F496004

General Info

Members Datasets Scaffolds Average Seq Length
1896 1419 3792 351

Family's Representative Sequence

Representative Sequence 3300037418|Ga0395900_0242476|Ga0395900_0242476_391_1740
Length 423
Sequence MPFKIAKEKSAFRQSSLASFMQLPVLIPKTTSMLKNYSLDSECGTLYIASNRIGAAKTGRIRMPAAGCAFGVERQAVEFELAGLVGVTPGAIAQDKGTIGISMPTKSSARWIADGSNMVKTFKDKGYDTDLQYAEDDIPNQLAQIENMITKNVKVLVIAAIDGTTLSNALQKAADKGIKVIAYDRLIRNSKNVDYYTTFDNFQVGVLQAGYIEKALNLKSGKGPYNIELFGGSPDDNNAYFFYNGAMSVLKPYIDKGKLVVRSKQIGMDKIATLRWDGAVAQARMDNLLSAYYGNAHLDAVLSPYDGLSIGILSSLKGVGYGTAGQPMPVVTGQDAEIPSVKSILRGEQKQTVFKDTRELAKVTVAMVDAMLSGKTPQINDTKTYNNGVKVVPAYLLKPVSVDASNWKQVLVGSGYYTEAQIK

Samples

Sample ID Description Type Environment
1 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
4 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
5 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
6 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
7 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
8 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
9 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
10 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
11 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
12 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
13 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
14 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
15 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
16 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
17 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
18 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
19 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
20 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
21 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
22 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
23 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
24 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
25 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
26 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
27 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
28 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
29 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
30 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
31 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
32 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
33 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
34 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
35 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
36 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
37 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
38 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
39 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
40 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
41 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
42 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
43 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
44 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
45 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
46 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
47 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
48 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
49 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
50 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
51 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
52 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
53 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
54 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
55 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
56 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
57 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
58 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
59 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
60 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
61 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
62 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
63 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
64 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
65 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
66 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
67 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
68 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
69 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
70 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
71 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
72 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
73 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
74 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
75 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
76 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
77 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
78 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
79 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
80 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
81 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
82 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
83 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
84 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
85 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
86 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
87 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
88 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
89 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
90 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
91 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
92 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
93 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
94 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
95 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
96 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
97 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
98 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
99 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
100 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
101 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
102 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
103 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
104 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
105 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
106 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
107 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
108 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
109 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
110 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
111 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
112 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
113 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
114 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
115 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
116 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
117 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
118 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
119 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
120 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
121 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
122 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
123 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
124 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
125 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
126 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
127 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
128 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
129 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
130 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
131 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
132 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
133 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
134 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
135 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
136 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
137 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
138 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
139 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
140 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
141 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
142 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
143 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
144 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
145 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
146 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
147 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
148 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
149 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
150 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
151 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
152 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
153 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
154 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
155 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
156 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
157 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
158 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
159 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
160 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
161 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
162 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
163 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
164 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
165 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
166 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
167 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
168 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
211 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
212 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
213 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
214 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
215 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
217 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
219 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
222 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
223 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
224 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
225 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
226 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
227 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
228 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
229 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
230 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
231 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
232 3300029277 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.ctcc.R1 Metatranscriptome Rhizosphere
233 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
234 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
235 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
236 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
237 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
238 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
239 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
240 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
241 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
242 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
243 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
244 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
245 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
246 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
247 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
248 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
249 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
250 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
251 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
252 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
253 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
254 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
255 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
256 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
257 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
258 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
259 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
260 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
261 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
262 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
263 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
264 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
265 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
266 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
267 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
268 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
269 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
270 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
271 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
272 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
273 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
274 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
275 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
276 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
277 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
278 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
279 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
280 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
281 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
282 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
283 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
284 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
285 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
286 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
287 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
288 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
289 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
290 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
291 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
292 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
293 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
294 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
295 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
296 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
297 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
298 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
299 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
300 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
301 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
302 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
303 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
304 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
305 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
306 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
307 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
308 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
309 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
310 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
311 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
312 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
313 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
314 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
315 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
316 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
317 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
318 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
319 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
320 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
321 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
322 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
323 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
324 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
325 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
326 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
327 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
328 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
329 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
330 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
331 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
332 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
333 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
334 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
335 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
336 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
337 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
338 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
339 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
340 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
341 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
342 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
343 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
344 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
345 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
346 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
347 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
348 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
349 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
350 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
351 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
352 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
353 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
354 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
355 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
356 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
357 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
358 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
359 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
360 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
361 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
362 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
363 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
364 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
365 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
366 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
367 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
368 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
369 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
370 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
371 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
372 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
373 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
374 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
375 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
376 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
377 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
378 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
379 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
380 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
381 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
382 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
383 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
384 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
385 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
386 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
387 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
388 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
389 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
390 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
391 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
392 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
393 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
394 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
395 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
396 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
397 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
398 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
399 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
400 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
401 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
402 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
403 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
404 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
405 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
406 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
407 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
408 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
409 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
410 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
411 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
412 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
413 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
414 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
415 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
416 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
