ga0265313_10133140 | 3300031595 | Bacteria | 1075 |
| 937 | Ga0265314_10004347 | 3300031711 | Bacteria | 13204 |
| 938 | Ga0265314_10004460 | 3300031711 | Bacteria | 12990 |
| 939 | Ga0265314_10009081 | 3300031711 | Bacteria | 8445 |
| 940 | Ga0265314_10011365 | 3300031711 | Bacteria | 7357 |
| 941 | Ga0265314_10012121 | 3300031711 | Bacteria | 7061 |
| 942 | Ga0265314_10021119 | 3300031711 | Bacteria | 5015 |
| 943 | Ga0265314_10027636 | 3300031711 | Bacteria | 4246 |
| 944 | Ga0265314_10031643 | 3300031711 | Bacteria | 3902 |
| 945 | Ga0265314_10033470 | 3300031711 | Bacteria | 3768 |
| 946 | Ga0265314_10037529 | 3300031711 | Bacteria | 3510 |
| 947 | Ga0265314_10038656 | 3300031711 | Bacteria | 3444 |
| 948 | Ga0265314_10056950 | 3300031711 | Bacteria | 2688 |
| 949 | Ga0265314_10094782 | 3300031711 | Bacteria | 1934 |
| 950 | Ga0265314_10128118 | 3300031711 | Bacteria | 1587 |
| 951 | Ga0265314_10191417 | 3300031711 | Bacteria | 1217 |
| 952 | Ga0265314_10207814 | 3300031711 | Bacteria | 1152 |
| 953 | Ga0265314_10272117 | 3300031711 | Bacteria | 962 |
| 954 | Ga0265342_10000448 | 3300031712 | Bacteria | 44982 |
| 955 | Ga0265342_10000677 | 3300031712 | Bacteria | 35579 |
| 956 | Ga0265342_10008087 | 3300031712 | Bacteria | 7602 |
| 957 | Ga0265342_10025101 | 3300031712 | Bacteria | 3752 |
| 958 | Ga0265342_10031129 | 3300031712 | Bacteria | 3301 |
| 959 | Ga0265342_10059470 | 3300031712 | Bacteria | 2257 |
| 960 | Ga0265342_10227272 | 3300031712 | Bacteria | 1003 |
| 961 | Ga0265342_10287707 | 3300031712 | Bacteria | 868 |
| 962 | Ga0307516_10038268 | 3300031730 | Bacteria | 4788 |
| 963 | Ga0307516_10231301 | 3300031730 | Bacteria | 1552 |
| 964 | Ga0307516_10264719 | 3300031730 | Bacteria | 1408 |
| 965 | Ga0307410_10512358 | 3300031852 | Bacteria | 989 |
| 966 | Ga0307412_10394045 | 3300031911 | Bacteria | 1125 |
| 967 | Ga0307409_100145672 | 3300031995 | Bacteria | 2048 |
| 968 | Ga0307416_100674159 | 3300032002 | Bacteria | 1121 |
| 969 | Ga0307415_100224377 | 3300032126 | Bacteria | 1509 |
| 970 | Ga0373930_0003008 | 3300034816 | Bacteria | 2651 |
| 971 | Ga0373948_0002824 | 3300034817 | Bacteria | 2607 |
| 972 | Ga0373950_0005337 | 3300034818 | Bacteria | 1917 |
| 973 | Ga0373950_0007127 | 3300034818 | Bacteria | 1727 |
| 974 | Ga0373950_0017039 | 3300034818 | Bacteria | 1248 |
| 975 | Ga0373958_0001566 | 3300034819 | Bacteria | 3095 |
| 976 | Ga0373958_0002620 | 3300034819 | Bacteria | 2538 |
| 977 | Ga0373959_0003005 | 3300034820 | Bacteria | 2682 |
| 978 | Ga0373938_0000343 | 3300034957 | Bacteria | 7374 |
| 979 | Ga0373938_0001532 | 3300034957 | Bacteria | 3712 |
| 980 | Ga0373926_0008207 | 3300035083 | Bacteria | 3475 |
| 981 | Ga0373928_0001369 | 3300035084 | Bacteria | 4772 |
| 982 | Ga0373934_0052439 | 3300035086 | Bacteria | 1617 |
| 983 | Ga0373934_0119053 | 3300035086 | Bacteria | 1074 |
| 984 | Ga0373934_0208429 | 3300035086 | Bacteria | 805 |
| 985 | Ga0373940_0003702 | 3300035088 | Bacteria | 3150 |
| 986 | Ga0373940_0021279 | 3300035088 | Bacteria | 1656 |
| 987 | Ga0373940_0054129 | 3300035088 | Bacteria | 1134 |
| 988 | Ga0373940_0087214 | 3300035088 | Bacteria | 930 |
| 989 | Ga0373944_0002736 | 3300035089 | Bacteria | 4504 |
| 990 | Ga0373949_0001707 | 3300035090 | Bacteria | 6092 |
| 991 | Ga0373949_0003940 | 3300035090 | Bacteria | 3447 |
| 992 | Ga0373952_0001963 | 3300035092 | Bacteria | 3719 |
| 993 | Ga0373923_0065885 | 3300035111 | Bacteria | 1547 |
| 994 | Ga0373932_0004128 | 3300035112 | Bacteria | 3451 |
| 995 | Ga0373932_0006364 | 3300035112 | Bacteria | 2791 |
| 996 | Ga0373932_0007842 | 3300035112 | Bacteria | 2547 |
| 997 | Ga0373932_0030106 | 3300035112 | Bacteria | 1502 |
| 998 | Ga0373936_0021903 | 3300035113 | Bacteria | 2487 |
| 999 | Ga0373936_0078578 | 3300035113 | Bacteria | 1370 |
| 1000 | Ga0373939_0001965 | 3300035114 | Bacteria | 4916 |
| 1001 | Ga0373939_0021734 | 3300035114 | Bacteria | 1760 |
| 1002 | Ga0373941_0003378 | 3300035115 | Bacteria | 3612 |
| 1003 | Ga0373945_0008514 | 3300035116 | Bacteria | 3344 |
| 1004 | Ga0373945_0034692 | 3300035116 | Bacteria | 1799 |
| 1005 | Ga0373953_0001370 | 3300035117 | Bacteria | 7005 |
| 1006 | Ga0373953_0019434 | 3300035117 | Bacteria | 2527 |
| 1007 | Ga0373953_0038626 | 3300035117 | Bacteria | 1889 |
| 1008 | Ga0373954_0001371 | 3300035118 | Bacteria | 9830 |
| 1009 | Ga0373954_0014718 | 3300035118 | Bacteria | 3490 |
| 1010 | Ga0373954_0020580 | 3300035118 | Bacteria | 2986 |
| 1011 | Ga0373956_0013664 | 3300035119 | Bacteria | 3379 |
| 1012 | Ga0373956_0041543 | 3300035119 | Bacteria | 2042 |
| 1013 | Ga0373957_0008557 | 3300035120 | Bacteria | 3320 |
| 1014 | Ga0373957_0018776 | 3300035120 | Bacteria | 2425 |
| 1015 | Ga0373957_0088922 | 3300035120 | Bacteria | 1226 |
| 1016 | Ga0373960_0049044 | 3300035121 | Bacteria | 1247 |
| 1017 | Ga0373943_0000918 | 3300035170 | Bacteria | 12966 |
| 1018 | Ga0373943_0006231 | 3300035170 | Bacteria | 5358 |
| 1019 | Ga0373943_0011453 | 3300035170 | Bacteria | 3990 |
| 1020 | Ga0373943_0024465 | 3300035170 | Bacteria | 2815 |
| 1021 | Ga0373943_0092935 | 3300035170 | Bacteria | 1565 |
| 1022 | Ga0373946_0004396 | 3300035171 | Bacteria | 5047 |
| 1023 | Ga0373946_0016833 | 3300035171 | Bacteria | 2790 |
| 1024 | Ga0373946_0056677 | 3300035171 | Bacteria | 1655 |
| 1025 | Ga0373955_0001179 | 3300035172 | Bacteria | 11123 |
| 1026 | Ga0373955_0017677 | 3300035172 | Bacteria | 3533 |
| 1027 | Ga0373955_0032229 | 3300035172 | Bacteria | 2750 |
| 1028 | Ga0373955_0094771 | 3300035172 | Bacteria | 1706 |
| 1029 | Ga0373955_0135259 | 3300035172 | Bacteria | 1441 |
| 1030 | Ga0373942_0001142 | 3300035207 | Bacteria | 7047 |
| 1031 | Ga0373961_0017751 | 3300035241 | Bacteria | 1850 |
| 1032 | Ga0373961_0019036 | 3300035241 | Bacteria | 1799 |
| 1033 | Ga0373962_0001106 | 3300035242 | Bacteria | 6274 |
| 1034 | Ga0316574_0388472 | 3300035398 | Bacteria | 880 |
| 1035 | Ga0373924_0014977 | 3300035410 | Bacteria | 2938 |
| 1036 | Ga0373924_0093130 | 3300035410 | Bacteria | 1290 |
| 1037 | Ga0373931_0000305 | 3300035691 | Bacteria | 20657 |
| 1038 | Ga0373931_0020150 | 3300035691 | Bacteria | 3334 |
| 1039 | Ga0373931_0033067 | 3300035691 | Bacteria | 2678 |
| 1040 | Ga0373931_0217256 | 3300035691 | Bacteria | 1149 |
| 1041 | Ga0373935_0003403 | 3300035692 | Bacteria | 9238 |
| 1042 | Ga0373935_0014201 | 3300035692 | Bacteria | 4806 |
| 1043 | Ga0373935_0021874 | 3300035692 | Bacteria | 3915 |
| 1044 | Ga0373935_0213221 | 3300035692 | Bacteria | 1339 |
| 1045 | Ga0373935_0248291 | 3300035692 | Bacteria | 1244 |
| 1046 | Ga0373927_0017421 | 3300035695 | Bacteria | 4727 |
| 1047 | Ga0373927_0017892 | 3300035695 | Bacteria | 4660 |
| 1048 | Ga0373927_0103791 | 3300035695 | Bacteria | 1850 |
| 1049 | Ga0373927_0252607 | 3300035695 | Bacteria | 1159 |
| 1050 | Ga0373933_0012634 | 3300035724 | Bacteria | 4666 |
| 1051 | Ga0373933_0018034 | 3300035724 | Bacteria | 3965 |
| 1052 | Ga0373933_0030576 | 3300035724 | Bacteria | 3118 |
| 1053 | Ga0373947_0006238 | 3300035725 | Bacteria | 6931 |
| 1054 | Ga0373947_0009172 | 3300035725 | Bacteria | 5687 |
| 1055 | Ga0373947_0062903 | 3300035725 | Bacteria | 2260 |
| 1056 | Ga0373947_0398055 | 3300035725 | Bacteria | 928 |
| 1057 | Ga0373937_0007608 | 3300036401 | Bacteria | 9383 |
| 1058 | Ga0373937_0025062 | 3300036401 | Bacteria | 5384 |
| 1059 | Ga0373937_0039941 | 3300036401 | Bacteria | 4277 |
| 1060 | Ga0373937_0072988 | 3300036401 | Bacteria | 3165 |
| 1061 | Ga0373937_0077479 | 3300036401 | Bacteria | 3072 |
| 1062 | Ga0373937_0126066 | 3300036401 | Bacteria | 2388 |
| 1063 | Ga0373937_0411316 | 3300036401 | Bacteria | 1283 |
| 1064 | Ga0373937_0422939 | 3300036401 | Bacteria | 1264 |
| 1065 | Ga0373937_0666658 | 3300036401 | Bacteria | 986 |
| 1066 | Ga0373937_0731608 | 3300036401 | Bacteria | 936 |
| 1067 | Ga0373937_0744705 | 3300036401 | Bacteria | 927 |
| 1068 | Ga0316582_0312479 | 3300036647 | Bacteria | 1080 |
| 1069 | Ga0373925_0002514 | 3300037068 | Bacteria | 14651 |
| 1070 | Ga0373925_0011485 | 3300037068 | Bacteria | 6409 |
| 1071 | Ga0373925_0020892 | 3300037068 | Bacteria | 4771 |
| 1072 | Ga0373925_0022203 | 3300037068 | Bacteria | 4627 |
| 1073 | Ga0373925_0051088 | 3300037068 | Bacteria | 3085 |
| 1074 | Ga0373925_0156062 | 3300037068 | Bacteria | 1795 |
| 1075 | Ga0373925_0300431 | 3300037068 | Bacteria | 1296 |
| 1076 | Ga0395899_0032920 | 3300037312 | Bacteria | 3895 |
| 1077 | Ga0395899_0053109 | 3300037312 | Bacteria | 3001 |
| 1078 | Ga0395900_0022401 | 3300037418 | Bacteria | 6461 |
| 1079 | Ga0395900_0104393 | 3300037418 | Bacteria | 2911 |
| 1080 | Ga0395900_0233159 | 3300037418 | Bacteria | 1850 |
| 1081 | Ga0395900_0298709 | 3300037418 | Bacteria | 1597 |
| 1082 | Ga0395900_0419468 | 3300037418 | Bacteria | 1299 |
| 1083 | Ga0395900_0607650 | 3300037418 | Bacteria | 1033 |
| 1084 | Ga0395898_0021752 | 3300037466 | Bacteria | 6499 |
| 1085 | Ga0395898_0021940 | 3300037466 | Bacteria | 6467 |
| 1086 | Ga0395898_0047384 | 3300037466 | Bacteria | 4218 |
| 1087 | Ga0395898_0139246 | 3300037466 | Bacteria | 2323 |
| 1088 | Ga0395898_0222431 | 3300037466 | Bacteria | 1800 |
| 1089 | Ga0436364_0333324 | 3300037853 | Bacteria | 10396 |
| 1090 | Ga0395901_0015561 | 3300038443 | Bacteria | 7748 |
| 1091 | Ga0395901_0057654 | 3300038443 | Bacteria | 4039 |
| 1092 | Ga0395901_0105438 | 3300038443 | Bacteria | 2958 |
| 1093 | Ga0395901_0196440 | 3300038443 | Bacteria | 2115 |
| 1094 | Ga0395901_0425885 | 3300038443 | Bacteria | 1360 |
| 1095 | Ga0395901_0454020 | 3300038443 | Bacteria | 1310 |
| 1096 | Ga0395901_0829599 | 3300038443 | Bacteria | 911 |
| 1097 | Ga0400483_117124 | 3300039062 | Bacteria | 6760 |
| 1098 | Ga0436365_0032540 | 3300039437 | Bacteria | 1867 |
| 1099 | Ga0436365_0152711 | 3300039437 | Bacteria | 1231 |
| 1100 | Ga0436365_0680520 | 3300039437 | Bacteria | 2305 |
| 1101 | Ga0436365_1138385 | 3300039437 | Bacteria | 908 |
| 1102 | Ga0436365_1200736 | 3300039437 | Bacteria | 1999 |
| 1103 | Ga0436365_1245822 | 3300039437 | Bacteria | 2312 |
| 1104 | Ga0436365_1505093 | 3300039437 | Bacteria | 2918 |
| 1105 | Ga0436365_1637588 | 3300039437 | Bacteria | 49130 |
| 1106 | Ga0436365_1682615 | 3300039437 | Bacteria | 4267 |
| 1107 | Ga0436365_1870318 | 3300039437 | Bacteria | 5247 |
| 1108 | Ga0436360_0155882 | 3300039438 | Bacteria | 1317 |
| 1109 | Ga0436360_0174767 | 3300039438 | Bacteria | 1232 |
| 1110 | Ga0436360_0842897 | 3300039438 | Bacteria | 1330 |
| 1111 | Ga0436361_0057811 | 3300039447 | Bacteria | 854 |
| 1112 | Ga0436363_0402877 | 3300039450 | Bacteria | 3022 |
| 1113 | Ga0436362_0451203 | 3300039453 | Bacteria | 919 |
| 1114 | Ga0436362_0808711 | 3300039453 | Bacteria | 2134 |
| 1115 | Ga0439453_0002481 | 3300041408 | Bacteria | 2553 |
| 1116 | Ga0439443_002060 | 3300042003 | Bacteria | 2347 |
| 1117 | Ga0450923_011089 | 3300042125 | Bacteria | 1614 |
| 1118 | Ga0439458_0077397 | 3300042157 | Bacteria | 845 |
| 1119 | Ga0439435_0021439 | 3300042436 | Bacteria | 1677 |
| 1120 | Ga0439435_0042295 | 3300042436 | Bacteria | 1279 |
| 1121 | Ga0439440_0012161 | 3300042993 | Bacteria | 1826 |
| 1122 | Ga0466966_0191039 | 3300044684 | Bacteria | 1241 |
| 1123 | Ga0466963_0019290 | 3300044694 | Bacteria | 4274 |
| 1124 | Ga0466957_0014805 | 3300044842 | Bacteria | 4545 |
| 1125 | Ga0466957_0033087 | 3300044842 | Bacteria | 3100 |
| 1126 | Ga0466957_0075585 | 3300044842 | Bacteria | 2090 |
| 1127 | Ga0451576_0024106 | 3300045051 | Bacteria | 6574 |
| 1128 | Ga0451576_0043660 | 3300045051 | Bacteria | 4729 |
| 1129 | Ga0466967_0011664 | 3300045976 | Bacteria | 6675 |
| 1130 | Ga0466967_0031236 | 3300045976 | Bacteria | 4481 |
| 1131 | Ga0495627_065240 | 3300046453 | Bacteria | 1070 |
| 1132 | Ga0495592_0001138 | 3300046454 | Bacteria | 18507 |
| 1133 | Ga0495592_0043997 | 3300046454 | Bacteria | 3338 |
| 1134 | Ga0495592_0123999 | 3300046454 | Bacteria | 1814 |
| 1135 | Ga0495603_0000644 | 3300046455 | Bacteria | 19646 |
| 1136 | Ga0495603_0012514 | 3300046455 | Bacteria | 5137 |
| 1137 | Ga0495603_0013543 | 3300046455 | Bacteria | 4933 |
| 1138 | Ga0495629_0000177 | 3300046459 | Bacteria | 56906 |
| 1139 | Ga0495629_0000317 | 3300046459 | Bacteria | 41238 |
| 1140 | Ga0495629_0029090 | 3300046459 | Bacteria | 3921 |
| 1141 | Ga0495629_0473847 | 3300046459 | Bacteria | 846 |
| 1142 | Ga0495629_0550137 | 3300046459 | Bacteria | 775 |
| 1143 | Ga0495641_0009769 | 3300046461 | Bacteria | 5662 |
| 1144 | Ga0495641_0035126 | 3300046461 | Bacteria | 2366 |
| 1145 | Ga0495641_0129595 | 3300046461 | Bacteria | 1126 |
| 1146 | Ga0495651_0003129 | 3300046462 | Bacteria | 12760 |
| 1147 | Ga0495651_0004850 | 3300046462 | Bacteria | 10291 |
| 1148 | Ga0495653_0000149 | 3300046463 | Bacteria | 58288 |
| 1149 | Ga0495653_0061894 | 3300046463 | Bacteria | 2829 |
| 1150 | Ga0495653_0072344 | 3300046463 | Bacteria | 2574 |
| 1151 | Ga0495653_0275613 | 3300046463 | Bacteria | 1106 |
| 1152 | Ga0495653_0405121 | 3300046463 | Bacteria | 866 |
| 1153 | Ga0495580_0000498 | 3300046472 | Bacteria | 32908 |
| 1154 | Ga0495580_0036721 | 3300046472 | Bacteria | 3517 |
| 1155 | Ga0495580_0046764 | 3300046472 | Bacteria | 3069 |
| 1156 | Ga0495580_0074442 | 3300046472 | Bacteria | 2370 |
| 1157 | Ga0495580_0088638 | 3300046472 | Bacteria | 2154 |
| 1158 | Ga0495582_0000185 | 3300046473 | Bacteria | 34065 |
| 1159 | Ga0495582_0013082 | 3300046473 | Bacteria | 4570 |
| 1160 | Ga0495582_0044051 | 3300046473 | Bacteria | 2458 |
| 1161 | Ga0495582_0170090 | 3300046473 | Bacteria | 1240 |
| 1162 | Ga0495582_0314423 | 3300046473 | Bacteria | 901 |
| 1163 | Ga0495605_0138713 | 3300046474 | Bacteria | 1092 |
| 1164 | Ga0495639_0001788 | 3300046475 | Bacteria | 9521 |
| 1165 | Ga0495639_0009268 | 3300046475 | Bacteria | 4218 |
| 1166 | Ga0495639_0092685 | 3300046475 | Bacteria | 1419 |
| 1167 | Ga0495662_0015062 | 3300046476 | Bacteria | 3757 |
| 1168 | Ga0495662_0069984 | 3300046476 | Bacteria | 1700 |
| 1169 | Ga0495662_0093593 | 3300046476 | Bacteria | 1467 |
| 1170 | Ga0495664_0033507 | 3300046477 | Bacteria | 3018 |
| 1171 | Ga0495664_0076784 | 3300046477 | Bacteria | 1999 |
| 1172 | Ga0495664_0132628 | 3300046477 | Bacteria | 1509 |
| 1173 | Ga0495664_0386270 | 3300046477 | Bacteria | 841 |
| 1174 | Ga0495584_0020723 | 3300046491 | Bacteria | 3339 |
| 1175 | Ga0495584_0063797 | 3300046491 | Bacteria | 1852 |
| 1176 | Ga0495585_0004711 | 3300046492 | Bacteria | 8786 |
| 1177 | Ga0495585_0178166 | 3300046492 | Bacteria | 1094 |
| 1178 | Ga0495594_0000023 | 3300046499 | Bacteria | 70363 |
| 1179 | Ga0495594_0053830 | 3300046499 | Bacteria | 2217 |
| 1180 | Ga0495607_0008511 | 3300046501 | Bacteria | 7013 |
| 1181 | Ga0495607_0193664 | 3300046501 | Bacteria | 1011 |
| 1182 | Ga0495606_0050237 | 3300046507 | Bacteria | 2729 |
| 1183 | Ga0495608_0007771 | 3300046511 | Bacteria | 7551 |
| 1184 | Ga0495608_0016548 | 3300046511 | Bacteria | 5103 |
| 1185 | Ga0495608_0071471 | 3300046511 | Bacteria | 2264 |
| 1186 | Ga0495608_0189523 | 3300046511 | Bacteria | 1299 |
| 1187 | Ga0495610_0046787 | 3300046512 | Bacteria | 2132 |
| 1188 | Ga0495616_0035835 | 3300046513 | Bacteria | 2564 |
| 1189 | Ga0495616_0174155 | 3300046513 | Bacteria | 960 |
| 1190 | Ga0495618_0086295 | 3300046514 | Bacteria | 2007 |
| 1191 | Ga0495618_0086821 | 3300046514 | Bacteria | 2000 |
| 1192 | Ga0495618_0121557 | 3300046514 | Bacteria | 1672 |
| 1193 | Ga0495620_0083704 | 3300046515 | Bacteria | 1287 |
| 1194 | Ga0495628_0005831 | 3300046516 | Bacteria | 10790 |
| 1195 | Ga0495630_0106670 | 3300046517 | Bacteria | 2122 |
| 1196 | Ga0495630_0264712 | 3300046517 | Bacteria | 1313 |
| 1197 | Ga0495630_0301723 | 3300046517 | Bacteria | 1224 |
| 1198 | Ga0495632_0062625 | 3300046519 | Bacteria | 1803 |
| 1199 | Ga0495643_0086414 | 3300046522 | Bacteria | 1624 |
| 1200 | Ga0495644_0000713 | 3300046523 | Bacteria | 13759 |
| 1201 | Ga0495648_0008251 | 3300046524 | Bacteria | 8213 |
| 1202 | Ga0495666_0038494 | 3300046526 | Bacteria | 2325 |
| 1203 | Ga0495652_0026006 | 3300046529 | Bacteria | 5172 |
| 1204 | Ga0495652_0138777 | 3300046529 | Bacteria | 1914 |
| 1205 | Ga0495652_0228765 | 3300046529 | Bacteria | 1392 |
| 1206 | Ga0495654_0144998 | 3300046530 | Bacteria | 1055 |
| 1207 | Ga0495665_0004028 | 3300046531 | Bacteria | 7928 |
| 1208 | Ga0495665_0004234 | 3300046531 | Bacteria | 7745 |
| 1209 | Ga0495665_0020621 | 3300046531 | Bacteria | 3539 |
| 1210 | Ga0495665_0137795 | 3300046531 | Bacteria | 1276 |
| 1211 | Ga0495640_0036039 | 3300046533 | Bacteria | 3498 |
| 1212 | Ga0495640_0062400 | 3300046533 | Bacteria | 2527 |
| 1213 | Ga0495640_0068878 | 3300046533 | Bacteria | 2380 |
| 1214 | Ga0495640_0096857 | 3300046533 | Bacteria | 1940 |
| 1215 | Ga0495640_0162175 | 3300046533 | Bacteria | 1432 |
| 1216 | Ga0495640_0292638 | 3300046533 | Bacteria | 1012 |
| 1217 | Ga0495586_0047555 | 3300046535 | Bacteria | 2316 |
| 1218 | Ga0495587_0001671 | 3300046536 | Bacteria | 14800 |
| 1219 | Ga0495587_0031176 | 3300046536 | Bacteria | 3230 |
| 1220 | Ga0495587_0128938 | 3300046536 | Bacteria | 1446 |
| 1221 | Ga0495587_0161457 | 3300046536 | Bacteria | 1275 |
| 1222 | Ga0495598_0006692 | 3300046537 | Bacteria | 2613 |
| 1223 | Ga0495598_0015543 | 3300046537 | Bacteria | 1924 |
| 1224 | Ga0495609_0050263 | 3300046538 | Bacteria | 1859 |
| 1225 | Ga0495609_0092341 | 3300046538 | Bacteria | 1316 |
| 1226 | Ga0495609_0230676 | 3300046538 | Bacteria | 767 |
| 1227 | Ga0495645_0005350 | 3300046543 | Bacteria | 8799 |
| 1228 | Ga0495645_0017640 | 3300046543 | Bacteria | 5115 |
| 1229 | Ga0495645_0041803 | 3300046543 | Bacteria | 3342 |
| 1230 | Ga0495645_0050307 | 3300046543 | Bacteria | 3034 |
| 1231 | Ga0495622_0000916 | 3300046557 | Bacteria | 15986 |
| 1232 | Ga0495622_0026496 | 3300046557 | Bacteria | 2706 |
| 1233 | Ga0495622_0148504 | 3300046557 | Bacteria | 1061 |
| 1234 | Ga0495633_0000941 | 3300046558 | Bacteria | 24412 |
| 1235 | Ga0495667_0004251 | 3300046559 | Bacteria | 9648 |
| 1236 | Ga0495667_0006602 | 3300046559 | Bacteria | 7875 |
| 1237 | Ga0495667_0011743 | 3300046559 | Bacteria | 5932 |
| 1238 | Ga0495667_0057695 | 3300046559 | Bacteria | 2551 |
| 1239 | Ga0495667_0355294 | 3300046559 | Bacteria | 925 |
| 1240 | Ga0495656_0000589 | 3300046615 | Bacteria | 11760 |
| 1241 | Ga0495634_0036751 | 3300046642 | Bacteria | 3348 |
| 1242 | Ga0495634_0050361 | 3300046642 | Bacteria | 2797 |
| 1243 | Ga0495634_0126421 | 3300046642 | Bacteria | 1633 |
| 1244 | Ga0495634_0215317 | 3300046642 | Bacteria | 1188 |
| 1245 | Ga0495611_0106226 | 3300046648 | Bacteria | 1306 |
| 1246 | Ga0495611_0192766 | 3300046648 | Bacteria | 951 |
| 1247 | Ga0495625_0028714 | 3300046660 | Bacteria | 4167 |
| 1248 | Ga0495625_0475799 | 3300046660 | Bacteria | 768 |
| 1249 | Ga0495635_0007513 | 3300046663 | Bacteria | 7606 |
| 1250 | Ga0495635_0008691 | 3300046663 | Bacteria | 7094 |
| 1251 | Ga0495635_0102078 | 3300046663 | Bacteria | 1960 |
| 1252 | Ga0495635_0146883 | 3300046663 | Bacteria | 1605 |
| 1253 | Ga0495635_0263989 | 3300046663 | Bacteria | 1159 |
| 1254 | Ga0495635_0340540 | 3300046663 | Bacteria | 1002 |
| 1255 | Ga0495635_0398521 | 3300046663 | Bacteria | 914 |
| 1256 | Ga0495659_0003548 | 3300046664 | Bacteria | 4967 |
| 1257 | Ga0495661_0011421 | 3300046665 | Bacteria | 6028 |
| 1258 | Ga0495661_0027406 | 3300046665 | Bacteria | 3658 |
| 1259 | Ga0495588_0005432 | 3300046674 | Bacteria | 5672 |
| 1260 | Ga0495588_0011242 | 3300046674 | Bacteria | 4195 |
| 1261 | Ga0495588_0041790 | 3300046674 | Bacteria | 2342 |
| 1262 | Ga0495657_0011421 | 3300046675 | Bacteria | 6638 |
| 1263 | Ga0495657_0019703 | 3300046675 | Bacteria | 4863 |
| 1264 | Ga0495657_0026745 | 3300046675 | Bacteria | 4083 |
| 1265 | Ga0495657_0037526 | 3300046675 | Bacteria | 3339 |
| 1266 | Ga0495657_0053216 | 3300046675 | Bacteria | 2710 |
| 1267 | Ga0495657_0121577 | 3300046675 | Bacteria | 1644 |
| 1268 | Ga0495657_0307333 | 3300046675 | Bacteria | 945 |
| 1269 | Ga0495599_0018700 | 3300046678 | Bacteria | 4317 |
| 1270 | Ga0495599_0067022 | 3300046678 | Bacteria | 2242 |
| 1271 | Ga0495599_0211321 | 3300046678 | Bacteria | 1189 |
| 1272 | Ga0495623_0000858 | 3300046679 | Bacteria | 20593 |
| 1273 | Ga0495623_0002372 | 3300046679 | Bacteria | 12521 |
| 1274 | Ga0495623_0400881 | 3300046679 | Bacteria | 738 |
| 1275 | Ga0495646_0007260 | 3300046680 | Bacteria | 7040 |
| 1276 | Ga0495646_0013907 | 3300046680 | Bacteria | 5115 |
| 1277 | Ga0495646_0293914 | 3300046680 | Bacteria | 861 |
| 1278 | Ga0495647_0006380 | 3300046681 | Bacteria | 3902 |
| 1279 | Ga0495647_0009980 | 3300046681 | Bacteria | 3227 |
| 1280 | Ga0495647_0093629 | 3300046681 | Bacteria | 1235 |
| 1281 | Ga0495658_0001492 | 3300046683 | Bacteria | 12268 |
| 1282 | Ga0495658_0002288 | 3300046683 | Bacteria | 9659 |
| 1283 | Ga0495658_0007902 | 3300046683 | Bacteria | 5265 |
| 1284 | Ga0495658_0017238 | 3300046683 | Bacteria | 3728 |
| 1285 | Ga0495658_0021417 | 3300046683 | Bacteria | 3408 |
| 1286 | Ga0495658_0037194 | 3300046683 | Bacteria | 2689 |
| 1287 | Ga0495669_0092584 | 3300046684 | Bacteria | 1397 |
| 1288 | Ga0495669_0111866 | 3300046684 | Bacteria | 1275 |
| 1289 | Ga0495613_0013711 | 3300046689 | Bacteria | 6013 |
| 1290 | Ga0495613_0024584 | 3300046689 | Bacteria | 4488 |
| 1291 | Ga0495613_0045423 | 3300046689 | Bacteria | 3249 |
| 1292 | Ga0495613_0056840 | 3300046689 | Bacteria | 2873 |
| 1293 | Ga0495624_0048203 | 3300046690 | Bacteria | 2704 |
| 1294 | Ga0495624_0190045 | 3300046690 | Bacteria | 1249 |
| 1295 | Ga0495670_0001016 | 3300046691 | Bacteria | 13619 |
| 1296 | Ga0495671_0058073 | 3300046692 | Bacteria | 1914 |
| 1297 | Ga0495671_0066432 | 3300046692 | Bacteria | 1775 |
| 1298 | Ga0495649_0066314 | 3300046694 | Bacteria | 1937 |
| 1299 | Ga0495589_0032579 | 3300046794 | Bacteria | 2620 |
| 1300 | Ga0495589_0146279 | 3300046794 | Bacteria | 1130 |
| 1301 | Ga0495600_0002535 | 3300046809 | Bacteria | 10511 |
| 1302 | Ga0495600_0004858 | 3300046809 | Bacteria | 8070 |
| 1303 | Ga0495600_0057702 | 3300046809 | Bacteria | 2535 |
| 1304 | Ga0495600_0100175 | 3300046809 | Bacteria | 1888 |
| 1305 | Ga0495600_0118459 | 3300046809 | Bacteria | 1722 |
| 1306 | Ga0495600_0272229 | 3300046809 | Bacteria | 1074 |
| 1307 | Ga0495660_0060594 | 3300046810 | Bacteria | 2032 |
| 1308 | Ga0495581_0001042 | 3300047315 | Bacteria | 15004 |
| 1309 | Ga0495581_0137501 | 3300047315 | Bacteria | 1424 |
| 1310 | Ga0495604_0007851 | 3300047317 | Bacteria | 8446 |
| 1311 | Ga0495604_0007934 | 3300047317 | Bacteria | 8408 |
| 1312 | Ga0495604_0072089 | 3300047317 | Bacteria | 2611 |
| 1313 | Ga0495636_0076801 | 3300047318 | Bacteria | 1433 |
| 1314 | Ga0495674_0100641 | 3300047319 | Bacteria | 2459 |
| 1315 | Ga0495674_0134805 | 3300047319 | Bacteria | 2079 |
| 1316 | Ga0495674_0153457 | 3300047319 | Bacteria | 1930 |
| 1317 | Ga0495674_0225067 | 3300047319 | Bacteria | 1549 |
| 1318 | Ga0495672_0059536 | 3300047320 | Bacteria | 2209 |
| 1319 | Ga0495672_0113453 | 3300047320 | Bacteria | 1451 |
| 1320 | Ga0495672_0167802 | 3300047320 | Bacteria | 1122 |
| 1321 | Ga0495676_0008691 | 3300047321 | Bacteria | 9296 |
| 1322 | Ga0495676_0013652 | 3300047321 | Bacteria | 7289 |
| 1323 | Ga0495676_0069481 | 3300047321 | Bacteria | 2717 |
| 1324 | Ga0495680_0019366 | 3300047322 | Bacteria | 5745 |
| 1325 | Ga0495680_0026170 | 3300047322 | Bacteria | 4814 |
| 1326 | Ga0495680_0047015 | 3300047322 | Bacteria | 3398 |
| 1327 | Ga0495680_0058793 | 3300047322 | Bacteria | 2969 |
| 1328 | Ga0495680_0068123 | 3300047322 | Bacteria | 2720 |
| 1329 | Ga0495680_0106939 | 3300047322 | Bacteria | 2078 |
| 1330 | Ga0495680_0144944 | 3300047322 | Bacteria | 1735 |
| 1331 | Ga0495680_0312289 | 3300047322 | Bacteria | 1101 |
| 1332 | Ga0495675_0006492 | 3300047444 | Bacteria | 7157 |
| 1333 | Ga0495675_0169775 | 3300047444 | Bacteria | 1340 |
| 1334 | Ga0495675_0207164 | 3300047444 | Bacteria | 1192 |
| 1335 | Ga0495677_0142461 | 3300047445 | Bacteria | 921 |
| 1336 | Ga0495679_024983 | 3300047446 | Bacteria | 2004 |
| 1337 | Ga0495684_0082884 | 3300047471 | Bacteria | 2433 |
| 1338 | Ga0495684_0176675 | 3300047471 | Bacteria | 1585 |
| 1339 | Ga0495684_0281160 | 3300047471 | Bacteria | 1201 |
| 1340 | Ga0495686_0077376 | 3300047472 | Bacteria | 2037 |
| 1341 | Ga0495593_0001943 | 3300047673 | Bacteria | 12328 |
| 1342 | Ga0495593_0012417 | 3300047673 | Bacteria | 4870 |
| 1343 | Ga0495593_0022296 | 3300047673 | Bacteria | 3531 |
| 1344 | Ga0495593_0059926 | 3300047673 | Bacteria | 1993 |
| 1345 | Ga0495602_0007161 | 3300048088 | Bacteria | 11684 |
| 1346 | Ga0495602_0074205 | 3300048088 | Bacteria | 2892 |
| 1347 | Ga0495602_0163605 | 3300048088 | Bacteria | 1734 |
| 1348 | Ga0495614_0000618 | 3300048089 | Bacteria | 14895 |
| 1349 | Ga0495614_0031857 | 3300048089 | Bacteria | 2269 |
| 1350 | Ga0495626_0097869 | 3300048091 | Bacteria | 1282 |
| 1351 | Ga0496100_0116994 | 3300048903 | Bacteria | 1860 |
| 1352 | Ga0496100_0175028 | 3300048903 | Bacteria | 1548 |
| 1353 | Ga0496100_0257045 | 3300048903 | Bacteria | 1294 |
| 1354 | Ga0496101_0000969 | 3300048904 | Bacteria | 16936 |
| 1355 | Ga0496101_0014870 | 3300048904 | Bacteria | 5237 |
| 1356 | Ga0496101_0019543 | 3300048904 | Bacteria | 4625 |
| 1357 | Ga0496101_0049050 | 3300048904 | Bacteria | 3035 |
| 1358 | Ga0496102_0004376 | 3300048905 | Bacteria | 11928 |
| 1359 | Ga0496102_0062325 | 3300048905 | Bacteria | 3414 |
| 1360 | Ga0496102_0067172 | 3300048905 | Bacteria | 3288 |
| 1361 | Ga0496102_0158448 | 3300048905 | Bacteria | 2129 |
| 1362 | Ga0496102_0569399 | 3300048905 | Bacteria | 1055 |
| 1363 | Ga0496102_0614555 | 3300048905 | Bacteria | 1010 |
| 1364 | Ga0496103_0001732 | 3300048906 | Bacteria | 14251 |
| 1365 | Ga0496103_0023227 | 3300048906 | Bacteria | 3738 |
| 1366 | Ga0496103_0061364 | 3300048906 | Bacteria | 2338 |
| 1367 | Ga0496103_0100733 | 3300048906 | Bacteria | 1828 |
| 1368 | Ga0496104_0000399 | 3300048907 | Bacteria | 38066 |
| 1369 | Ga0496104_0101217 | 3300048907 | Bacteria | 2758 |
| 1370 | Ga0496104_0108172 | 3300048907 | Bacteria | 2664 |
| 1371 | Ga0496104_0174623 | 3300048907 | Bacteria | 2059 |
| 1372 | Ga0496104_0189398 | 3300048907 | Bacteria | 1968 |
| 1373 | Ga0496104_0251879 | 3300048907 | Bacteria | 1678 |
| 1374 | Ga0496105_0002417 | 3300048908 | Bacteria | 13529 |
| 1375 | Ga0496105_0035470 | 3300048908 | Bacteria | 4104 |
| 1376 | Ga0496105_0316563 | 3300048908 | Bacteria | 1251 |
| 1377 | Ga0496105_0342805 | 3300048908 | Bacteria | 1194 |
| 1378 | Ga0496105_0345285 | 3300048908 | Bacteria | 1189 |
| 1379 | Ga0496106_0015788 | 3300048909 | Bacteria | 5584 |
| 1380 | Ga0496106_0036410 | 3300048909 | Bacteria | 3681 |
| 1381 | Ga0496106_0278742 | 3300048909 | Bacteria | 1339 |
| 1382 | Ga0496106_0316134 | 3300048909 | Bacteria | 1253 |
| 1383 | Ga0496106_0822784 | 3300048909 | Bacteria | 736 |
| 1384 | Ga0496107_0005598 | 3300048910 | Bacteria | 8604 |
| 1385 | Ga0496107_0020535 | 3300048910 | Bacteria | 4667 |
| 1386 | Ga0496107_0091546 | 3300048910 | Bacteria | 2223 |
| 1387 | Ga0496107_0092306 | 3300048910 | Bacteria | 2213 |
| 1388 | Ga0496107_0135855 | 3300048910 | Bacteria | 1816 |
| 1389 | Ga0496107_0205055 | 3300048910 | Bacteria | 1466 |
| 1390 | Ga0496107_0345267 | 3300048910 | Bacteria | 1107 |
| 1391 | Ga0496108_0007368 | 3300048911 | Bacteria | 8919 |
| 1392 | Ga0496108_0167448 | 3300048911 | Bacteria | 1900 |
| 1393 | Ga0496108_0543052 | 3300048911 | Bacteria | 1014 |
| 1394 | Ga0496109_0005949 | 3300048912 | Bacteria | 10237 |
| 1395 | Ga0496109_0012139 | 3300048912 | Bacteria | 7430 |
| 1396 | Ga0496109_0054198 | 3300048912 | Bacteria | 3658 |
| 1397 | Ga0496109_0133489 | 3300048912 | Bacteria | 2318 |
| 1398 | Ga0496109_0367124 | 3300048912 | Bacteria | 1360 |
| 1399 | Ga0496110_0054594 | 3300048913 | Bacteria | 3514 |
| 1400 | Ga0496110_0106807 | 3300048913 | Bacteria | 2512 |
| 1401 | Ga0496110_0121916 | 3300048913 | Bacteria | 2349 |
| 1402 | Ga0496110_0253605 | 3300048913 | Bacteria | 1601 |
| 1403 | Ga0496110_0608904 | 3300048913 | Bacteria | 990 |
| 1404 | Ga0496110_0834079 | 3300048913 | Bacteria | 827 |
| 1405 | Ga0496111_0037153 | 3300048914 | Bacteria | 3486 |
| 1406 | Ga0496111_0043921 | 3300048914 | Bacteria | 3213 |
| 1407 | Ga0496112_0070213 | 3300048915 | Bacteria | 3461 |
| 1408 | Ga0496112_0139286 | 3300048915 | Bacteria | 2395 |
| 1409 | Ga0496112_0178648 | 3300048915 | Bacteria | 2086 |
| 1410 | Ga0496112_0273206 | 3300048915 | Bacteria | 1638 |
| 1411 | Ga0496112_0336823 | 3300048915 | Bacteria | 1452 |
| 1412 | Ga0496113_0043476 | 3300048916 | Bacteria | 3325 |
| 1413 | Ga0496113_0045614 | 3300048916 | Bacteria | 3251 |
| 1414 | Ga0496113_0049357 | 3300048916 | Bacteria | 3133 |
| 1415 | Ga0496113_0129113 | 3300048916 | Bacteria | 1982 |
| 1416 | Ga0496113_0182482 | 3300048916 | Bacteria | 1664 |
| 1417 | Ga0496113_0347681 | 3300048916 | Bacteria | 1189 |
| 1418 | Ga0496113_0487029 | 3300048916 | Bacteria | 990 |
| 1419 | Ga0496113_0529394 | 3300048916 | Bacteria | 946 |
| 1420 | Ga0496114_0002647 | 3300048917 | Bacteria | 13668 |
| 1421 | Ga0496114_0048435 | 3300048917 | Bacteria | 3535 |
| 1422 | Ga0496114_0069593 | 3300048917 | Bacteria | 2955 |
| 1423 | Ga0496114_0106109 | 3300048917 | Bacteria | 2403 |
| 1424 | Ga0496114_0126273 | 3300048917 | Bacteria | 2205 |
| 1425 | Ga0496115_0024784 | 3300048918 | Bacteria | 4665 |
| 1426 | Ga0496115_0030807 | 3300048918 | Bacteria | 4223 |
| 1427 | Ga0496115_0047461 | 3300048918 | Bacteria | 3435 |
| 1428 | Ga0496115_0082945 | 3300048918 | Bacteria | 2612 |
| 1429 | Ga0496115_0117368 | 3300048918 | Bacteria | 2189 |
| 1430 | Ga0496115_0215818 | 3300048918 | Bacteria | 1584 |
| 1431 | Ga0496115_0262717 | 3300048918 | Bacteria | 1419 |
| 1432 | Ga0496115_0349341 | 3300048918 | Bacteria | 1206 |
| 1433 | Ga0496116_0047218 | 3300048919 | Bacteria | 2899 |
| 1434 | Ga0496117_0128671 | 3300048920 | Bacteria | 1539 |
| 1435 | Ga0496118_0271882 | 3300048921 | Bacteria | 949 |
| 1436 | Ga0496119_0040092 | 3300048922 | Bacteria | 3000 |
| 1437 | Ga0496119_0105536 | 3300048922 | Bacteria | 1574 |
| 1438 | Ga0496119_0242680 | 3300048922 | Bacteria | 912 |
| 1439 | Ga0496120_0019667 | 3300048923 | Bacteria | 4313 |
| 1440 | Ga0496120_0072566 | 3300048923 | Bacteria | 1886 |
| 1441 | Ga0496121_0003067 | 3300048924 | Bacteria | 24202 |
| 1442 | Ga0496121_0006108 | 3300048924 | Bacteria | 15150 |
| 1443 | Ga0496121_0036137 | 3300048924 | Bacteria | 4407 |
| 1444 | Ga0496121_0203792 | 3300048924 | Bacteria | 1408 |
| 1445 | Ga0496121_0219426 | 3300048924 | Bacteria | 1340 |
| 1446 | Ga0496122_0043087 | 3300048925 | Bacteria | 3540 |
| 1447 | Ga0496122_0164998 | 3300048925 | Bacteria | 1344 |
| 1448 | Ga0496123_0048593 | 3300048926 | Bacteria | 2853 |
| 1449 | Ga0496123_0094491 | 3300048926 | Bacteria | 1761 |
| 1450 | Ga0496124_0217321 | 3300048927 | Bacteria | 1440 |
| 1451 | Ga0496125_0001858 | 3300048928 | Bacteria | 29110 |