417 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
418 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
419 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
420 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
421 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
422 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
423 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
424 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
425 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
426 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
427 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
428 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
429 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
430 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
431 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
432 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
433 3300049757 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control Metagenome Rhizosphere
434 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
435 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
436 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
437 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
438 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
439 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
440 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
441 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
442 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
443 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
444 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
445 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
446 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
447 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
448 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
449 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
450 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
451 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
452 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
453 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
454 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
455 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
456 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
457 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
458 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
459 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
460 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
461 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
462 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
463 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
464 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
465 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
466 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
467 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
468 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
469 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
470 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
471 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
472 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
473 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
474 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
475 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
476 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
477 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
478 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
479 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
480 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
481 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
482 3300059648 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 65R_SW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
483 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
484 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
485 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
486 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
487 2508501050 Microvirga lupini Lut6 Isolate Nodule
488 2508501114 Microvirga lotononidis WSM3557 Isolate Nodule
489 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
490 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
491 2509276019 Ensifer aridi TW10 Isolate Nodule
492 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
493 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
494 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
495 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
496 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
497 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
498 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
499 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
500 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
501 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
502 2511231003 Herbaspirillum sp. CF444 Isolate Rhizosphere
503 2511231026 Herbaspirillum sp. YR522 Isolate Rhizosphere
504 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
505 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
506 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
507 2511231221 Azospirillum lipoferum 4B Isolate Rhizosphere
508 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
509 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
510 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
511 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
512 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
513 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
514 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
515 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
516 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
517 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
518 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
519 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
520 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
521 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
522 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
523 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
524 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
525 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
526 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
527 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
528 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
529 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
530 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
531 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
532 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
533 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
534 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
535 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
536 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
537 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
538 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
539 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
540 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
541 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
542 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
543 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
544 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
545 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
546 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
547 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
548 2516143018 Ensifer sp. BR816 Isolate Nodule
549 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
550 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
551 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
552 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
553 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
554 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
555 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
556 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
557 2519899620 Rhizobium sp. Pop5 Isolate Nodule
558 2521172590 Herbaspirillum sp. GW103 Isolate Rhizosphere
559 2522572158 Azospirillum halopraeferens DSM 3675 Isolate Unclassified
560 2523231067 Pleomorphomonas oryzae DSM 16300 Isolate Unclassified
561 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
562 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
563 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
564 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
565 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
566 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
567 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
568 2534681786 Brucella suis 92/29 Isolate Unclassified
569 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
570 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
571 2547132374 Acidovorax radicis N35 Isolate Unclassified
572 2548876994 Herbaspirillum lusitanum P6-12 Isolate Nodule
573 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
574 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
575 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
576 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
577 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
578 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
579 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
580 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
581 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
582 2551306416 Herbaspirillum seropedicae Os34 Isolate Unclassified
583 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
584 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
585 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
586 2558860983 Allorhizobium undicola ATCC 700741 Isolate Rhizoplane
587 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
588 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
589 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
590 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
591 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
592 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
593 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
594 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
595 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
596 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
597 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
598 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
599 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
600 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
601 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
602 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
603 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
604 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
605 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
606 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
607 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
608 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
609 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
610 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
611 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
612 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
613 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
614 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
615 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
616 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
617 2595698237 Methylobacterium sp. UNCCL125 Isolate Unclassified
618 2597490356 Azospirillum brasilense sp7 Isolate Unclassified
619 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
620 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
621 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
622 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
623 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
624 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
625 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
626 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
627 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
628 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
629 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
630 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
631 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
632 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
633 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
634 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
635 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
636 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
637 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
638 2643221544 Pelomonas sp. Root1444 Isolate Unclassified
639 2643221557 Ensifer sp. Root558 Isolate Unclassified
640 2643221558 Rhizobium sp. Root149 Isolate Unclassified
641 2643221568 Rhizobium sp. Root564 Isolate Unclassified
642 2643221570 Acidovorax sp. Root568 Isolate Unclassified
643 2643221582 Rhizobium sp. Root651 Isolate Unclassified
644 2643221585 Pelomonas sp. Root662 Isolate Unclassified
645 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
646 2643221596 Acidovorax sp. Root70 Isolate Unclassified
647 2643221599 Rhizobium sp. Root708 Isolate Unclassified
648 2643221607 Rhizobium sp. Root73 Isolate Unclassified
649 2643221609 Acidovorax sp. Root217 Isolate Unclassified
650 2643221610 Ensifer sp. Root74 Isolate Unclassified
651 2643221611 Acidovorax sp. Root219 Isolate Unclassified
652 2643221618 Ensifer sp. Root231 Isolate Unclassified
653 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
654 2643221626 Ensifer sp. Root31 Isolate Unclassified
655 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
656 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
657 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
658 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
659 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
660 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
661 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
662 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
663 2643221652 Acidovorax sp. Root402 Isolate Unclassified
664 2643221655 Ensifer sp. Root1252 Isolate Unclassified
665 2643221656 Pelomonas sp. Root405 Isolate Unclassified
666 2643221658 Variovorax sp. Root411 Isolate Unclassified
667 2643221659 Ensifer sp. Root127 Isolate Unclassified
668 2643221668 Ensifer sp. Root423 Isolate Unclassified
669 2643221672 Variovorax sp. Root434 Isolate Unclassified
670 2643221675 Ensifer sp. Root1298 Isolate Unclassified
671 2643221680 Ensifer sp. Root1312 Isolate Unclassified
672 2643221683 Variovorax sp. Root473 Isolate Unclassified
673 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
674 2643221688 Rhizobium sp. Root482 Isolate Unclassified
675 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
676 2643221693 Rhizobium sp. Root491 Isolate Unclassified
677 2643221698 Ensifer sp. Root142 Isolate Unclassified
678 2643221712 Ensifer sp. Root258 Isolate Unclassified
679 2643221717 Acidovorax sp. Root267 Isolate Unclassified
680 2643221718 Rhizobium sp. Root268 Isolate Unclassified
681 2643221723 Ensifer sp. Root278 Isolate Unclassified
682 2643221726 Ensifer sp. Root954 Isolate Unclassified
683 2643221961 Aeromicrobium sp. Root236 Isolate Unclassified
684 2643221962 Aeromicrobium sp. Root344 Isolate Unclassified
685 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
686 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
687 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
688 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
689 2718217882 Rhizobium sp. N741 Isolate Nodule
690 2718217927 Rhizobium sp. N324 Isolate Nodule
691 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
692 2718218009 Rhizobium sp. N561 Isolate Nodule
693 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
694 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
695 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
696 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
697 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
698 2718218363 Rhizobium sp. N113 Isolate Nodule
699 2718218365 Rhizobium sp. N731 Isolate Nodule
700 2718218366 Rhizobium sp. N621 Isolate Nodule
701 2718218423 Rhizobium sp. N941 Isolate Nodule
702 2721755514 Rhizobium sp. N6212 Isolate Nodule
703 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
704 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
705 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
706 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
707 2721755809 Rhizobium sp. N541 Isolate Nodule
708 2721755810 Rhizobium sp. N871 Isolate Nodule
709 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
710 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
711 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
712 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
713 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
714 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
715 2728369365 Rhizobium sp. N1341 Isolate Nodule
716 2728369397 Rhizobium sp. N1314 Isolate Nodule
717 2738541277 Variovorax sp. GV051 Isolate Unclassified
718 2738541307 Variovorax sp. GV008 Isolate Unclassified
719 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
720 2738543012 Acidovorax sp. CF301 Isolate Unclassified
721 2738543013 Variovorax sp. BT01 Isolate Unclassified
722 2738543019 Variovorax sp. GV040 Isolate Unclassified
723 2738543031 Pleomorphomonas sp. CF100 Isolate Unclassified
724 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
725 2751185800 Brucella pituitosa AA2 Isolate Unclassified
726 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
727 2757320392 Phyllobacterium leguminum ORS 1419 Isolate Nodule
728 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
729 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
730 2765235838 Herbaspirillum robiniae AA6 Isolate Unclassified
731 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
732 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
733 2773857925 Microvirga vignae BR3299 Isolate Unclassified
734 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
735 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
736 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
737 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
738 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
739 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
740 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
741 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
742 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
743 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
744 2791355199
745 2791355222 Paenibacillus oryzae 1DrF-4 Isolate Unclassified
746 2791355256 Rhizobium sp. M10 Isolate Nodule
747 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
748 2791355260 Rhizobium sp. L9 Isolate Nodule
749 2791355261 Rhizobium sp. J15 Isolate Nodule
750 2791355262 Rhizobium sp. M1 Isolate Nodule
751 2791355263 Rhizobium chutanense C5 Isolate Nodule
752 2791355264 Rhizobium sp. S9 Isolate Nodule
753 2791355265 Rhizobium sp. H4 Isolate Nodule
754 2791355266 Rhizobium sp. L43 Isolate Nodule
755 2791355267 Rhizobium sp. L18 Isolate Nodule
756 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
757 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
758 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
759 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
760 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
761 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
762 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
763 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
764 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
765 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
766 2802429633 Rhizobium anhuiense J3 Isolate Nodule
767 2802429634 Rhizobium anhuiense S10 Isolate Nodule
768 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
769 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
770 2802429637 Rhizobium anhuiense C15 Isolate Nodule
771 2808606386 Herbaspirillum sp. SJZ099 Isolate Rhizosphere
772 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
773 2808606415 Herbaspirillum sp. SJZ130 Isolate Rhizosphere
774 2808606419 Herbaspirillum sp. SJZ106 Isolate Rhizosphere
775 2816332133 Acidovorax radicis 2721A Isolate Unclassified
776 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
777 2818991436 Collimonas arenae 515 Isolate Unclassified
778 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
779 2818991445 Herbaspirillum hiltneri 3195 Isolate Unclassified
780 2818991446 Variovorax sp. 1180 Isolate Unclassified
781 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
782 2818991449 Herbaspirillum huttiense 1147 Isolate Unclassified
783 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
784 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
785 2818991467 Bosea vestrisii 3192 Isolate Unclassified
786 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
787 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
788 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
789 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
790 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
791 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
792 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
793 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
794 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
795 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
796 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