| 1452 | Ga0496125_0115218 | 3300048928 | Bacteria | 1933 |
| 1453 | Ga0496125_0168911 | 3300048928 | Bacteria | 1473 |
| 1454 | Ga0496126_0000480 | 3300048929 | Bacteria | 79257 |
| 1455 | Ga0496126_0040052 | 3300048929 | Bacteria | 4345 |
| 1456 | Ga0496126_0090979 | 3300048929 | Bacteria | 2684 |
| 1457 | Ga0496126_0110380 | 3300048929 | Bacteria | 2396 |
| 1458 | Ga0496126_0117141 | 3300048929 | Bacteria | 2314 |
| 1459 | Ga0496126_0150833 | 3300048929 | Bacteria | 1992 |
| 1460 | Ga0496126_0341974 | 3300048929 | Bacteria | 1225 |
| 1461 | Ga0496126_0392309 | 3300048929 | Bacteria | 1128 |
| 1462 | Ga0495682_0013068 | 3300049460 | Bacteria | 3166 |
| 1463 | Ga0501031_0044398 | 3300049568 | Bacteria | 2900 |
| 1464 | Ga0501031_0070573 | 3300049568 | Bacteria | 2275 |
| 1465 | Ga0501031_0074807 | 3300049568 | Bacteria | 2205 |
| 1466 | Ga0501031_0085878 | 3300049568 | Bacteria | 2051 |
| 1467 | Ga0501031_0090980 | 3300049568 | Bacteria | 1990 |
| 1468 | Ga0501032_0008814 | 3300049569 | Bacteria | 7337 |
| 1469 | Ga0501032_0040734 | 3300049569 | Bacteria | 3156 |
| 1470 | Ga0501032_0042811 | 3300049569 | Bacteria | 3070 |
| 1471 | Ga0501032_0058423 | 3300049569 | Bacteria | 2589 |
| 1472 | Ga0501032_0118749 | 3300049569 | Bacteria | 1748 |
| 1473 | Ga0501032_0163537 | 3300049569 | Bacteria | 1461 |
| 1474 | Ga0501032_0238250 | 3300049569 | Bacteria | 1182 |
| 1475 | Ga0501032_0270312 | 3300049569 | Bacteria | 1101 |
| 1476 | Ga0501033_0000094 | 3300049570 | Bacteria | 84669 |
| 1477 | Ga0501033_0021359 | 3300049570 | Bacteria | 4883 |
| 1478 | Ga0501033_0033508 | 3300049570 | Bacteria | 3856 |
| 1479 | Ga0501033_0086738 | 3300049570 | Bacteria | 2291 |
| 1480 | Ga0501033_0101453 | 3300049570 | Bacteria | 2099 |
| 1481 | Ga0501033_0139045 | 3300049570 | Bacteria | 1756 |
| 1482 | Ga0501033_0216760 | 3300049570 | Bacteria | 1363 |
| 1483 | Ga0501033_0222912 | 3300049570 | Bacteria | 1341 |
| 1484 | Ga0501033_0392054 | 3300049570 | Bacteria | 969 |
| 1485 | Ga0501034_0000021 | 3300049571 | Bacteria | 266023 |
| 1486 | Ga0501034_0000482 | 3300049571 | Bacteria | 65380 |
| 1487 | Ga0501034_0002673 | 3300049571 | Bacteria | 21040 |
| 1488 | Ga0501034_0024772 | 3300049571 | Bacteria | 6104 |
| 1489 | Ga0501034_0046023 | 3300049571 | Bacteria | 4408 |
| 1490 | Ga0501034_0060811 | 3300049571 | Bacteria | 3794 |
| 1491 | Ga0501034_0062644 | 3300049571 | Bacteria | 3735 |
| 1492 | Ga0501034_0134254 | 3300049571 | Bacteria | 2456 |
| 1493 | Ga0501034_0164332 | 3300049571 | Bacteria | 2189 |
| 1494 | Ga0501034_0167276 | 3300049571 | Bacteria | 2167 |
| 1495 | Ga0501034_0212658 | 3300049571 | Bacteria | 1888 |
| 1496 | Ga0501034_0240132 | 3300049571 | Bacteria | 1758 |
| 1497 | Ga0501034_0247867 | 3300049571 | Bacteria | 1726 |
| 1498 | Ga0501034_0269164 | 3300049571 | Bacteria | 1645 |
| 1499 | Ga0501034_0339036 | 3300049571 | Bacteria | 1433 |
| 1500 | Ga0501034_0349858 | 3300049571 | Bacteria | 1406 |
| 1501 | Ga0501034_0464352 | 3300049571 | Bacteria | 1182 |
| 1502 | Ga0501036_0001704 | 3300049572 | Bacteria | 17077 |
| 1503 | Ga0501036_0005563 | 3300049572 | Bacteria | 10220 |
| 1504 | Ga0501036_0005653 | 3300049572 | Bacteria | 10145 |
| 1505 | Ga0501036_0076536 | 3300049572 | Bacteria | 2830 |
| 1506 | Ga0501036_0091111 | 3300049572 | Bacteria | 2575 |
| 1507 | Ga0501036_0091320 | 3300049572 | Bacteria | 2572 |
| 1508 | Ga0501036_0177505 | 3300049572 | Bacteria | 1793 |
| 1509 | Ga0501037_0000450 | 3300049573 | Bacteria | 33712 |
| 1510 | Ga0501037_0046720 | 3300049573 | Bacteria | 3175 |
| 1511 | Ga0501037_0050986 | 3300049573 | Bacteria | 3027 |
| 1512 | Ga0501037_0056591 | 3300049573 | Bacteria | 2863 |
| 1513 | Ga0501037_0063759 | 3300049573 | Bacteria | 2686 |
| 1514 | Ga0501037_0095843 | 3300049573 | Bacteria | 2144 |
| 1515 | Ga0501037_0108992 | 3300049573 | Bacteria | 1995 |
| 1516 | Ga0501037_0141799 | 3300049573 | Bacteria | 1719 |
| 1517 | Ga0501037_0290529 | 3300049573 | Bacteria | 1137 |
| 1518 | Ga0501038_0000052 | 3300049574 | Bacteria | 94841 |
| 1519 | Ga0501038_0037384 | 3300049574 | Bacteria | 4256 |
| 1520 | Ga0501038_0046533 | 3300049574 | Bacteria | 3761 |
| 1521 | Ga0501038_0058047 | 3300049574 | Bacteria | 3319 |
| 1522 | Ga0501038_0071577 | 3300049574 | Bacteria | 2941 |
| 1523 | Ga0501038_0071986 | 3300049574 | Bacteria | 2930 |
| 1524 | Ga0501038_0079573 | 3300049574 | Bacteria | 2763 |
| 1525 | Ga0501038_0083447 | 3300049574 | Bacteria | 2690 |
| 1526 | Ga0501038_0098475 | 3300049574 | Bacteria | 2438 |
| 1527 | Ga0501038_0108148 | 3300049574 | Bacteria | 2306 |
| 1528 | Ga0501038_0113532 | 3300049574 | Bacteria | 2242 |
| 1529 | Ga0501038_0115212 | 3300049574 | Bacteria | 2222 |
| 1530 | Ga0501038_0134728 | 3300049574 | Bacteria | 2025 |
| 1531 | Ga0501038_0146399 | 3300049574 | Bacteria | 1928 |
| 1532 | Ga0501038_0158446 | 3300049574 | Bacteria | 1841 |
| 1533 | Ga0501038_0355974 | 3300049574 | Bacteria | 1139 |
| 1534 | Ga0501039_0000549 | 3300049575 | Bacteria | 27168 |
| 1535 | Ga0501039_0039657 | 3300049575 | Bacteria | 3637 |
| 1536 | Ga0501039_0094100 | 3300049575 | Bacteria | 2335 |
| 1537 | Ga0501039_0116277 | 3300049575 | Bacteria | 2093 |
| 1538 | Ga0501039_0151389 | 3300049575 | Bacteria | 1822 |
| 1539 | Ga0501039_0179242 | 3300049575 | Bacteria | 1666 |
| 1540 | Ga0501039_0273189 | 3300049575 | Bacteria | 1329 |
| 1541 | Ga0501039_0293386 | 3300049575 | Bacteria | 1278 |
| 1542 | Ga0501040_0038034 | 3300049576 | Bacteria | 3271 |
| 1543 | Ga0501040_0271288 | 3300049576 | Bacteria | 1211 |
| 1544 | Ga0501040_0358231 | 3300049576 | Bacteria | 1045 |
| 1545 | Ga0501041_0021685 | 3300049577 | Bacteria | 3847 |
| 1546 | Ga0501041_0111333 | 3300049577 | Bacteria | 1698 |
| 1547 | Ga0501042_0014227 | 3300049578 | Bacteria | 5429 |
| 1548 | Ga0501042_0030132 | 3300049578 | Bacteria | 3831 |
| 1549 | Ga0501042_0090650 | 3300049578 | Bacteria | 2194 |
| 1550 | Ga0501042_0094589 | 3300049578 | Bacteria | 2146 |
| 1551 | Ga0501042_0191226 | 3300049578 | Bacteria | 1476 |
| 1552 | Ga0501043_0005051 | 3300049579 | Bacteria | 10670 |
| 1553 | Ga0501043_0012919 | 3300049579 | Bacteria | 6526 |
| 1554 | Ga0501043_0037798 | 3300049579 | Bacteria | 3797 |
| 1555 | Ga0501043_0042971 | 3300049579 | Bacteria | 3552 |
| 1556 | Ga0501043_0093452 | 3300049579 | Bacteria | 2364 |
| 1557 | Ga0501043_0116039 | 3300049579 | Bacteria | 2101 |
| 1558 | Ga0501043_0117710 | 3300049579 | Bacteria | 2084 |
| 1559 | Ga0501043_0129223 | 3300049579 | Bacteria | 1980 |
| 1560 | Ga0501043_0138567 | 3300049579 | Bacteria | 1905 |
| 1561 | Ga0501043_0142315 | 3300049579 | Bacteria | 1878 |
| 1562 | Ga0501043_0230224 | 3300049579 | Bacteria | 1431 |
| 1563 | Ga0501043_0377564 | 3300049579 | Bacteria | 1073 |
| 1564 | Ga0501046_0002237 | 3300049580 | Bacteria | 18256 |
| 1565 | Ga0501046_0024393 | 3300049580 | Bacteria | 4963 |
| 1566 | Ga0501046_0101892 | 3300049580 | Bacteria | 2202 |
| 1567 | Ga0501046_0111685 | 3300049580 | Bacteria | 2087 |
| 1568 | Ga0501046_0154028 | 3300049580 | Bacteria | 1733 |
| 1569 | Ga0501046_0156128 | 3300049580 | Bacteria | 1718 |
| 1570 | Ga0501046_0162788 | 3300049580 | Bacteria | 1677 |
| 1571 | Ga0501046_0175873 | 3300049580 | Bacteria | 1603 |
| 1572 | Ga0501046_0202042 | 3300049580 | Bacteria | 1478 |
| 1573 | Ga0501046_0545747 | 3300049580 | Bacteria | 827 |
| 1574 | Ga0501047_0000235 | 3300049581 | Bacteria | 65603 |
| 1575 | Ga0501047_0017348 | 3300049581 | Bacteria | 6894 |
| 1576 | Ga0501047_0024757 | 3300049581 | Bacteria | 5762 |
| 1577 | Ga0501047_0025781 | 3300049581 | Bacteria | 5653 |
| 1578 | Ga0501047_0044775 | 3300049581 | Bacteria | 4277 |
| 1579 | Ga0501047_0050813 | 3300049581 | Bacteria | 4003 |
| 1580 | Ga0501047_0079255 | 3300049581 | Bacteria | 3158 |
| 1581 | Ga0501047_0095267 | 3300049581 | Bacteria | 2855 |
| 1582 | Ga0501047_0099459 | 3300049581 | Bacteria | 2787 |
| 1583 | Ga0501047_0133502 | 3300049581 | Bacteria | 2362 |
| 1584 | Ga0501047_0134755 | 3300049581 | Bacteria | 2350 |
| 1585 | Ga0501047_0147338 | 3300049581 | Bacteria | 2230 |
| 1586 | Ga0501047_0159685 | 3300049581 | Bacteria | 2126 |
| 1587 | Ga0501047_0223963 | 3300049581 | Bacteria | 1736 |
| 1588 | Ga0501047_0250701 | 3300049581 | Bacteria | 1619 |
| 1589 | Ga0501047_0262622 | 3300049581 | Bacteria | 1574 |
| 1590 | Ga0501047_0277985 | 3300049581 | Bacteria | 1519 |
| 1591 | Ga0501047_0303139 | 3300049581 | Bacteria | 1439 |
| 1592 | Ga0501047_0410524 | 3300049581 | Bacteria | 1186 |
| 1593 | Ga0501047_0592950 | 3300049581 | Bacteria | 930 |
| 1594 | Ga0501047_0697831 | 3300049581 | Bacteria | 832 |
| 1595 | Ga0501048_0001862 | 3300049582 | Bacteria | 16006 |
| 1596 | Ga0501048_0006738 | 3300049582 | Bacteria | 8727 |
| 1597 | Ga0501048_0020705 | 3300049582 | Bacteria | 4821 |
| 1598 | Ga0501048_0041101 | 3300049582 | Bacteria | 3312 |
| 1599 | Ga0501048_0103199 | 3300049582 | Bacteria | 2012 |
| 1600 | Ga0501048_0138183 | 3300049582 | Bacteria | 1722 |
| 1601 | Ga0501048_0341260 | 3300049582 | Bacteria | 1068 |
| 1602 | Ga0501067_0001776 | 3300049583 | Bacteria | 11844 |
| 1603 | Ga0501067_0005350 | 3300049583 | Bacteria | 7126 |
| 1604 | Ga0501067_0006170 | 3300049583 | Bacteria | 6642 |
| 1605 | Ga0501067_0033573 | 3300049583 | Bacteria | 2846 |
| 1606 | Ga0501067_0051199 | 3300049583 | Bacteria | 2289 |
| 1607 | Ga0501068_0001049 | 3300049584 | Bacteria | 14641 |
| 1608 | Ga0501068_0035313 | 3300049584 | Bacteria | 2983 |
| 1609 | Ga0501069_0001817 | 3300049585 | Bacteria | 10655 |
| 1610 | Ga0501069_0005996 | 3300049585 | Bacteria | 6340 |
| 1611 | Ga0501069_0008119 | 3300049585 | Bacteria | 5516 |
| 1612 | Ga0501069_0030545 | 3300049585 | Bacteria | 2959 |
| 1613 | Ga0501069_0155458 | 3300049585 | Bacteria | 1315 |
| 1614 | Ga0501069_0212034 | 3300049585 | Bacteria | 1124 |
| 1615 | Ga0501070_0001611 | 3300049586 | Bacteria | 20025 |
| 1616 | Ga0501070_0003398 | 3300049586 | Bacteria | 13819 |
| 1617 | Ga0501070_0033678 | 3300049586 | Bacteria | 4287 |
| 1618 | Ga0501070_0069151 | 3300049586 | Bacteria | 2923 |
| 1619 | Ga0501070_0095592 | 3300049586 | Bacteria | 2458 |
| 1620 | Ga0501070_0126129 | 3300049586 | Bacteria | 2115 |
| 1621 | Ga0501070_0163525 | 3300049586 | Bacteria | 1834 |
| 1622 | Ga0501070_0175198 | 3300049586 | Bacteria | 1766 |
| 1623 | Ga0501070_0196271 | 3300049586 | Bacteria | 1658 |
| 1624 | Ga0501070_0258564 | 3300049586 | Bacteria | 1423 |
| 1625 | Ga0501070_0270302 | 3300049586 | Bacteria | 1388 |
| 1626 | Ga0501070_0302330 | 3300049586 | Bacteria | 1303 |
| 1627 | Ga0501070_0417463 | 3300049586 | Bacteria | 1084 |
| 1628 | Ga0501071_0057085 | 3300049587 | Bacteria | 2821 |
| 1629 | Ga0501071_0070423 | 3300049587 | Bacteria | 2547 |
| 1630 | Ga0501071_0088539 | 3300049587 | Bacteria | 2272 |
| 1631 | Ga0501071_0095538 | 3300049587 | Bacteria | 2187 |
| 1632 | Ga0501071_0176824 | 3300049587 | Bacteria | 1598 |
| 1633 | Ga0501071_0228560 | 3300049587 | Bacteria | 1401 |
| 1634 | Ga0501071_0260600 | 3300049587 | Bacteria | 1309 |
| 1635 | Ga0501071_0534980 | 3300049587 | Bacteria | 899 |
| 1636 | Ga0501072_0005670 | 3300049588 | Bacteria | 9507 |
| 1637 | Ga0501072_0013154 | 3300049588 | Bacteria | 6335 |
| 1638 | Ga0501072_0072626 | 3300049588 | Bacteria | 2719 |
| 1639 | Ga0501072_0088285 | 3300049588 | Bacteria | 2460 |
| 1640 | Ga0501072_0158132 | 3300049588 | Bacteria | 1807 |
| 1641 | Ga0501072_0680190 | 3300049588 | Bacteria | 809 |
| 1642 | Ga0501073_0000597 | 3300049589 | Bacteria | 25445 |
| 1643 | Ga0501073_0004494 | 3300049589 | Bacteria | 10476 |
| 1644 | Ga0501073_0028618 | 3300049589 | Bacteria | 3981 |
| 1645 | Ga0501073_0040649 | 3300049589 | Bacteria | 3289 |
| 1646 | Ga0501073_0048979 | 3300049589 | Bacteria | 2963 |
| 1647 | Ga0501073_0085962 | 3300049589 | Bacteria | 2187 |
| 1648 | Ga0501073_0215286 | 3300049589 | Bacteria | 1327 |
| 1649 | Ga0501073_0222782 | 3300049589 | Bacteria | 1303 |
| 1650 | Ga0501073_0436380 | 3300049589 | Bacteria | 905 |
| 1651 | Ga0501074_0008250 | 3300049590 | Bacteria | 7550 |
| 1652 | Ga0501074_0010906 | 3300049590 | Bacteria | 6595 |
| 1653 | Ga0501074_0058520 | 3300049590 | Bacteria | 2777 |
| 1654 | Ga0501074_0169846 | 3300049590 | Bacteria | 1557 |
| 1655 | Ga0501074_0174752 | 3300049590 | Bacteria | 1533 |
| 1656 | Ga0501074_0297540 | 3300049590 | Bacteria | 1146 |
| 1657 | Ga0501074_0556438 | 3300049590 | Bacteria | 812 |
| 1658 | Ga0501075_0095302 | 3300049591 | Bacteria | 2258 |
| 1659 | Ga0501075_0114552 | 3300049591 | Bacteria | 2050 |
| 1660 | Ga0501076_0017899 | 3300049592 | Bacteria | 5388 |
| 1661 | Ga0501076_0054065 | 3300049592 | Bacteria | 3182 |
| 1662 | Ga0501076_0094419 | 3300049592 | Bacteria | 2408 |
| 1663 | Ga0501076_0188244 | 3300049592 | Bacteria | 1684 |
| 1664 | Ga0501076_0382548 | 3300049592 | Bacteria | 1157 |
| 1665 | Ga0501077_0196207 | 3300049593 | Bacteria | 1282 |
| 1666 | Ga0501077_0211172 | 3300049593 | Bacteria | 1233 |
| 1667 | Ga0501079_0001478 | 3300049741 | Bacteria | 16629 |
| 1668 | Ga0501079_0011059 | 3300049741 | Bacteria | 6882 |
| 1669 | Ga0501079_0018448 | 3300049741 | Bacteria | 5331 |
| 1670 | Ga0501079_0037891 | 3300049741 | Bacteria | 3717 |
| 1671 | Ga0501079_0056415 | 3300049741 | Bacteria | 3031 |
| 1672 | Ga0501079_0081804 | 3300049741 | Bacteria | 2497 |
| 1673 | Ga0501079_0142053 | 3300049741 | Bacteria | 1870 |
| 1674 | Ga0501079_0356873 | 3300049741 | Bacteria | 1145 |
| 1675 | Ga0501080_0006960 | 3300049742 | Bacteria | 10202 |
| 1676 | Ga0501080_0028291 | 3300049742 | Bacteria | 5213 |
| 1677 | Ga0501080_0064957 | 3300049742 | Bacteria | 3395 |
| 1678 | Ga0501080_0081520 | 3300049742 | Bacteria | 3006 |
| 1679 | Ga0501080_0247437 | 3300049742 | Bacteria | 1626 |
| 1680 | Ga0501080_0254414 | 3300049742 | Bacteria | 1601 |
| 1681 | Ga0501080_0278784 | 3300049742 | Bacteria | 1520 |
| 1682 | Ga0501080_0279412 | 3300049742 | Bacteria | 1518 |
| 1683 | Ga0501080_0294504 | 3300049742 | Bacteria | 1473 |
| 1684 | Ga0501080_0325595 | 3300049742 | Bacteria | 1390 |
| 1685 | Ga0501080_0361098 | 3300049742 | Bacteria | 1310 |
| 1686 | Ga0501080_0394041 | 3300049742 | Bacteria | 1246 |
| 1687 | Ga0501081_0029037 | 3300049743 | Bacteria | 3735 |
| 1688 | Ga0501081_0089635 | 3300049743 | Bacteria | 2161 |
| 1689 | Ga0501083_0008114 | 3300049744 | Bacteria | 7426 |
| 1690 | Ga0501083_0028991 | 3300049744 | Bacteria | 3811 |
| 1691 | Ga0501083_0069494 | 3300049744 | Bacteria | 2343 |
| 1692 | Ga0501083_0071786 | 3300049744 | Bacteria | 2301 |
| 1693 | Ga0501083_0095282 | 3300049744 | Bacteria | 1964 |
| 1694 | Ga0501083_0163629 | 3300049744 | Bacteria | 1455 |
| 1695 | Ga0501083_0167731 | 3300049744 | Bacteria | 1435 |
| 1696 | Ga0501083_0170624 | 3300049744 | Bacteria | 1422 |
| 1697 | Ga0501083_0393089 | 3300049744 | Bacteria | 902 |
| 1698 | Ga0501035_0000255 | 3300049822 | Bacteria | 63841 |
| 1699 | Ga0501035_0005931 | 3300049822 | Bacteria | 11499 |
| 1700 | Ga0501035_0013364 | 3300049822 | Bacteria | 7579 |
| 1701 | Ga0501035_0024934 | 3300049822 | Bacteria | 5484 |
| 1702 | Ga0501035_0043569 | 3300049822 | Bacteria | 4043 |
| 1703 | Ga0501035_0051927 | 3300049822 | Bacteria | 3668 |
| 1704 | Ga0501035_0055903 | 3300049822 | Bacteria | 3523 |
| 1705 | Ga0501035_0066191 | 3300049822 | Bacteria | 3207 |
| 1706 | Ga0501035_0073482 | 3300049822 | Bacteria | 3025 |
| 1707 | Ga0501035_0079965 | 3300049822 | Bacteria | 2886 |
| 1708 | Ga0501035_0082602 | 3300049822 | Bacteria | 2835 |