797 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
798 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
799 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
800 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
801 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
802 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
803 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
804 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
805 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
806 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
807 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
808 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
809 2835312727 Microvirga calopogonii CCBAU 65841 Isolate Nodule
810 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
811 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
812 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
813 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
814 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
815 2838048938 Rhizobium pisi 27/80 Isolate Nodule
816 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
817 2838061910 Rhizobium phaseoli L15 Isolate Nodule
818 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
819 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
820 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
821 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
822 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
823 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
824 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
825 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
826 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
827 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
828 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
829 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
830 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
831 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
832 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
833 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
834 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
835 2839094727 Herbaspirillum robiniae HZ10 Isolate Nodule
836 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
837 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
838 2841760612 Bosea sp. Tri-49 Isolate Nodule
839 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
840 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
841 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
842 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
843 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
844 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
845 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
846 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
847 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
848 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
849 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
850 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
851 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
852 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
853 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
854 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
855 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
856 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
857 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
858 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
859 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
860 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
861 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
862 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
863 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
864 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
865 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
866 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
867 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
868 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
869 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
870 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
871 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
872 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
873 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
874 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
875 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
876 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
877 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
878 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
879 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
880 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
881 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
882 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
883 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
884 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
885 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
886 2842333319 Skermanella aerolata SEMIA 4010 Isolate Nodule
887 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
888 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
889 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
890 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
891 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
892 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
893 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
894 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
895 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
896 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
897 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
898 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
899 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
900 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
901 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
902 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
903 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
904 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
905 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
906 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
907 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
908 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
909 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
910 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
911 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
912 2842677519 Variovorax sp. R-72495 Isolate Unclassified
913 2842747753 Variovorax sp. R-72060 Isolate Unclassified
914 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
915 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
916 2844104063 Bosea sp. Tri-39 Isolate Nodule
917 2844163670 Ensifer sp. 1H6 Isolate Unclassified
918 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
919 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
920 2844533157 Inquilinus sp. R-72501 v. 2 Isolate Unclassified
921 2846952575 Azospirillum brasilense sp7 Isolate Unclassified
922 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
923 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
924 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
925 2848858292 Azospirillum brasilense Az39 Isolate Unclassified
926 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
927 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
928 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
929 2851182111 Bosea sp. Tri-44 Isolate Nodule
930 2851246043 Bosea sp. Tri-54 Isolate Nodule
931 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
932 2852618963 Herbaspirillum sp. SJZ102 Isolate Rhizosphere
933 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
934 2854911287 Brucella lupini LUP21 Isolate Unclassified
935 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
936 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
937 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
938 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
939 2856741275 Microbispora triticiradicis NEAU-HRDPA2-9 Isolate Unclassified
940 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
941 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
942 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
943 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
944 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
945 2861520306 Phytomonospora endophytica DSM 45386 Isolate Unclassified
946 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
947 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
948 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
949 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
950 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
951 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
952 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
953 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
954 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
955 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
956 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
957 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
958 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
959 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
960 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
961 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
962 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
963 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
964 2882456835 Microvirga sp. KLBC 81 Isolate Unclassified
965 2884811622 Herbaspirillum sp. 3C11 Isolate Unclassified
966 2884836552 Herbaspirillum sp. 3R-11 Isolate Unclassified
967 2884852848 Herbaspirillum sp. 3R11 Isolate Unclassified
968 2885080285 Janthinobacterium sp. AD80 Isolate Rhizosphere
969 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
970 2885198086 Variovorax sp. 679 Isolate Unclassified
971 2885211737 Variovorax sp. 553 Isolate Unclassified
972 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
973 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
974 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
975 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
976 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
977 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
978 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
979 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
980 2889306138 Methylobacterium sp. PvR107 Isolate Rhizosphere
981 2894232714 Microvirga tunisiensis Lmie10 Isolate Nodule
982 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
983 2894817345 Aureimonas psammosilenae YIM DR1026 Isolate Unclassified
984 2896154374 Herbaspirillum sp. 3R-3a1 Isolate Nodule
985 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
986 2897803580 Azospirillum doebereinerae GSF71 Isolate Unclassified
987 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
988 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
989 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
990 2899924645 Variovorax sp. 369 Isolate Unclassified
991 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
992 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
993 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
994 2904439833 Herbaspirillum sp. 1589 Isolate Rhizosphere
995 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
996 2904456579 Variovorax sp. 2002 Isolate Unclassified
997 2904530477 Herbaspirillum huttiense 611 Isolate Unclassified
998 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
999 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
1000 2904584206 Herbaspirillum sp. 1050 Isolate Unclassified
1001 2904589729 Herbaspirillum sp. 1130 Isolate Unclassified
1002 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
1003 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
1004 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
1005 2904699407
1006 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
1007 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
1008 2906610324
1009 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
1010 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
1011 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
1012 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
1013 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
1014 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
1015 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
1016 2909042592 Labrys sp. LIt4 Isolate Nodule
1017 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
1018 2915650412 Ochrobactrum sp. CM-21-5 Isolate Rhizosphere
1019 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
1020 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
1021 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
1022 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
1023 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
1024 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
1025 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
1026 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
1027 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
1028 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
1029 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
1030 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
1031 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
1032 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
1033 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
1034 2917554339 Chthonobacter rhizosphaerae yh7-1 Isolate Rhizosphere
1035 2917699015 Bosea sp. F3-2 Isolate Rhizosphere
1036 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
1037 2919079590 Herbaspirillum sp. 1173 Isolate Unclassified
1038 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
1039 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
1040 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
1041 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
1042 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
1043 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
1044 2919450847 Ancylobacter sp. 3268 Isolate Rhizosphere
1045 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
1046 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
1047 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
1048 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
1049 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
1050 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
1051 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
1052 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
1053 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
1054 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
1055 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
1056 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
1057 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
1058 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
1059 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
1060 2922368715
1061 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
1062 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
1063 2922425934
1064 2923510766 Herbaspirillum rubrisubalbicans SLBN-127 Isolate Rhizosphere
1065 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
1066 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
1067 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
1068 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
1069 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
1070 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
1071 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
1072 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
1073 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
1074 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
1075 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
1076 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
1077 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
1078 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
1079 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
1080 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
1081 2928037797 Variovorax sp. 1126 Isolate Unclassified
1082 2928044640 Variovorax sp. 1128 Isolate Unclassified
1083 2928051484 Variovorax sp. 1133 Isolate Unclassified
1084 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
1085 2928070936 Variovorax gossypii 1167 Isolate Unclassified
1086 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
1087 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
1088 2928125067 Methylobacterium sp. 1973 Isolate Unclassified
1089 2928130867 Herbaspirillum seropedicae 1977 Isolate Unclassified
1090 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
1091 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
1092 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
1093 2929520902 Variovorax beijingensis 502 Isolate Unclassified
1094 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
1095 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
1096 2932410948 Janthinobacterium lividum 2829 Isolate Rhizosphere
1097 2932416698 Janthinobacterium lividum 2830 Isolate Rhizosphere
1098 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
1099 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
1100 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
1101 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
1102 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
1103 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
1104 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
1105 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
1106 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
1107 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
1108 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
1109 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
1110 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
1111 2933599457 Rhizobium phaseoli M3 Isolate Nodule
1112 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
1113 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
1114 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
1115 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
1116 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
1117 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
1118 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
1119 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
1120 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
1121 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
1122 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
1123 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
1124 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
1125 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
1126 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
1127 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
1128 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
1129 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
1130 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
1131 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
1132 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
1133 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
1134 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
1135 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
1136 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
1137 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
1138 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
1139 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
1140 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
1141 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
1142 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
1143 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
1144 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
1145 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
1146 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
1147 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
1148 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
1149 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
1150 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
1151 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
1152 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
1153 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
1154 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
1155 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
1156 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
1157 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
1158 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
1159 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
1160 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
1161 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
1162 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
1163 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
1164 2936381700 Rhizobium chutanense C16 Isolate Unclassified
1165 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
1166 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
1167 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
1168 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
1169 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
1170 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
1171 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
1172 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
1173 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
1174 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