| 1709 | Ga0501035_0158311 | 3300049822 | Bacteria | 1962 |
| 1710 | Ga0501035_0224354 | 3300049822 | Bacteria | 1603 |
| 1711 | Ga0501035_0227016 | 3300049822 | Bacteria | 1592 |
| 1712 | Ga0501035_0249041 | 3300049822 | Bacteria | 1509 |
| 1713 | Ga0501035_0322372 | 3300049822 | Bacteria | 1298 |
| 1714 | Ga0501044_0014028 | 3300049823 | Bacteria | 8651 |
| 1715 | Ga0501044_0028702 | 3300049823 | Bacteria | 5870 |
| 1716 | Ga0501044_0038683 | 3300049823 | Bacteria | 4980 |
| 1717 | Ga0501044_0044447 | 3300049823 | Bacteria | 4609 |
| 1718 | Ga0501044_0062058 | 3300049823 | Bacteria | 3821 |
| 1719 | Ga0501044_0107934 | 3300049823 | Bacteria | 2794 |
| 1720 | Ga0501044_0118786 | 3300049823 | Bacteria | 2646 |
| 1721 | Ga0501044_0119255 | 3300049823 | Bacteria | 2641 |
| 1722 | Ga0501044_0134695 | 3300049823 | Bacteria | 2462 |
| 1723 | Ga0501044_0138736 | 3300049823 | Bacteria | 2421 |
| 1724 | Ga0501044_0141817 | 3300049823 | Bacteria | 2391 |
| 1725 | Ga0501044_0225504 | 3300049823 | Bacteria | 1823 |
| 1726 | Ga0501044_0233773 | 3300049823 | Bacteria | 1784 |
| 1727 | Ga0501044_0238198 | 3300049823 | Bacteria | 1764 |
| 1728 | Ga0501044_0270633 | 3300049823 | Bacteria | 1634 |
| 1729 | Ga0501044_0275130 | 3300049823 | Bacteria | 1618 |
| 1730 | Ga0501044_0278859 | 3300049823 | Bacteria | 1605 |
| 1731 | Ga0501044_0343028 | 3300049823 | Bacteria | 1414 |
| 1732 | Ga0501044_0381449 | 3300049823 | Bacteria | 1324 |
| 1733 | Ga0501044_0398557 | 3300049823 | Bacteria | 1289 |
| 1734 | Ga0501044_0410246 | 3300049823 | Bacteria | 1266 |
| 1735 | Ga0501044_0451214 | 3300049823 | Bacteria | 1192 |
| 1736 | Ga0501044_0824870 | 3300049823 | Bacteria | 805 |
| 1737 | Ga0501045_0070801 | 3300049824 | Bacteria | 2566 |
| 1738 | Ga0501045_0087751 | 3300049824 | Bacteria | 2297 |
| 1739 | Ga0501045_0142155 | 3300049824 | Bacteria | 1784 |
| 1740 | Ga0501045_0461578 | 3300049824 | Bacteria | 944 |
| 1741 | nmdc:mga03683_51131_c1 | 3300050489 | Bacteria | 1724 |
| 1742 | nmdc:mga03n38_189102_c1 | 3300050490 | Bacteria | 1060 |
| 1743 | nmdc:mga03n38_59041_c1 | 3300050490 | Bacteria | 1740 |
| 1744 | nmdc:mga00v17_255849_c1 | 3300050491 | Bacteria | 1136 |
| 1745 | nmdc:mga00v17_6230_c1 | 3300050491 | Bacteria | 6326 |
| 1746 | nmdc:mga0yw44_19482_c1 | 3300050492 | Bacteria | 3743 |
| 1747 | nmdc:mga0yw44_46317_c1 | 3300050492 | Bacteria | 2611 |
| 1748 | nmdc:mga0k408_25101_c1 | 3300050493 | Bacteria | 3373 |
| 1749 | nmdc:mga06z11_171341_c1 | 3300050494 | Bacteria | 1247 |
| 1750 | nmdc:mga06z11_7008_c1 | 3300050494 | Bacteria | 4623 |
| 1751 | nmdc:mga07m45_120105_c1 | 3300050496 | Bacteria | 1518 |
| 1752 | nmdc:mga07m45_28689_c1 | 3300050496 | Bacteria | 3072 |
| 1753 | nmdc:mga05p37_1004186_c1 | 3300050507 | Bacteria | 886 |
| 1754 | nmdc:mga05p37_1773_c1 | 3300050507 | Bacteria | 25196 |
| 1755 | nmdc:mga05p37_2437_c1 | 3300050507 | Bacteria | 21635 |
| 1756 | nmdc:mga05p37_36180_c1 | 3300050507 | Bacteria | 6059 |
| 1757 | nmdc:mga09592_1370_c1 | 3300050508 | Bacteria | 19524 |
| 1758 | nmdc:mga0qj67_2465_c1 | 3300050509 | Bacteria | 13183 |
| 1759 | nmdc:mga06r32_591663_c1 | 3300050510 | Bacteria | 1081 |
| 1760 | nmdc:mga06r32_638_c1 | 3300050510 | Bacteria | 30472 |
| 1761 | nmdc:mga08y16_319763_c1 | 3300050511 | Bacteria | 1598 |
| 1762 | nmdc:mga08y16_35725_c1 | 3300050511 | Bacteria | 5219 |
| 1763 | nmdc:mga08y16_413994_c1 | 3300050511 | Bacteria | 1378 |
| 1764 | nmdc:mga08y16_44765_c1 | 3300050511 | Bacteria | 4639 |
| 1765 | nmdc:mga08y16_549_c1 | 3300050511 | Bacteria | 34756 |
| 1766 | nmdc:mga08y16_95891_c1 | 3300050511 | Bacteria | 3089 |
| 1767 | nmdc:mga0n895_158795_c1 | 3300050512 | Bacteria | 2292 |
| 1768 | nmdc:mga0n895_19785_c1 | 3300050512 | Bacteria | 6264 |
| 1769 | nmdc:mga0n895_256768_c1 | 3300050512 | Bacteria | 1774 |
| 1770 | nmdc:mga0n895_283_c1 | 3300050512 | Bacteria | 33340 |
| 1771 | nmdc:mga0n895_343834_c1 | 3300050512 | Bacteria | 1511 |
| 1772 | nmdc:mga0n895_6552_c1 | 3300050512 | Bacteria | 9908 |
| 1773 | nmdc:mga0rr50_127821_c1 | 3300050513 | Bacteria | 2031 |
| 1774 | nmdc:mga0rr50_142937_c1 | 3300050513 | Bacteria | 1926 |
| 1775 | nmdc:mga0rr50_15656_c1 | 3300050513 | Bacteria | 5011 |
| 1776 | nmdc:mga0rr50_21738_c1 | 3300050513 | Bacteria | 4387 |
| 1777 | nmdc:mga0rr50_579135_c1 | 3300050513 | Bacteria | 956 |
| 1778 | nmdc:mga08x19_14934_c1 | 3300050514 | Bacteria | 4717 |
| 1779 | nmdc:mga08x19_177_c1 | 3300050514 | Bacteria | 51482 |
| 1780 | nmdc:mga08x19_195316_c1 | 3300050514 | Bacteria | 1386 |
| 1781 | nmdc:mga08x19_67568_c1 | 3300050514 | Bacteria | 2325 |
| 1782 | nmdc:mga08x19_91478_c1 | 3300050514 | Bacteria | 2008 |
| 1783 | nmdc:mga0a205_136415_c1 | 3300050515 | Bacteria | 2354 |
| 1784 | nmdc:mga0a205_171385_c1 | 3300050515 | Bacteria | 2066 |
| 1785 | nmdc:mga0a205_19999_c1 | 3300050515 | Bacteria | 6316 |
| 1786 | nmdc:mga0a205_387_c1 | 3300050515 | Bacteria | 33459 |
| 1787 | nmdc:mga0a205_8273_c1 | 3300050515 | Bacteria | 9459 |
| 1788 | nmdc:mga0sz30_104861_c1 | 3300050516 | Bacteria | 1236 |
| 1789 | nmdc:mga0sz30_11705_c1 | 3300050516 | Bacteria | 3395 |
| 1790 | nmdc:mga0sz30_8120_c1 | 3300050516 | Bacteria | 3954 |
| 1791 | Ga0495601_0001193 | 3300053077 | Bacteria | 14223 |
| 1792 | Ga0495601_0002336 | 3300053077 | Bacteria | 10730 |
| 1793 | Ga0495601_0004742 | 3300053077 | Bacteria | 7882 |
| 1794 | Ga0495601_0005274 | 3300053077 | Bacteria | 7518 |
| 1795 | Ga0495601_0005651 | 3300053077 | Bacteria | 7293 |
| 1796 | Ga0495601_0007365 | 3300053077 | Bacteria | 6453 |
| 1797 | Ga0495601_0032855 | 3300053077 | Bacteria | 3232 |
| 1798 | Ga0495601_0050869 | 3300053077 | Bacteria | 2614 |
| 1799 | Ga0495601_0181136 | 3300053077 | Bacteria | 1377 |
| 1800 | Ga0495612_0017871 | 3300053078 | Bacteria | 2838 |
| 1801 | Ga0495612_0047295 | 3300053078 | Bacteria | 1763 |
| 1802 | Ga0495612_0063092 | 3300053078 | Bacteria | 1536 |
| 1803 | Ga0495595_0000532 | 3300053084 | Bacteria | 14535 |
| 1804 | Ga0495595_0001637 | 3300053084 | Bacteria | 8760 |
| 1805 | Ga0495595_0022326 | 3300053084 | Bacteria | 2777 |
| 1806 | Ga0495595_0050071 | 3300053084 | Bacteria | 1933 |
| 1807 | Ga0495595_0080343 | 3300053084 | Bacteria | 1552 |
| 1808 | Ga0495595_0085816 | 3300053084 | Bacteria | 1505 |
| 1809 | Ga0495619_0001164 | 3300053085 | Bacteria | 17272 |
| 1810 | Ga0495619_0001481 | 3300053085 | Bacteria | 15481 |
| 1811 | Ga0495619_0002710 | 3300053085 | Bacteria | 11582 |
| 1812 | Ga0495619_0015650 | 3300053085 | Bacteria | 4801 |
| 1813 | Ga0495619_0041602 | 3300053085 | Bacteria | 3006 |
| 1814 | Ga0495619_0043000 | 3300053085 | Bacteria | 2960 |
| 1815 | Ga0495619_0060862 | 3300053085 | Bacteria | 2511 |
| 1816 | Ga0495619_0125863 | 3300053085 | Bacteria | 1758 |
| 1817 | Ga0495619_0480959 | 3300053085 | Bacteria | 855 |
| 1818 | Ga0500578_0236727 | 3300053086 | Bacteria | 1104 |
| 1819 | Ga0500643_005061 | 3300053087 | Bacteria | 5766 |
| 1820 | Ga0500643_052533 | 3300053087 | Bacteria | 1161 |
| 1821 | Ga0500644_0008929 | 3300053088 | Bacteria | 2662 |
| 1822 | Ga0500644_0032371 | 3300053088 | Bacteria | 1670 |
| 1823 | Ga0500646_0003562 | 3300053090 | Bacteria | 3987 |
| 1824 | Ga0500646_0016450 | 3300053090 | Bacteria | 1932 |
| 1825 | Ga0500651_0045191 | 3300053093 | Bacteria | 2771 |
| 1826 | Ga0500651_0115831 | 3300053093 | Bacteria | 1631 |
| 1827 | Ga0500641_0005677 | 3300053096 | Bacteria | 4421 |
| 1828 | Ga0500641_0021719 | 3300053096 | Bacteria | 2451 |
| 1829 | Ga0500650_0001523 | 3300053098 | Bacteria | 7063 |
| 1830 | Ga0500654_112898 | 3300053099 | Bacteria | 1104 |
| 1831 | Ga0500556_0000125 | 3300053104 | Bacteria | 65777 |
| 1832 | Ga0500593_174969 | 3300053117 | Bacteria | 804 |
| 1833 | Ga0500595_000016 | 3300053119 | Bacteria | 211397 |
| 1834 | Ga0500595_010713 | 3300053119 | Bacteria | 3628 |
| 1835 | Ga0500595_018990 | 3300053119 | Bacteria | 2501 |
| 1836 | Ga0500608_027463 | 3300053122 | Bacteria | 2682 |
| 1837 | Ga0500642_0000105 | 3300053130 | Bacteria | 40593 |
| 1838 | Ga0500642_0009901 | 3300053130 | Bacteria | 3335 |
| 1839 | Ga0500642_0127103 | 3300053130 | Bacteria | 1194 |
| 1840 | Ga0500652_019736 | 3300053131 | Bacteria | 2509 |
| 1841 | Ga0500652_051493 | 3300053131 | Bacteria | 1682 |
| 1842 | Ga0500655_006775 | 3300053133 | Bacteria | 2061 |
| 1843 | Ga0500658_0086249 | 3300053134 | Bacteria | 1350 |
| 1844 | Ga0500559_0062898 | 3300053136 | Bacteria | 1658 |
| 1845 | Ga0500559_0277986 | 3300053136 | Bacteria | 787 |
| 1846 | Ga0500568_0014095 | 3300053139 | Bacteria | 3622 |
| 1847 | Ga0500568_0041603 | 3300053139 | Bacteria | 1846 |
| 1848 | Ga0500568_0159862 | 3300053139 | Bacteria | 831 |
| 1849 | Ga0500573_0000452 | 3300053140 | Bacteria | 17648 |
| 1850 | Ga0500573_0006745 | 3300053140 | Bacteria | 6228 |
| 1851 | Ga0500586_007745 | 3300053145 | Bacteria | 2885 |
| 1852 | Ga0500616_0000085 | 3300053153 | Bacteria | 193192 |
| 1853 | Ga0500616_0000876 | 3300053153 | Bacteria | 33191 |
| 1854 | Ga0500616_0070843 | 3300053153 | Bacteria | 1778 |
| 1855 | Ga0500619_033505 | 3300053154 | Bacteria | 1581 |
| 1856 | Ga0500622_0013118 | 3300053156 | Bacteria | 4473 |
| 1857 | Ga0500624_007708 | 3300053157 | Bacteria | 1489 |
| 1858 | Ga0500627_0046797 | 3300053158 | Bacteria | 1875 |
| 1859 | Ga0500567_130262 | 3300053723 | Bacteria | 985 |
| 1860 | Ga0500645_001772 | 3300053730 | Bacteria | 10420 |
| 1861 | Ga0501084_0000175 | 3300054114 | Bacteria | 50123 |
| 1862 | Ga0501084_0028118 | 3300054114 | Bacteria | 4698 |
| 1863 | Ga0501084_0030163 | 3300054114 | Bacteria | 4535 |
| 1864 | Ga0501084_0034419 | 3300054114 | Bacteria | 4236 |
| 1865 | Ga0501084_0044330 | 3300054114 | Bacteria | 3724 |
| 1866 | Ga0501084_0059035 | 3300054114 | Bacteria | 3210 |
| 1867 | Ga0501084_0311314 | 3300054114 | Bacteria | 1330 |
| 1868 | Ga0501084_0393799 | 3300054114 | Bacteria | 1171 |
| 1869 | Ga0501082_0000653 | 3300060353 | Bacteria | 30577 |
| 1870 | Ga0501082_0004728 | 3300060353 | Bacteria | 11876 |
| 1871 | Ga0501082_0027700 | 3300060353 | Bacteria | 4878 |
| 1872 | Ga0501082_0032834 | 3300060353 | Bacteria | 4477 |
| 1873 | Ga0501082_0093597 | 3300060353 | Bacteria | 2597 |
| 1874 | Ga0501082_0108585 | 3300060353 | Bacteria | 2401 |
| 1875 | Ga0501082_0131205 | 3300060353 | Bacteria | 2174 |
| 1876 | Ga0501082_0160690 | 3300060353 | Bacteria | 1952 |
| 1877 | Ga0501082_0181935 | 3300060353 | Bacteria | 1828 |
| 1878 | Ga0501082_0230867 | 3300060353 | Bacteria | 1610 |
| 1879 | Ga0501082_0308123 | 3300060353 | Bacteria | 1379 |
| 1880 | Ga0530510_0179127 | 3300061734 | Bacteria | 1571 |
| 1881 | Ga0530510_0268027 | 3300061734 | Bacteria | 1274 |
| 1882 | 2513857536 | 2513237137 | Bacteria | 9558895 |
| 1883 | 2524537994 | 2524023228 | Bacteria | 10118060 |
| 1884 | 2603859871 | 2602042107 | Bacteria | 6226103 |
| 1885 | 2643755779 | 2643221547 | Bacteria | 4740017 |
| 1886 | 2644287952 | 2643221651 | Bacteria | 4798932 |
| 1887 | 2793071754 | 2791355197 | Bacteria | 8420563 |
| 1888 | 2857528519 | 2857524615 | Bacteria | 6615449 |
| 1889 | 2893070165 | 2893066018 | Bacteria | 6158120 |
| 1890 | 2903758267 | 2903748898 | Bacteria | 9972761 |
| 1891 | 2904701654 | |||
| 1892 | 2906610374 | |||
| 1893 | 2919076116 | 2919073203 | Bacteria | 6531949 |
| 1894 | 2922428987 | |||
| 1895 | 8006942216 | 8006933436 | Bacteria | 10410654 |
| 1896 | 8006981950 | 8006973647 | Bacteria | 10679141 |
| 1897 | Ga0265316_10018043 | |||
| 1898 | ARcpr5oldR_c000035 | |||
| 1899 | ARcpr5yngRDRAFT_c000212 | |||
| 1900 | ARcpr5yngRDRAFT_c001457 | |||
| 1901 | ARSoilOldRDRAFT_c000208 | |||
| 1902 | ARSoilOldRDRAFT_c001089 | |||
| 1903 | ARCol0oldRDRAFT_c00767 | |||
| 1904 | LJQas_1006294 | |||
| 1905 | ARCol0yngRDRAFT_1000025 | |||
| 1906 | JGI24747J21853_1003301 | |||
| 1907 | JGI24739J22299_10001271 | |||
| 1908 | JGI24737J22298_10002998 | |||
| 1909 | JGI24737J22298_10007299 | |||
| 1910 | JGI24737J22298_10020339 | |||
| 1911 | JGI24735J21928_10012540 | |||
| 1912 | JGI24750J21931_1001136 | |||
| 1913 | JGI24745J21846_1000034 | |||
| 1914 | JGI24745J21846_1000277 | |||
| 1915 | JGI24748J21848_1000741 | |||
| 1916 | JGI24738J21930_10001754 | |||
| 1917 | JGI24749J21850_1002096 | |||
| 1918 | JGI24744J21845_10000241 | |||
| 1919 | JGI24742J22300_10000465 | |||
| 1920 | JGI25406J46586_10002015 | |||
| 1921 | JGI25165J46597_1001315 | |||
| 1922 | JGI25153J46596_10010402 | |||
| 1923 | Ga0007410J51695_1034900 | |||
| 1924 | JGI25404J52841_10015726 | |||
| 1925 | Ga0058862_12808773 | |||
| 1926 | Ga0065712_10138949 | |||
| 1927 | Ga0065715_10002813 | |||
| 1928 | Ga0065715_10009083 | |||
| 1929 | Ga0070658_10018691 | |||
| 1930 | Ga0070658_10021396 | |||
| 1931 | Ga0070658_10059824 | |||
| 1932 | Ga0070658_10416724 | |||
| 1933 | Ga0070676_10001242 | |||
| 1934 | Ga0070676_10018760 | |||
| 1935 | Ga0070676_10200933 | |||
| 1936 | Ga0070676_10201179 | |||
| 1937 | Ga0070676_10406381 | |||
| 1938 | Ga0070683_100002064 | |||
| 1939 | Ga0070683_100404282 | |||
| 1940 | Ga0070683_100678487 | |||
| 1941 | Ga0070690_100020216 | |||
| 1942 | Ga0070690_100027028 | |||
| 1943 | Ga0070690_100064067 | |||
| 1944 | Ga0070670_100006103 | |||
| 1945 | Ga0070670_100036557 | |||
| 1946 | Ga0070670_100305757 | |||
| 1947 | Ga0070670_100356512 | |||
| 1948 | Ga0070677_10003234 | |||
| 1949 | Ga0070677_10211984 | |||
| 1950 | Ga0068869_100000755 | |||
| 1951 | Ga0068869_100049348 | |||
| 1952 | Ga0068869_100336424 | |||
| 1953 | Ga0070666_10044127 | |||
| 1954 | Ga0070666_10071615 | |||
| 1955 | Ga0070666_10087332 | |||
| 1956 | Ga0070666_10115779 | |||
| 1957 | Ga0070680_100013921 | |||
| 1958 | Ga0070680_100020347 | |||
| 1959 | Ga0070680_100046330 | |||
| 1960 | Ga0070680_100052990 | |||
| 1961 | Ga0070680_100062663 | |||
| 1962 | Ga0070680_100089957 | |||
| 1963 | Ga0070680_100137909 | |||
| 1964 | Ga0070680_100138570 | |||
| 1965 | Ga0070680_100143239 | |||
| 1966 | Ga0070680_100225377 | |||
| 1967 | Ga0070680_100232973 | |||
| 1968 | Ga0070682_100000693 | |||
| 1969 | Ga0070682_100067778 | |||
| 1970 | Ga0070682_100304094 | |||
| 1971 | Ga0068868_100043374 | |||
| 1972 | Ga0068868_100044894 | |||
| 1973 | Ga0068868_100201743 | |||
| 1974 | Ga0070660_100001324 | |||
| 1975 | Ga0070660_100004264 | |||
| 1976 | Ga0070660_100088013 | |||
| 1977 | Ga0070660_100233572 | |||
| 1978 | Ga0070660_100297578 | |||
| 1979 | Ga0070660_100387271 | |||
| 1980 | Ga0070660_100459760 | |||
| 1981 | Ga0070689_100031007 | |||
| 1982 | Ga0070689_100051095 | |||
| 1983 | Ga0070689_100051585 | |||
| 1984 | Ga0070691_10000386 | |||
| 1985 | Ga0070691_10000795 | |||
| 1986 | Ga0070691_10078003 | |||
| 1987 | Ga0070687_100000768 | |||
| 1988 | Ga0070687_100017582 | |||
| 1989 | Ga0070661_100005946 | |||
| 1990 | Ga0070661_100006236 | |||
| 1991 | Ga0070661_100197586 | |||
| 1992 | Ga0070692_10011093 | |||
| 1993 | Ga0070668_100002043 | |||
| 1994 | Ga0070668_100277534 | |||
| 1995 | Ga0070668_100330482 | |||
| 1996 | Ga0070669_100004204 | |||
| 1997 | Ga0070669_100056953 | |||
| 1998 | Ga0070669_100147551 | |||
| 1999 | Ga0070675_100004033 | |||
| 2000 | Ga0070675_100142778 | |||
| 2001 | Ga0070671_100029434 | |||
| 2002 | Ga0070671_100223769 | |||
| 2003 | Ga0070671_100514334 | |||
| 2004 | Ga0070674_100001294 | |||
| 2005 | Ga0070674_100031711 | |||
| 2006 | Ga0070674_100058873 | |||
| 2007 | Ga0070674_100379629 | |||
| 2008 | Ga0070673_100002364 | |||
| 2009 | Ga0070673_100026334 | |||
| 2010 | Ga0070673_100101196 | |||
| 2011 | Ga0070673_100786292 | |||
| 2012 | Ga0070688_100035071 | |||
| 2013 | Ga0070688_100100102 | |||
| 2014 | Ga0070688_100200154 | |||
| 2015 | Ga0070688_100219310 | |||
| 2016 | Ga0070688_100233871 | |||
| 2017 | Ga0070659_100005048 | |||
| 2018 | Ga0070659_100018128 | |||
| 2019 | Ga0070659_100046184 | |||
| 2020 | Ga0070667_100010781 | |||
| 2021 | Ga0070667_100052294 | |||
| 2022 | Ga0070667_100214012 | |||
| 2023 | Ga0070667_100251409 | |||
| 2024 | Ga0070667_100339918 | |||
| 2025 | Ga0070667_100489645 | |||
| 2026 | Ga0070709_10003511 | |||
| 2027 | Ga0070709_10022452 | |||
| 2028 | Ga0070709_10048294 | |||
| 2029 | Ga0070709_10064061 | |||
| 2030 | Ga0070709_10308544 | |||
| 2031 | Ga0070709_10385642 | |||
| 2032 | Ga0070714_100009083 | |||
| 2033 | Ga0070714_100011419 | |||
| 2034 | Ga0070714_100017244 | |||
| 2035 | Ga0070714_100027595 | |||
| 2036 | Ga0070714_100107950 | |||
| 2037 | Ga0070714_100142833 | |||
| 2038 | Ga0070714_100148074 | |||
| 2039 | Ga0070714_100305726 | |||
| 2040 | Ga0070714_100339019 | |||
| 2041 | Ga0070714_100731402 | |||
| 2042 | Ga0070713_100000012 | |||
| 2043 | Ga0070713_100042539 | |||
| 2044 | Ga0070713_100051698 | |||
| 2045 | Ga0070713_100060535 | |||
| 2046 | Ga0070713_100103102 | |||
| 2047 | Ga0070713_100617693 | |||
| 2048 | Ga0070710_10005644 | |||
| 2049 | Ga0070710_10014954 | |||
| 2050 | Ga0070710_10052773 | |||
| 2051 | Ga0070710_10103973 | |||
| 2052 | Ga0070710_10146698 | |||
| 2053 | Ga0070701_10318394 | |||
| 2054 | Ga0070711_100004304 | |||
| 2055 | Ga0070711_100027798 | |||
| 2056 | Ga0070711_100079027 | |||
| 2057 | Ga0070711_100140078 | |||
| 2058 | Ga0070711_100145188 | |||
| 2059 | Ga0070711_100286851 | |||
| 2060 | Ga0070711_100746895 | |||
| 2061 | Ga0070705_100001981 | |||
| 2062 | Ga0070705_100068685 | |||
| 2063 | Ga0070700_100017413 | |||
| 2064 | Ga0070694_100007138 | |||
| 2065 | Ga0070694_100010924 | |||
| 2066 | Ga0070708_100060973 | |||
| 2067 | Ga0070708_100469201 | |||
| 2068 | Ga0070663_100010153 | |||
| 2069 | Ga0070663_100028446 | |||
| 2070 | Ga0070663_100150267 | |||
| 2071 | Ga0070663_100290596 | |||
| 2072 | Ga0070678_100004700 | |||
| 2073 | Ga0070678_100006525 | |||
| 2074 | Ga0070678_100010048 | |||
| 2075 | Ga0070678_100202402 | |||
| 2076 | Ga0070678_100492298 | |||
| 2077 | Ga0070678_100677019 | |||
| 2078 | Ga0070678_100720491 | |||
| 2079 | Ga0070662_100007011 | |||
| 2080 | Ga0070662_100049113 | |||
| 2081 | Ga0070662_100464192 | |||
| 2082 | Ga0070681_10000037 | |||
| 2083 | Ga0070681_10010029 | |||
| 2084 | Ga0070681_10029025 | |||
| 2085 | Ga0070681_10029349 | |||
| 2086 | Ga0070681_10066848 | |||
| 2087 | Ga0070681_10078949 | |||
| 2088 | Ga0070681_10111364 | |||
| 2089 | Ga0070681_10218303 | |||
| 2090 | Ga0070681_10410685 | |||
| 2091 | Ga0070681_10598653 | |||
| 2092 | Ga0070681_10867119 | |||
| 2093 | Ga0068867_100003543 | |||
| 2094 | Ga0068867_100040232 | |||
| 2095 | Ga0068867_100137801 | |||
| 2096 | Ga0068867_100820916 | |||
| 2097 | Ga0070685_10222405 | |||
| 2098 | Ga0070699_100265743 | |||
| 2099 | Ga0070679_100008411 | |||
| 2100 | Ga0070679_100035943 | |||
| 2101 | Ga0070679_100058331 | |||
| 2102 | Ga0070679_100069873 | |||
| 2103 | Ga0070679_100186092 | |||
| 2104 | Ga0070679_100255070 | |||
| 2105 | Ga0070684_100007624 | |||
| 2106 | Ga0070684_100276337 | |||
| 2107 | Ga0070684_100470348 | |||
| 2108 | Ga0068853_100002020 | |||
| 2109 | Ga0068853_100002660 | |||
| 2110 | Ga0068853_100023191 | |||
| 2111 | Ga0068853_100117767 | |||
| 2112 | Ga0068853_100125502 | |||
| 2113 | Ga0070672_100002637 | |||
| 2114 | Ga0070672_100003392 | |||
| 2115 | Ga0070672_100286596 | |||
| 2116 | Ga0070686_100004029 | |||
| 2117 | Ga0070686_100202066 | |||
| 2118 | Ga0070686_100351558 | |||
| 2119 | Ga0070695_100003098 | |||
| 2120 | Ga0070695_100014423 | |||
| 2121 | Ga0070695_100039405 | |||
| 2122 | Ga0070696_100010916 | |||
| 2123 | Ga0070693_100051681 | |||
| 2124 | Ga0070693_100054219 | |||
| 2125 | Ga0070693_100214218 | |||
| 2126 | Ga0070693_100251057 | |||
| 2127 | Ga0070665_100014624 | |||
| 2128 | Ga0070665_100128255 | |||
| 2129 | Ga0070665_100174797 | |||
| 2130 | Ga0070665_100271609 | |||
| 2131 | Ga0070665_100291751 | |||
| 2132 | Ga0070665_100377545 | |||
| 2133 | Ga0070665_100675610 | |||
| 2134 | Ga0070704_100004936 | |||
| 2135 | Ga0068855_100012001 | |||
| 2136 | Ga0068855_100047378 | |||
| 2137 | Ga0068855_100057023 | |||
| 2138 | Ga0068855_100093513 | |||
| 2139 | Ga0068855_100149068 | |||
| 2140 | Ga0068855_100285728 | |||
| 2141 | Ga0068855_100296783 | |||
| 2142 | Ga0068855_100349371 | |||
| 2143 | Ga0068855_101093999 | |||
| 2144 | Ga0070664_100004534 | |||
| 2145 | Ga0070664_100066218 | |||
| 2146 | Ga0070664_100290295 | |||
| 2147 | Ga0068857_100006037 | |||
| 2148 | Ga0068857_100007896 | |||
| 2149 | Ga0068857_100115785 | |||
| 2150 | Ga0068857_100180341 | |||
| 2151 | Ga0068857_100198674 | |||
| 2152 | Ga0068857_100338159 | |||
| 2153 | Ga0068857_100431518 | |||
| 2154 | Ga0068854_100329508 | |||
| 2155 | Ga0068854_100630810 | |||
| 2156 | Ga0068856_100001032 | |||
| 2157 | Ga0068856_100008706 | |||
| 2158 | Ga0068856_100034393 | |||
| 2159 | Ga0068856_100154116 | |||
| 2160 | Ga0068856_100344995 | |||
| 2161 | Ga0068856_100941438 | |||
| 2162 | Ga0070702_100000378 | |||
| 2163 | Ga0070702_100148776 | |||
| 2164 | Ga0068852_100006800 | |||
| 2165 | Ga0068852_100017082 | |||
| 2166 | Ga0068852_100022852 | |||
| 2167 | Ga0068852_100025730 | |||
| 2168 | Ga0068852_100142141 | |||
| 2169 | Ga0068852_100400874 | |||
| 2170 | Ga0068852_100515820 | |||
| 2171 | Ga0068859_100007402 | |||
| 2172 | Ga0068859_100391446 | |||
| 2173 | Ga0068859_100622809 | |||
| 2174 | Ga0068864_100000595 | |||
| 2175 | Ga0068864_100521538 | |||
| 2176 | Ga0068861_100002973 | |||
| 2177 | Ga0068861_100098923 | |||
| 2178 | Ga0068861_100189622 | |||
| 2179 | Ga0068851_10037994 | |||
| 2180 | Ga0068851_10102652 | |||
| 2181 | Ga0068851_10374922 | |||
| 2182 | Ga0068870_10000216 | |||
| 2183 | Ga0068863_100022557 | |||
| 2184 | Ga0068863_100254929 | |||
| 2185 | Ga0068863_100755481 | |||
| 2186 | Ga0068863_100908860 | |||
| 2187 | Ga0068858_100024760 | |||
| 2188 | Ga0068858_100144437 | |||
| 2189 | Ga0068860_100007174 | |||
| 2190 | Ga0068860_100583209 | |||
| 2191 | Ga0068862_100017504 | |||
| 2192 | Ga0068862_100018639 | |||
| 2193 | Ga0068862_100057395 | |||
| 2194 | Ga0068862_100192379 | |||
| 2195 | Ga0068862_100723989 | |||
| 2196 | Ga0081455_10000048 | |||
| 2197 | Ga0081455_10012767 | |||
| 2198 | Ga0081538_10001041 | |||
| 2199 | Ga0081538_10006728 | |||
| 2200 | Ga0081540_1001166 | |||
| 2201 | Ga0081540_1002979 | |||
| 2202 | Ga0081539_10004794 | |||
| 2203 | Ga0070717_10039765 | |||
| 2204 | Ga0070717_10130640 | |||
| 2205 | Ga0070717_10519040 | |||
| 2206 | Ga0075365_10103453 | |||
| 2207 | Ga0075368_10034503 | |||
| 2208 | Ga0075368_10037933 | |||
| 2209 | Ga0075363_100060337 | |||
| 2210 | Ga0075363_100118875 | |||
| 2211 | Ga0075364_10019516 | |||
| 2212 | Ga0075364_10063494 | |||
| 2213 | Ga0075364_10101082 | |||
| 2214 | Ga0070715_10056436 | |||
| 2215 | Ga0070716_100205070 | |||
| 2216 | Ga0070716_100207272 | |||
| 2217 | Ga0070716_100448776 | |||
| 2218 | Ga0070712_100000902 | |||
| 2219 | Ga0070712_100004052 | |||
| 2220 | Ga0070712_100024878 | |||
| 2221 | Ga0070712_100092034 | |||
| 2222 | Ga0070712_100160466 | |||
| 2223 | Ga0070712_100186908 | |||
| 2224 | Ga0075367_10131800 | |||
| 2225 | Ga0075367_10225760 | |||
| 2226 | Ga0075367_10445522 | |||
| 2227 | Ga0075369_10005925 | |||
| 2228 | Ga0075369_10026380 | |||
| 2229 | Ga0075369_10064996 | |||
| 2230 | Ga0075366_10013189 | |||
| 2231 | Ga0097621_100000600 | |||
| 2232 | Ga0097621_100069869 | |||
| 2233 | Ga0097621_100127391 | |||
| 2234 | Ga0097621_100205433 | |||
| 2235 | Ga0097621_100587859 | |||
| 2236 | Ga0075370_10046577 | |||
| 2237 | Ga0075370_10111572 | |||
| 2238 | Ga0075370_10114641 | |||
| 2239 | Ga0068871_100000118 | |||
| 2240 | Ga0068871_100080549 | |||
| 2241 | Ga0068871_100317268 | |||
| 2242 | Ga0068871_100625611 | |||
| 2243 | Ga0068871_100833779 | |||
| 2244 | Ga0075428_100012701 | |||
| 2245 | Ga0075428_100048564 | |||
| 2246 | Ga0075428_100195979 | |||
| 2247 | Ga0075430_100000196 | |||
| 2248 | Ga0075430_100038858 | |||
| 2249 | Ga0075430_100294749 | |||
| 2250 | Ga0075431_100132984 | |||
| 2251 | Ga0075431_100443591 | |||
| 2252 | Ga0075431_101046779 | |||
| 2253 | Ga0075433_10029412 | |||
| 2254 | Ga0075433_10104991 | |||
| 2255 | Ga0075434_100003094 | |||
| 2256 | Ga0075434_100051111 | |||
| 2257 | Ga0075434_100153113 | |||
| 2258 | Ga0075434_100160681 | |||
| 2259 | Ga0075429_100000573 | |||
| 2260 | Ga0075429_100107524 | |||
| 2261 | Ga0068865_100007181 | |||
| 2262 | Ga0068865_100039028 | |||
| 2263 | Ga0068865_100527421 | |||
| 2264 | Ga0075436_100002564 | |||
| 2265 | Ga0075436_100019157 | |||
| 2266 | Ga0075436_100216753 | |||
| 2267 | Ga0097620_100007402 | |||
| 2268 | Ga0097620_100391445 | |||
| 2269 | Ga0097620_100622778 | |||
| 2270 | Ga0075435_100014955 | |||
| 2271 | Ga0075435_100017968 | |||
| 2272 | Ga0075435_100032499 | |||
| 2273 | Ga0075435_100140132 | |||
| 2274 | Ga0099795_10001950 | |||
| 2275 | Ga0105240_10004696 | |||
| 2276 | Ga0105240_10011051 | |||
| 2277 | Ga0105240_10017473 | |||
| 2278 | Ga0105240_10133003 | |||
| 2279 | Ga0105240_10455624 | |||
| 2280 | Ga0105240_10493821 | |||
| 2281 | Ga0105240_10652311 | |||
| 2282 | Ga0105240_10753714 | |||
| 2283 | Ga0111539_10000683 | |||
| 2284 | Ga0111539_10010079 | |||
| 2285 | Ga0111539_10070545 | |||
| 2286 | Ga0111539_10080440 | |||
| 2287 | Ga0111539_10303887 | |||
| 2288 | Ga0111539_10326450 | |||
| 2289 | Ga0105245_10003702 | |||
| 2290 | Ga0105245_10017665 | |||
| 2291 | Ga0105245_10030667 | |||
| 2292 | Ga0105245_10042887 | |||
| 2293 | Ga0105245_10072236 | |||
| 2294 | Ga0105245_10481226 | |||
| 2295 | Ga0105245_10590586 | |||
| 2296 | Ga0105245_10622355 | |||
| 2297 | Ga0105247_10151400 | |||
| 2298 | Ga0105247_10234068 | |||
| 2299 | Ga0114129_10005890 | |||
| 2300 | Ga0114129_10008352 | |||
| 2301 | Ga0114129_10030751 | |||
| 2302 | Ga0114129_10481451 | |||
| 2303 | Ga0114129_10783469 | |||
| 2304 | Ga0114129_10961834 | |||
| 2305 | Ga0105243_10009969 | |||
| 2306 | Ga0105243_10037311 | |||
| 2307 | Ga0105243_10068588 | |||
| 2308 | Ga0105243_10251410 | |||
| 2309 | Ga0105243_10348082 | |||
| 2310 | Ga0105241_10142659 | |||
| 2311 | Ga0105241_10159833 | |||
| 2312 | Ga0105241_10211682 | |||
| 2313 | Ga0105241_10336211 | |||
| 2314 | Ga0105242_10016828 | |||
| 2315 | Ga0105242_10044757 | |||
| 2316 | Ga0105242_10122649 | |||
| 2317 | Ga0105242_10154742 | |||
| 2318 | Ga0105242_10313029 | |||
| 2319 | Ga0105248_10000005 | |||
| 2320 | Ga0105248_10056191 | |||
| 2321 | Ga0105248_10114304 | |||
| 2322 | Ga0105248_10405807 | |||
| 2323 | Ga0105237_10027530 | |||
| 2324 | Ga0105237_10032303 | |||
| 2325 | Ga0105237_10053645 | |||
| 2326 | Ga0105237_10382504 | |||
| 2327 | Ga0105237_10469967 | |||
| 2328 | Ga0105238_10001939 | |||
| 2329 | Ga0105238_10035831 | |||
| 2330 | Ga0105238_10173207 | |||
| 2331 | Ga0105238_10176816 | |||
| 2332 | Ga0105238_10177982 | |||
| 2333 | Ga0105238_10303270 | |||
| 2334 | Ga0105238_10324246 | |||
| 2335 | Ga0105238_10652931 | |||
| 2336 | Ga0105238_11065567 | |||
| 2337 | Ga0105249_10002122 | |||
| 2338 | Ga0105249_10023350 | |||
| 2339 | Ga0105249_10161429 | |||
| 2340 | Ga0105249_10257311 | |||
| 2341 | Ga0099796_10001539 | |||
| 2342 | Ga0099796_10077406 | |||
| 2343 | Ga0105239_10028473 | |||
| 2344 | Ga0105239_10052904 | |||
| 2345 | Ga0105239_10057391 | |||
| 2346 | Ga0105239_10090514 | |||
| 2347 | Ga0105239_10115685 | |||
| 2348 | Ga0105239_10162951 | |||
| 2349 | Ga0105239_10220454 | |||
| 2350 | Ga0105239_10343841 | |||
| 2351 | Ga0105239_10413340 | |||
| 2352 | Ga0105246_10002558 | |||
| 2353 | Ga0105246_10140380 | |||
| 2354 | Ga0105246_10154831 | |||
| 2355 | Ga0105246_10305930 | |||
| 2356 | Ga0105246_10536917 | |||
| 2357 | Ga0157336_1001006 | |||
| 2358 | Ga0157373_10000820 | |||
| 2359 | Ga0157371_10057710 | |||
| 2360 | Ga0157371_10303390 | |||
| 2361 | Ga0157371_10428607 | |||
| 2362 | Ga0157370_10058956 | |||
| 2363 | Ga0157370_10082927 | |||
| 2364 | Ga0157370_10089027 | |||
| 2365 | Ga0157370_10187647 | |||
| 2366 | Ga0157370_10477886 | |||
| 2367 | Ga0157369_10001535 | |||
| 2368 | Ga0157369_10132262 | |||
| 2369 | Ga0157369_10153459 | |||
| 2370 | Ga0157369_10171228 | |||
| 2371 | Ga0157369_10447677 | |||
| 2372 | Ga0157374_10018401 | |||
| 2373 | Ga0157374_10115150 | |||
| 2374 | Ga0157378_10015153 | |||
| 2375 | Ga0157378_10112197 | |||
| 2376 | Ga0163162_10028695 | |||
| 2377 | Ga0163162_10046698 | |||
| 2378 | Ga0163162_10241481 | |||
| 2379 | Ga0163162_10770557 | |||
| 2380 | Ga0157372_10023820 | |||
| 2381 | Ga0157372_10059581 | |||
| 2382 | Ga0157372_10437922 | |||
| 2383 | Ga0157372_10468546 | |||
| 2384 | Ga0157372_10893284 | |||
| 2385 | Ga0157372_11042959 | |||
| 2386 | Ga0157372_11160265 | |||
| 2387 | Ga0157375_10007178 | |||
| 2388 | Ga0157375_10037143 | |||
| 2389 | Ga0157375_10154210 | |||
| 2390 | Ga0157375_10418092 | |||
| 2391 | Ga0157375_10776327 | |||
| 2392 | Ga0157375_10921856 | |||
| 2393 | Ga0163163_10008003 | |||
| 2394 | Ga0163163_10113766 | |||
| 2395 | Ga0163163_10159978 | |||
| 2396 | Ga0163163_10400600 | |||
| 2397 | Ga0163163_10664643 | |||
| 2398 | Ga0163163_10718688 | |||
| 2399 | Ga0157380_10021174 | |||
| 2400 | Ga0157380_10641176 | |||
| 2401 | Ga0157380_10762508 | |||
| 2402 | Ga0157377_10000628 | |||
| 2403 | Ga0157377_10384529 | |||
| 2404 | Ga0157379_10018151 | |||
| 2405 | Ga0157379_10018171 | |||
| 2406 | Ga0157379_10038101 | |||
| 2407 | Ga0157379_10071200 | |||
| 2408 | Ga0157379_10073976 | |||
| 2409 | Ga0157379_10307604 | |||
| 2410 | Ga0157379_10564259 | |||
| 2411 | Ga0157379_10874642 | |||
| 2412 | Ga0157376_10006966 | |||
| 2413 | Ga0157376_10273159 | |||
| 2414 | Ga0157376_10478212 | |||
| 2415 | Ga0163161_10009359 | |||
| 2416 | Ga0163161_10049613 | |||
| 2417 | Ga0213876_10000421 | |||
| 2418 | Ga0213876_10002961 | |||
| 2419 | Ga0213876_10003189 | |||
| 2420 | Ga0213876_10046760 | |||
| 2421 | Ga0213875_10000089 | |||
| 2422 | Ga0224712_10120152 | |||
| 2423 | Ga0209233_1000013 | |||
| 2424 | Ga0209233_1003250 | |||
| 2425 | Ga0207666_1000185 | |||
| 2426 | Ga0209455_1009081 | |||
| 2427 | Ga0209130_1036140 | |||
| 2428 | Ga0209564_1002708 | |||
| 2429 | Ga0209758_1000548 | |||
| 2430 | Ga0209758_1006193 | |||
| 2431 | Ga0207426_1026172 | |||
| 2432 | Ga0207697_10003861 | |||
| 2433 | Ga0207697_10034987 | |||
| 2434 | Ga0207656_10025078 | |||
| 2435 | Ga0207682_10000350 | |||
| 2436 | Ga0207682_10038677 | |||
| 2437 | Ga0207682_10076484 | |||
| 2438 | Ga0207692_10105360 | |||
| 2439 | Ga0207692_10201717 | |||
| 2440 | Ga0207692_10224858 | |||
| 2441 | Ga0207692_10236709 | |||
| 2442 | Ga0207710_10014061 | |||
| 2443 | Ga0207688_10007287 | |||
| 2444 | Ga0207688_10037550 | |||
| 2445 | Ga0207688_10283760 | |||
| 2446 | Ga0207680_10005899 | |||
| 2447 | Ga0207680_10129058 | |||
| 2448 | Ga0207680_10182716 | |||
| 2449 | Ga0207680_10531538 | |||
| 2450 | Ga0207647_10030675 | |||
| 2451 | Ga0207647_10033853 | |||
| 2452 | Ga0207647_10055947 | |||
| 2453 | Ga0207647_10278971 | |||
| 2454 | Ga0207685_10053068 | |||
| 2455 | Ga0207699_10000164 | |||
| 2456 | Ga0207699_10008214 | |||
| 2457 | Ga0207699_10043634 | |||
| 2458 | Ga0207699_10347377 | |||
| 2459 | Ga0207645_10010484 | |||