1175 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
1176 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
1177 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
1178 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
1179 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
1180 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
1181 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
1182 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
1183 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
1184 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
1185 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
1186 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
1187 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
1188 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
1189 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
1190 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
1191 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
1192 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
1193 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
1194 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
1195 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
1196 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
1197 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
1198 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
1199 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
1200 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
1201 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
1202 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
1203 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
1204 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
1205 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
1206 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
1207 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
1208 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
1209 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
1210 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
1211 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
1212 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
1213 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
1214 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
1215 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
1216 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
1217 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
1218 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
1219 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
1220 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
1221 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
1222 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
1223 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
1224 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
1225 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
1226 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
1227 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
1228 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
1229 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
1230 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
1231 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
1232 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
1233 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
1234 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
1235 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
1236 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
1237 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
1238 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
1239 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
1240 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
1241 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
1242 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
1243 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
1244 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
1245 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
1246 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
1247 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
1248 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
1249 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
1250 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
1251 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
1252 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
1253 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
1254 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
1255 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
1256 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
1257 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
1258 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
1259 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
1260 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
1261 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
1262 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
1263 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
1264 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
1265 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
1266 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
1267 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
1268 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
1269 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
1270 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
1271 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
1272 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
1273 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
1274 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
1275 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
1276 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
1277 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
1278 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
1279 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
1280 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
1281 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
1282 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
1283 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
1284 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
1285 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
1286 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
1287 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
1288 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
1289 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
1290 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
1291 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
1292 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
1293 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
1294 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
1295 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
1296 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
1297 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
1298 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
1299 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
1300 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
1301 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
1302 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
1303 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
1304 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
1305 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
1306 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
1307 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
1308 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
1309 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
1310 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
1311 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere
1312 2996887358 Rhizobium sp. R711 Isolate Nodule
1313 2996893221 Rhizobium sp. R635 Isolate Nodule
1314 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
1315 3003665799 Methylobacterium aquaticum BG2 Isolate Unclassified
1316 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
1317 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
1318 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
1319 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
1320 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
1321 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
1322 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
1323 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
1324 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
1325 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
1326 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
1327 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
1328 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
1329 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
1330 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
1331 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
1332 8001845381 Ancylobacter sonchi VKM B-3145 Isolate Unclassified
1333 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
1334 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
1335 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
1336 8005258706 Rhizobium sp. R693 Isolate Nodule
1337 8005275841 Rhizobium sp. N4311 Isolate Nodule
1338 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
1339 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
1340 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
1341 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
1342 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
1343 8005321885 Rhizobium sp. R72 Isolate Nodule
1344 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
1345 8005382845 Rhizobium sp. R634 Isolate Nodule
1346 8005395548 Rhizobium sp. R339 Isolate Nodule
1347 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
1348 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
1349 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
1350 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
1351 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
1352 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
1353 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
1354 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
1355 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
1356 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
1357 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
1358 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
1359 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
1360 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
1361 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
1362 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
1363 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
1364 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
1365 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
1366 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
1367 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
1368 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
1369 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
1370 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
1371 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
1372 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
1373 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
1374 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
1375 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
1376 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
1377 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
1378 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
1379 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
1380 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
1381 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
1382 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
1383 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
1384 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
1385 8018176218 Rhizobium sp. N122 Isolate Nodule
1386 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
1387 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
1388 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
1389 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
1390 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
1391 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
1392 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
1393 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
1394 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
1395 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
1396 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
1397 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
1398 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
1399 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
1400 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
1401 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
1402 8024501048 Rhizobium sp. H4 Isolate Nodule
1403 8045864390 Aurantimonas endophytica KCTC 52296 Isolate Unclassified
1404 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
1405 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
1406 8054002106 Azospirillum lipoferum 59b Isolate Unclassified
1407 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
1408 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified
1409 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
1410 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
1411 8056382006 Rhizobium croatiense 13T Isolate Nodule
1412 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
1413 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
1414 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere
1415 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule
1416 8057132660 Paracoccus rhizosphaerae LMG 21293 Isolate Rhizosphere
1417 8057529695 Bosea vestrisii A18/4-2 Isolate Nodule
1418 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
1419 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 49.97
Metatranscriptomes 0.48
Isolates 49.55

Biome Distribution

Category Percentage (%)
Aerial Root 0.26
Bulb 0
Endosphere 11.87
Nodule 32.38
Rhizoplane 3.16
Rhizosphere 35.44
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395900_0242476 3300037418 Bacteria 1807
2 JGI24740J21852_10011127 3300001979 Bacteria 3435
3 JGI25156J39149_1001036 3300002705 Bacteria 12935
4 JGI25162J39368_1000001 3300002737 Bacteria 740113
5 JGI25162J39368_1002679 3300002737 Bacteria 6502
6 JGI25158J39367_1002199 3300002739 Bacteria 3250
7 JGI25152J39213_1004465 3300002773 Bacteria 4400
8 JGI25159J45721_1008212 3300002987 Bacteria 2895
9 JGI25159J45721_1008935 3300002987 Bacteria 2693
10 JGI25151J46595_10000952 3300003187 Bacteria 22247
11 JGI25406J46586_10000107 3300003203 Bacteria 37037
12 JGI25406J46586_10012746 3300003203 Bacteria 3634
13 JGI25406J46586_10033401 3300003203 Bacteria 1899
14 JGI25165J46597_1000001 3300003214 Bacteria 1111887
15 JGI25165J46597_1006128 3300003214 Bacteria 2173
16 JGI25153J46596_10002552 3300003215 Bacteria 10442
17 JGI25153J46596_10007970 3300003215 Bacteria 5129
18 rootL2_10000270 3300003322 Bacteria 83376
19 JGI25160J50197_1000642 3300003354 Bacteria 19446
20 JGI25404J52841_10014310 3300003659 Bacteria 1721
21 Ga0055538_1000001 3300003751 Bacteria 1111887
22 Ga0055538_1000008 3300003751 Bacteria 398547
23 Ga0055539_1000001 3300003752 Bacteria 1111887
24 Ga0055539_1000012 3300003752 Bacteria 398547
25 Ga0055539_1006046 3300003752 Bacteria 1556
26 Ga0055533_1000003 3300003756 Bacteria 1111887
27 Ga0055533_1000015 3300003756 Bacteria 398547
28 Ga0055532_1000005 3300003758 Bacteria 458107
29 Ga0055525_1000003 3300003759 Bacteria 962094
30 Ga0055525_1000017 3300003759 Bacteria 398547
31 Ga0055542_1009250 3300003762 Bacteria 1870
32 Ga0055537_1000096 3300003773 Bacteria 65970
33 Ga0055524_1023481 3300003775 Bacteria 1983
34 Ga0055524_1023902 3300003775 Bacteria 1955
35 Ga0055534_1000695 3300003784 Bacteria 16643
36 Ga0055534_1004475 3300003784 Bacteria 4039
37 Ga0055528_1000104 3300003790 Bacteria 67913
38 Ga0055530_10009863 3300003791 Bacteria 3605
39 Ga0055530_10011434 3300003791 Bacteria 3187
40 Ga0055540_1022126 3300003792 Bacteria 1633
41 Ga0055531_10009359 3300003794 Bacteria 5014
42 Ga0055531_10011980 3300003794 Bacteria 4120
43 Ga0055531_10016338 3300003794 Bacteria 3207
44 Ga0055541_1000001 3300003841 Bacteria 1111887
45 Ga0055541_1000009 3300003841 Bacteria 398547
46 Ga0055543_1002531 3300004625 Bacteria 5975
47 Ga0065165_1000410 3300005262 Bacteria 68475
48 Ga0065165_1000883 3300005262 Bacteria 38751
49 Ga0065165_1001488 3300005262 Bacteria 24882
50 Ga0065165_1009852 3300005262 Bacteria 4215
51 Ga0065165_1042807 3300005262 Bacteria 1333
52 Ga0065714_10083006 3300005288 Bacteria 2274
53 Ga0070676_10087404 3300005328 Bacteria 1903
54 Ga0070683_100094051 3300005329 Bacteria 2817
55 Ga0070683_100363933 3300005329 Bacteria 1377
56 Ga0070690_100146767 3300005330 Bacteria 1606
57 Ga0070670_100326742 3300005331 Bacteria 1345
58 Ga0068869_100127028 3300005334 Bacteria 1956
59 Ga0070680_100014938 3300005336 Bacteria 6078
60 Ga0070682_100245596 3300005337 Bacteria 1287
61 Ga0068868_100046499 3300005338 Bacteria 3397
62 Ga0070661_100340669 3300005344 Bacteria 1174
63 Ga0070668_100008262 3300005347 Bacteria 7726
64 Ga0070668_100261041 3300005347 Bacteria 1440
65 Ga0070671_100063456 3300005355 Bacteria 3076
66 Ga0070674_100055197 3300005356 Bacteria 2750
67 Ga0070673_100073096 3300005364 Bacteria 2759
68 Ga0070667_100174593 3300005367 Bacteria 1898
69 Ga0070709_10069745 3300005434 Bacteria 2264
70 Ga0070714_100011608 3300005435 Bacteria 6994
71 Ga0070713_100013165 3300005436 Bacteria 6097
72 Ga0070713_100022628 3300005436 Bacteria 4860
73 Ga0070713_100067247 3300005436 Bacteria 3016
74 Ga0070711_100026611 3300005439 Bacteria 3791
75 Ga0070711_100062401 3300005439 Bacteria 2597
76 Ga0070711_100176755 3300005439 Bacteria 1631
77 Ga0070705_100230320 3300005440 Bacteria 1289
78 Ga0070663_100016175 3300005455 Bacteria 4835
79 Ga0070663_100149791 3300005455 Bacteria 1788
80 Ga0070663_100162814 3300005455 Bacteria 1718
81 Ga0070678_100031477 3300005456 Bacteria 3660
82 Ga0070678_100163759 3300005456 Bacteria 1804
83 Ga0070662_100035632 3300005457 Bacteria 3515
84 Ga0070662_100260649 3300005457 Bacteria 1396
85 Ga0070681_10000912 3300005458 Bacteria 24962
86 Ga0068867_100147322 3300005459 Bacteria 1846
87 Ga0070707_100033699 3300005468 Bacteria 4884
88 Ga0070707_100040975 3300005468 Bacteria 4432
89 Ga0070698_100371654 3300005471 Bacteria 1362
90 Ga0070679_100002460 3300005530 Bacteria 16770
91 Ga0070679_100057701 3300005530 Bacteria 3870
92 Ga0070684_100027835 3300005535 Bacteria 4774
93 Ga0070697_100063577 3300005536 Bacteria 3013
94 Ga0068853_100069650 3300005539 Bacteria 3060
95 Ga0068853_100080729 3300005539 Bacteria 2847
96 Ga0070672_100129624 3300005543 Bacteria 2072
97 Ga0068855_100000423 3300005563 Bacteria 52174
98 Ga0070664_100130677 3300005564 Bacteria 2205
99 Ga0070664_100135452 3300005564 Bacteria 2165
100 Ga0068857_100032491 3300005577 Bacteria 4614
101 Ga0068857_100275935 3300005577 Bacteria 1545
102 Ga0068854_100083248 3300005578 Bacteria 2365
103 Ga0068854_100264378 3300005578 Bacteria 1379
104 Ga0068856_100131696 3300005614 Bacteria 2506
105 Ga0068856_100404468 3300005614 Bacteria 1385
106 Ga0068852_100001139 3300005616 Bacteria 17577
107 Ga0068852_100075576 3300005616 Bacteria 2972
108 Ga0068852_100133896 3300005616 Bacteria 2286
109 Ga0068852_100264587 3300005616 Bacteria 1652
110 Ga0068852_100271164 3300005616 Bacteria 1633
111 Ga0068852_100356906 3300005616 Bacteria 1429
112 Ga0068859_100072044 3300005617 Bacteria 3491
113 Ga0068859_100098886 3300005617 Bacteria 2972
114 Ga0068859_100219588 3300005617 Bacteria 1988
115 Ga0068859_100339757 3300005617 Bacteria 1596
116 Ga0068864_100326870 3300005618 Bacteria 1441
117 Ga0068863_100063713 3300005841 Bacteria 3487
118 Ga0068858_100172061 3300005842 Bacteria 2042
119 Ga0068860_100000471 3300005843 Bacteria 50128
120 Ga0068860_100023822 3300005843 Bacteria 5918
121 Ga0068860_100261569 3300005843 Bacteria 1687
122 Ga0081455_10002099 3300005937 Bacteria 23756
123 Ga0081455_10005028 3300005937 Bacteria 14622
124 Ga0081455_10006573 3300005937 Bacteria 12437
125 Ga0081455_10016438 3300005937 Bacteria 7145
126 Ga0081538_10032016 3300005981 Bacteria 3535
127 Ga0081538_10033054 3300005981 Bacteria 3451
128 Ga0081540_1001707 3300005983 Bacteria 18600
129 Ga0081540_1002090 3300005983 Bacteria 16651
130 Ga0081540_1017988 3300005983 Bacteria 4353
131 Ga0081540_1022394 3300005983 Bacteria 3732
132 Ga0081540_1030826 3300005983 Bacteria 2962
133 Ga0081540_1037486 3300005983 Bacteria 2569
134 Ga0081539_10000051 3300005985 Bacteria 268337
135 Ga0081539_10001557 3300005985 Bacteria 38200
136 Ga0081539_10001947 3300005985 Bacteria 31581
137 Ga0081539_10004431 3300005985 Bacteria 15505
138 Ga0081539_10017073 3300005985 Bacteria 5125
139 Ga0081539_10017886 3300005985 Bacteria 4948
140 Ga0070717_10002173 3300006028 Bacteria 13752
141 Ga0075365_10014659 3300006038 Bacteria 4721
142 Ga0075365_10038895 3300006038 Bacteria 3094
143 Ga0075365_10078390 3300006038 Bacteria 2234
144 Ga0075365_10132304 3300006038 Bacteria 1727
145 Ga0075368_10029384 3300006042 Bacteria 2125
146 Ga0075368_10045526 3300006042 Bacteria 1733
147 Ga0075368_10051710 3300006042 Bacteria 1633
148 Ga0075368_10064549 3300006042 Bacteria 1470
149 Ga0075363_100004083 3300006048 Bacteria 6324
150 Ga0075363_100040478 3300006048 Bacteria 2457
151 Ga0075363_100084462 3300006048 Bacteria 1741
152 Ga0075363_100110654 3300006048 Bacteria 1527
153 Ga0075364_10000419 3300006051 Bacteria 21262
154 Ga0075364_10007102 3300006051 Bacteria 6622
155 Ga0075364_10024520 3300006051 Bacteria 3832
156 Ga0075364_10055886 3300006051 Bacteria 2583
157 Ga0070712_100019688 3300006175 Bacteria 4406
158 Ga0070712_100209056 3300006175 Bacteria 1538
159 Ga0075362_10065364 3300006177 Bacteria 1652
160 Ga0075367_10018482 3300006178 Bacteria 3847
161 Ga0075367_10021851 3300006178 Bacteria 3582
162 Ga0075367_10036227 3300006178 Bacteria 2860
163 Ga0075367_10095289 3300006178 Bacteria 1815
164 Ga0075369_10001765 3300006186 Bacteria 7509
165 Ga0075369_10030976 3300006186 Bacteria 2254
166 Ga0075369_10041480 3300006186 Bacteria 1970
167 Ga0075369_10105966 3300006186 Bacteria 1264
168 Ga0075366_10001007 3300006195 Bacteria 13770
169 Ga0075366_10001909 3300006195 Bacteria 10537
170 Ga0075366_10006493 3300006195 Bacteria 6411
171 Ga0075366_10018672 3300006195 Bacteria 4005
172 Ga0075366_10062212 3300006195 Bacteria 2219
173 Ga0075366_10082767 3300006195 Bacteria 1918
174 Ga0097621_100140616 3300006237 Bacteria 2062
175 Ga0075370_10044141 3300006353 Bacteria 2520
176 Ga0075370_10060771 3300006353 Bacteria 2153
177 Ga0068871_100134549 3300006358 Bacteria 2098
178 Ga0068871_100254205 3300006358 Bacteria 1531
179 Ga0068871_100282079 3300006358 Bacteria 1453
180 Ga0075434_100222650 3300006871 Bacteria 1906
181 Ga0068865_100076807 3300006881 Bacteria 2385
182 Ga0075436_100248986 3300006914 Bacteria 1265
183 Ga0097620_100072046 3300006931 Bacteria 3491
184 Ga0097620_100098892 3300006931 Bacteria 2972
185 Ga0097620_100219588 3300006931 Bacteria 1988
186 Ga0097620_100339740 3300006931 Bacteria 1596
187 Ga0099824_1010395 3300006942 Bacteria 10980
188 Ga0099822_1003442 3300006943 Bacteria 20275
189 Ga0079104_1000103 3300006946 Bacteria 124578
190 Ga0079104_1006095 3300006946 Bacteria 4657
191 Ga0099826_10000647 3300006948 Bacteria 17955
192 Ga0105244_10000718 3300009036 Bacteria 28598
193 Ga0105244_10014405 3300009036 Bacteria 4572
194 Ga0105240_10001776 3300009093 Bacteria 36388
195 Ga0105240_10008933 3300009093 Bacteria 14247
196 Ga0105240_10015278 3300009093 Bacteria 10449
197 Ga0105240_10017280 3300009093 Bacteria 9727
198 Ga0105240_10225909 3300009093 Bacteria 2178
199 Ga0105240_10266283 3300009093 Bacteria 1975
200 Ga0111539_10164602 3300009094 Bacteria 2594
201 Ga0111539_10501254 3300009094 Bacteria 1414
202 Ga0105245_10056166 3300009098 Bacteria 3538
203 Ga0105245_10116994 3300009098 Bacteria 2486
204 Ga0105247_10035859 3300009101 Bacteria 3024
205 Ga0105247_10063527 3300009101 Bacteria 2292
206 Ga0105247_10097788 3300009101 Bacteria 1872
207 Ga0105243_10138599 3300009148 Bacteria 2072
208 Ga0105241_10206601 3300009174 Bacteria 1643
209 Ga0105242_10163928 3300009176 Bacteria 1948
210 Ga0105248_10043261 3300009177 Bacteria 5051
211 Ga0105248_10146526 3300009177 Bacteria 2664
212 Ga0105248_10220407 3300009177 Bacteria 2136
213 Ga0105237_10001461 3300009545 Bacteria 31169
214 Ga0105237_10010075 3300009545 Bacteria 10082
215 Ga0105237_10192806 3300009545 Bacteria 2037
216 Ga0105237_10198918 3300009545 Bacteria 2003
217 Ga0105237_10348357 3300009545 Bacteria 1485
218 Ga0105238_10000062 3300009551 Bacteria 126356
219 Ga0105238_10009650 3300009551 Bacteria 9660
220 Ga0105239_10000798 3300010375 Bacteria 44685
221 Ga0105239_10005131 3300010375 Bacteria 15461
222 Ga0105239_10014064 3300010375 Bacteria 8885
223 Ga0105239_10097320 3300010375 Bacteria 3252
224 Ga0105246_10029088 3300011119 Bacteria 3635
225 Ga0105246_10038359 3300011119 Bacteria 3221
226 Ga0105246_10049572 3300011119 Bacteria 2876
227 Ga0157319_1000003 3300012497 Bacteria 397199
228 Ga0157319_1000029 3300012497 Bacteria 52134
229 Ga0157373_10008513 3300013100 Bacteria 7621
230 Ga0157373_10028982 3300013100 Bacteria 3991
231 Ga0157370_10116881 3300013104 Bacteria 2491
232 Ga0157370_10149520 3300013104 Bacteria 2174
233 Ga0157369_10083060 3300013105 Bacteria 3426
234 Ga0157369_10153964 3300013105 Bacteria 2429
235 Ga0171462_1019 3300013250 Bacteria 146628
236 Ga0157374_10085403 3300013296 Bacteria 3001
237 Ga0157378_10180834 3300013297 Bacteria 1984
238 Ga0157378_10402340 3300013297 Bacteria 1349
239 Ga0163162_10041666 3300013306 Bacteria 4595
240 Ga0157372_10069112 3300013307 Bacteria 3972
241 Ga0163163_10038358 3300014325 Bacteria 4669
242 Ga0163163_10043845 3300014325 Bacteria 4388
243 Ga0163163_10071649 3300014325 Bacteria 3454
244 Ga0182008_10085920 3300014497 Bacteria 1549
245 Ga0157376_10065256 3300014969 Bacteria 3073
246 Ga0157376_10074842 3300014969 Bacteria 2888
247 Ga0182006_1000007 3300015261 Bacteria 452190
248 Ga0182006_1024790 3300015261 Bacteria 2471
249 Ga0182007_10000022 3300015262 Bacteria 189018
250 Ga0182007_10001677 3300015262 Bacteria 11744
251 Ga0182007_10003970 3300015262 Bacteria 6831
252 Ga0182005_1000010 3300015265 Bacteria 434103
253 Ga0182005_1000798 3300015265 Bacteria 14346
254 Ga0182005_1003928 3300015265 Bacteria 4908
255 Ga0163161_10000072 3300017792 Bacteria 102352
256 Ga0163161_10045371 3300017792 Bacteria 3169
257 Ga0163161_10111514 3300017792 Bacteria 2045
258 Ga0197907_10548788 3300020069 Bacteria 1363
259 Ga0206356_11527734 3300020070 Bacteria 1346
260 Ga0214544_1000004 3300021320 Bacteria 455869
261 Ga0214542_1000001 3300021321 Bacteria 1018696
262 Ga0214545_1000001 3300021324 Bacteria 1092817
263 Ga0214543_1000006 3300021327 Bacteria 443395
264 Ga0213873_10005146 3300021358 Bacteria 2491
265 Ga0213872_10004376 3300021361 Bacteria 7521
266 Ga0213876_10063371 3300021384 Bacteria 1952
267 Ga0213876_10094002 3300021384 Bacteria 1588
268 Ga0224712_10074223 3300022467 Bacteria 1389
269 Ga0209435_100004 3300025206 Bacteria 633417
270 Ga0209784_100004 3300025224 Bacteria 1378156
271 Ga0209784_100005 3300025224 Bacteria 1040422
272 Ga0209566_100004 3300025225 Bacteria 1531866
273 Ga0209566_100005 3300025225 Bacteria 1040422
274 Ga0209674_100006 3300025226 Bacteria 1531866
275 Ga0209674_100009 3300025226 Bacteria 1040422
276 Ga0209147_100011 3300025229 Bacteria 702140
277 Ga0209563_100009 3300025230 Bacteria 1378156
278 Ga0209563_100012 3300025230 Bacteria 1040422
279 Ga0207427_100254 3300025231 Bacteria 42320
280 Ga0209437_100004 3300025233 Bacteria 1378156
281 Ga0209437_100084 3300025233 Bacteria 255423
282 Ga0209258_100441 3300025242 Bacteria 46899
283 Ga0209646_1000032 3300025246 Bacteria 375315
284 Ga0209646_1000052 3300025246 Bacteria 286370
285 Ga0209026_1000062 3300025250 Bacteria 213298
286 Ga0209677_100005 3300025253 Bacteria 1378156
287 Ga0209677_100006 3300025253 Bacteria 1040422
288 Ga0209677_100697 3300025253 Bacteria 17158
289 Ga0209677_103560 3300025253 Bacteria 4961
290 Ga0209148_1000261 3300025254 Bacteria 82670
291 Ga0209759_1000054 3300025256 Bacteria 211422
292 Ga0209129_1000147 3300025258 Bacteria 115120
293 Ga0209129_1008462 3300025258 Bacteria 2859
294 Ga0209233_1000005 3300025261 Bacteria 1531866
295 Ga0209233_1003705 3300025261 Bacteria 5340
296 Ga0209233_1009712 3300025261 Bacteria 2917
297 Ga0209233_1010932 3300025261 Bacteria 2694
298 Ga0209565_1000117 3300025263 Bacteria 113536
299 Ga0209565_1008486 3300025263 Bacteria 2683
300 Ga0209455_1002374 3300025272 Bacteria 7332
301 Ga0209455_1003522 3300025272 Bacteria 5502
302 Ga0209673_1000218 3300025273 Bacteria 113542
303 Ga0209673_1000415 3300025273 Bacteria 74762
304 Ga0209673_1004047 3300025273 Bacteria 8110
305 Ga0209673_1010175 3300025273 Bacteria 3991
306 Ga0209673_1011872 3300025273 Bacteria 3555
307 Ga0209130_1000130 3300025284 Bacteria 121749
308 Ga0209130_1000821 3300025284 Bacteria 26175
309 Ga0209130_1000916 3300025284 Bacteria 23720
310 Ga0209675_1000113 3300025291 Bacteria 113542
311 Ga0209675_1000379 3300025291 Bacteria 36995
312 Ga0209676_1000028 3300025292 Bacteria 559745
313 Ga0209676_1000286 3300025292 Bacteria 103478
314 Ga0209676_1005887 3300025292 Bacteria 6236
315 Ga0209025_1000194 3300025294 Bacteria 148593
316 Ga0209025_1000282 3300025294 Bacteria 115627
317 Ga0209025_1000375 3300025294 Bacteria 93043
318 Ga0209025_1003283 3300025294 Bacteria 15570
319 Ga0209025_1007633 3300025294 Bacteria 8002
320 Ga0209564_1000220 3300025295 Bacteria 129579
321 Ga0209564_1000327 3300025295 Bacteria 92740
322 Ga0209758_1000199 3300025297 Bacteria 133164
323 Ga0209758_1000237 3300025297 Bacteria 115867
324 Ga0209758_1000345 3300025297 Bacteria 84958
325 Ga0209758_1001280 3300025297 Bacteria 31015
326 Ga0209758_1005055 3300025297 Bacteria 10467
327 Ga0209758_1009018 3300025297 Bacteria 6303
328 Ga0209758_1015294 3300025297 Bacteria 3988
329 Ga0209758_1037871 3300025297 Bacteria 1857
330 Ga0209050_1000072 3300025298 Bacteria 293619
331 Ga0209050_1000133 3300025298 Bacteria 184688
332 Ga0209050_1002056 3300025298 Bacteria 18543
333 Ga0209050_1002244 3300025298 Bacteria 17235
334 Ga0209050_1006071 3300025298 Bacteria 7300
335 Ga0209050_1025448 3300025298 Bacteria 2010
336 Ga0209256_1000117 3300025299 Bacteria 169435
337 Ga0209256_1000151 3300025299 Bacteria 145299
338 Ga0209256_1000242 3300025299 Bacteria 96789
339 Ga0209256_1003478 3300025299 Bacteria 10993
340 Ga0209256_1007278 3300025299 Bacteria 5515
341 Ga0209256_1021536 3300025299 Bacteria 1975
342 Ga0209256_1034604 3300025299 Bacteria 1342
343 Ga0207426_1000049 3300025302 Bacteria 401954
344 Ga0207426_1000166 3300025302 Bacteria 169435
345 Ga0207426_1000182 3300025302 Bacteria 155724
346 Ga0207426_1000402 3300025302 Bacteria 72738
347 Ga0207426_1002639 3300025302 Bacteria 11080
348 Ga0207426_1005169 3300025302 Bacteria 6067
349 Ga0207426_1030815 3300025302 Bacteria 1756
350 Ga0209051_1000015 3300025303 Bacteria 546798
351 Ga0209051_1000056 3300025303 Bacteria 271616
352 Ga0209051_1000255 3300025303 Bacteria 89418
353 Ga0209051_1001521 3300025303 Bacteria 19295
354 Ga0209051_1001607 3300025303 Bacteria 18438
355 Ga0209051_1001786 3300025303 Bacteria 17071
356 Ga0209257_1000037 3300025304 Bacteria 612915
357 Ga0209257_1000162 3300025304 Bacteria 175776
358 Ga0209257_1000628 3300025304 Bacteria 56788
359 Ga0209257_1001388 3300025304 Bacteria 29020
360 Ga0209257_1007486 3300025304 Bacteria 6574
361 Ga0207697_10102770 3300025315 Bacteria 1219
362 Ga0207655_1000813 3300025728 Bacteria 33800
363 Ga0207655_1004027 3300025728 Bacteria 10604
364 Ga0207692_10094256 3300025898 Bacteria 1630
365 Ga0207710_10004120 3300025900 Bacteria 6386
366 Ga0207710_10057214 3300025900 Bacteria 1761
367 Ga0207688_10060613 3300025901 Bacteria 2131
368 Ga0207688_10093993 3300025901 Bacteria 1725
369 Ga0207647_10042546 3300025904 Bacteria 2849
370 Ga0207647_10063619 3300025904 Bacteria 2244
371 Ga0207654_10065634 3300025911 Bacteria 2138
372 Ga0207654_10162760 3300025911 Bacteria 1443
373 Ga0207707_10000088 3300025912 Bacteria 90991
374 Ga0207695_10007898 3300025913 Bacteria 13428
375 Ga0207695_10010192 3300025913 Bacteria 11527
376 Ga0207695_10014849 3300025913 Bacteria 9198
377 Ga0207695_10023548 3300025913 Bacteria 6953
378 Ga0207695_10034101 3300025913 Bacteria 5541
379 Ga0207695_10146385 3300025913 Bacteria 2306
380 Ga0207671_10001730 3300025914 Bacteria 24566
381 Ga0207671_10012019 3300025914 Bacteria 6993
382 Ga0207671_10026884 3300025914 Bacteria 4304
383 Ga0207671_10112730 3300025914 Bacteria 2071
384 Ga0207671_10197339 3300025914 Bacteria 1571
385 Ga0207671_10229451 3300025914 Bacteria 1456
386 Ga0207671_10304825 3300025914 Bacteria 1259
387 Ga0207693_10021622 3300025915 Bacteria 5112
388 Ga0207693_10027933 3300025915 Bacteria 4460
389 Ga0207663_10023414 3300025916 Bacteria 3543
390 Ga0207663_10037822 3300025916 Bacteria 2912
391 Ga0207663_10049775 3300025916 Bacteria 2601
392 Ga0207652_10002304 3300025921 Bacteria 16176
393 Ga0207646_10238801 3300025922 Bacteria 1642
394 Ga0207646_10240143 3300025922 Bacteria 1637
395 Ga0207694_10000359 3300025924 Bacteria 42962
396 Ga0207694_10008580 3300025924 Bacteria 7720
397 Ga0207694_10066667 3300025924 Bacteria 2809
398 Ga0207694_10099331 3300025924 Bacteria 2305
399 Ga0207694_10137283 3300025924 Bacteria 1965
400 Ga0207694_10147710 3300025924 Bacteria 1893
401 Ga0207700_10017947 3300025928 Bacteria 4738
402 Ga0207700_10061106 3300025928 Bacteria 2856
403 Ga0207700_10372731 3300025928 Bacteria 1247
404 Ga0207644_10142936 3300025931 Bacteria 1844
405 Ga0207706_10015728 3300025933 Bacteria 6838
406 Ga0207706_10032627 3300025933 Bacteria 4636
407 Ga0207706_10157047 3300025933 Bacteria 2000
408 Ga0207709_10000208 3300025935 Bacteria 76530
409 Ga0207709_10005471 3300025935 Bacteria 7213
410 Ga0207709_10019781 3300025935 Bacteria 3790
411 Ga0207709_10087954 3300025935 Bacteria 2021
412 Ga0207709_10106251 3300025935 Bacteria 1867
413 Ga0207670_10190001 3300025936 Bacteria 1553
414 Ga0207669_10010599 3300025937 Bacteria 4442
415 Ga0207704_10204921 3300025938 Bacteria 1447
416 Ga0207665_10078289 3300025939 Bacteria 2271
417 Ga0207691_10063332 3300025940 Bacteria 3354
418 Ga0207691_10150921 3300025940 Bacteria 2043
419 Ga0207711_10114161 3300025941 Bacteria 2405
420 Ga0207711_10150353 3300025941 Bacteria 2100
421 Ga0207689_10131829 3300025942 Bacteria 2057
422 Ga0207689_10182153 3300025942 Bacteria 1732
423 Ga0207661_10000538 3300025944 Bacteria 24251
424 Ga0207679_10046418 3300025945 Bacteria 3149
425 Ga0207679_10209071 3300025945 Bacteria 1635
426 Ga0207667_10000028 3300025949 Bacteria 334510
427 Ga0207667_10045866 3300025949 Bacteria 4628
428 Ga0207667_10263609 3300025949 Bacteria 1762
429 Ga0207667_10391715 3300025949 Bacteria 1415
430 Ga0207651_10050213 3300025960 Bacteria 2831
431 Ga0207668_10096896 3300025972 Bacteria 2181
432 Ga0207677_10047677 3300026023 Bacteria 2878
433 Ga0207703_10096053 3300026035 Bacteria 2501
434 Ga0207703_10237906 3300026035 Bacteria 1636
435 Ga0207639_10070306 3300026041 Bacteria 2734
436 Ga0207639_10073067 3300026041 Bacteria 2688
437 Ga0207678_10027560 3300026067 Bacteria 4958
438 Ga0207678_10057818 3300026067 Bacteria 3337
439 Ga0207708_10156921 3300026075 Bacteria 1795
440 Ga0207648_10079358 3300026089 Bacteria 2863
441 Ga0207676_10244279 3300026095 Bacteria 1612
442 Ga0207674_10366442 3300026116 Bacteria 1393
443 Ga0207675_100046602 3300026118 Bacteria 4050
444 Ga0207675_100186611 3300026118 Bacteria 1988
445 Ga0207683_10059000 3300026121 Bacteria 3370
446 Ga0207683_10061761 3300026121 Bacteria 3298
447 Ga0207698_10003809 3300026142 Bacteria 9126
448 Ga0207698_10069974 3300026142 Bacteria 2778
449 Ga0207698_10198535 3300026142 Bacteria 1794
450 Ga0207698_10493658 3300026142 Bacteria 1190
451 Ga0209281_1000512 3300027111 Bacteria 50723
452 Ga0209389_1000001 3300027296 Bacteria 463799
453 Ga0209389_1000010 3300027296 Bacteria 223892
454 Ga0209589_1000001 3300027357 Bacteria 794224
455 Ga0209589_1000016 3300027357 Bacteria 223788
456 Ga0209489_100001 3300027361 Bacteria 794224
457 Ga0209489_100016 3300027361 Bacteria 223873
458 Ga0209489_110021 3300027361 Bacteria 11132
459 Ga0209700_100001 3300027363 Bacteria 794224
460 Ga0209700_100007 3300027363 Bacteria 454608
461 Ga0209179_1002435 3300027512 Bacteria 2517
462 Ga0209282_1002635 3300027666 Bacteria 10441
463 Ga0209588_1044125 3300027671 Bacteria 1442
464 Ga0209974_10010658 3300027876 Bacteria 3101
465 Ga0268266_10003707 3300028379 Bacteria 15038
466 Ga0268266_10063457 3300028379 Bacteria 3189
467 Ga0268264_10000048 3300028381 Bacteria 334457
468 Ga0268264_10014815 3300028381 Bacteria 6404
469 Ga0265337_1002039 3300028556 Bacteria 9583
470 Ga0265326_10000558 3300028558 Bacteria 13919
471 Ga0265319_1004781 3300028563 Bacteria 6642
472 Ga0265334_10000665 3300028573 Bacteria 17269
473 Ga0265318_10001512 3300028577 Bacteria 13550
474 Ga0265323_10000345 3300028653 Bacteria 26579
475 Ga0265322_10010782 3300028654 Bacteria 2653
476 Ga0265336_10000091 3300028666 Bacteria 69365
477 Ga0307517_10000522 3300028786 Bacteria 65754
478 Ga0307515_10000178 3300028794 Bacteria 157107
479 Ga0307515_10011180 3300028794 Bacteria 17068
480 Ga0307515_10043688 3300028794 Bacteria 6956
481 Ga0265338_10000094 3300028800 Bacteria 168366
482 Ga0311001_1006093 3300029277 Bacteria 1727
483 Ga0265324_10001898 3300029957 Bacteria 11233
484 Ga0307511_10059359 3300030521 Bacteria 2943
485 Ga0314311_1034047 3300030733 Bacteria 2534
486 Ga0316181_1099951 3300030744 Bacteria 1959
487 Ga0265330_10002898 3300031235 Bacteria 9158
488 Ga0265340_10005711 3300031247 Bacteria 6872
489 Ga0265339_10035116 3300031249 Bacteria 2815
490 Ga0307513_10007700 3300031456 Bacteria 13917
491 Ga0307513_10018055 3300031456 Bacteria 8443
492 Ga0307513_10211997 3300031456 Bacteria 1767
493 Ga0307509_10017893 3300031507 Bacteria 8139
494 Ga0307509_10105271 3300031507 Bacteria 2843
495 Ga0307408_100000087 3300031548 Bacteria 101616
496 Ga0307408_100253548 3300031548 Bacteria 1452
497 Ga0307508_10000003 3300031616 Bacteria 321602
498 Ga0265314_10038746 3300031711 Bacteria 3441
499 Ga0265314_10133948 3300031711 Bacteria 1542
500 Ga0307516_10000181 3300031730 Bacteria 81531
501 Ga0307516_10007742 3300031730 Bacteria 12285
502 Ga0307516_10021070 3300031730 Bacteria 6721
503 Ga0307516_10075763 3300031730 Bacteria 3218
504 Ga0307413_10199961 3300031824 Bacteria 1442
505 Ga0307406_10000960 3300031901 Bacteria 16138
506 Ga0307412_10028205 3300031911 Bacteria 3509
507 Ga0307412_10100058 3300031911 Bacteria 2048
508 Ga0307416_100522012 3300032002 Bacteria 1256
509 Ga0307414_10023747 3300032004 Bacteria 3895
510 Ga0307414_10028258 3300032004 Bacteria 3635
511 Ga0307414_10050876 3300032004 Bacteria 2872
512 Ga0307414_10244839 3300032004 Bacteria 1486
513 Ga0307411_10004044 3300032005 Bacteria 6940
514 Ga0307411_10014765 3300032005 Bacteria 4359
515 Ga0307411_10211845 3300032005 Bacteria 1497
516 Ga0307510_10019636 3300033180 Bacteria 7920
517 Ga0307510_10023745 3300033180 Bacteria 7102
518 Ga0307510_10108002 3300033180 Bacteria 2538
519 Ga0307510_10158482 3300033180 Bacteria 1866
520 Ga0315911_1000002 3300033442 Bacteria 926833
521 Ga0316588_1036982 3300033528 Bacteria 1160
522 Ga0316587_1002993 3300033529 Bacteria 2319
523 Ga0373934_0005394 3300035086 Bacteria 4735
524 Ga0373940_0019654 3300035088 Bacteria 1709
525 Ga0373951_0030681 3300035091 Bacteria 1266
526 Ga0373923_0104101 3300035111 Bacteria 1254
527 Ga0373936_0010388 3300035113 Bacteria 3512
528 Ga0373939_0000137 3300035114 Bacteria 21265
529 Ga0373945_0002690 3300035116 Bacteria 5576
530 Ga0373954_0012016 3300035118 Bacteria 3847
531 Ga0373957_0056713 3300035120 Bacteria 1509
532 Ga0373960_0000875 3300035121 Bacteria 6382
533 Ga0373960_0032180 3300035121 Bacteria 1472
534 Ga0373943_0037355 3300035170 Bacteria 2331
535 Ga0373946_0076568 3300035171 Bacteria 1456
536 Ga0373924_0109108 3300035410 Bacteria 1195
537 Ga0373931_0000475 3300035691 Bacteria 16350
538 Ga0373931_0047581 3300035691 Bacteria 2270
539 Ga0373935_0008025 3300035692 Bacteria 6325
540 Ga0373935_0042149 3300035692 Bacteria 2869
541 Ga0373927_0036503 3300035695 Bacteria 3196
542 Ga0373927_0087381 3300035695 Bacteria 2024
543 Ga0373933_0103423 3300035724 Bacteria 1769
544 Ga0373947_0009434 3300035725 Bacteria 5604
545 Ga0373947_0047708 3300035725 Bacteria 2567
546 Ga0373947_0053203 3300035725 Bacteria 2441
547 Ga0373937_0058036 3300036401 Bacteria 3556
548 Ga0373937_0068010 3300036401 Bacteria 3283
549 Ga0373937_0135512 3300036401 Bacteria 2302
550 Ga0373925_0024373 3300037068 Bacteria 4418
551 Ga0373925_0036535 3300037068 Bacteria 3625
552 Ga0395899_0031041 3300037312 Bacteria 4017
553 Ga0395900_0012199 3300037418 Bacteria 8785
554 Ga0395900_0291496 3300037418 Bacteria 1620
555 Ga0395900_0311367 3300037418 Bacteria 1558
556 Ga0395900_0369845 3300037418 Bacteria 1403
557 Ga0395898_0002134 3300037466 Bacteria 24380
558 Ga0395898_0006688 3300037466 Bacteria 12295
559 Ga0395898_0084747 3300037466 Bacteria 3055
560 Ga0395898_0120827 3300037466 Bacteria 2510
561 Ga0395898_0133300 3300037466 Bacteria 2379
562 Ga0395898_0201205 3300037466 Bacteria 1901
563 Ga0395898_0213258 3300037466 Bacteria 1842
564 Ga0395905_0005302 3300037471 Bacteria 13184
565 Ga0395905_0029147 3300037471 Bacteria 5202
566 Ga0395905_0044811 3300037471 Bacteria 4150
567 Ga0395905_0051745 3300037471 Bacteria 3847
568 Ga0395905_0265694 3300037471 Bacteria 1601
569 Ga0436364_0788772 3300037853 Bacteria 1981
570 Ga0436364_1504240 3300037853 Bacteria 1325
571 Ga0395901_0020552 3300038443 Bacteria 6757
572 Ga0395901_0030925 3300038443 Bacteria 5518
573 Ga0395901_0118732 3300038443 Bacteria 2779
574 Ga0400483_126795 3300039062 Bacteria 5704
575 Ga0400483_218802 3300039062 Bacteria 4413
576 Ga0436365_0072519 3300039437 Bacteria 5313
577 Ga0436365_0340068 3300039437 Bacteria 1712
578 Ga0436365_1152325 3300039437 Bacteria 1622
579 Ga0436365_1416771 3300039437 Bacteria 1732
580 Ga0436365_1784783 3300039437 Bacteria 1512
581 Ga0436360_0671955 3300039438 Bacteria 2176
582 Ga0436360_1274595 3300039438 Bacteria 1815
583 Ga0436361_0351327 3300039447 Bacteria 31675
584 Ga0436361_0607915 3300039447 Bacteria 2083
585 Ga0436361_0997954 3300039447 Bacteria 2413
586 Ga0436361_1200916 3300039447 Bacteria 1586
587 Ga0436362_0320951 3300039453 Bacteria 2604
588 Ga0439466_0011207 3300041411 Bacteria 3319
589 Ga0439466_0013490 3300041411 Bacteria 2990
590 Ga0439465_0000696 3300041413 Bacteria 10320
591 Ga0439465_0047352 3300041413 Bacteria 1401
592 Ga0451807_1217081 3300041486 Bacteria 1709
593 Ga0439431_0027595 3300041997 Bacteria 1396
594 Ga0439437_000814 3300042000 Bacteria 3202
595 Ga0450917_001519 3300042120 Bacteria 1662
596 Ga0450888_000366 3300042126 Bacteria 4286
597 Ga0450890_000263 3300042127 Bacteria 7736
598 Ga0450890_004048 3300042127 Bacteria 1928
599 Ga0450891_000524 3300042129 Bacteria 4009
600 Ga0450892_001674 3300042130 Bacteria 2064
601 Ga0450889_000411 3300042144 Bacteria 4777
602 Ga0450918_000966 3300042531 Bacteria 5990
603 Ga0450893_0000325 3300042532 Bacteria 6654
604 Ga0451577_0000068 3300042876 Bacteria 241923
605 Ga0466969_0000006 3300044656 Bacteria 152970
606 Ga0466972_0000223 3300044658 Bacteria 40015
607 Ga0453683_0060794 3300044673 Bacteria 2362
608 Ga0466965_0093537 3300044683 Bacteria 1531
609 Ga0466966_0003259 3300044684 Bacteria 10703
610 Ga0466961_0000057 3300044693 Bacteria 66922