| 2460 | Ga0207645_10089754 | |||
| 2461 | Ga0207645_10091158 | |||
| 2462 | Ga0207645_10096386 | |||
| 2463 | Ga0207645_10099195 | |||
| 2464 | Ga0207645_10111940 | |||
| 2465 | Ga0207645_10150084 | |||
| 2466 | Ga0207643_10000009 | |||
| 2467 | Ga0207643_10268780 | |||
| 2468 | Ga0207705_10000180 | |||
| 2469 | Ga0207705_10004720 | |||
| 2470 | Ga0207705_10034426 | |||
| 2471 | Ga0207705_10039818 | |||
| 2472 | Ga0207705_10104145 | |||
| 2473 | Ga0207705_10151482 | |||
| 2474 | Ga0207654_10074102 | |||
| 2475 | Ga0207654_10077388 | |||
| 2476 | Ga0207654_10193933 | |||
| 2477 | Ga0207707_10000011 | |||
| 2478 | Ga0207707_10002211 | |||
| 2479 | Ga0207707_10004335 | |||
| 2480 | Ga0207707_10006091 | |||
| 2481 | Ga0207707_10168245 | |||
| 2482 | Ga0207707_10537382 | |||
| 2483 | Ga0207695_10000018 | |||
| 2484 | Ga0207695_10001032 | |||
| 2485 | Ga0207695_10029506 | |||
| 2486 | Ga0207695_10047727 | |||
| 2487 | Ga0207695_10063576 | |||
| 2488 | Ga0207695_10163030 | |||
| 2489 | Ga0207695_10215806 | |||
| 2490 | Ga0207695_10323348 | |||
| 2491 | Ga0207671_10016535 | |||
| 2492 | Ga0207671_10144760 | |||
| 2493 | Ga0207671_10200053 | |||
| 2494 | Ga0207671_10248016 | |||
| 2495 | Ga0207693_10001210 | |||
| 2496 | Ga0207693_10001929 | |||
| 2497 | Ga0207693_10004752 | |||
| 2498 | Ga0207693_10015635 | |||
| 2499 | Ga0207693_10032195 | |||
| 2500 | Ga0207693_10036016 | |||
| 2501 | Ga0207693_10037608 | |||
| 2502 | Ga0207693_10100265 | |||
| 2503 | Ga0207693_10116216 | |||
| 2504 | Ga0207693_10157406 | |||
| 2505 | Ga0207693_10190644 | |||
| 2506 | Ga0207693_10307449 | |||
| 2507 | Ga0207663_10011662 | |||
| 2508 | Ga0207663_10061935 | |||
| 2509 | Ga0207663_10100658 | |||
| 2510 | Ga0207663_10127095 | |||
| 2511 | Ga0207663_10161620 | |||
| 2512 | Ga0207663_10178070 | |||
| 2513 | Ga0207660_10000110 | |||
| 2514 | Ga0207660_10000197 | |||
| 2515 | Ga0207660_10003537 | |||
| 2516 | Ga0207660_10013609 | |||
| 2517 | Ga0207660_10058863 | |||
| 2518 | Ga0207660_10073136 | |||
| 2519 | Ga0207660_10228082 | |||
| 2520 | Ga0207662_10010568 | |||
| 2521 | Ga0207662_10019357 | |||
| 2522 | Ga0207662_10122304 | |||
| 2523 | Ga0207662_10377440 | |||
| 2524 | Ga0207657_10000241 | |||
| 2525 | Ga0207657_10028527 | |||
| 2526 | Ga0207657_10043533 | |||
| 2527 | Ga0207657_10058646 | |||
| 2528 | Ga0207657_10262648 | |||
| 2529 | Ga0207649_10000052 | |||
| 2530 | Ga0207649_10000194 | |||
| 2531 | Ga0207649_10057815 | |||
| 2532 | Ga0207652_10001654 | |||
| 2533 | Ga0207652_10004826 | |||
| 2534 | Ga0207652_10007272 | |||
| 2535 | Ga0207652_10063586 | |||
| 2536 | Ga0207652_10071225 | |||
| 2537 | Ga0207652_10093381 | |||
| 2538 | Ga0207652_10117970 | |||
| 2539 | Ga0207652_10122811 | |||
| 2540 | Ga0207652_10190259 | |||
| 2541 | Ga0207652_10204028 | |||
| 2542 | Ga0207652_10349150 | |||
| 2543 | Ga0207652_10453660 | |||
| 2544 | Ga0207681_10001135 | |||
| 2545 | Ga0207681_10161561 | |||
| 2546 | Ga0207681_10340311 | |||
| 2547 | Ga0207694_10000010 | |||
| 2548 | Ga0207694_10008694 | |||
| 2549 | Ga0207694_10031812 | |||
| 2550 | Ga0207694_10066558 | |||
| 2551 | Ga0207694_10203444 | |||
| 2552 | Ga0207694_10257958 | |||
| 2553 | Ga0207650_10002693 | |||
| 2554 | Ga0207650_10141681 | |||
| 2555 | Ga0207650_10569902 | |||
| 2556 | Ga0207659_10002396 | |||
| 2557 | Ga0207659_10012855 | |||
| 2558 | Ga0207659_10188772 | |||
| 2559 | Ga0207687_10008117 | |||
| 2560 | Ga0207687_10019725 | |||
| 2561 | Ga0207687_10025014 | |||
| 2562 | Ga0207687_10033978 | |||
| 2563 | Ga0207687_10128166 | |||
| 2564 | Ga0207687_10401890 | |||
| 2565 | Ga0207687_10461060 | |||
| 2566 | Ga0207700_10000295 | |||
| 2567 | Ga0207700_10090974 | |||
| 2568 | Ga0207700_10118748 | |||
| 2569 | Ga0207700_10124100 | |||
| 2570 | Ga0207700_10227054 | |||
| 2571 | Ga0207700_10533990 | |||
| 2572 | Ga0207664_10028891 | |||
| 2573 | Ga0207664_10035779 | |||
| 2574 | Ga0207664_10071514 | |||
| 2575 | Ga0207664_10151608 | |||
| 2576 | Ga0207664_10235849 | |||
| 2577 | Ga0207664_10244868 | |||
| 2578 | Ga0207664_10307466 | |||
| 2579 | Ga0207664_10437790 | |||
| 2580 | Ga0207664_10490126 | |||
| 2581 | Ga0207664_10595171 | |||
| 2582 | Ga0207644_10000212 | |||
| 2583 | Ga0207644_10181448 | |||
| 2584 | Ga0207690_10001288 | |||
| 2585 | Ga0207706_10016311 | |||
| 2586 | Ga0207706_10040241 | |||
| 2587 | Ga0207706_10054725 | |||
| 2588 | Ga0207706_10288771 | |||
| 2589 | Ga0207686_10002314 | |||
| 2590 | Ga0207686_10202258 | |||
| 2591 | Ga0207709_10000530 | |||
| 2592 | Ga0207709_10022766 | |||
| 2593 | Ga0207709_10083247 | |||
| 2594 | Ga0207709_10096959 | |||
| 2595 | Ga0207670_10015207 | |||
| 2596 | Ga0207670_10044307 | |||
| 2597 | Ga0207669_10000235 | |||
| 2598 | Ga0207669_10151320 | |||
| 2599 | Ga0207669_10294524 | |||
| 2600 | Ga0207704_10000198 | |||
| 2601 | Ga0207704_10019711 | |||
| 2602 | Ga0207704_10195247 | |||
| 2603 | Ga0207665_10020388 | |||
| 2604 | Ga0207665_10141171 | |||
| 2605 | Ga0207691_10013970 | |||
| 2606 | Ga0207691_10028811 | |||
| 2607 | Ga0207691_10364602 | |||
| 2608 | Ga0207711_10000002 | |||
| 2609 | Ga0207711_10180040 | |||
| 2610 | Ga0207689_10000031 | |||
| 2611 | Ga0207689_10071871 | |||
| 2612 | Ga0207689_10088891 | |||
| 2613 | Ga0207689_10261105 | |||
| 2614 | Ga0207661_10003727 | |||
| 2615 | Ga0207661_10065582 | |||
| 2616 | Ga0207661_10089596 | |||
| 2617 | Ga0207661_10186929 | |||
| 2618 | Ga0207661_10457124 | |||
| 2619 | Ga0207661_10476054 | |||
| 2620 | Ga0207679_10000183 | |||
| 2621 | Ga0207679_10100904 | |||
| 2622 | Ga0207667_10000388 | |||
| 2623 | Ga0207667_10004001 | |||
| 2624 | Ga0207667_10006198 | |||
| 2625 | Ga0207667_10013025 | |||
| 2626 | Ga0207667_10024994 | |||
| 2627 | Ga0207667_10027381 | |||
| 2628 | Ga0207667_10030652 | |||
| 2629 | Ga0207667_10250942 | |||
| 2630 | Ga0207667_10339043 | |||
| 2631 | Ga0207667_10964608 | |||
| 2632 | Ga0207651_10000051 | |||
| 2633 | Ga0207651_10690770 | |||
| 2634 | Ga0207712_10001703 | |||
| 2635 | Ga0207712_10494081 | |||
| 2636 | Ga0207668_10001674 | |||
| 2637 | Ga0207668_10361289 | |||
| 2638 | Ga0207640_10000343 | |||
| 2639 | Ga0207640_10024133 | |||
| 2640 | Ga0207640_10515244 | |||
| 2641 | Ga0207658_10066787 | |||
| 2642 | Ga0207658_10154989 | |||
| 2643 | Ga0207658_10157925 | |||
| 2644 | Ga0207658_10341525 | |||
| 2645 | Ga0207658_10561565 | |||
| 2646 | Ga0207677_10081022 | |||
| 2647 | Ga0207677_10278125 | |||
| 2648 | Ga0207677_10728325 | |||
| 2649 | Ga0207703_10010733 | |||
| 2650 | Ga0207703_10044546 | |||
| 2651 | Ga0207703_10172911 | |||
| 2652 | Ga0207703_10175184 | |||
| 2653 | Ga0207703_10332748 | |||
| 2654 | Ga0207639_10000867 | |||
| 2655 | Ga0207639_10003883 | |||
| 2656 | Ga0207639_10010763 | |||
| 2657 | Ga0207639_10033916 | |||
| 2658 | Ga0207639_10227024 | |||
| 2659 | Ga0207678_10024280 | |||
| 2660 | Ga0207678_10043860 | |||
| 2661 | Ga0207678_10100765 | |||
| 2662 | Ga0207678_10142928 | |||
| 2663 | Ga0207678_10368921 | |||
| 2664 | Ga0207708_10014839 | |||
| 2665 | Ga0207708_10102376 | |||
| 2666 | Ga0207708_10397909 | |||
| 2667 | Ga0207702_10000005 | |||
| 2668 | Ga0207702_10000315 | |||
| 2669 | Ga0207702_10004643 | |||
| 2670 | Ga0207702_10009824 | |||
| 2671 | Ga0207702_10048646 | |||
| 2672 | Ga0207702_10229342 | |||
| 2673 | Ga0207702_10350900 | |||
| 2674 | Ga0207641_10001831 | |||
| 2675 | Ga0207641_10062870 | |||
| 2676 | Ga0207648_10025743 | |||
| 2677 | Ga0207648_10154550 | |||
| 2678 | Ga0207648_10221620 | |||
| 2679 | Ga0207648_10706873 | |||
| 2680 | Ga0207676_10000124 | |||
| 2681 | Ga0207676_10217418 | |||
| 2682 | Ga0207676_10634474 | |||
| 2683 | Ga0207674_10001605 | |||
| 2684 | Ga0207674_10016004 | |||
| 2685 | Ga0207674_10145542 | |||
| 2686 | Ga0207674_10363573 | |||
| 2687 | Ga0207674_10588472 | |||
| 2688 | Ga0207674_10821416 | |||
| 2689 | Ga0207675_100029702 | |||
| 2690 | Ga0207675_100440578 | |||
| 2691 | Ga0207675_100811797 | |||
| 2692 | Ga0207683_10000242 | |||
| 2693 | Ga0207683_10001846 | |||
| 2694 | Ga0207683_10079317 | |||
| 2695 | Ga0207683_10081510 | |||
| 2696 | Ga0207683_10213762 | |||
| 2697 | Ga0207683_10233042 | |||
| 2698 | Ga0207683_10533217 | |||
| 2699 | Ga0207698_10010960 | |||
| 2700 | Ga0207698_10036626 | |||
| 2701 | Ga0207698_10040510 | |||
| 2702 | Ga0207698_10072790 | |||
| 2703 | Ga0207698_10391941 | |||
| 2704 | Ga0209982_1002370 | |||
| 2705 | Ga0210002_1001035 | |||
| 2706 | Ga0209966_1008822 | |||
| 2707 | Ga0209998_10010491 | |||
| 2708 | Ga0209813_10002687 | |||
| 2709 | Ga0209813_10009253 | |||
| 2710 | Ga0209813_10017408 | |||
| 2711 | Ga0207428_10000037 | |||
| 2712 | Ga0207428_10002442 | |||
| 2713 | Ga0207428_10013074 | |||
| 2714 | Ga0268266_10000557 | |||
| 2715 | Ga0268266_10813652 | |||
| 2716 | Ga0268265_10016165 | |||
| 2717 | Ga0268265_10050585 | |||
| 2718 | Ga0268265_10162265 | |||
| 2719 | Ga0268265_10214183 | |||
| 2720 | Ga0268264_10003234 | |||
| 2721 | Ga0268264_10140651 | |||
| 2722 | Ga0268264_10391464 | |||
| 2723 | Ga0268264_10562834 | |||
| 2724 | Ga0265337_1019347 | |||
| 2725 | Ga0265326_10002138 | |||
| 2726 | Ga0265319_1001825 | |||
| 2727 | Ga0265334_10000469 | |||
| 2728 | Ga0265334_10001106 | |||
| 2729 | Ga0265334_10016312 | |||
| 2730 | Ga0265334_10065129 | |||
| 2731 | Ga0265318_10000037 | |||
| 2732 | Ga0265318_10001354 | |||
| 2733 | Ga0265318_10004765 | |||
| 2734 | Ga0265323_10001237 | |||
| 2735 | Ga0265322_10008354 | |||
| 2736 | Ga0265336_10000535 | |||
| 2737 | Ga0307515_10040807 | |||
| 2738 | Ga0265338_10000017 | |||
| 2739 | Ga0265338_10000131 | |||
| 2740 | Ga0265338_10005387 | |||
| 2741 | Ga0265338_10023435 | |||
| 2742 | Ga0265338_10023604 | |||
| 2743 | Ga0265338_10033513 | |||
| 2744 | Ga0265338_10065293 | |||
| 2745 | Ga0265338_10098917 | |||
| 2746 | Ga0265338_10149487 | |||
| 2747 | Ga0265338_10153758 | |||
| 2748 | Ga0265338_10211121 | |||
| 2749 | Ga0265338_10314147 | |||
| 2750 | Ga0265338_10419399 | |||
| 2751 | Ga0265338_10455780 | |||
| 2752 | Ga0265324_10001269 | |||
| 2753 | Ga0265762_1007126 | |||
| 2754 | Ga0265763_1000228 | |||
| 2755 | Ga0265330_10013605 | |||
| 2756 | Ga0265330_10028450 | |||
| 2757 | Ga0265330_10033745 | |||
| 2758 | Ga0265330_10081849 | |||
| 2759 | Ga0265330_10085850 | |||
| 2760 | Ga0265330_10129990 | |||
| 2761 | Ga0265332_10003525 | |||
| 2762 | Ga0265332_10011436 | |||
| 2763 | Ga0265332_10038320 | |||
| 2764 | Ga0265332_10080505 | |||
| 2765 | Ga0265320_10002069 | |||
| 2766 | Ga0265320_10016123 | |||
| 2767 | Ga0265325_10000014 | |||
| 2768 | Ga0265325_10000449 | |||
| 2769 | Ga0265325_10000820 | |||
| 2770 | Ga0265325_10001071 | |||
| 2771 | Ga0265325_10001732 | |||
| 2772 | Ga0265325_10001769 | |||
| 2773 | Ga0265325_10012680 | |||
| 2774 | Ga0265325_10031434 | |||
| 2775 | Ga0265325_10034463 | |||
| 2776 | Ga0265325_10042427 | |||
| 2777 | Ga0265325_10064283 | |||
| 2778 | Ga0265325_10066787 | |||
| 2779 | Ga0265329_10034806 | |||
| 2780 | Ga0265329_10039168 | |||
| 2781 | Ga0265340_10002810 | |||
| 2782 | Ga0265340_10003857 | |||
| 2783 | Ga0265340_10008522 | |||
| 2784 | Ga0265340_10025043 | |||
| 2785 | Ga0265340_10042895 | |||
| 2786 | Ga0265340_10056838 | |||
| 2787 | Ga0265340_10063149 | |||
| 2788 | Ga0265340_10074553 | |||
| 2789 | Ga0265340_10163807 | |||
| 2790 | Ga0265340_10217733 | |||
| 2791 | Ga0265340_10251950 | |||
| 2792 | Ga0265339_10000053 | |||
| 2793 | Ga0265339_10000256 | |||
| 2794 | Ga0265339_10003063 | |||
| 2795 | Ga0265339_10005687 | |||
| 2796 | Ga0265339_10006973 | |||
| 2797 | Ga0265339_10009282 | |||
| 2798 | Ga0265339_10020355 | |||
| 2799 | Ga0265339_10051695 | |||
| 2800 | Ga0265339_10078048 | |||
| 2801 | Ga0265339_10108339 | |||
| 2802 | Ga0265331_10014841 | |||
| 2803 | Ga0265331_10019323 | |||
| 2804 | Ga0265331_10039963 | |||
| 2805 | Ga0265331_10065184 | |||
| 2806 | Ga0265331_10227999 | |||
| 2807 | Ga0265327_10001297 | |||
| 2808 | Ga0265316_10050012 | |||
| 2809 | Ga0265316_10088313 | |||
| 2810 | Ga0265316_10104722 | |||
| 2811 | Ga0265316_10108470 | |||
| 2812 | Ga0265316_10183202 | |||
| 2813 | Ga0265316_10241243 | |||
| 2814 | Ga0265316_10280165 | |||
| 2815 | Ga0265316_10302428 | |||
| 2816 | Ga0265316_10303173 | |||
| 2817 | Ga0265316_10345735 | |||
| 2818 | Ga0265316_10616217 | |||
| 2819 | Ga0265313_10000098 | |||
| 2820 | Ga0265313_10001315 | |||
| 2821 | Ga0265313_10001884 | |||
| 2822 | Ga0265313_10006263 | |||
| 2823 | Ga0265313_10008423 | |||
| 2824 | Ga0265313_10012279 | |||
| 2825 | Ga0265313_10015578 | |||
| 2826 | Ga0265313_10047949 | |||
| 2827 | Ga0265313_10054715 | |||
| 2828 | Ga0265313_10060934 | |||
| 2829 | Ga0265313_10061872 | |||
| 2830 | Ga0265313_10071098 | |||
| 2831 | Ga0265313_10079819 | |||
| 2832 | Ga0265313_10133140 | |||
| 2833 | Ga0265314_10004347 | |||
| 2834 | Ga0265314_10004460 | |||
| 2835 | Ga0265314_10009081 | |||
| 2836 | Ga0265314_10011365 | |||
| 2837 | Ga0265314_10012121 | |||
| 2838 | Ga0265314_10021119 | |||
| 2839 | Ga0265314_10027636 | |||
| 2840 | Ga0265314_10031643 | |||
| 2841 | Ga0265314_10033470 | |||
| 2842 | Ga0265314_10037529 | |||
| 2843 | Ga0265314_10038656 | |||
| 2844 | Ga0265314_10056950 | |||
| 2845 | Ga0265314_10094782 | |||
| 2846 | Ga0265314_10128118 | |||
| 2847 | Ga0265314_10191417 | |||
| 2848 | Ga0265314_10207814 | |||
| 2849 | Ga0265314_10272117 | |||
| 2850 | Ga0265342_10000448 | |||
| 2851 | Ga0265342_10000677 | |||
| 2852 | Ga0265342_10008087 | |||
| 2853 | Ga0265342_10025101 | |||
| 2854 | Ga0265342_10031129 | |||
| 2855 | Ga0265342_10059470 | |||
| 2856 | Ga0265342_10227272 | |||
| 2857 | Ga0265342_10287707 | |||
| 2858 | Ga0307516_10038268 | |||
| 2859 | Ga0307516_10231301 | |||
| 2860 | Ga0307516_10264719 | |||
| 2861 | Ga0307410_10512358 | |||
| 2862 | Ga0307412_10394045 | |||
| 2863 | Ga0307409_100145672 | |||
| 2864 | Ga0307416_100674159 | |||
| 2865 | Ga0307415_100224377 | |||
| 2866 | Ga0373930_0003008 | |||
| 2867 | Ga0373948_0002824 | |||
| 2868 | Ga0373950_0005337 | |||
| 2869 | Ga0373950_0007127 | |||
| 2870 | Ga0373950_0017039 | |||
| 2871 | Ga0373958_0001566 | |||
| 2872 | Ga0373958_0002620 | |||
| 2873 | Ga0373959_0003005 | |||
| 2874 | Ga0373938_0000343 | |||
| 2875 | Ga0373938_0001532 | |||
| 2876 | Ga0373926_0008207 | |||
| 2877 | Ga0373928_0001369 | |||
| 2878 | Ga0373934_0052439 | |||
| 2879 | Ga0373934_0119053 | |||
| 2880 | Ga0373934_0208429 | |||
| 2881 | Ga0373940_0003702 | |||
| 2882 | Ga0373940_0021279 | |||
| 2883 | Ga0373940_0054129 | |||
| 2884 | Ga0373940_0087214 | |||
| 2885 | Ga0373944_0002736 | |||
| 2886 | Ga0373949_0001707 | |||
| 2887 | Ga0373949_0003940 | |||
| 2888 | Ga0373952_0001963 | |||
| 2889 | Ga0373923_0065885 | |||
| 2890 | Ga0373932_0004128 | |||
| 2891 | Ga0373932_0006364 | |||
| 2892 | Ga0373932_0007842 | |||
| 2893 | Ga0373932_0030106 | |||
| 2894 | Ga0373936_0021903 | |||
| 2895 | Ga0373936_0078578 | |||
| 2896 | Ga0373939_0001965 | |||
| 2897 | Ga0373939_0021734 | |||
| 2898 | Ga0373941_0003378 | |||
| 2899 | Ga0373945_0008514 | |||
| 2900 | Ga0373945_0034692 | |||
| 2901 | Ga0373953_0001370 | |||
| 2902 | Ga0373953_0019434 | |||
| 2903 | Ga0373953_0038626 | |||
| 2904 | Ga0373954_0001371 | |||
| 2905 | Ga0373954_0014718 | |||
| 2906 | Ga0373954_0020580 | |||
| 2907 | Ga0373956_0013664 | |||
| 2908 | Ga0373956_0041543 | |||
| 2909 | Ga0373957_0008557 | |||
| 2910 | Ga0373957_0018776 | |||
| 2911 | Ga0373957_0088922 | |||
| 2912 | Ga0373960_0049044 | |||
| 2913 | Ga0373943_0000918 | |||
| 2914 | Ga0373943_0006231 | |||
| 2915 | Ga0373943_0011453 | |||
| 2916 | Ga0373943_0024465 | |||
| 2917 | Ga0373943_0092935 | |||
| 2918 | Ga0373946_0004396 | |||
| 2919 | Ga0373946_0016833 | |||
| 2920 | Ga0373946_0056677 | |||
| 2921 | Ga0373955_0001179 | |||
| 2922 | Ga0373955_0017677 | |||
| 2923 | Ga0373955_0032229 | |||
| 2924 | Ga0373955_0094771 | |||
| 2925 | Ga0373955_0135259 | |||
| 2926 | Ga0373942_0001142 | |||
| 2927 | Ga0373961_0017751 | |||
| 2928 | Ga0373961_0019036 | |||
| 2929 | Ga0373962_0001106 | |||
| 2930 | Ga0316574_0388472 | |||
| 2931 | Ga0373924_0014977 | |||
| 2932 | Ga0373924_0093130 | |||
| 2933 | Ga0373931_0000305 | |||
| 2934 | Ga0373931_0020150 | |||
| 2935 | Ga0373931_0033067 | |||
| 2936 | Ga0373931_0217256 | |||
| 2937 | Ga0373935_0003403 | |||
| 2938 | Ga0373935_0014201 | |||
| 2939 | Ga0373935_0021874 | |||
| 2940 | Ga0373935_0213221 | |||
| 2941 | Ga0373935_0248291 | |||
| 2942 | Ga0373927_0017421 | |||
| 2943 | Ga0373927_0017892 | |||
| 2944 | Ga0373927_0103791 | |||
| 2945 | Ga0373927_0252607 | |||
| 2946 | Ga0373933_0012634 | |||
| 2947 | Ga0373933_0018034 | |||
| 2948 | Ga0373933_0030576 | |||
| 2949 | Ga0373947_0006238 | |||
| 2950 | Ga0373947_0009172 | |||
| 2951 | Ga0373947_0062903 | |||
| 2952 | Ga0373947_0398055 | |||
| 2953 | Ga0373937_0007608 | |||
| 2954 | Ga0373937_0025062 | |||
| 2955 | Ga0373937_0039941 | |||
| 2956 | Ga0373937_0072988 | |||
| 2957 | Ga0373937_0077479 | |||
| 2958 | Ga0373937_0126066 | |||
| 2959 | Ga0373937_0411316 | |||
| 2960 | Ga0373937_0422939 | |||
| 2961 | Ga0373937_0666658 | |||
| 2962 | Ga0373937_0731608 | |||
| 2963 | Ga0373937_0744705 | |||
| 2964 | Ga0316582_0312479 | |||
| 2965 | Ga0373925_0002514 | |||
| 2966 | Ga0373925_0011485 | |||
| 2967 | Ga0373925_0020892 | |||
| 2968 | Ga0373925_0022203 | |||
| 2969 | Ga0373925_0051088 | |||
| 2970 | Ga0373925_0156062 | |||
| 2971 | Ga0373925_0300431 | |||
| 2972 | Ga0395899_0032920 | |||
| 2973 | Ga0395899_0053109 | |||
| 2974 | Ga0395900_0022401 | |||
| 2975 | Ga0395900_0104393 | |||
| 2976 | Ga0395900_0233159 | |||
| 2977 | Ga0395900_0298709 | |||
| 2978 | Ga0395900_0419468 | |||
| 2979 | Ga0395900_0607650 | |||
| 2980 | Ga0395898_0021752 | |||
| 2981 | Ga0395898_0021940 | |||
| 2982 | Ga0395898_0047384 | |||
| 2983 | Ga0395898_0139246 | |||
| 2984 | Ga0395898_0222431 | |||
| 2985 | Ga0436364_0333324 | |||
| 2986 | Ga0395901_0015561 | |||
| 2987 | Ga0395901_0057654 | |||
| 2988 | Ga0395901_0105438 | |||
| 2989 | Ga0395901_0196440 | |||
| 2990 | Ga0395901_0425885 | |||
| 2991 | Ga0395901_0454020 | |||
| 2992 | Ga0395901_0829599 | |||
| 2993 | Ga0400483_117124 | |||
| 2994 | Ga0436365_0032540 | |||
| 2995 | Ga0436365_0152711 | |||
| 2996 | Ga0436365_0680520 | |||
| 2997 | Ga0436365_1138385 | |||
| 2998 | Ga0436365_1200736 | |||
| 2999 | Ga0436365_1245822 | |||
| 3000 | Ga0436365_1505093 | |||
| 3001 | Ga0436365_1637588 | |||
| 3002 | Ga0436365_1682615 | |||
| 3003 | Ga0436365_1870318 | |||
| 3004 | Ga0436360_0155882 | |||
| 3005 | Ga0436360_0174767 | |||
| 3006 | Ga0436360_0842897 | |||
| 3007 | Ga0436361_0057811 | |||
| 3008 | Ga0436363_0402877 | |||
| 3009 | Ga0436362_0451203 | |||
| 3010 | Ga0436362_0808711 | |||
| 3011 | Ga0439453_0002481 | |||
| 3012 | Ga0439443_002060 | |||
| 3013 | Ga0450923_011089 | |||
| 3014 | Ga0439458_0077397 | |||
| 3015 | Ga0439435_0021439 | |||
| 3016 | Ga0439435_0042295 | |||
| 3017 | Ga0439440_0012161 | |||
| 3018 | Ga0466966_0191039 | |||
| 3019 | Ga0466963_0019290 | |||
| 3020 | Ga0466957_0014805 | |||
| 3021 | Ga0466957_0033087 | |||
| 3022 | Ga0466957_0075585 | |||
| 3023 | Ga0451576_0024106 | |||
| 3024 | Ga0451576_0043660 | |||
| 3025 | Ga0466967_0011664 | |||
| 3026 | Ga0466967_0031236 | |||
| 3027 | Ga0495627_065240 | |||
| 3028 | Ga0495592_0001138 | |||
| 3029 | Ga0495592_0043997 | |||
| 3030 | Ga0495592_0123999 | |||
| 3031 | Ga0495603_0000644 | |||
| 3032 | Ga0495603_0012514 | |||
| 3033 | Ga0495603_0013543 | |||
| 3034 | Ga0495629_0000177 | |||
| 3035 | Ga0495629_0000317 | |||
| 3036 | Ga0495629_0029090 | |||
| 3037 | Ga0495629_0473847 | |||
| 3038 | Ga0495629_0550137 | |||
| 3039 | Ga0495641_0009769 | |||
| 3040 | Ga0495641_0035126 | |||
| 3041 | Ga0495641_0129595 | |||
| 3042 | Ga0495651_0003129 | |||
| 3043 | Ga0495651_0004850 | |||
| 3044 | Ga0495653_0000149 | |||
| 3045 | Ga0495653_0061894 | |||
| 3046 | Ga0495653_0072344 | |||
| 3047 | Ga0495653_0275613 | |||
| 3048 | Ga0495653_0405121 | |||
| 3049 | Ga0495580_0000498 | |||
| 3050 | Ga0495580_0036721 | |||
| 3051 | Ga0495580_0046764 | |||
| 3052 | Ga0495580_0074442 | |||
| 3053 | Ga0495580_0088638 | |||
| 3054 | Ga0495582_0000185 | |||
| 3055 | Ga0495582_0013082 | |||
| 3056 | Ga0495582_0044051 | |||
| 3057 | Ga0495582_0170090 | |||
| 3058 | Ga0495582_0314423 | |||
| 3059 | Ga0495605_0138713 | |||
| 3060 | Ga0495639_0001788 | |||
| 3061 | Ga0495639_0009268 | |||
| 3062 | Ga0495639_0092685 | |||
| 3063 | Ga0495662_0015062 | |||
| 3064 | Ga0495662_0069984 | |||
| 3065 | Ga0495662_0093593 | |||
| 3066 | Ga0495664_0033507 | |||
| 3067 | Ga0495664_0076784 | |||
| 3068 | Ga0495664_0132628 | |||
| 3069 | Ga0495664_0386270 | |||
| 3070 | Ga0495584_0020723 | |||
| 3071 | Ga0495584_0063797 | |||
| 3072 | Ga0495585_0004711 | |||
| 3073 | Ga0495585_0178166 | |||
| 3074 | Ga0495594_0000023 | |||
| 3075 | Ga0495594_0053830 | |||
| 3076 | Ga0495607_0008511 | |||
| 3077 | Ga0495607_0193664 | |||
| 3078 | Ga0495606_0050237 | |||
| 3079 | Ga0495608_0007771 | |||
| 3080 | Ga0495608_0016548 | |||
| 3081 | Ga0495608_0071471 | |||
| 3082 | Ga0495608_0189523 | |||
| 3083 | Ga0495610_0046787 | |||
| 3084 | Ga0495616_0035835 | |||
| 3085 | Ga0495616_0174155 | |||
| 3086 | Ga0495618_0086295 | |||
| 3087 | Ga0495618_0086821 | |||
| 3088 | Ga0495618_0121557 | |||
| 3089 | Ga0495620_0083704 | |||
| 3090 | Ga0495628_0005831 | |||
| 3091 | Ga0495630_0106670 | |||
| 3092 | Ga0495630_0264712 | |||
| 3093 | Ga0495630_0301723 | |||
| 3094 | Ga0495632_0062625 | |||
| 3095 | Ga0495643_0086414 | |||
| 3096 | Ga0495644_0000713 | |||
| 3097 | Ga0495648_0008251 | |||
| 3098 | Ga0495666_0038494 | |||
| 3099 | Ga0495652_0026006 | |||
| 3100 | Ga0495652_0138777 | |||
| 3101 | Ga0495652_0228765 | |||
| 3102 | Ga0495654_0144998 | |||
| 3103 | Ga0495665_0004028 | |||
| 3104 | Ga0495665_0004234 | |||
| 3105 | Ga0495665_0020621 | |||
| 3106 | Ga0495665_0137795 | |||
| 3107 | Ga0495640_0036039 | |||
| 3108 | Ga0495640_0062400 | |||
| 3109 | Ga0495640_0068878 | |||
| 3110 | Ga0495640_0096857 | |||
| 3111 | Ga0495640_0162175 | |||
| 3112 | Ga0495640_0292638 | |||
| 3113 | Ga0495586_0047555 | |||
| 3114 | Ga0495587_0001671 | |||
| 3115 | Ga0495587_0031176 | |||
| 3116 | Ga0495587_0128938 | |||
| 3117 | Ga0495587_0161457 | |||
| 3118 | Ga0495598_0006692 | |||
| 3119 | Ga0495598_0015543 | |||
| 3120 | Ga0495609_0050263 | |||
| 3121 | Ga0495609_0092341 | |||
| 3122 | Ga0495609_0230676 | |||
| 3123 | Ga0495645_0005350 | |||
| 3124 | Ga0495645_0017640 | |||
| 3125 | Ga0495645_0041803 | |||
| 3126 | Ga0495645_0050307 | |||
| 3127 | Ga0495622_0000916 | |||
| 3128 | Ga0495622_0026496 | |||
| 3129 | Ga0495622_0148504 | |||
| 3130 | Ga0495633_0000941 | |||
| 3131 | Ga0495667_0004251 | |||
| 3132 | Ga0495667_0006602 | |||
| 3133 | Ga0495667_0011743 | |||
| 3134 | Ga0495667_0057695 | |||
| 3135 | Ga0495667_0355294 | |||
| 3136 | Ga0495656_0000589 | |||
| 3137 | Ga0495634_0036751 | |||
| 3138 | Ga0495634_0050361 | |||
| 3139 | Ga0495634_0126421 | |||
| 3140 | Ga0495634_0215317 | |||
| 3141 | Ga0495611_0106226 | |||
| 3142 | Ga0495611_0192766 | |||
| 3143 | Ga0495625_0028714 | |||
| 3144 | Ga0495625_0475799 | |||
| 3145 | Ga0495635_0007513 | |||
| 3146 | Ga0495635_0008691 | |||
| 3147 | Ga0495635_0102078 | |||
| 3148 | Ga0495635_0146883 | |||
| 3149 | Ga0495635_0263989 | |||
| 3150 | Ga0495635_0340540 | |||
| 3151 | Ga0495635_0398521 | |||
| 3152 | Ga0495659_0003548 | |||
| 3153 | Ga0495661_0011421 | |||
| 3154 | Ga0495661_0027406 | |||
| 3155 | Ga0495588_0005432 | |||
| 3156 | Ga0495588_0011242 | |||
| 3157 | Ga0495588_0041790 | |||
| 3158 | Ga0495657_0011421 | |||
| 3159 | Ga0495657_0019703 | |||
| 3160 | Ga0495657_0026745 | |||
| 3161 | Ga0495657_0037526 | |||
| 3162 | Ga0495657_0053216 | |||
| 3163 | Ga0495657_0121577 | |||
| 3164 | Ga0495657_0307333 | |||
| 3165 | Ga0495599_0018700 | |||
| 3166 | Ga0495599_0067022 | |||
| 3167 | Ga0495599_0211321 | |||
| 3168 | Ga0495623_0000858 | |||
| 3169 | Ga0495623_0002372 | |||
| 3170 | Ga0495623_0400881 | |||
| 3171 | Ga0495646_0007260 | |||
| 3172 | Ga0495646_0013907 | |||
| 3173 | Ga0495646_0293914 | |||
| 3174 | Ga0495647_0006380 | |||
| 3175 | Ga0495647_0009980 | |||
| 3176 | Ga0495647_0093629 | |||
| 3177 | Ga0495658_0001492 | |||
| 3178 | Ga0495658_0002288 | |||
| 3179 | Ga0495658_0007902 | |||
| 3180 | Ga0495658_0017238 | |||
| 3181 | Ga0495658_0021417 | |||
| 3182 | Ga0495658_0037194 | |||
| 3183 | Ga0495669_0092584 | |||
| 3184 | Ga0495669_0111866 | |||
| 3185 | Ga0495613_0013711 | |||
| 3186 | Ga0495613_0024584 | |||
| 3187 | Ga0495613_0045423 | |||
| 3188 | Ga0495613_0056840 | |||
| 3189 | Ga0495624_0048203 | |||
| 3190 | Ga0495624_0190045 | |||
| 3191 | Ga0495670_0001016 | |||
| 3192 | Ga0495671_0058073 | |||
| 3193 | Ga0495671_0066432 | |||
| 3194 | Ga0495649_0066314 | |||
| 3195 | Ga0495589_0032579 | |||
| 3196 | Ga0495589_0146279 | |||
| 3197 | Ga0495600_0002535 | |||
| 3198 | Ga0495600_0004858 | |||
| 3199 | Ga0495600_0057702 | |||
| 3200 | Ga0495600_0100175 | |||
| 3201 | Ga0495600_0118459 | |||
| 3202 | Ga0495600_0272229 | |||
| 3203 | Ga0495660_0060594 | |||
| 3204 | Ga0495581_0001042 | |||
| 3205 | Ga0495581_0137501 | |||
| 3206 | Ga0495604_0007851 | |||
| 3207 | Ga0495604_0007934 | |||
| 3208 | Ga0495604_0072089 | |||
| 3209 | Ga0495636_0076801 | |||
| 3210 | Ga0495674_0100641 | |||
| 3211 | Ga0495674_0134805 | |||
| 3212 | Ga0495674_0153457 | |||
| 3213 | Ga0495674_0225067 | |||
| 3214 | Ga0495672_0059536 | |||
| 3215 | Ga0495672_0113453 | |||
| 3216 | Ga0495672_0167802 | |||
| 3217 | Ga0495676_0008691 | |||
| 3218 | Ga0495676_0013652 | |||
| 3219 | Ga0495676_0069481 | |||
| 3220 | Ga0495680_0019366 | |||
| 3221 | Ga0495680_0026170 | |||
| 3222 | Ga0495680_0047015 | |||
| 3223 | Ga0495680_0058793 | |||
| 3224 | Ga0495680_0068123 | |||
| 3225 | Ga0495680_0106939 | |||
| 3226 | Ga0495680_0144944 | |||
| 3227 | Ga0495680_0312289 | |||
| 3228 | Ga0495675_0006492 | |||
| 3229 | Ga0495675_0169775 | |||
| 3230 | Ga0495675_0207164 | |||
| 3231 | Ga0495677_0142461 | |||
| 3232 | Ga0495679_024983 | |||
| 3233 | Ga0495684_0082884 | |||
| 3234 | Ga0495684_0176675 | |||
| 3235 | Ga0495684_0281160 | |||
| 3236 | Ga0495686_0077376 | |||
| 3237 | Ga0495593_0001943 | |||
| 3238 | Ga0495593_0012417 | |||
| 3239 | Ga0495593_0022296 | |||
| 3240 | Ga0495593_0059926 | |||
| 3241 | Ga0495602_0007161 | |||
| 3242 | Ga0495602_0074205 | |||
| 3243 | Ga0495602_0163605 | |||
| 3244 | Ga0495614_0000618 | |||
| 3245 | Ga0495614_0031857 | |||
| 3246 | Ga0495626_0097869 | |||
| 3247 | Ga0496100_0116994 | |||
| 3248 | Ga0496100_0175028 | |||
| 3249 | Ga0496100_0257045 | |||
| 3250 | Ga0496101_0000969 | |||
| 3251 | Ga0496101_0014870 | |||
| 3252 | Ga0496101_0019543 | |||
| 3253 | Ga0496101_0049050 | |||
| 3254 | Ga0496102_0004376 | |||
| 3255 | Ga0496102_0062325 | |||
| 3256 | Ga0496102_0067172 | |||
| 3257 | Ga0496102_0158448 | |||
| 3258 | Ga0496102_0569399 | |||
| 3259 | Ga0496102_0614555 | |||
| 3260 | Ga0496103_0001732 | |||
| 3261 | Ga0496103_0023227 | |||
| 3262 | Ga0496103_0061364 | |||
| 3263 | Ga0496103_0100733 | |||
| 3264 | Ga0496104_0000399 | |||
| 3265 | Ga0496104_0101217 | |||
| 3266 | Ga0496104_0108172 | |||
| 3267 | Ga0496104_0174623 | |||
| 3268 | Ga0496104_0189398 | |||
| 3269 | Ga0496104_0251879 | |||
| 3270 | Ga0496105_0002417 | |||
| 3271 | Ga0496105_0035470 | |||
| 3272 | Ga0496105_0316563 | |||
| 3273 | Ga0496105_0342805 | |||
| 3274 | Ga0496105_0345285 | |||
| 3275 | Ga0496106_0015788 | |||
| 3276 | Ga0496106_0036410 | |||
| 3277 | Ga0496106_0278742 | |||
| 3278 | Ga0496106_0316134 | |||
| 3279 | Ga0496106_0822784 | |||
| 3280 | Ga0496107_0005598 | |||
| 3281 | Ga0496107_0020535 | |||
| 3282 | Ga0496107_0091546 | |||
| 3283 | Ga0496107_0092306 | |||
| 3284 | Ga0496107_0135855 | |||
| 3285 | Ga0496107_0205055 | |||
| 3286 | Ga0496107_0345267 | |||
| 3287 | Ga0496108_0007368 | |||
| 3288 | Ga0496108_0167448 | |||
| 3289 | Ga0496108_0543052 | |||
| 3290 | Ga0496109_0005949 | |||
| 3291 | Ga0496109_0012139 | |||
| 3292 | Ga0496109_0054198 | |||
| 3293 | Ga0496109_0133489 | |||
| 3294 | Ga0496109_0367124 | |||
| 3295 | Ga0496110_0054594 | |||
| 3296 | Ga0496110_0106807 | |||
| 3297 | Ga0496110_0121916 | |||
| 3298 | Ga0496110_0253605 | |||
| 3299 | Ga0496110_0608904 | |||
| 3300 | Ga0496110_0834079 | |||
| 3301 | Ga0496111_0037153 | |||
| 3302 | Ga0496111_0043921 | |||
| 3303 | Ga0496112_0070213 | |||
| 3304 | Ga0496112_0139286 | |||
| 3305 | Ga0496112_0178648 | |||
| 3306 | Ga0496112_0273206 | |||
| 3307 | Ga0496112_0336823 | |||
| 3308 | Ga0496113_0043476 | |||
| 3309 | Ga0496113_0045614 | |||
| 3310 | Ga0496113_0049357 | |||
| 3311 | Ga0496113_0129113 | |||
| 3312 | Ga0496113_0182482 | |||
| 3313 | Ga0496113_0347681 | |||
| 3314 | Ga0496113_0487029 | |||
| 3315 | Ga0496113_0529394 | |||
| 3316 | Ga0496114_0002647 | |||
| 3317 | Ga0496114_0048435 | |||
| 3318 | Ga0496114_0069593 | |||
| 3319 | Ga0496114_0106109 | |||
| 3320 | Ga0496114_0126273 | |||
| 3321 | Ga0496115_0024784 | |||
| 3322 | Ga0496115_0030807 | |||
| 3323 | Ga0496115_0047461 | |||
| 3324 | Ga0496115_0082945 | |||
| 3325 | Ga0496115_0117368 | |||
| 3326 | Ga0496115_0215818 | |||
| 3327 | Ga0496115_0262717 | |||
| 3328 | Ga0496115_0349341 | |||
| 3329 | Ga0496116_0047218 | |||
| 3330 | Ga0496117_0128671 | |||
| 3331 | Ga0496118_0271882 | |||
| 3332 | Ga0496119_0040092 | |||
| 3333 | Ga0496119_0105536 | |||
| 3334 | Ga0496119_0242680 | |||
| 3335 | Ga0496120_0019667 | |||
| 3336 | Ga0496120_0072566 | |||
| 3337 | Ga0496121_0003067 | |||
| 3338 | Ga0496121_0006108 | |||
| 3339 | Ga0496121_0036137 | |||
| 3340 | Ga0496121_0203792 | |||
| 3341 | Ga0496121_0219426 | |||
| 3342 | Ga0496122_0043087 | |||
| 3343 | Ga0496122_0164998 | |||
| 3344 | Ga0496123_0048593 | |||
| 3345 | Ga0496123_0094491 | |||
| 3346 | Ga0496124_0217321 | |||
| 3347 | Ga0496125_0001858 | |||
| 3348 | Ga0496125_0115218 | |||
| 3349 | Ga0496125_0168911 | |||
| 3350 | Ga0496126_0000480 | |||
| 3351 | Ga0496126_0040052 | |||
| 3352 | Ga0496126_0090979 | |||
| 3353 | Ga0496126_0110380 | |||
| 3354 | Ga0496126_0117141 | |||
| 3355 | Ga0496126_0150833 | |||
| 3356 | Ga0496126_0341974 | |||
| 3357 | Ga0496126_0392309 | |||
| 3358 | Ga0495682_0013068 | |||
| 3359 | Ga0501031_0044398 | |||
| 3360 | Ga0501031_0070573 | |||
| 3361 | Ga0501031_0074807 | |||
| 3362 | Ga0501031_0085878 | |||
| 3363 | Ga0501031_0090980 | |||
| 3364 | Ga0501032_0008814 | |||
| 3365 | Ga0501032_0040734 | |||
| 3366 | Ga0501032_0042811 | |||
| 3367 | Ga0501032_0058423 | |||
| 3368 | Ga0501032_0118749 | |||
| 3369 | Ga0501032_0163537 | |||
| 3370 | Ga0501032_0238250 | |||
| 3371 | Ga0501032_0270312 | |||
| 3372 | Ga0501033_0000094 | |||
| 3373 | Ga0501033_0021359 | |||
| 3374 | Ga0501033_0033508 | |||
| 3375 | Ga0501033_0086738 | |||
| 3376 | Ga0501033_0101453 | |||
| 3377 | Ga0501033_0139045 | |||
| 3378 | Ga0501033_0216760 | |||
| 3379 | Ga0501033_0222912 | |||
| 3380 | Ga0501033_0392054 | |||
| 3381 | Ga0501034_0000021 | |||
| 3382 | Ga0501034_0000482 | |||
| 3383 | Ga0501034_0002673 | |||