611 Ga0466961_0006649 3300044693 Bacteria 7353
612 Ga0466964_0016413 3300044706 Bacteria 2828
613 Ga0466964_0021195 3300044706 Bacteria 2512
614 Ga0453684_0000126 3300044712 Bacteria 336395
615 Ga0453684_0002989 3300044712 Bacteria 39341
616 Ga0453684_0091867 3300044712 Bacteria 3745
617 Ga0466968_0004560 3300044735 Bacteria 5182
618 Ga0466968_0011463 3300044735 Bacteria 3454
619 Ga0466970_0038329 3300044765 Bacteria 2542
620 Ga0466960_0014675 3300044901 Bacteria 3362
621 Ga0466960_0019271 3300044901 Bacteria 3004
622 Ga0466960_0052949 3300044901 Bacteria 1965
623 Ga0466959_0006458 3300045049 Bacteria 8121
624 Ga0466959_0011786 3300045049 Bacteria 6294
625 Ga0451576_0012737 3300045051 Bacteria 9442
626 Ga0451576_0038144 3300045051 Bacteria 5085
627 Ga0451576_0247990 3300045051 Bacteria 1861
628 Ga0495603_0000154 3300046455 Bacteria 34448
629 Ga0495603_0086554 3300046455 Bacteria 1834
630 Ga0495590_0038433 3300046457 Bacteria 1669
631 Ga0495629_0000093 3300046459 Bacteria 77978
632 Ga0495629_0003355 3300046459 Bacteria 12097
633 Ga0495629_0006301 3300046459 Bacteria 8804
634 Ga0495629_0048131 3300046459 Bacteria 2989
635 Ga0495638_0000961 3300046460 Bacteria 29188
636 Ga0495638_0011724 3300046460 Bacteria 6037
637 Ga0495638_0025611 3300046460 Bacteria 3832
638 Ga0495638_0043109 3300046460 Bacteria 2847
639 Ga0495641_0003998 3300046461 Bacteria 10692
640 Ga0495641_0110475 3300046461 Bacteria 1227
641 Ga0495651_0021206 3300046462 Bacteria 5048
642 Ga0495651_0027213 3300046462 Bacteria 4454
643 Ga0495651_0090494 3300046462 Bacteria 2295
644 Ga0495653_0001714 3300046463 Bacteria 17267
645 Ga0495580_0001670 3300046472 Bacteria 19485
646 Ga0495580_0016571 3300046472 Bacteria 5527
647 Ga0495582_0000010 3300046473 Bacteria 118676
648 Ga0495605_0000121 3300046474 Bacteria 102560
649 Ga0495639_0000071 3300046475 Bacteria 47406
650 Ga0495664_0003905 3300046477 Bacteria 8137
651 Ga0495664_0005970 3300046477 Bacteria 6711
652 Ga0495664_0046231 3300046477 Bacteria 2583
653 Ga0495584_0006864 3300046491 Bacteria 5951
654 Ga0495594_0000116 3300046499 Bacteria 37209
655 Ga0495607_0002118 3300046501 Bacteria 16571
656 Ga0495607_0024270 3300046501 Bacteria 3783
657 Ga0495583_0000150 3300046506 Bacteria 117772
658 Ga0495606_0000201 3300046507 Bacteria 103926
659 Ga0495606_0014543 3300046507 Bacteria 6127
660 Ga0495606_0017637 3300046507 Bacteria 5388
661 Ga0495608_0003465 3300046511 Bacteria 11295
662 Ga0495608_0071873 3300046511 Bacteria 2257
663 Ga0495610_0011547 3300046512 Bacteria 5391
664 Ga0495610_0043716 3300046512 Bacteria 2229
665 Ga0495616_0006237 3300046513 Bacteria 7247
666 Ga0495616_0016466 3300046513 Bacteria 4092
667 Ga0495628_0000929 3300046516 Bacteria 26874
668 Ga0495628_0012592 3300046516 Bacteria 7127
669 Ga0495628_0129391 3300046516 Bacteria 1932
670 Ga0495630_0000418 3300046517 Bacteria 32809
671 Ga0495630_0011159 3300046517 Bacteria 6503
672 Ga0495643_0026786 3300046522 Bacteria 3248
673 Ga0495644_0000423 3300046523 Bacteria 18769
674 Ga0495644_0001030 3300046523 Bacteria 11606
675 Ga0495648_0004025 3300046524 Bacteria 12697
676 Ga0495648_0077901 3300046524 Bacteria 1898
677 Ga0495663_0023783 3300046525 Bacteria 1777
678 Ga0495652_0002952 3300046529 Bacteria 17113
679 Ga0495652_0011030 3300046529 Bacteria 8189
680 Ga0495652_0011959 3300046529 Bacteria 7848
681 Ga0495652_0059818 3300046529 Bacteria 3222
682 Ga0495654_0000766 3300046530 Bacteria 24777
683 Ga0495665_0000667 3300046531 Bacteria 17580
684 Ga0495640_0022624 3300046533 Bacteria 4591
685 Ga0495640_0079011 3300046533 Bacteria 2191
686 Ga0495587_0027187 3300046536 Bacteria 3484
687 Ga0495609_0000606 3300046538 Bacteria 28071
688 Ga0495621_0086369 3300046539 Bacteria 1177
689 Ga0495622_0002831 3300046557 Bacteria 8282
690 Ga0495622_0012054 3300046557 Bacteria 3997
691 Ga0495622_0037577 3300046557 Bacteria 2255
692 Ga0495633_0001660 3300046558 Bacteria 16778
693 Ga0495633_0003523 3300046558 Bacteria 10371
694 Ga0495667_0012123 3300046559 Bacteria 5842
695 Ga0495656_0002603 3300046615 Bacteria 6021
696 Ga0495656_0063323 3300046615 Bacteria 1620
697 Ga0495668_0068265 3300046616 Bacteria 1955
698 Ga0495634_0000234 3300046642 Bacteria 51752
699 Ga0495634_0096698 3300046642 Bacteria 1912
700 Ga0495634_0117958 3300046642 Bacteria 1702
701 Ga0495634_0126814 3300046642 Bacteria 1630
702 Ga0495611_0008141 3300046648 Bacteria 4446
703 Ga0495625_0000294 3300046660 Bacteria 77321
704 Ga0495625_0106458 3300046660 Bacteria 1920
705 Ga0495635_0035101 3300046663 Bacteria 3477
706 Ga0495635_0044523 3300046663 Bacteria 3062
707 Ga0495635_0050991 3300046663 Bacteria 2852
708 Ga0495659_0001353 3300046664 Bacteria 8413
709 Ga0495588_0027888 3300046674 Bacteria 2824
710 Ga0495588_0029182 3300046674 Bacteria 2766
711 Ga0495657_0002015 3300046675 Bacteria 17294
712 Ga0495657_0033153 3300046675 Bacteria 3598
713 Ga0495623_0001689 3300046679 Bacteria 14839
714 Ga0495623_0017026 3300046679 Bacteria 4695
715 Ga0495646_0075821 3300046680 Bacteria 1971
716 Ga0495647_0001855 3300046681 Bacteria 6552
717 Ga0495658_0012316 3300046683 Bacteria 4326
718 Ga0495669_0073623 3300046684 Bacteria 1560
719 Ga0495669_0145799 3300046684 Bacteria 1119
720 Ga0495613_0001996 3300046689 Bacteria 15490
721 Ga0495613_0004247 3300046689 Bacteria 10733
722 Ga0495624_0000183 3300046690 Bacteria 46945
723 Ga0495670_0003004 3300046691 Bacteria 8317
724 Ga0495649_0009712 3300046694 Bacteria 5701
725 Ga0495649_0017146 3300046694 Bacteria 4091
726 Ga0495600_0000151 3300046809 Bacteria 39828
727 Ga0495600_0028531 3300046809 Bacteria 3611
728 Ga0495660_0111004 3300046810 Bacteria 1399
729 Ga0495581_0000027 3300047315 Bacteria 54326
730 Ga0495581_0010220 3300047315 Bacteria 5429
731 Ga0495604_0000753 3300047317 Bacteria 27221
732 Ga0495604_0002785 3300047317 Bacteria 14021
733 Ga0495604_0087661 3300047317 Bacteria 2317
734 Ga0495636_0000857 3300047318 Bacteria 11239
735 Ga0495674_0000050 3300047319 Bacteria 77111
736 Ga0495674_0010179 3300047319 Bacteria 8910
737 Ga0495672_0000864 3300047320 Bacteria 31968
738 Ga0495672_0010360 3300047320 Bacteria 6651
739 Ga0495672_0010731 3300047320 Bacteria 6502
740 Ga0495672_0022707 3300047320 Bacteria 4073
741 Ga0495676_0064396 3300047321 Bacteria 2851
742 Ga0495676_0073733 3300047321 Bacteria 2616
743 Ga0495676_0081762 3300047321 Bacteria 2447
744 Ga0495676_0092044 3300047321 Bacteria 2264
745 Ga0495676_0096470 3300047321 Bacteria 2198
746 Ga0495683_0000903 3300047323 Bacteria 20926
747 Ga0495687_000057 3300047443 Bacteria 186224
748 Ga0495687_003007 3300047443 Bacteria 12732
749 Ga0495675_0034798 3300047444 Bacteria 3216
750 Ga0495677_0000232 3300047445 Bacteria 25202
751 Ga0495685_000310 3300047447 Bacteria 15936
752 Ga0495673_0005301 3300047469 Bacteria 7825
753 Ga0495684_0004001 3300047471 Bacteria 11497
754 Ga0495684_0128880 3300047471 Bacteria 1902
755 Ga0495686_0001619 3300047472 Bacteria 23622
756 Ga0495686_0008869 3300047472 Bacteria 7317
757 Ga0495686_0028428 3300047472 Bacteria 3642
758 Ga0495686_0145518 3300047472 Bacteria 1395
759 Ga0495593_0000014 3300047673 Bacteria 82518
760 Ga0495593_0029281 3300047673 Bacteria 3020
761 Ga0495593_0040884 3300047673 Bacteria 2495
762 Ga0495602_0027011 3300048088 Bacteria 5527
763 Ga0495602_0123494 3300048088 Bacteria 2078
764 Ga0495602_0169153 3300048088 Bacteria 1698
765 Ga0495614_0009048 3300048089 Bacteria 4414
766 Ga0496100_0060435 3300048903 Bacteria 2494
767 Ga0496100_0066674 3300048903 Bacteria 2388
768 Ga0496101_0033412 3300048904 Bacteria 3628
769 Ga0496101_0077446 3300048904 Bacteria 2450
770 Ga0496101_0100457 3300048904 Bacteria 2164
771 Ga0496102_0006280 3300048905 Bacteria 10131
772 Ga0496102_0010092 3300048905 Bacteria 8126
773 Ga0496102_0030892 3300048905 Bacteria 4798
774 Ga0496102_0301877 3300048905 Bacteria 1509
775 Ga0496103_0053005 3300048906 Bacteria 2513
776 Ga0496104_0005472 3300048907 Bacteria 11122
777 Ga0496104_0119404 3300048907 Bacteria 2531
778 Ga0496104_0119736 3300048907 Bacteria 2527
779 Ga0496104_0163249 3300048907 Bacteria 2136
780 Ga0496104_0239967 3300048907 Bacteria 1725
781 Ga0496105_0003472 3300048908 Bacteria 11659
782 Ga0496105_0019879 3300048908 Bacteria 5419
783 Ga0496105_0109358 3300048908 Bacteria 2282
784 Ga0496105_0366462 3300048908 Bacteria 1148
785 Ga0496106_0004614 3300048909 Bacteria 10220
786 Ga0496106_0008372 3300048909 Bacteria 7653
787 Ga0496106_0268173 3300048909 Bacteria 1367
788 Ga0496107_0003403 3300048910 Bacteria 10642
789 Ga0496107_0015918 3300048910 Bacteria 5276
790 Ga0496107_0073660 3300048910 Bacteria 2484
791 Ga0496107_0158388 3300048910 Bacteria 1677
792 Ga0496108_0019176 3300048911 Bacteria 5614
793 Ga0496108_0033014 3300048911 Bacteria 4300
794 Ga0496109_0050080 3300048912 Bacteria 3804
795 Ga0496110_0007655 3300048913 Bacteria 8644
796 Ga0496110_0010803 3300048913 Bacteria 7444
797 Ga0496110_0105397 3300048913 Bacteria 2529
798 Ga0496111_0013224 3300048914 Bacteria 5610
799 Ga0496111_0044835 3300048914 Bacteria 3179
800 Ga0496111_0052347 3300048914 Bacteria 2948
801 Ga0496111_0057268 3300048914 Bacteria 2821
802 Ga0496112_0000004 3300048915 Bacteria 553294
803 Ga0496112_0015093 3300048915 Bacteria 7195
804 Ga0496112_0189634 3300048915 Bacteria 2018
805 Ga0496113_0069020 3300048916 Bacteria 2683
806 Ga0496114_0338989 3300048917 Bacteria 1329
807 Ga0496115_0045853 3300048918 Bacteria 3491
808 Ga0496115_0198585 3300048918 Bacteria 1657
809 Ga0496116_0024957 3300048919 Bacteria 4406
810 Ga0496116_0069686 3300048919 Bacteria 2235
811 Ga0496117_0000005 3300048920 Bacteria 777468
812 Ga0496117_0035133 3300048920 Bacteria 3767
813 Ga0496117_0132592 3300048920 Bacteria 1507
814 Ga0496118_0000022 3300048921 Bacteria 438602
815 Ga0496118_0016427 3300048921 Bacteria 6791
816 Ga0496118_0033145 3300048921 Bacteria 4244
817 Ga0496118_0138624 3300048921 Bacteria 1547
818 Ga0496119_0001100 3300048922 Bacteria 34059
819 Ga0496119_0006291 3300048922 Bacteria 11073
820 Ga0496119_0013474 3300048922 Bacteria 6506
821 Ga0496120_0019305 3300048923 Bacteria 4364
822 Ga0496121_0000710 3300048924 Bacteria 61765
823 Ga0496121_0004128 3300048924 Bacteria 19885
824 Ga0496121_0004801 3300048924 Bacteria 17819
825 Ga0496121_0007150 3300048924 Bacteria 13537
826 Ga0496121_0009764 3300048924 Bacteria 10975
827 Ga0496121_0021033 3300048924 Bacteria 6416
828 Ga0496121_0025806 3300048924 Bacteria 5560
829 Ga0496121_0040194 3300048924 Bacteria 4106
830 Ga0496121_0110799 3300048924 Bacteria 2094
831 Ga0496122_0000074 3300048925 Bacteria 219900
832 Ga0496122_0000249 3300048925 Bacteria 121066
833 Ga0496122_0007646 3300048925 Bacteria 11935
834 Ga0496122_0048754 3300048925 Bacteria 3252
835 Ga0496122_0049627 3300048925 Bacteria 3210
836 Ga0496123_0000062 3300048926 Bacteria 219882
837 Ga0496123_0000347 3300048926 Bacteria 86788
838 Ga0496123_0000524 3300048926 Bacteria 66159
839 Ga0496123_0020386 3300048926 Bacteria 5187
840 Ga0496123_0099472 3300048926 Bacteria 1697
841 Ga0496124_0003294 3300048927 Bacteria 19907
842 Ga0496124_0006546 3300048927 Bacteria 12668
843 Ga0496124_0010080 3300048927 Bacteria 9636
844 Ga0496124_0013552 3300048927 Bacteria 7950
845 Ga0496124_0029377 3300048927 Bacteria 4900
846 Ga0496124_0056911 3300048927 Bacteria 3296
847 Ga0496124_0078334 3300048927 Bacteria 2724
848 Ga0496124_0102060 3300048927 Bacteria 2322
849 Ga0496124_0180853 3300048927 Bacteria 1623
850 Ga0496125_0000420 3300048928 Bacteria 78930
851 Ga0496125_0001362 3300048928 Bacteria 35992
852 Ga0496125_0001876 3300048928 Bacteria 28875
853 Ga0496126_0008116 3300048929 Bacteria 11369
854 Ga0496126_0076749 3300048929 Bacteria 2963
855 Ga0495678_004356 3300049459 Bacteria 8226
856 Ga0495678_084734 3300049459 Bacteria 1130
857 Ga0495682_0001235 3300049460 Bacteria 14458
858 Ga0501297_001375 3300049520 Bacteria 2226
859 Ga0501299_005402 3300049522 Bacteria 1963
860 Ga0501300_002703 3300049523 Bacteria 2652
861 Ga0501034_0131647 3300049571 Bacteria 2484
862 Ga0501034_0251210 3300049571 Bacteria 1713
863 Ga0501037_0098257 3300049573 Bacteria 2115
864 Ga0501067_0005558 3300049583 Bacteria 6989
865 Ga0501067_0016830 3300049583 Bacteria 4038
866 Ga0501199_003121 3300049650 Bacteria 1578
867 Ga0501207_002021 3300049654 Bacteria 2597
868 Ga0501211_000435 3300049658 Bacteria 4027
869 Ga0501222_002800 3300049662 Bacteria 2414
870 Ga0501223_004280 3300049663 Bacteria 3066
871 Ga0501233_004178 3300049668 Bacteria 2633
872 Ga0501235_003132 3300049669 Bacteria 3566
873 Ga0501249_007428 3300049679 Bacteria 2264
874 Ga0501252_004121 3300049682 Bacteria 1537
875 Ga0501258_002004 3300049687 Bacteria 1746
876 Ga0501259_021302 3300049688 Bacteria 1157
877 Ga0501221_001691 3300049704 Bacteria 3668
878 Ga0501232_006040 3300049757 Bacteria 1228
879 Ga0501262_001772 3300049759 Bacteria 2424
880 Ga0501264_001752 3300049761 Bacteria 2195
881 Ga0501267_000820 3300049764 Bacteria 2520
882 Ga0501269_007006 3300049766 Bacteria 1361
883 Ga0501272_000474 3300049769 Bacteria 3541
884 nmdc:mga03683_21433_c1 3300050489 Bacteria 2492
885 nmdc:mga03683_2314_c1 3300050489 Bacteria 5899
886 nmdc:mga03683_54900_c1 3300050489 Bacteria 1672
887 nmdc:mga03n38_134745_c1 3300050490 Bacteria 1228
888 nmdc:mga00v17_113_c1 3300050491 Bacteria 44622
889 nmdc:mga00v17_19023_c1 3300050491 Bacteria 3913
890 nmdc:mga0yw44_1577_c1 3300050492 Bacteria 9146
891 nmdc:mga0yw44_51657_c1 3300050492 Bacteria 2490
892 nmdc:mga0yw44_76127_c1 3300050492 Bacteria 2094
893 nmdc:mga0k408_126925_c1 3300050493 Bacteria 1513
894 nmdc:mga0k408_2400_c1 3300050493 Bacteria 9965
895 nmdc:mga0k408_2702_c2 3300050493 Bacteria 2245
896 nmdc:mga0k408_47710_c1 3300050493 Bacteria 2476
897 nmdc:mga0k408_9438_c1 3300050493 Bacteria 5257
898 nmdc:mga04h51_49351_c1 3300050495 Bacteria 1406
899 nmdc:mga07m45_24542_c1 3300050496 Bacteria 2184
900 nmdc:mga07m45_39549_c1 3300050496 Bacteria 2636
901 nmdc:mga07m45_51047_c1 3300050496 Bacteria 2332
902 nmdc:mga07m45_54051_c1 3300050496 Bacteria 2270
903 nmdc:mga08y16_60380_c1 3300050511 Bacteria 3960
904 nmdc:mga0n895_207159_c1 3300050512 Bacteria 1991
905 nmdc:mga08x19_217491_c1 3300050514 Bacteria 1312
906 nmdc:mga0sz30_36903_c1 3300050516 Bacteria 2044
907 nmdc:mga0sz30_74014_c1 3300050516 Bacteria 1469
908 nmdc:mga0sz30_7745_c1 3300050516 Bacteria 3624
909 nmdc:mga0sz30_77827_c1 3300050516 Bacteria 1433
910 Ga0495601_0034066 3300053077 Bacteria 3175
911 Ga0500610_0009487 3300053079 Bacteria 4318
912 Ga0500610_0106582 3300053079 Bacteria 1445
913 Ga0495655_0013816 3300053083 Bacteria 1679
914 Ga0495619_0132561 3300053085 Bacteria 1713
915 Ga0500643_000272 3300053087 Bacteria 45523
916 Ga0500643_024625 3300053087 Bacteria 1908
917 Ga0500647_0031164 3300053091 Bacteria 2536
918 Ga0500647_0080180 3300053091 Bacteria 1566
919 Ga0500651_0009826 3300053093 Bacteria 5708
920 Ga0500651_0028502 3300053093 Bacteria 3511
921 Ga0500566_0000008 3300053094 Bacteria 143641
922 Ga0500566_0001356 3300053094 Bacteria 14328
923 Ga0500640_002900 3300053095 Bacteria 5824
924 Ga0500641_0000812 3300053096 Bacteria 11284
925 Ga0500641_0003855 3300053096 Bacteria 5302
926 Ga0500650_0064541 3300053098 Bacteria 1711
927 Ga0500556_0000022 3300053104 Bacteria 174894
928 Ga0500557_000009 3300053105 Bacteria 125806
929 Ga0500562_029587 3300053108 Bacteria 1442
930 Ga0500572_022404 3300053111 Bacteria 1684
931 Ga0500595_008013 3300053119 Bacteria 4337
932 Ga0500607_025439 3300053121 Bacteria 3295
933 Ga0500607_093591 3300053121 Bacteria 1507
934 Ga0500618_000041 3300053125 Bacteria 111404
935 Ga0500658_0004502 3300053134 Bacteria 5203
936 Ga0500658_0023464 3300053134 Bacteria 2355
937 Ga0500568_0000017 3300053139 Bacteria 197578
938 Ga0500568_0062324 3300053139 Bacteria 1441
939 Ga0500603_000835 3300053150 Bacteria 7357
940 Ga0500616_0004990 3300053153 Bacteria 9199
941 Ga0500620_035584 3300053155 Bacteria 1606
942 Ga0500622_0128845 3300053156 Bacteria 1218
943 Ga0500634_0005820 3300053161 Bacteria 5903
944 Ga0500639_000126 3300053163 Bacteria 36854
945 Ga0500636_0001047 3300053177 Bacteria 14830
946 Ga0500636_0020526 3300053177 Bacteria 3913
947 Ga0500636_0054464 3300053177 Bacteria 2345
948 Ga0500637_0000605 3300053178 Bacteria 14151
949 Ga0500596_003379 3300053735 Bacteria 3042
950 Ga0500601_000769 3300053737 Bacteria 4102
951 Ga0587085_004138 3300059506 Bacteria 1628
952 Ga0587072_020051 3300059643 Bacteria 1175
953 Ga0587100_001500 3300059648 Bacteria 1379
954 Ga0530510_0013723 3300061734 Bacteria 5703
955 2507507929 2507262055 Bacteria 8048963
956 2508542042 2508501009 Bacteria 7784016
957 2508692414 2508501042 Bacteria 8719808
958 2508727228 2508501050 Bacteria 9633614
959 2509077685 2508501114 Bacteria 7082538
960 2509108089 2508501122 Bacteria 6292184
961 2509153192 2508501128 Bacteria 8613869
962 2509376736 2509276019 Bacteria 6802256
963 2509391708 2509276021 Bacteria 7634384
964 2509447427 2509276033 Bacteria 7180565
965 2510134262 2510065019 Bacteria 6903379
966 2510302692 2510065057 Bacteria 6649661
967 2510839162 2510461069 Bacteria 5505000
968 2510895702 2510461076 Bacteria 8618824
969 2511131864 2510917022 Bacteria 6504556
970 2511186073 2510917028 Bacteria 6185411
971 2511199345 2510917030 Bacteria 7460662
972 2511246268 2511231002 Bacteria 5042903
973 2511248256 2511231003 Bacteria 5606035
974 2511384803 2511231026 Bacteria 5225445
975 2511388626 2511231027 Bacteria 5013807
976 2511399356 2511231028 Bacteria 8046582
977 2511497743 2511231052 Bacteria 6974333
978 2512035836 2511231221 Bacteria 6846400
979 2512528776 2512047086 Bacteria 6850303
980 2512969595 2512875026 Bacteria 6861065
981 2513228466 2513020051 Bacteria 6053213
982 2513567658 2513237084 Bacteria 7231967
983 2513577944 2513237085 Bacteria 7695351
984 2513584598 2513237086 Bacteria 7265287
985 2513599468 2513237088 Bacteria 6927906
986 2513607181 2513237089 Bacteria 6553624
987 2513618425 2513237091 Bacteria 6900273
988 2513622525 2513237092 Bacteria 8341956
989 2513631907 2513237093 Bacteria 7545552
990 2513639359 2513237094 Bacteria 8789602
991 2513647249 2513237095 Bacteria 8976980
992 2513653771 2513237096 Bacteria 8722461
993 2513674495 2513237098 Bacteria 9902361
994 2513695622 2513237101 Bacteria 7952346
995 2513700074 2513237102 Bacteria 7703324
996 2513707944 2513237103 Bacteria 7647401
997 2513715232 2513237104 Bacteria 10034502
998 2513856208 2513237137 Bacteria 9558895
999 2513870155 2513237138 Bacteria 7368160
1000 2513877555 2513237139 Bacteria 8737671
1001 2513883855 2513237140 Bacteria 7076289
1002 2513887602 2513237141 Bacteria 8496279
1003 2513902041 2513237143 Bacteria 6664116
1004 2513908461 2513237144 Bacteria 7530820
1005 2513918111 2513237145 Bacteria 8979722
1006 2513928175 2513237146 Bacteria 7166346
1007 2513988364 2513237156 Bacteria 6402557
1008 2513997610 2513237159 Bacteria 6810126
1009 2514008954 2513237160 Bacteria 6650282
1010 2514009701 2513237161 Bacteria 8871253
1011 2514017986 2513237162 Bacteria 7468464
1012 2515113432 2515075009 Bacteria 7288508
1013 2515612012 2515154107 Bacteria 6795637
1014 2515626829 2515154112 Bacteria 8294334
1015 2515635148 2515154113 Bacteria 7807172
1016 2515645590 2515154114 Bacteria 7848616
1017 2515655026 2515154116 Bacteria 7552979
1018 2515739796 2515154134 Bacteria 7220242
1019 2516206132 2516143018 Bacteria 6951533
1020 2516896606 2516653046 Bacteria 6989037
1021 2517037040 2516653077 Bacteria 7555578
1022 2517077392 2516653085 Bacteria 7346596
1023 2517096154 2517093000 Bacteria 7412387
1024 2517103864 2517093001 Bacteria 9002274
1025 2517407773 2517287029 Bacteria 6905599
1026 2517565527 2517487022 Bacteria 7227575
1027 2517891652 2517572143 Bacteria 9484767
1028 2520376984 2519899620 Bacteria 6499161
1029 2521556910 2521172590 Bacteria 5047645
1030 2523106069 2522572158 Bacteria 6514390
1031 2523466567 2523231067 Bacteria 5230452
1032 2524441825 2524023205 Bacteria 8918781
1033 2524452101 2524023207 Bacteria 6813453
1034 2524458934 2524023209 Bacteria 6679728
1035 2524466010 2524023210 Bacteria 9029266
1036 2524536747 2524023228 Bacteria 10118060
1037 2528853103 2528768022 Bacteria 10457665
1038 2530646475 2529292951 Bacteria 6916614
1039 2535486881 2534681786 Bacteria 3308809
1040 2535517179 2534681796 Bacteria 7146037
1041 2537873851 2537561587 Bacteria 5425293
1042 2548498731 2547132374 Bacteria 5530232
1043 2550697486 2548876994 Bacteria 4904866
1044 2551681464 2551306084 Bacteria 8942552
1045 2551684699 2551306085 Bacteria 7347181
1046 2551692703 2551306086 Bacteria 6843938
1047 2551700299 2551306087 Bacteria 7351905
1048 2551713046 2551306089 Bacteria 7162724
1049 2551718166 2551306090 Bacteria 7953713
1050 2551722867 2551306090 Bacteria 7953713
1051 2551731540 2551306091 Bacteria 7086830
1052 2551737057 2551306092 Bacteria 6992595
1053 2551744385 2551306093 Bacteria 7064773
1054 2553004700 2551306416 Bacteria 6152985
1055 2554248467 2554235003 Bacteria 5877155
1056 2558863900 2558860100 Bacteria 8458965
1057 2559295583 2558860242 Bacteria 5568029
1058 2561467978 2558860983 Bacteria 4133860
1059 2585167519 2582581283 Bacteria 6030556
1060 2585201926 2582581294 Bacteria 6626667
1061 2585225322 2582581298 Bacteria 7315509
1062 2585228603 2582581299 Bacteria 6518058
1063 2585259418 2582581304 Bacteria 5831370
1064 2585265745 2582581306 Bacteria 6450535
1065 2585271425 2582581307 Bacteria 6597605
1066 2585279362 2582581308 Bacteria 7413247
1067 2585323032 2582581315 Bacteria 7318924
1068 2585331146 2582581316 Bacteria 7774528
1069 2585388951 2582581865 Bacteria 6644329
1070 2585395136 2582581866 Bacteria 6859583
1071 2585401036 2582581867 Bacteria 7184437
1072 2585524822 2585427526 Bacteria 7258840
1073 2585531153 2585427527 Bacteria 7273426
1074 2585538501 2585427528 Bacteria 6842387
1075 2585547878 2585427529 Bacteria 7395659
1076 2585552923 2585427530 Bacteria 7383882
1077 2585559168 2585427531 Bacteria 6992870
1078 2585822063 2585427590 Bacteria 6824633
1079 2585836454 2585427593 Bacteria 7141551
1080 2585898550 2585427608 Bacteria 6544331
1081 2585903886 2585427609 Bacteria 6667127
1082 2585996302 2585427633 Bacteria 6413184
1083 2586000914 2585427634 Bacteria 6455027