| 3384 | Ga0501034_0024772 | |||
| 3385 | Ga0501034_0046023 | |||
| 3386 | Ga0501034_0060811 | |||
| 3387 | Ga0501034_0062644 | |||
| 3388 | Ga0501034_0134254 | |||
| 3389 | Ga0501034_0164332 | |||
| 3390 | Ga0501034_0167276 | |||
| 3391 | Ga0501034_0212658 | |||
| 3392 | Ga0501034_0240132 | |||
| 3393 | Ga0501034_0247867 | |||
| 3394 | Ga0501034_0269164 | |||
| 3395 | Ga0501034_0339036 | |||
| 3396 | Ga0501034_0349858 | |||
| 3397 | Ga0501034_0464352 | |||
| 3398 | Ga0501036_0001704 | |||
| 3399 | Ga0501036_0005563 | |||
| 3400 | Ga0501036_0005653 | |||
| 3401 | Ga0501036_0076536 | |||
| 3402 | Ga0501036_0091111 | |||
| 3403 | Ga0501036_0091320 | |||
| 3404 | Ga0501036_0177505 | |||
| 3405 | Ga0501037_0000450 | |||
| 3406 | Ga0501037_0046720 | |||
| 3407 | Ga0501037_0050986 | |||
| 3408 | Ga0501037_0056591 | |||
| 3409 | Ga0501037_0063759 | |||
| 3410 | Ga0501037_0095843 | |||
| 3411 | Ga0501037_0108992 | |||
| 3412 | Ga0501037_0141799 | |||
| 3413 | Ga0501037_0290529 | |||
| 3414 | Ga0501038_0000052 | |||
| 3415 | Ga0501038_0037384 | |||
| 3416 | Ga0501038_0046533 | |||
| 3417 | Ga0501038_0058047 | |||
| 3418 | Ga0501038_0071577 | |||
| 3419 | Ga0501038_0071986 | |||
| 3420 | Ga0501038_0079573 | |||
| 3421 | Ga0501038_0083447 | |||
| 3422 | Ga0501038_0098475 | |||
| 3423 | Ga0501038_0108148 | |||
| 3424 | Ga0501038_0113532 | |||
| 3425 | Ga0501038_0115212 | |||
| 3426 | Ga0501038_0134728 | |||
| 3427 | Ga0501038_0146399 | |||
| 3428 | Ga0501038_0158446 | |||
| 3429 | Ga0501038_0355974 | |||
| 3430 | Ga0501039_0000549 | |||
| 3431 | Ga0501039_0039657 | |||
| 3432 | Ga0501039_0094100 | |||
| 3433 | Ga0501039_0116277 | |||
| 3434 | Ga0501039_0151389 | |||
| 3435 | Ga0501039_0179242 | |||
| 3436 | Ga0501039_0273189 | |||
| 3437 | Ga0501039_0293386 | |||
| 3438 | Ga0501040_0038034 | |||
| 3439 | Ga0501040_0271288 | |||
| 3440 | Ga0501040_0358231 | |||
| 3441 | Ga0501041_0021685 | |||
| 3442 | Ga0501041_0111333 | |||
| 3443 | Ga0501042_0014227 | |||
| 3444 | Ga0501042_0030132 | |||
| 3445 | Ga0501042_0090650 | |||
| 3446 | Ga0501042_0094589 | |||
| 3447 | Ga0501042_0191226 | |||
| 3448 | Ga0501043_0005051 | |||
| 3449 | Ga0501043_0012919 | |||
| 3450 | Ga0501043_0037798 | |||
| 3451 | Ga0501043_0042971 | |||
| 3452 | Ga0501043_0093452 | |||
| 3453 | Ga0501043_0116039 | |||
| 3454 | Ga0501043_0117710 | |||
| 3455 | Ga0501043_0129223 | |||
| 3456 | Ga0501043_0138567 | |||
| 3457 | Ga0501043_0142315 | |||
| 3458 | Ga0501043_0230224 | |||
| 3459 | Ga0501043_0377564 | |||
| 3460 | Ga0501046_0002237 | |||
| 3461 | Ga0501046_0024393 | |||
| 3462 | Ga0501046_0101892 | |||
| 3463 | Ga0501046_0111685 | |||
| 3464 | Ga0501046_0154028 | |||
| 3465 | Ga0501046_0156128 | |||
| 3466 | Ga0501046_0162788 | |||
| 3467 | Ga0501046_0175873 | |||
| 3468 | Ga0501046_0202042 | |||
| 3469 | Ga0501046_0545747 | |||
| 3470 | Ga0501047_0000235 | |||
| 3471 | Ga0501047_0017348 | |||
| 3472 | Ga0501047_0024757 | |||
| 3473 | Ga0501047_0025781 | |||
| 3474 | Ga0501047_0044775 | |||
| 3475 | Ga0501047_0050813 | |||
| 3476 | Ga0501047_0079255 | |||
| 3477 | Ga0501047_0095267 | |||
| 3478 | Ga0501047_0099459 | |||
| 3479 | Ga0501047_0133502 | |||
| 3480 | Ga0501047_0134755 | |||
| 3481 | Ga0501047_0147338 | |||
| 3482 | Ga0501047_0159685 | |||
| 3483 | Ga0501047_0223963 | |||
| 3484 | Ga0501047_0250701 | |||
| 3485 | Ga0501047_0262622 | |||
| 3486 | Ga0501047_0277985 | |||
| 3487 | Ga0501047_0303139 | |||
| 3488 | Ga0501047_0410524 | |||
| 3489 | Ga0501047_0592950 | |||
| 3490 | Ga0501047_0697831 | |||
| 3491 | Ga0501048_0001862 | |||
| 3492 | Ga0501048_0006738 | |||
| 3493 | Ga0501048_0020705 | |||
| 3494 | Ga0501048_0041101 | |||
| 3495 | Ga0501048_0103199 | |||
| 3496 | Ga0501048_0138183 | |||
| 3497 | Ga0501048_0341260 | |||
| 3498 | Ga0501067_0001776 | |||
| 3499 | Ga0501067_0005350 | |||
| 3500 | Ga0501067_0006170 | |||
| 3501 | Ga0501067_0033573 | |||
| 3502 | Ga0501067_0051199 | |||
| 3503 | Ga0501068_0001049 | |||
| 3504 | Ga0501068_0035313 | |||
| 3505 | Ga0501069_0001817 | |||
| 3506 | Ga0501069_0005996 | |||
| 3507 | Ga0501069_0008119 | |||
| 3508 | Ga0501069_0030545 | |||
| 3509 | Ga0501069_0155458 | |||
| 3510 | Ga0501069_0212034 | |||
| 3511 | Ga0501070_0001611 | |||
| 3512 | Ga0501070_0003398 | |||
| 3513 | Ga0501070_0033678 | |||
| 3514 | Ga0501070_0069151 | |||
| 3515 | Ga0501070_0095592 | |||
| 3516 | Ga0501070_0126129 | |||
| 3517 | Ga0501070_0163525 | |||
| 3518 | Ga0501070_0175198 | |||
| 3519 | Ga0501070_0196271 | |||
| 3520 | Ga0501070_0258564 | |||
| 3521 | Ga0501070_0270302 | |||
| 3522 | Ga0501070_0302330 | |||
| 3523 | Ga0501070_0417463 | |||
| 3524 | Ga0501071_0057085 | |||
| 3525 | Ga0501071_0070423 | |||
| 3526 | Ga0501071_0088539 | |||
| 3527 | Ga0501071_0095538 | |||
| 3528 | Ga0501071_0176824 | |||
| 3529 | Ga0501071_0228560 | |||
| 3530 | Ga0501071_0260600 | |||
| 3531 | Ga0501071_0534980 | |||
| 3532 | Ga0501072_0005670 | |||
| 3533 | Ga0501072_0013154 | |||
| 3534 | Ga0501072_0072626 | |||
| 3535 | Ga0501072_0088285 | |||
| 3536 | Ga0501072_0158132 | |||
| 3537 | Ga0501072_0680190 | |||
| 3538 | Ga0501073_0000597 | |||
| 3539 | Ga0501073_0004494 | |||
| 3540 | Ga0501073_0028618 | |||
| 3541 | Ga0501073_0040649 | |||
| 3542 | Ga0501073_0048979 | |||
| 3543 | Ga0501073_0085962 | |||
| 3544 | Ga0501073_0215286 | |||
| 3545 | Ga0501073_0222782 | |||
| 3546 | Ga0501073_0436380 | |||
| 3547 | Ga0501074_0008250 | |||
| 3548 | Ga0501074_0010906 | |||
| 3549 | Ga0501074_0058520 | |||
| 3550 | Ga0501074_0169846 | |||
| 3551 | Ga0501074_0174752 | |||
| 3552 | Ga0501074_0297540 | |||
| 3553 | Ga0501074_0556438 | |||
| 3554 | Ga0501075_0095302 | |||
| 3555 | Ga0501075_0114552 | |||
| 3556 | Ga0501076_0017899 | |||
| 3557 | Ga0501076_0054065 | |||
| 3558 | Ga0501076_0094419 | |||
| 3559 | Ga0501076_0188244 | |||
| 3560 | Ga0501076_0382548 | |||
| 3561 | Ga0501077_0196207 | |||
| 3562 | Ga0501077_0211172 | |||
| 3563 | Ga0501079_0001478 | |||
| 3564 | Ga0501079_0011059 | |||
| 3565 | Ga0501079_0018448 | |||
| 3566 | Ga0501079_0037891 | |||
| 3567 | Ga0501079_0056415 | |||
| 3568 | Ga0501079_0081804 | |||
| 3569 | Ga0501079_0142053 | |||
| 3570 | Ga0501079_0356873 | |||
| 3571 | Ga0501080_0006960 | |||
| 3572 | Ga0501080_0028291 | |||
| 3573 | Ga0501080_0064957 | |||
| 3574 | Ga0501080_0081520 | |||
| 3575 | Ga0501080_0247437 | |||
| 3576 | Ga0501080_0254414 | |||
| 3577 | Ga0501080_0278784 | |||
| 3578 | Ga0501080_0279412 | |||
| 3579 | Ga0501080_0294504 | |||
| 3580 | Ga0501080_0325595 | |||
| 3581 | Ga0501080_0361098 | |||
| 3582 | Ga0501080_0394041 | |||
| 3583 | Ga0501081_0029037 | |||
| 3584 | Ga0501081_0089635 | |||
| 3585 | Ga0501083_0008114 | |||
| 3586 | Ga0501083_0028991 | |||
| 3587 | Ga0501083_0069494 | |||
| 3588 | Ga0501083_0071786 | |||
| 3589 | Ga0501083_0095282 | |||
| 3590 | Ga0501083_0163629 | |||
| 3591 | Ga0501083_0167731 | |||
| 3592 | Ga0501083_0170624 | |||
| 3593 | Ga0501083_0393089 | |||
| 3594 | Ga0501035_0000255 | |||
| 3595 | Ga0501035_0005931 | |||
| 3596 | Ga0501035_0013364 | |||
| 3597 | Ga0501035_0024934 | |||
| 3598 | Ga0501035_0043569 | |||
| 3599 | Ga0501035_0051927 | |||
| 3600 | Ga0501035_0055903 | |||
| 3601 | Ga0501035_0066191 | |||
| 3602 | Ga0501035_0073482 | |||
| 3603 | Ga0501035_0079965 | |||
| 3604 | Ga0501035_0082602 | |||
| 3605 | Ga0501035_0158311 | |||
| 3606 | Ga0501035_0224354 | |||
| 3607 | Ga0501035_0227016 | |||
| 3608 | Ga0501035_0249041 | |||
| 3609 | Ga0501035_0322372 | |||
| 3610 | Ga0501044_0014028 | |||
| 3611 | Ga0501044_0028702 | |||
| 3612 | Ga0501044_0038683 | |||
| 3613 | Ga0501044_0044447 | |||
| 3614 | Ga0501044_0062058 | |||
| 3615 | Ga0501044_0107934 | |||
| 3616 | Ga0501044_0118786 | |||
| 3617 | Ga0501044_0119255 | |||
| 3618 | Ga0501044_0134695 | |||
| 3619 | Ga0501044_0138736 | |||
| 3620 | Ga0501044_0141817 | |||
| 3621 | Ga0501044_0225504 | |||
| 3622 | Ga0501044_0233773 | |||
| 3623 | Ga0501044_0238198 | |||
| 3624 | Ga0501044_0270633 | |||
| 3625 | Ga0501044_0275130 | |||
| 3626 | Ga0501044_0278859 | |||
| 3627 | Ga0501044_0343028 | |||
| 3628 | Ga0501044_0381449 | |||
| 3629 | Ga0501044_0398557 | |||
| 3630 | Ga0501044_0410246 | |||
| 3631 | Ga0501044_0451214 | |||
| 3632 | Ga0501044_0824870 | |||
| 3633 | Ga0501045_0070801 | |||
| 3634 | Ga0501045_0087751 | |||
| 3635 | Ga0501045_0142155 | |||
| 3636 | Ga0501045_0461578 | |||
| 3637 | nmdc:mga03683_51131_c1 | |||
| 3638 | nmdc:mga03n38_189102_c1 | |||
| 3639 | nmdc:mga03n38_59041_c1 | |||
| 3640 | nmdc:mga00v17_255849_c1 | |||
| 3641 | nmdc:mga00v17_6230_c1 | |||
| 3642 | nmdc:mga0yw44_19482_c1 | |||
| 3643 | nmdc:mga0yw44_46317_c1 | |||
| 3644 | nmdc:mga0k408_25101_c1 | |||
| 3645 | nmdc:mga06z11_171341_c1 | |||
| 3646 | nmdc:mga06z11_7008_c1 | |||
| 3647 | nmdc:mga07m45_120105_c1 | |||
| 3648 | nmdc:mga07m45_28689_c1 | |||
| 3649 | nmdc:mga05p37_1004186_c1 | |||
| 3650 | nmdc:mga05p37_1773_c1 | |||
| 3651 | nmdc:mga05p37_2437_c1 | |||
| 3652 | nmdc:mga05p37_36180_c1 | |||
| 3653 | nmdc:mga09592_1370_c1 | |||
| 3654 | nmdc:mga0qj67_2465_c1 | |||
| 3655 | nmdc:mga06r32_591663_c1 | |||
| 3656 | nmdc:mga06r32_638_c1 | |||
| 3657 | nmdc:mga08y16_319763_c1 | |||
| 3658 | nmdc:mga08y16_35725_c1 | |||
| 3659 | nmdc:mga08y16_413994_c1 | |||
| 3660 | nmdc:mga08y16_44765_c1 | |||
| 3661 | nmdc:mga08y16_549_c1 | |||
| 3662 | nmdc:mga08y16_95891_c1 | |||
| 3663 | nmdc:mga0n895_158795_c1 | |||
| 3664 | nmdc:mga0n895_19785_c1 | |||
| 3665 | nmdc:mga0n895_256768_c1 | |||
| 3666 | nmdc:mga0n895_283_c1 | |||
| 3667 | nmdc:mga0n895_343834_c1 | |||
| 3668 | nmdc:mga0n895_6552_c1 | |||
| 3669 | nmdc:mga0rr50_127821_c1 | |||
| 3670 | nmdc:mga0rr50_142937_c1 | |||
| 3671 | nmdc:mga0rr50_15656_c1 | |||
| 3672 | nmdc:mga0rr50_21738_c1 | |||
| 3673 | nmdc:mga0rr50_579135_c1 | |||
| 3674 | nmdc:mga08x19_14934_c1 | |||
| 3675 | nmdc:mga08x19_177_c1 | |||
| 3676 | nmdc:mga08x19_195316_c1 | |||
| 3677 | nmdc:mga08x19_67568_c1 | |||
| 3678 | nmdc:mga08x19_91478_c1 | |||
| 3679 | nmdc:mga0a205_136415_c1 | |||
| 3680 | nmdc:mga0a205_171385_c1 | |||
| 3681 | nmdc:mga0a205_19999_c1 | |||
| 3682 | nmdc:mga0a205_387_c1 | |||
| 3683 | nmdc:mga0a205_8273_c1 | |||
| 3684 | nmdc:mga0sz30_104861_c1 | |||
| 3685 | nmdc:mga0sz30_11705_c1 | |||
| 3686 | nmdc:mga0sz30_8120_c1 | |||
| 3687 | Ga0495601_0001193 | |||
| 3688 | Ga0495601_0002336 | |||
| 3689 | Ga0495601_0004742 | |||
| 3690 | Ga0495601_0005274 | |||
| 3691 | Ga0495601_0005651 | |||
| 3692 | Ga0495601_0007365 | |||
| 3693 | Ga0495601_0032855 | |||
| 3694 | Ga0495601_0050869 | |||
| 3695 | Ga0495601_0181136 | |||
| 3696 | Ga0495612_0017871 | |||
| 3697 | Ga0495612_0047295 | |||
| 3698 | Ga0495612_0063092 | |||
| 3699 | Ga0495595_0000532 | |||
| 3700 | Ga0495595_0001637 | |||
| 3701 | Ga0495595_0022326 | |||
| 3702 | Ga0495595_0050071 | |||
| 3703 | Ga0495595_0080343 | |||
| 3704 | Ga0495595_0085816 | |||
| 3705 | Ga0495619_0001164 | |||
| 3706 | Ga0495619_0001481 | |||
| 3707 | Ga0495619_0002710 | |||
| 3708 | Ga0495619_0015650 | |||
| 3709 | Ga0495619_0041602 | |||
| 3710 | Ga0495619_0043000 | |||
| 3711 | Ga0495619_0060862 | |||
| 3712 | Ga0495619_0125863 | |||
| 3713 | Ga0495619_0480959 | |||
| 3714 | Ga0500578_0236727 | |||
| 3715 | Ga0500643_005061 | |||
| 3716 | Ga0500643_052533 | |||
| 3717 | Ga0500644_0008929 | |||
| 3718 | Ga0500644_0032371 | |||
| 3719 | Ga0500646_0003562 | |||
| 3720 | Ga0500646_0016450 | |||
| 3721 | Ga0500651_0045191 | |||
| 3722 | Ga0500651_0115831 | |||
| 3723 | Ga0500641_0005677 | |||
| 3724 | Ga0500641_0021719 | |||
| 3725 | Ga0500650_0001523 | |||
| 3726 | Ga0500654_112898 | |||
| 3727 | Ga0500556_0000125 | |||
| 3728 | Ga0500593_174969 | |||
| 3729 | Ga0500595_000016 | |||
| 3730 | Ga0500595_010713 | |||
| 3731 | Ga0500595_018990 | |||
| 3732 | Ga0500608_027463 | |||
| 3733 | Ga0500642_0000105 | |||
| 3734 | Ga0500642_0009901 | |||
| 3735 | Ga0500642_0127103 | |||
| 3736 | Ga0500652_019736 | |||
| 3737 | Ga0500652_051493 | |||
| 3738 | Ga0500655_006775 | |||
| 3739 | Ga0500658_0086249 | |||
| 3740 | Ga0500559_0062898 | |||
| 3741 | Ga0500559_0277986 | |||
| 3742 | Ga0500568_0014095 | |||
| 3743 | Ga0500568_0041603 | |||
| 3744 | Ga0500568_0159862 | |||
| 3745 | Ga0500573_0000452 | |||
| 3746 | Ga0500573_0006745 | |||
| 3747 | Ga0500586_007745 | |||
| 3748 | Ga0500616_0000085 | |||
| 3749 | Ga0500616_0000876 | |||
| 3750 | Ga0500616_0070843 | |||
| 3751 | Ga0500619_033505 | |||
| 3752 | Ga0500622_0013118 | |||
| 3753 | Ga0500624_007708 | |||
| 3754 | Ga0500627_0046797 | |||
| 3755 | Ga0500567_130262 | |||
| 3756 | Ga0500645_001772 | |||
| 3757 | Ga0501084_0000175 | |||
| 3758 | Ga0501084_0028118 | |||
| 3759 | Ga0501084_0030163 | |||
| 3760 | Ga0501084_0034419 | |||
| 3761 | Ga0501084_0044330 | |||
| 3762 | Ga0501084_0059035 | |||
| 3763 | Ga0501084_0311314 | |||
| 3764 | Ga0501084_0393799 | |||
| 3765 | Ga0501082_0000653 | |||
| 3766 | Ga0501082_0004728 | |||
| 3767 | Ga0501082_0027700 | |||
| 3768 | Ga0501082_0032834 | |||
| 3769 | Ga0501082_0093597 | |||
| 3770 | Ga0501082_0108585 | |||
| 3771 | Ga0501082_0131205 | |||
| 3772 | Ga0501082_0160690 | |||
| 3773 | Ga0501082_0181935 | |||
| 3774 | Ga0501082_0230867 | |||
| 3775 | Ga0501082_0308123 | |||
| 3776 | Ga0530510_0179127 | |||
| 3777 | Ga0530510_0268027 | |||
| 3778 | 2513857536 | |||
| 3779 | 2524537994 | |||
| 3780 | 2603859871 | |||
| 3781 | 2643755779 | |||
| 3782 | 2644287952 | |||
| 3783 | 2793071754 | |||
| 3784 | 2857528519 | |||
| 3785 | 2893070165 | |||
| 3786 | 2903758267 | |||
| 3787 | 2904701654 | |||
| 3788 | 2906610374 | |||
| 3789 | 2919076116 | |||
| 3790 | 2922428987 | |||
| 3791 | 8006942216 | |||
| 3792 | 8006981950 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8c97-assembly1.cif.gz_D | cryo-em captures early ribosome assembly in action | 0.8522 | 2 | 199 |
| 8c93-assembly1.cif.gz_D | cryo-em captures early ribosome assembly in action | 0.8444 | 2 | 198 |
| 6pvk-assembly1.cif.gz_D | bacterial 45srbga ribosomal particle class a | 0.8347 | 1 | 198 |
| 6ppf-assembly1.cif.gz_D | bacterial 45srbga ribosomal particle class b | 0.8231 | 1 | 198 |
| 6hix-assembly1.cif.gz_AE | cryo-em structure of the trypanosoma brucei mitochondrial ribosome - this entry contains the large mitoribosomal subunit | 0.8164 | 2 | 199 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q54I61_95_160_3.30.160.810 | Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; | 0.7538 | 22 | 77 | 3.30.160.810 |
| af_Q9P6P6_75_139_3.30.160.810 | Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; | 0.7393 | 23 | 83 | 3.30.160.810 |
| af_P60438_33_95_3.30.160.810 | Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; | 0.7335 | 23 | 83 | 3.30.160.810 |
| af_Q9LIT4_106_169_3.30.160.810 | Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; | 0.7209 | 24 | 83 | 3.30.160.810 |
| 1vw3C02 | Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; | 0.7163 | 22 | 83 | 3.30.160.810 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A836DX71-F1-model_v4 | deleted | 0.729 | 1 | 203 |
|
| AF-A0A7X6FVD3-F1-model_v4 | deleted | 0.7256 | 1 | 211 |
|
| AF-A0A7W4CIR4-F1-model_v4 | Large ribosomal subunit protein uL3 | 0.7249 | 1 | 212 |
GO:0003735
GO:0006412 GO:0019843 GO:0022625 |
| AF-Q2RQW0-F1-model_v4 | Large ribosomal subunit protein uL3 (50S ribosomal protein L3) | 0.7246 | 2 | 212 |
GO:0003735
GO:0006412 GO:0019843 GO:0022625 |
| AF-A0A420WMM9-F1-model_v4 | Large ribosomal subunit protein uL3 | 0.7242 | 1 | 211 |
GO:0003735
GO:0006412 GO:0019843 GO:0022625 |