1084 2587729919 2585428057 Bacteria 6737412
1085 2587733465 2585428058 Bacteria 6853932
1086 2587759868 2585428062 Bacteria 6842168
1087 2587980996 2585428125 Bacteria 6662905
1088 2588294445 2588253510 Bacteria 6901809
1089 2596371702 2595698237 Bacteria 6712432
1090 2599106587 2597490356 Bacteria 7030811
1091 2599332055 2599185156 Bacteria 5403036
1092 2599416935 2599185170 Bacteria 7295545
1093 2599601906 2599185210 Bacteria 5624189
1094 2599620758 2599185214 Bacteria 8209958
1095 2599674057 2599185226 Bacteria 8233575
1096 2599678626 2599185227 Bacteria 8246414
1097 2599690269 2599185229 Bacteria 8216126
1098 2599720420 2599185236 Bacteria 6875203
1099 2600196130 2599185352 Bacteria 7228948
1100 2600373158 2600254933 Bacteria 4750527
1101 2601609840 2600255279 Bacteria 5605316
1102 2601671415 2600255292 Bacteria 6300551
1103 2601746615 2600255308 Bacteria 5611129
1104 2616293052 2615840624 Bacteria 6557588
1105 2616311105 2615840626 Bacteria 7921970
1106 2616554544 2615840698 Bacteria 7319877
1107 2617346531 2617270735 Bacteria 9163226
1108 2617378636 2617270741 Bacteria 8201522
1109 2617385394 2617270742 Bacteria 6808054
1110 2643746753 2643221544 Bacteria 5886209
1111 2643804324 2643221557 Bacteria 7184309
1112 2643814015 2643221558 Bacteria 5460675
1113 2643856506 2643221568 Bacteria 5187270
1114 2643865514 2643221570 Bacteria 5103772
1115 2643920099 2643221582 Bacteria 5804683
1116 2643933564 2643221585 Bacteria 5812563
1117 2643968887 2643221592 Bacteria 6608788
1118 2643992053 2643221596 Bacteria 5006805
1119 2644006962 2643221599 Bacteria 6292121
1120 2644050159 2643221607 Bacteria 6314006
1121 2644063243 2643221609 Bacteria 6756331
1122 2644065095 2643221610 Bacteria 7480339
1123 2644071726 2643221611 Bacteria 6820941
1124 2644105398 2643221618 Bacteria 7717186
1125 2644139808 2643221625 Bacteria 6512927
1126 2644145732 2643221626 Bacteria 8069654
1127 2644161447 2643221628 Bacteria 5745828
1128 2644191738 2643221634 Bacteria 6705461
1129 2644204782 2643221636 Bacteria 6583769
1130 2644221233 2643221639 Bacteria 6649903
1131 2644222298 2643221639 Bacteria 6649903
1132 2644242633 2643221643 Bacteria 5749658
1133 2644245662 2643221644 Bacteria 6865017
1134 2644257004 2643221646 Bacteria 6433402
1135 2644273802 2643221648 Bacteria 6521465
1136 2644296224 2643221652 Bacteria 5140275
1137 2644311375 2643221655 Bacteria 7722067
1138 2644315064 2643221656 Bacteria 5809961
1139 2644324164 2643221658 Bacteria 6064537
1140 2644331226 2643221659 Bacteria 7890716
1141 2644377504 2643221668 Bacteria 7306521
1142 2644400593 2643221672 Bacteria 6322190
1143 2644416767 2643221675 Bacteria 7473456
1144 2644449807 2643221680 Bacteria 7473610
1145 2644465113 2643221683 Bacteria 5749203
1146 2644483080 2643221686 Bacteria 6310811
1147 2644494249 2643221688 Bacteria 5260751
1148 2644497726 2643221689 Bacteria 6042950
1149 2644521722 2643221693 Bacteria 5513853
1150 2644544679 2643221698 Bacteria 7756764
1151 2644617049 2643221712 Bacteria 7729434
1152 2644649461 2643221717 Bacteria 5676132
1153 2644652262 2643221718 Bacteria 5345506
1154 2644672836 2643221723 Bacteria 7095460
1155 2644689941 2643221726 Bacteria 7455827
1156 2645722043 2643221961 Bacteria 3919167
1157 2645724894 2643221962 Bacteria 3874254
1158 2657684902 2657244999 Bacteria 5946535
1159 2671111139 2667528174 Bacteria 6435400
1160 2671118578 2667528175 Bacteria 7532676
1161 2692315229 2690316117 Bacteria 6800650
1162 2719182102 2718217882 Bacteria 6556348
1163 2719386729 2718217927 Bacteria 6972593
1164 2719666467 2718217997 Bacteria 6740740
1165 2719732818 2718218009 Bacteria 6478651
1166 2720492887 2718218199 Bacteria 6740745
1167 2720614351 2718218232 Bacteria 6720332
1168 2720621123 2718218233 Bacteria 6662049
1169 2720632452 2718218235 Bacteria 6630699
1170 2720776174 2718218269 Bacteria 6906114
1171 2721148193 2718218363 Bacteria 6524337
1172 2721159646 2718218365 Bacteria 6274507
1173 2721165029 2718218366 Bacteria 6425255
1174 2721400435 2718218423 Bacteria 6438183
1175 2722841199 2721755514 Bacteria 6424414
1176 2723027771 2721755556 Bacteria 6745503
1177 2723561401 2721755684 Bacteria 6859907
1178 2723568024 2721755685 Bacteria 6704835
1179 2723846870 2721755755 Bacteria 8322773
1180 2724039248 2721755809 Bacteria 6438790
1181 2724045574 2721755810 Bacteria 6479005
1182 2724090781 2721755819 Bacteria 6906405
1183 2724105289 2721755822 Bacteria 6726041
1184 2724111116 2721755823 Bacteria 6752556
1185 2725950334 2724679232 Bacteria 7646494
1186 2728749412 2728368998 Bacteria 8720350
1187 2730108707 2728369352 Bacteria 6745171
1188 2730165337 2728369365 Bacteria 6555560
1189 2730299278 2728369397 Bacteria 6274511
1190 2738720603 2738541277 Bacteria 7458140
1191 2738884194 2738541307 Bacteria 8606193
1192 2739033143 2738541333 Bacteria 7106503
1193 2739246357 2738543012 Bacteria 7115078
1194 2739250250 2738543013 Bacteria 5618633
1195 2739279802 2738543019 Bacteria 7459457
1196 2739348410 2738543031 Bacteria 5769731
1197 2745081281 2744054633 Bacteria 8678936
1198 2753359990 2751185800 Bacteria 5467370
1199 2753463402 2751185821 Bacteria 6189929
1200 2757572104 2757320392 Bacteria 3737298
1201 2758642308 2758568016 Bacteria 5645291
1202 2765469134 2765235802 Bacteria 5618596
1203 2765568105 2765235838 Bacteria 5445269
1204 2766066187 2765235942 Bacteria 7445910
1205 2770196386 2767802442 Bacteria 5747986
1206 2774871391 2773857925 Bacteria 6472445
1207 2776261896 2775506901 Bacteria 9631051
1208 2776268499 2775506902 Bacteria 6208009
1209 2776285420 2775506904 Bacteria 5954060
1210 2778175721 2775507266 Bacteria 7392367
1211 2792581498 2791355082 Bacteria 5973319
1212 2792620529 2791355091 Bacteria 6135441
1213 2792625887 2791355092 Bacteria 6248105
1214 2792638826 2791355094 Bacteria 7011481
1215 2793060839 2791355196 Bacteria 7323613
1216 2793067017 2791355197 Bacteria 8420563
1217 2793080050
1218 2793181672 2791355222 Bacteria 5898266
1219 2793294128 2791355256 Bacteria 6798008
1220 2793318124 2791355259 Bacteria 7254731
1221 2793319481 2791355260 Bacteria 6598818
1222 2793328892 2791355261 Bacteria 6661293
1223 2793334887 2791355262 Bacteria 6774204
1224 2793343024 2791355263 Bacteria 6872478
1225 2793346945 2791355264 Bacteria 6429314
1226 2793351531 2791355265 Bacteria 6539969
1227 2793362463 2791355266 Bacteria 7116587
1228 2793367580 2791355267 Bacteria 7222458
1229 2802716025 2802428858 Bacteria 6636079
1230 2802722951 2802428859 Bacteria 6667919
1231 2802728918 2802428860 Bacteria 6525526
1232 2802735283 2802428861 Bacteria 6534206
1233 2802742112 2802428862 Bacteria 6633353
1234 2802748560 2802428863 Bacteria 6410669
1235 2804752970 2802429268 Bacteria 6094027
1236 2805918435 2802429603 Bacteria 8777136
1237 2805926765 2802429605 Bacteria 6875453
1238 2805932673 2802429606 Bacteria 6346811
1239 2806045282 2802429633 Bacteria 7341974
1240 2806049923 2802429634 Bacteria 7083200
1241 2806056761 2802429635 Bacteria 7650140
1242 2806064143 2802429636 Bacteria 7597525
1243 2806071411 2802429637 Bacteria 7067217
1244 2808983648 2808606386 Bacteria 4471946
1245 2808987684 2808606387 Bacteria 5697198
1246 2809129312 2808606415 Bacteria 4576710
1247 2809149633 2808606419 Bacteria 4576925
1248 2816475428 2816332133 Bacteria 7249298
1249 2818236287 2816332527 Bacteria 8933356
1250 2819542824 2818991436 Bacteria 5376622
1251 2819559299 2818991439 Bacteria 6907412
1252 2819595585 2818991445 Bacteria 4955017
1253 2819601289 2818991446 Bacteria 7757362
1254 2819609431 2818991448 Bacteria 6772224
1255 2819616908 2818991449 Bacteria 5518009
1256 2819641258 2818991453 Bacteria 7181617
1257 2819686925 2818991461 Bacteria 7026071
1258 2819721946 2818991467 Bacteria 5893227
1259 2821128814 2821123053 Bacteria 7836056
1260 2821448518 2821443989 Bacteria 7658172
1261 2824607137 2824600985 Bacteria 8488197
1262 2824616562 2824609381 Bacteria 8672835
1263 2824624519 2824617872 Bacteria 8814715
1264 2824633434 2824626560 Bacteria 8813858
1265 2824642098 2824635225 Bacteria 8785348
1266 2824651772 2824644064 Bacteria 8743947
1267 2824659504 2824653114 Bacteria 8493680
1268 2824669264 2824661429 Bacteria 9877870
1269 2824675697 2824671348 Bacteria 8369588
1270 2824685768 2824679649 Bacteria 8248951
1271 2824693380 2824687955 Bacteria 8360029
1272 2824700399 2824696289 Bacteria 8335049
1273 2824708121 2824704595 Bacteria 9667483
1274 2824721988 2824714736 Bacteria 8717648
1275 2824731830 2824723954 Bacteria 8758240
1276 2824735763 2824732956 Bacteria 7810675
1277 2824751117 2824746037 Bacteria 7911610
1278 2824755742 2824753945 Bacteria 9787441
1279 2824766406 2824763712 Bacteria 9792355
1280 2824774789 2824773399 Bacteria 8360218
1281 2831269305 2831265667 Bacteria 7184833
1282 2835313887 2835312727 Bacteria 7413381
1283 2838020042 2838016132 Bacteria 6577831
1284 2838023542 2838022645 Bacteria 6494267
1285 2838033304 2838029111 Bacteria 6603031
1286 2838041736 2838035591 Bacteria 7166484
1287 2838045279 2838042994 Bacteria 6046894
1288 2838052852 2838048938 Bacteria 6044578
1289 2838055299 2838054893 Bacteria 7451788
1290 2838065110 2838061910 Bacteria 6794874
1291 2838069837 2838068647 Bacteria 6208656
1292 2838079729 2838074704 Bacteria 6785777
1293 2838122931 2838122688 Bacteria 8803140
1294 2838661290 2838661181 Bacteria 7385261
1295 2838674831 2838668709 Bacteria 6671819
1296 2838675530 2838675328 Bacteria 4909118
1297 2838683133 2838680041 Bacteria 6545511
1298 2838686733 2838686498 Bacteria 7807632
1299 2838697923 2838694306 Bacteria 6853137
1300 2838707116 2838701080 Bacteria 6669771
1301 2838711038 2838707686 Bacteria 6619912
1302 2838714411 2838714209 Bacteria 5525906
1303 2838721787 2838719591 Bacteria 5523910
1304 2838725172 2838724970 Bacteria 4908691
1305 2838730309 2838729681 Bacteria 7400765
1306 2838742018 2838736955 Bacteria 5760694
1307 2838742676 2838742623 Bacteria 7396178
1308 2839097602 2839094727 Bacteria 5534556
1309 2839997558 2839993093 Bacteria 5512535
1310 2840770653 2840764183 Bacteria 6358399
1311 2841763053 2841760612 Bacteria 6454112
1312 2841845853 2841840854 Bacteria 5761912
1313 2841848770 2841846520 Bacteria 5345850
1314 2841854561 2841851746 Bacteria 7532261
1315 2841862372 2841859092 Bacteria 5436171
1316 2841867277 2841864319 Bacteria 6742987
1317 2841944787 2841941048 Bacteria 8688029
1318 2841950806 2841949485 Bacteria 8680857
1319 2841959971 2841957949 Bacteria 8652217
1320 2841973743 2841966195 Bacteria 8673214
1321 2841978629 2841974524 Bacteria 8931498
1322 2841988999 2841983080 Bacteria 8395090
1323 2842040383 2842038055 Bacteria 8002051
1324 2842046672 2842045827 Bacteria 8006841
1325 2842079213 2842077413 Bacteria 6508645
1326 2842112953 2842110456 Bacteria 7656360
1327 2842118276 2842118031 Bacteria 7033875
1328 2842125199 2842124991 Bacteria 5346824
1329 2842130425 2842130223 Bacteria 4909145
1330 2842145557 2842140634 Bacteria 5759631
1331 2842151760 2842146304 Bacteria 5957337
1332 2842154405 2842152218 Bacteria 4908957
1333 2842158420 2842156927 Bacteria 6894975
1334 2842170205 2842163707 Bacteria 6916235
1335 2842170654 2842170452 Bacteria 5525737
1336 2842178025 2842175837 Bacteria 4908771
1337 2842182035 2842180545 Bacteria 6888678
1338 2842187520 2842187318 Bacteria 5524014
1339 2842195742 2842192696 Bacteria 6147454
1340 2842199056 2842198810 Bacteria 6608673
1341 2842209501 2842205361 Bacteria 6340321
1342 2842211831 2842211629 Bacteria 5523832
1343 2842218271 2842217011 Bacteria 7497767
1344 2842226549 2842224351 Bacteria 5524473
1345 2842229966 2842229732 Bacteria 7475766
1346 2842240190 2842237096 Bacteria 6620661
1347 2842243855 2842243621 Bacteria 7421798
1348 2842256954 2842250916 Bacteria 6579627
1349 2842258060 2842257432 Bacteria 7401195
1350 2842267763 2842264693 Bacteria 6472963
1351 2842271729 2842271015 Bacteria 7807131
1352 2842282955 2842278818 Bacteria 6340002
1353 2842285299 2842285085 Bacteria 6011953
1354 2842292875 2842291075 Bacteria 7076806
1355 2842298286 2842298080 Bacteria 6123127
1356 2842305362 2842304105 Bacteria 7023636
1357 2842313912 2842311132 Bacteria 6616990
1358 2842319852 2842317721 Bacteria 6793725
1359 2842338120 2842333319 Bacteria 8899485
1360 2842347914 2842341865 Bacteria 7003929
1361 2842360114 2842357229 Bacteria 6485165
1362 2842368411 2842363717 Bacteria 6844742
1363 2842373763 2842370503 Bacteria 7038661
1364 2842379272 2842377471 Bacteria 7140707
1365 2842384787 2842384541 Bacteria 7057858
1366 2842400694 2842395702 Bacteria 6780583
1367 2842402658 2842402390 Bacteria 6681310
1368 2842409970 2842409023 Bacteria 6687331
1369 2842416619 2842415677 Bacteria 6596907
1370 2842423451 2842422224 Bacteria 6239196
1371 2842430407 2842428310 Bacteria 6767288
1372 2842436781 2842434925 Bacteria 6502746
1373 2842443377 2842441272 Bacteria 6769273
1374 2842449247 2842447887 Bacteria 6754142
1375 2842466661 2842462802 Bacteria 6588055
1376 2842471349 2842469257 Bacteria 6752936
1377 2842480031 2842475841 Bacteria 6603183
1378 2842483779 2842482326 Bacteria 7212537
1379 2842493607 2842489311 Bacteria 6620893
1380 2842497758 2842495871 Bacteria 6820686
1381 2842505184 2842502639 Bacteria 6604161
1382 2842514196 2842509118 Bacteria 6850950
1383 2842519156 2842515876 Bacteria 5436280
1384 2842522147 2842521101 Bacteria 6569494
1385 2842679447 2842677519 Bacteria 5615038
1386 2842749771 2842747753 Bacteria 5578255
1387 2842876074 2842871566 Bacteria 4827117
1388 2842924390 2842922631 Bacteria 5824079
1389 2844109077 2844104063 Bacteria 6440972
1390 2844163947 2844163670 Bacteria 7266046
1391 2844319756 2844315083 Bacteria 8138177
1392 2844458030 2844454524 Bacteria 7952546
1393 2844534206 2844533157 Bacteria 7517899
1394 2846958232 2846952575 Bacteria 6587527
1395 2847419714 2847417321 Bacteria 6913799
1396 2847937080 2847930680 Bacteria 9342022
1397 2847947471 2847939898 Bacteria 8606328
1398 2848864714 2848858292 Bacteria 7391279
1399 2848994716 2848992105 Bacteria 6810864
1400 2849078654 2849076700 Bacteria 7039503
1401 2850081738 2850079185 Bacteria 6848280
1402 2851182317 2851182111 Bacteria 6047226
1403 2851251184 2851246043 Bacteria 6439203
1404 2852390570 2852387548 Bacteria 8025568
1405 2852619785 2852618963 Bacteria 4577824
1406 2854901112 2854896431 Bacteria 5869725
1407 2854912654 2854911287 Bacteria 5582813
1408 2854918503 2854916844 Bacteria 5725939
1409 2855828562 2855825444 Bacteria 6785811
1410 2855843687 2855839649 Bacteria 7135830
1411 2855877231 2855872281 Bacteria 6964271
1412 2856748202 2856741275 Bacteria 8096094
1413 2857513054 2857509624 Bacteria 7472071
1414 2857517108 2857516855 Bacteria 7787325
1415 2857534033 2857531043 Bacteria 6754041
1416 2857548748 2857547612 Bacteria 6179999
1417 2858807068 2858800743 Bacteria 6603254
1418 2861524979 2861520306 Bacteria 8348283
1419 2874599034 2874590934 Bacteria 8299676
1420 2874611170 2874604998 Bacteria 7834745
1421 2874617195 2874612657 Bacteria 8252029
1422 2874626668 2874620515 Bacteria 8290088
1423 2874635289 2874628541 Bacteria 8630250
1424 2874650521 2874645413 Bacteria 8214782
1425 2876764288 2876761206 Bacteria 10111113
1426 2876779073 2876771140 Bacteria 8287509
1427 2876810555 2876808645 Bacteria 8824342
1428 2876822677 2876818435 Bacteria 8274608
1429 2879082866 2879074833 Bacteria 8279565
1430 2879083399 2879083081 Bacteria 8587928
1431 2879101546 2879099564 Bacteria 10442239
1432 2879114411 2879110137 Bacteria 8907982
1433 2879133069 2879127579 Bacteria 8294491
1434 2879149356 2879142872 Bacteria 8267021
1435 2881364657 2881364244 Bacteria 7710352
1436 2881672035 2881665667 Bacteria 8175609
1437 2882460195 2882456835 Bacteria 6863978
1438 2884816873 2884811622 Bacteria 5552861
1439 2884839098 2884836552 Bacteria 5219991
1440 2884855389 2884852848 Bacteria 5221161
1441 2885082124 2885080285 Bacteria 6355622
1442 2885197182 2885192300 Bacteria 5882526
1443 2885201640 2885198086 Bacteria 7212419
1444 2885215649 2885211737 Bacteria 7212420
1445 2885369632 2885366525 Bacteria 8326213
1446 2885380980 2885374607 Bacteria 8927485
1447 2885385695 2885383462 Bacteria 9473874
1448 2885418215 2885409591 Bacteria 9235467
1449 2888385182 2888378607 Bacteria 9652610
1450 2888393057 2888388044 Bacteria 7304136
1451 2888425326 2888419890 Bacteria 7857137
1452 2889038335 2889033259 Bacteria 9099371
1453 2889307160 2889306138 Bacteria 6358934
1454 2894233990 2894232714 Bacteria 8834183
1455 2894657281 2894652903 Bacteria 4587256
1456 2894819809 2894817345 Bacteria 4892941
1457 2894821915 2894817345 Bacteria 4892941
1458 2896159104 2896154374 Bacteria 5221518
1459 2896391158 2896384573 Bacteria 7700774
1460 2897808546 2897803580 Bacteria 7000062
1461 2899795555 2899792073 Bacteria 4926588
1462 2899804081 2899803654 Bacteria 5577784
1463 2899848843 2899845264 Bacteria 5672268
1464 2899927364 2899924645 Bacteria 7487985
1465 2903730567 2903727486 Bacteria 8281579
1466 2903753235 2903748898 Bacteria 9972761
1467 2903769435 2903768456 Bacteria 9749579
1468 2904440388 2904439833 Bacteria 5931679
1469 2904450896 2904449895 Bacteria 6927402
1470 2904459601 2904456579 Bacteria 6819253
1471 2904530697 2904530477 Bacteria 5876334
1472 2904549254 2904541872 Bacteria 8915136
1473 2904584067 2904578770 Bacteria 5302906
1474 2904585890 2904584206 Bacteria 6028872
1475 2904592297 2904589729 Bacteria 6113573
1476 2904601567 2904601388 Bacteria 5884906
1477 2904672008 2904666416 Bacteria 8226587
1478 2904697847 2904690495 Bacteria 9412302
1479 2904704617
1480 2904712256 2904711408 Bacteria 9771557
1481 2906609629 2906602504 Bacteria 8295279
1482 2906616826
1483 2906628928 2906626472 Bacteria 8826946
1484 2906642864 2906635258 Bacteria 8601019
1485 2906651228 2906643746 Bacteria 8722424
1486 2906667153 2906660503 Bacteria 8595048
1487 2908742004 2908739725 Bacteria 8628932
1488 2908759671 2908756301 Bacteria 8864324
1489 2908780882 2908775508 Bacteria 8092255
1490 2909043367 2909042592 Bacteria 6499737
1491 2909043368 2909042592 Bacteria 6499737
1492 2913296178 2913295892 Bacteria 6333755
1493 2915653374 2915650412 Bacteria 4288180
1494 2915983690 2915980308 Bacteria 6624279
1495 2915988614 2915986958 Bacteria 6739310
1496 2916000226 2915993759 Bacteria 7016183
1497 2916007332 2916000859 Bacteria 6865702
1498 2916013466 2916007675 Bacteria 6898660
1499 2916020750 2916014648 Bacteria 6946486
1500 2916028092 2916021584 Bacteria 6854472
1501 2916031151 2916028427 Bacteria 6748433
1502 2916041557 2916035215 Bacteria 6755766
1503 2916043674 2916041962 Bacteria 6820487
1504 2916054048 2916048683 Bacteria 6543552
1505 2916057787 2916055098 Bacteria 6758838
1506 2916068327 2916061851 Bacteria 6737736
1507 2916072229 2916068649 Bacteria 6943657
1508 2916082554 2916076590 Bacteria 6596108
1509 2917558064 2917554339 Bacteria 4987857
1510 2917700224 2917699015 Bacteria 7043791
1511 2919049710 2919046199 Bacteria 5567169
1512 2919082781 2919079590 Bacteria 5946433
1513 2919106140 2919100787 Bacteria 7710546
1514 2919114447 2919114240 Bacteria 5700270
1515 2919124967 2919119836 Bacteria 5208557
1516 2919169571 2919166419 Bacteria 4952238
1517 2919174606 2919171160 Bacteria 6499771
1518 2919410295 2919408235 Bacteria 6149349
1519 2919453697 2919450847 Bacteria 5631160
1520 2919462576 2919462493 Bacteria 5817112
1521 2919707682 2919704043 Bacteria 5560311
1522 2920761249 2920760137 Bacteria 7427611
1523 2920825551 2920822456 Bacteria 6897201
1524 2921204321 2921201388 Bacteria 6926299
1525 2921213256 2921208531 Bacteria 6745326
1526 2921243245 2921237296 Bacteria 6876710
1527 2921245727 2921244191 Bacteria 6568419
1528 2921256929 2921250672 Bacteria 6677771
1529 2921258307 2921257292 Bacteria 6808382
1530 2921266558 2921263974 Bacteria 6864552
1531 2921284672 2921282425 Bacteria 6826397
1532 2921290724 2921289301 Bacteria 7316391
1533 2921302630 2921296804 Bacteria 7176999
1534 2922362561 2922361189 Bacteria 7436256
1535 2922372713
1536 2922387635 2922386360 Bacteria 7017218
1537 2922397344 2922393267 Bacteria 8285685
1538 2922431112
1539 2923515528 2923510766 Bacteria 5926163
1540 2923560180 2923556063 Bacteria 6793593
1541 2924148112 2924144063 Bacteria 6883928
1542 2924158264 2924150972 Bacteria 7169444
1543 2924164272 2924158325 Bacteria 7188855
1544 2924168446 2924165586 Bacteria 7260590
1545 2924174834 2924172951 Bacteria 6749356
1546 2924182029 2924179722 Bacteria 6843264
1547 2924188905 2924186466 Bacteria 6876637
1548 2924195755 2924193448 Bacteria 6955718
1549 2924202975 2924200457 Bacteria 6757188
1550 2924210009 2924207177 Bacteria 6917007
1551 2924217082 2924214083 Bacteria 7080103
1552 2924222656 2924221636 Bacteria 7113495
1553 2924231047 2924228884 Bacteria 6633132
1554 2926755462 2926754445 Bacteria 5964435
1555 2926762593 2926760298 Bacteria 5505990
1556 2928042724 2928037797 Bacteria 7273642
1557 2928048849 2928044640 Bacteria 7271509
1558 2928055182 2928051484 Bacteria 7773759
1559 2928068608 2928064002 Bacteria 7419480
1560 2928073484 2928070936 Bacteria 8062541
1561 2928089963 2928084124 Bacteria 7159212
1562 2928118316 2928115317 Bacteria 6477646
1563 2928127961 2928125067 Bacteria 5937560
1564 2928134449 2928130867 Bacteria 5467269
1565 2928525723 2928521798 Bacteria 4960112
1566 2929141100 2929138655 Bacteria 5810547
1567 2929161430 2929160207 Bacteria 9075316
1568 2929521700 2929520902 Bacteria 6765052
1569 2929620529 2929615660 Bacteria 9193770
1570 2929626422 2929624759 Bacteria 9339455
1571 2932415928 2932410948 Bacteria 6312192
1572 2932422059 2932416698 Bacteria 6315112
1573 2932784707 2932784394 Bacteria 9704911
1574 2932795405 2932794094 Bacteria 7915132
1575 2932805936 2932801729 Bacteria 7987968
1576 2932809687 2932809354 Bacteria 9135765
1577 2932818569 2932818245 Bacteria 9955613
1578 2932828475 2932828146 Bacteria 9745859
1579 2933009050 2933006813 Bacteria 4912075
1580 2933014670 2933011516 Bacteria 5439334
1581 2933018561 2933016740 Bacteria 6355406
1582 2933571169 2933570622 Bacteria 7023390
1583 2933582447 2933577622 Bacteria 9116884
1584 2933588990 2933586486 Bacteria 7667493
1585 2933596351 2933594066 Bacteria 5594265
1586 2933600643 2933599457 Bacteria 5858799
1587 2935609572 2935608549 Bacteria 8203142
1588 2935617448 2935616580 Bacteria 9032984
1589 2935639070 2935638405 Bacteria 10015038
1590 2935652277 2935648319 Bacteria 8801166
1591 2935660859 2935656913 Bacteria 8965014
1592 2935666078 2935665750 Bacteria 9571747
1593 2935675726 2935675223 Bacteria 9928132
1594 2935685264 2935684952 Bacteria 9590419
1595 2935694954 2935694250 Bacteria 9291695
1596 2935704077 2935703347 Bacteria 10242284
1597 2935713817 2935713505 Bacteria 9608509
1598 2935724436 2935722832 Bacteria 9608746
1599 2935733206 2935732158 Bacteria 9706831
1600 2935742585 2935741537 Bacteria 9707219
1601 2935751229 2935750917 Bacteria 9590372
1602 2935760247 2935760218 Bacteria 9817913
1603 2935769963 2935769743 Bacteria 7878163
1604 2935782017 2935777560 Bacteria 8077691
1605 2935785795 2935785616 Bacteria 7962367
1606 2935794277 2935793552 Bacteria 8012592
1607 2935802160 2935801545 Bacteria 9301974
1608 2935810983 2935810662 Bacteria 9401221
1609 2935822734 2935819856 Bacteria 8261050
1610 2935828565 2935827899 Bacteria 10038562
1611 2935839941 2935837841 Bacteria 9454360
1612 2935848316 2935847175 Bacteria 8228321
1613 2935856073 2935855204 Bacteria 9035059
1614 2935865983 2935864058 Bacteria 9784707
1615 2935877692 2935873716 Bacteria 9632195
1616 2935883701 2935883170 Bacteria 7964738
1617 2935896692 2935894831 Bacteria 6620579
1618 2935901639 2935901341 Bacteria 7341747
1619 2935909881 2935908558 Bacteria 8568796
1620 2935917605 2935916978 Bacteria 9113783
1621 2935927361 2935926038 Bacteria 8601059
1622 2935936794 2935934488 Bacteria 8602579
1623 2935944903 2935942939 Bacteria 8599779
1624 2935953340 2935951376 Bacteria 8602333
1625 2935961163 2935959822 Bacteria 7869783
1626 2935970180 2935967501 Bacteria 8603075
1627 2935980474 2935975950 Bacteria 8347125
1628 2935986746 2935984226 Bacteria 8302647
1629 2935992636 2935992306 Bacteria 9802711
1630 2936002508 2936002035 Bacteria 9362176
1631 2936014915 2936011229 Bacteria 8801034
1632 2936022104 2936019824 Bacteria 8804134
1633 2936032792 2936028420 Bacteria 8965941
1634 2936037598 2936037263 Bacteria 9446081
1635 2936050656 2936046547 Bacteria 8903709
1636 2936059568 2936055302 Bacteria 8785755
1637 2936371729 2936367885 Bacteria 7324495
1638 2936379564 2936375103 Bacteria 6652732
1639 2936383302 2936381700 Bacteria 7006523
1640 2937001555 2936996657 Bacteria 6298727
1641 2937005563 2937002841 Bacteria 6934057
1642 2937014275 2937009748 Bacteria 6746052
1643 2937019199 2937016420 Bacteria 6782579
1644 2937026133 2937023124 Bacteria 6815156
1645 2937035042 2937029754 Bacteria 6424026
1646 2937036976 2937036028 Bacteria 6846469
1647 2937045917 2937042894 Bacteria 6741576
1648 2937054068 2937049772 Bacteria 6757901
1649 2937056832 2937056579 Bacteria 7107896
1650 2937066107 2937063883 Bacteria 7199456
1651 2937077654 2937071275 Bacteria 6984483
1652 2937084314 2937078374 Bacteria 6610289
1653 2937090716 2937084907 Bacteria 6618516
1654 2937093319 2937091812 Bacteria 6979387
1655 2937105072 2937098957 Bacteria 7249374
1656 2937111497 2937106411 Bacteria 6947143
1657 2937118862 2937113482 Bacteria 6505872
1658 2937120705 2937119839 Bacteria 6597547
1659 2937128967 2937126314 Bacteria 6771275
1660 2940557969 2940556831 Bacteria 9590747
1661 2941504662 2941499720 Bacteria 7599444
1662 2941536797 2941531003 Bacteria 7653939
1663 2941540719 2941538514 Bacteria 9402094
1664 2945914085 2945909444 Bacteria 7065066
1665 2945949633 2945945610 Bacteria 5951079
1666 2945973670 2945972063 Bacteria 6086495
1667 2945990522 2945984333 Bacteria 7358892
1668 2954012188 2954011201 Bacteria 4762601
1669 2954770708 2954767861 Bacteria 5535784
1670 2957381018 2957375807 Bacteria 6425588
1671 2957382980 2957382221 Bacteria 6737050
1672 2957391938 2957388812 Bacteria 6778072
1673 2957401395 2957395598 Bacteria 6822399
1674 2957402968 2957402308 Bacteria 6741770
1675 2957411324 2957408893 Bacteria 6558585
1676 2957418329 2957415311 Bacteria 6991633
1677 2957422836 2957422303 Bacteria 7172205
1678 2957436134 2957430029 Bacteria 7022557
1679 2957442267 2957437181 Bacteria 6568994
1680 2957443904 2957443900 Bacteria 6869977
1681 2957454875 2957450854 Bacteria 6765715
1682 2957464077 2957457609 Bacteria 6967680
1683 2957464860 2957464669 Bacteria 6568877
1684 2957477503 2957471148 Bacteria 6797643
1685 2957480495 2957478035 Bacteria 6756658
1686 2957487062 2957484790 Bacteria 6703082
1687 2957491725 2957491536 Bacteria 6695180
1688 2957498982 2957498199 Bacteria 7126688
1689 2957510118 2957505466 Bacteria 7253085
1690 2960584634 2960584000 Bacteria 6864594
1691 2960596514 2960591022 Bacteria 6622873
1692 2960598432 2960597568 Bacteria 6550735
1693 2960604973 2960603979 Bacteria 6898737
1694 2960613641 2960610863 Bacteria 6691244
1695 2960622155 2960617483 Bacteria 6727748
1696 2960625734 2960624210 Bacteria 6875384
1697 2960634410 2960631154 Bacteria 6732508
1698 2960640714 2960637947 Bacteria 7296468
1699 2960645676 2960645483 Bacteria 7211087
1700 2960658134 2960652885 Bacteria 7083688
1701 2960662778 2960660292 Bacteria 7041660
1702 2960669739 2960667422 Bacteria 6763020
1703 2960680355 2960674078 Bacteria 6609048
1704 2960683362 2960680706 Bacteria 6624464
1705 2960690850 2960687367 Bacteria 6535474
1706 2960695213 2960693952 Bacteria 6749742
1707 2964610797 2964607997 Bacteria 7101408
1708 2964615987 2964615318 Bacteria 6809089
1709 2964624173 2964621998 Bacteria 6834995
1710 2964632532 2964628898 Bacteria 7083044
1711 2964637324 2964636051 Bacteria 7091832
1712 2964644570 2964643177 Bacteria 6820887
1713 2964655591 2964649959 Bacteria 6675118
1714 2964657553 2964656573 Bacteria 7100150
1715 2964666789 2964663802 Bacteria 7019362
1716 2964677164 2964670856 Bacteria 6851364
1717 2964681966 2964678106 Bacteria 6792020
1718 2964685594 2964685014 Bacteria 6839111
1719 2964698597 2964691889 Bacteria 6802758
1720 2964703254 2964698721 Bacteria 6765331
1721 2964711620 2964705432 Bacteria 7114648
1722 2964714032 2964712639 Bacteria 6695970
1723 2964721114 2964719344 Bacteria 7286602
1724 2967669632 2967664464 Bacteria 6948836
1725 2967677051 2967671571 Bacteria 7021409
1726 2967679175 2967678726 Bacteria 7264382
1727 2967692142 2967686174 Bacteria 6678622
1728 2967698837 2967693043 Bacteria 6804451
1729 2967703151 2967699805 Bacteria 6854538
1730 2967708938 2967706974 Bacteria 7186053
1731 2967716962 2967714385 Bacteria 7000047
1732 2967723529 2967721400 Bacteria 7073753
1733 2967728833 2967728569 Bacteria 6641507
1734 2967740676 2967735183 Bacteria 6827012
1735 2967747846 2967742019 Bacteria 6794534
1736 2967750825 2967748971 Bacteria 6733771
1737 2967761853 2967755722 Bacteria 6814706
1738 2967765086 2967762386 Bacteria 6923502
1739 2967772311 2967769361 Bacteria 6587838
1740 2967777579 2967775926 Bacteria 6738189
1741 2970022413 2970019648 Bacteria 7072033
1742 2970032739 2970026789 Bacteria 6785236
1743 2970039035 2970033650 Bacteria 7118744
1744 2970047136 2970040964 Bacteria 6731123
1745 2970053742 2970047711 Bacteria 7088379
1746 2970058637 2970054988 Bacteria 6611507
1747 2970067945 2970061556 Bacteria 7099761
1748 2970071274 2970068827 Bacteria 7123112
1749 2970078400 2970076120 Bacteria 6697332
1750 2970083957 2970082768 Bacteria 6183754
1751 2970090178 2970088815 Bacteria 6933825
1752 2970097376 2970095765 Bacteria 6936963
1753 2970105649 2970102677 Bacteria 6812532
1754 2970109798 2970109326 Bacteria 6863976
1755 2970121545 2970116247 Bacteria 6501857
1756 2970126647 2970122695 Bacteria 6625855
1757 2970135045 2970129317 Bacteria 6806560
1758 2970139154 2970136068 Bacteria 7207982
1759 2970143933 2970143518 Bacteria 6446480
1760 2970154137 2970149975 Bacteria 6779706
1761 2970162925 2970156795 Bacteria 7168044
1762 2970167729 2970164137 Bacteria 6861252
1763 2970176655 2970170962 Bacteria 6876229
1764 2970179505 2970177841 Bacteria 6768001
1765 2970188377 2970184632 Bacteria 7054431
1766 2970194651 2970191845 Bacteria 7032787
1767 2977518823 2977516862 Bacteria 6940108
1768 2977524042 2977523885 Bacteria 6960446
1769 2977524051 2977523885 Bacteria 6960446
1770 2977532684 2977530762 Bacteria 6951399
1771 2977540074 2977537788 Bacteria 6929320
1772 2977547948 2977544691 Bacteria 6875412
1773 2977557359 2977551784 Bacteria 7125765
1774 2977559596 2977558990 Bacteria 6863948
1775 2977570919 2977565890 Bacteria 6901543
1776 2977579247 2977572785 Bacteria 6763888
1777 2977585260 2977579622 Bacteria 6772100
1778 2978971971 2978969890 Bacteria 5400756
1779 2979092097 2979089926 Bacteria 5670289
1780 2979100515 2979095461 Bacteria 5669583
1781 2979104154 2979100975 Bacteria 5423623
1782 2984511276 2984509177 Bacteria 5274802
1783 2984522363 2984518228 Bacteria 5277463
1784 2984541665 2984537506 Bacteria 5277481
1785 2984590255 2984587000 Bacteria 5263363
1786 2984603938 2984601300 Bacteria 5455244
1787 2990712103 2990710928 Bacteria 5002431
1788 2996892738 2996887358 Bacteria 5795980
1789 2996897954 2996893221 Bacteria 5823108
1790 3002145779 3002141150 Bacteria 5254435
1791 3003670717 3003665799 Bacteria 7279786
1792 3003934537 3003930520 Bacteria 5667563
1793 3005414250 3005409236 Bacteria 7188837
1794 3005418884 3005416602 Bacteria 7064308
1795 3005448763 3005445848 Bacteria 6906074
1796 3005454996 3005452660 Bacteria 5889319
1797 3005480931 3005474847 Bacteria 9259049
1798 3005485032 3005483717 Bacteria 7877331
1799 3005507354 3005506211 Bacteria 6943378
1800 3005587322 3005587118 Bacteria 7794411
1801 3005599979 3005594810 Bacteria 8716512
1802 3005715568 3005710791 Bacteria 7622528
1803 3005722899 3005718088 Bacteria 8283608
1804 639649493 639633055 Bacteria 7751309
1805 643826610 643692032 Bacteria 6891900
1806 648739888 648276728 Bacteria 6968865
1807 650740792 650716007 Bacteria 5573770
1808 8001846645 8001845381 Bacteria 5804942
1809 8003571868 8003570095 Bacteria 5747666
1810 8003996247 8003992118 Bacteria 7266902
1811 8004004004 8003999396 Bacteria 7063185
1812 8005259495 8005258706 Bacteria 6184835
1813 8005281539 8005275841 Bacteria 6929066
1814 8005284504 8005282627 Bacteria 6675747
1815 8005295826 8005289223 Bacteria 6634003
1816 8005303432 8005301065 Bacteria 6614431
1817 8005313913 8005307578 Bacteria 7395396
1818 8005318224 8005314921 Bacteria 7072929
1819 8005327265 8005321885 Bacteria 5795980
1820 8005381238 8005376324 Bacteria 6590079
1821 8005384749 8005382845 Bacteria 6732062
1822 8005395786 8005395548 Bacteria 6806915
1823 8005435579 8005430974 Bacteria 6689030
1824 8005464118 8005460587 Bacteria 7157962
1825 8005488898 8005484373 Bacteria 6297373
1826 8005501207 8005497431 Bacteria 6477605
1827 8005545995 8005542996 Bacteria 7077758
1828 8005561531 8005556819 Bacteria 6908598
1829 8005568309 8005563573 Bacteria 7153261
1830 8005573152 8005570704 Bacteria 6957481
1831 8005622574 8005619151 Bacteria 7030230
1832 8005630076 8005626139 Bacteria 6534237
1833 8005645982 8005645114 Bacteria 6950293
1834 8005672625 8005668836 Bacteria 6953162
1835 8005682589 8005682033 Bacteria 6726518
1836 8005691796 8005688590 Bacteria 6610080
1837 8005697728 8005695170 Bacteria 6912330
1838 8006932435 8006926726 Bacteria 6749210
1839 8006939782 8006933436 Bacteria 10410654
1840 8006969057 8006964411 Bacteria 8966052
1841 8006979551 8006973647 Bacteria 10679141
1842 8006987496 8006984368 Bacteria 9651211
1843 8006994997 8006994254 Bacteria 8309700
1844 8016521035 8016511872 Bacteria 9921665
1845 8016528951 8016522445 Bacteria 8156687
1846 8016534144 8016530956 Bacteria 8155261
1847 8016547377 8016539877 Bacteria 8155419
1848 8016554767 8016548790 Bacteria 8155074
1849 8016572488 8016566248 Bacteria 8158151
1850 8016576654 8016575299 Bacteria 8154085
1851 8016593837 8016583857 Bacteria 10421953
1852 8016600889 8016595262 Bacteria 8149947
1853 8016609586 8016603502 Bacteria 8731218
1854 8016615329 8016613128 Bacteria 8794220
1855 8016625881 8016622563 Bacteria 7999408
1856 8016639461 8016630954 Bacteria 9217207
1857 8017064569 8017057580 Bacteria 10023680
1858 8018127450 8018127388 Bacteria 7351159
1859 8018152415 8018150411 Bacteria 5549903
1860 8018164255 8018163183 Bacteria 7277977
1861 8018179560 8018176218 Bacteria 6896178
1862 8019533921 8019530166 Bacteria 8155624
1863 8019552965 8019547302 Bacteria 7996444
1864 8019565687 8019555841 Bacteria 9642137
1865 8019575778 8019565922 Bacteria 9639779
1866 8019583946 8019576017 Bacteria 10049540
1867 8019591752 8019586578 Bacteria 10212056
1868 8019599584 8019597564 Bacteria 10041141
1869 8019619527 8019619141 Bacteria 9218857
1870 8019633585 8019629233 Bacteria 8687553
1871 8019649074 8019648815 Bacteria 10014479
1872 8019661464 8019659431 Bacteria 8577854
1873 8019671006 8019668869 Bacteria 8791617
1874 8019685188 8019678201 Bacteria 8863603
1875 8023682853 8023680758 Bacteria 7729763
1876 8024486264 8024479707 Bacteria 6954785
1877 8024488342 8024486573 Bacteria 6540512
1878 8024504751 8024501048 Bacteria 6427847
1879 8045866996 8045864390 Bacteria 5043873
1880 8046770531 8046767195 Bacteria 7547379
1881 8049295579 8049293176 Bacteria 6128433
1882 8054005699 8054002106 Bacteria 7987183
1883 8054463211 8054460903 Bacteria 4872905
1884 8055431942 8055431914 Bacteria 4551896
1885 8055431944 8055431914 Bacteria 4551896
1886 8055745391 8055742211 Bacteria 9226248
1887 8056377524 8056375014 Bacteria 7006639
1888 8056387224 8056382006 Bacteria 6408074
1889 8056679574 8056673599 Bacteria 7871253
1890 8056692576 8056689827 Bacteria 6712655
1891 8056877243 8056875544 Bacteria 4355797
1892 8056968769 8056967851 Bacteria 9038162
1893 8057135964 8057132660 Bacteria 4061191
1894 8057533807 8057529695 Bacteria 6306553
1895 8057576659 8057575449 Bacteria 7367519
1896 8057882030 8057874678 Bacteria 7494653
1897 Ga0395900_0242476
1898 JGI24740J21852_10011127
1899 JGI25156J39149_1001036
1900 JGI25162J39368_1000001
1901 JGI25162J39368_1002679
1902 JGI25158J39367_1002199
1903 JGI25152J39213_1004465
1904 JGI25159J45721_1008212
1905 JGI25159J45721_1008935
1906 JGI25151J46595_10000952
1907 JGI25406J46586_10000107
1908 JGI25406J46586_10012746
1909 JGI25406J46586_10033401
1910 JGI25165J46597_1000001
1911 JGI25165J46597_1006128
1912 JGI25153J46596_10002552
1913 JGI25153J46596_10007970
1914 rootL2_10000270
1915 JGI25160J50197_1000642
1916 JGI25404J52841_10014310
1917 Ga0055538_1000001
1918 Ga0055538_1000008
1919 Ga0055539_1000001
1920 Ga0055539_1000012
1921 Ga0055539_1006046
1922 Ga0055533_1000003
1923 Ga0055533_1000015
1924 Ga0055532_1000005
1925 Ga0055525_1000003
1926 Ga0055525_1000017
1927 Ga0055542_1009250
1928 Ga0055537_1000096
1929 Ga0055524_1023481
1930 Ga0055524_1023902
1931 Ga0055534_1000695
1932 Ga0055534_1004475
1933 Ga0055528_1000104
1934 Ga0055530_10009863
1935 Ga0055530_10011434
1936 Ga0055540_1022126
1937 Ga0055531_10009359
1938 Ga0055531_10011980
1939 Ga0055531_10016338
1940 Ga0055541_1000001
1941 Ga0055541_1000009
1942 Ga0055543_1002531
1943 Ga0065165_1000410
1944 Ga0065165_1000883
1945 Ga0065165_1001488
1946 Ga0065165_1009852
1947 Ga0065165_1042807
1948 Ga0065714_10083006
1949 Ga0070676_10087404
1950 Ga0070683_100094051
1951 Ga0070683_100363933
1952 Ga0070690_100146767
1953 Ga0070670_100326742
1954 Ga0068869_100127028
1955 Ga0070680_100014938
1956 Ga0070682_100245596
1957 Ga0068868_100046499
1958 Ga0070661_100340669
1959 Ga0070668_100008262
1960 Ga0070668_100261041
1961 Ga0070671_100063456
1962 Ga0070674_100055197
1963 Ga0070673_100073096
1964 Ga0070667_100174593
1965 Ga0070709_10069745
1966 Ga0070714_100011608
1967 Ga0070713_100013165
1968 Ga0070713_100022628
1969 Ga0070713_100067247
1970 Ga0070711_100026611
1971 Ga0070711_100062401
1972 Ga0070711_100176755
1973 Ga0070705_100230320
1974 Ga0070663_100016175
1975 Ga0070663_100149791
1976 Ga0070663_100162814
1977 Ga0070678_100031477
1978 Ga0070678_100163759
1979 Ga0070662_100035632
1980 Ga0070662_100260649
1981 Ga0070681_10000912
1982 Ga0068867_100147322
1983 Ga0070707_100033699
1984 Ga0070707_100040975
1985 Ga0070698_100371654
1986 Ga0070679_100002460
1987 Ga0070679_100057701
1988 Ga0070684_100027835
1989 Ga0070697_100063577
1990 Ga0068853_100069650
1991 Ga0068853_100080729
1992 Ga0070672_100129624
1993 Ga0068855_100000423
1994 Ga0070664_100130677
1995 Ga0070664_100135452
1996 Ga0068857_100032491
1997 Ga0068857_100275935
1998 Ga0068854_100083248
1999 Ga0068854_100264378
2000 Ga0068856_100131696
2001 Ga0068856_100404468
2002 Ga0068852_100001139
2003 Ga0068852_100075576
2004 Ga0068852_100133896
2005 Ga0068852_100264587
2006 Ga0068852_100271164
2007 Ga0068852_100356906
2008 Ga0068859_100072044
2009 Ga0068859_100098886
2010 Ga0068859_100219588
2011 Ga0068859_100339757
2012 Ga0068864_100326870
2013 Ga0068863_100063713
2014 Ga0068858_100172061
2015 Ga0068860_100000471
2016 Ga0068860_100023822
2017 Ga0068860_100261569
2018 Ga0081455_10002099
2019 Ga0081455_10005028
2020 Ga0081455_10006573
2021 Ga0081455_10016438
2022 Ga0081538_10032016
2023 Ga0081538_10033054
2024 Ga0081540_1001707
2025 Ga0081540_1002090
2026 Ga0081540_1017988
2027 Ga0081540_1022394
2028 Ga0081540_1030826
2029 Ga0081540_1037486
2030 Ga0081539_10000051
2031 Ga0081539_10001557
2032 Ga0081539_10001947
2033 Ga0081539_10004431
2034 Ga0081539_10017073
2035 Ga0081539_10017886
2036 Ga0070717_10002173
2037 Ga0075365_10014659
2038 Ga0075365_10038895
2039 Ga0075365_10078390
2040 Ga0075365_10132304
2041 Ga0075368_10029384
2042 Ga0075368_10045526
2043 Ga0075368_10051710
2044 Ga0075368_10064549
2045 Ga0075363_100004083
2046 Ga0075363_100040478
2047 Ga0075363_100084462
2048 Ga0075363_100110654
2049 Ga0075364_10000419
2050 Ga0075364_10007102
2051 Ga0075364_10024520
2052 Ga0075364_10055886
2053 Ga0070712_100019688
2054 Ga0070712_100209056
2055 Ga0075362_10065364
2056 Ga0075367_10018482
2057 Ga0075367_10021851
2058 Ga0075367_10036227
2059 Ga0075367_10095289
2060 Ga0075369_10001765
2061 Ga0075369_10030976
2062 Ga0075369_10041480
2063 Ga0075369_10105966
2064 Ga0075366_10001007
2065 Ga0075366_10001909
2066 Ga0075366_10006493
2067 Ga0075366_10018672
2068 Ga0075366_10062212
2069 Ga0075366_10082767
2070 Ga0097621_100140616
2071 Ga0075370_10044141
2072 Ga0075370_10060771
2073 Ga0068871_100134549
2074 Ga0068871_100254205
2075 Ga0068871_100282079
2076 Ga0075434_100222650
2077 Ga0068865_100076807
2078 Ga0075436_100248986
2079 Ga0097620_100072046
2080 Ga0097620_100098892
2081 Ga0097620_100219588
2082 Ga0097620_100339740
2083 Ga0099824_1010395
2084 Ga0099822_1003442
2085 Ga0079104_1000103
2086 Ga0079104_1006095
2087 Ga0099826_10000647
2088 Ga0105244_10000718
2089 Ga0105244_10014405
2090 Ga0105240_10001776
2091 Ga0105240_10008933
2092 Ga0105240_10015278
2093 Ga0105240_10017280
2094 Ga0105240_10225909
2095 Ga0105240_10266283
2096 Ga0111539_10164602
2097 Ga0111539_10501254
2098 Ga0105245_10056166
2099 Ga0105245_10116994
2100 Ga0105247_10035859
2101 Ga0105247_10063527
2102 Ga0105247_10097788
2103 Ga0105243_10138599
2104 Ga0105241_10206601
2105 Ga0105242_10163928
2106 Ga0105248_10043261
2107 Ga0105248_10146526
2108 Ga0105248_10220407
2109 Ga0105237_10001461
2110 Ga0105237_10010075
2111 Ga0105237_10192806
2112 Ga0105237_10198918
2113 Ga0105237_10348357
2114 Ga0105238_10000062
2115 Ga0105238_10009650
2116 Ga0105239_10000798
2117 Ga0105239_10005131
2118 Ga0105239_10014064
2119 Ga0105239_10097320
2120 Ga0105246_10029088
2121 Ga0105246_10038359
2122 Ga0105246_10049572
2123 Ga0157319_1000003
2124 Ga0157319_1000029
2125 Ga0157373_10008513
2126 Ga0157373_10028982
2127 Ga0157370_10116881
2128 Ga0157370_10149520
2129 Ga0157369_10083060
2130 Ga0157369_10153964
2131 Ga0171462_1019
2132 Ga0157374_10085403
2133 Ga0157378_10180834
2134 Ga0157378_10402340
2135 Ga0163162_10041666
2136 Ga0157372_10069112
2137 Ga0163163_10038358
2138 Ga0163163_10043845
2139 Ga0163163_10071649
2140 Ga0182008_10085920
2141 Ga0157376_10065256
2142 Ga0157376_10074842
2143 Ga0182006_1000007
2144 Ga0182006_1024790
2145 Ga0182007_10000022
2146 Ga0182007_10001677
2147 Ga0182007_10003970
2148 Ga0182005_1000010
2149 Ga0182005_1000798
2150 Ga0182005_1003928
2151 Ga0163161_10000072
2152 Ga0163161_10045371
2153 Ga0163161_10111514
2154 Ga0197907_10548788
2155 Ga0206356_11527734
2156 Ga0214544_1000004
2157 Ga0214542_1000001
2158 Ga0214545_1000001
2159 Ga0214543_1000006
2160 Ga0213873_10005146
2161 Ga0213872_10004376
2162 Ga0213876_10063371
2163 Ga0213876_10094002
2164 Ga0224712_10074223
2165 Ga0209435_100004
2166 Ga0209784_100004
2167 Ga0209784_100005
2168 Ga0209566_100004
2169 Ga0209566_100005
2170 Ga0209674_100006
2171 Ga0209674_100009
2172 Ga0209147_100011
2173 Ga0209563_100009
2174 Ga0209563_100012
2175 Ga0207427_100254
2176 Ga0209437_100004
2177 Ga0209437_100084
2178 Ga0209258_100441
2179 Ga0209646_1000032
2180 Ga0209646_1000052
2181 Ga0209026_1000062
2182 Ga0209677_100005
2183 Ga0209677_100006
2184 Ga0209677_100697
2185 Ga0209677_103560
2186 Ga0209148_1000261
2187 Ga0209759_1000054
2188 Ga0209129_1000147
2189 Ga0209129_1008462
2190 Ga0209233_1000005
2191 Ga0209233_1003705
2192 Ga0209233_1009712
2193 Ga0209233_1010932
2194 Ga0209565_1000117
2195 Ga0209565_1008486
2196 Ga0209455_1002374
2197 Ga0209455_1003522
2198 Ga0209673_1000218
2199 Ga0209673_1000415
2200 Ga0209673_1004047
2201 Ga0209673_1010175
2202 Ga0209673_1011872
2203 Ga0209130_1000130
2204 Ga0209130_1000821
2205 Ga0209130_1000916
2206 Ga0209675_1000113
2207 Ga0209675_1000379
2208 Ga0209676_1000028
2209 Ga0209676_1000286
2210 Ga0209676_1005887
2211 Ga0209025_1000194
2212 Ga0209025_1000282
2213 Ga0209025_1000375
2214 Ga0209025_1003283
2215 Ga0209025_1007633
2216 Ga0209564_1000220
2217 Ga0209564_1000327
2218 Ga0209758_1000199
2219 Ga0209758_1000237
2220 Ga0209758_1000345
2221 Ga0209758_1001280
2222 Ga0209758_1005055
2223 Ga0209758_1009018
2224 Ga0209758_1015294
2225 Ga0209758_1037871
2226 Ga0209050_1000072
2227 Ga0209050_1000133
2228 Ga0209050_1002056
2229 Ga0209050_1002244
2230 Ga0209050_1006071
2231 Ga0209050_1025448
2232 Ga0209256_1000117
2233 Ga0209256_1000151
2234 Ga0209256_1000242
2235 Ga0209256_1003478
2236 Ga0209256_1007278
2237 Ga0209256_1021536
2238 Ga0209256_1034604
2239 Ga0207426_1000049
2240 Ga0207426_1000166
2241 Ga0207426_1000182
2242 Ga0207426_1000402
2243 Ga0207426_1002639
2244 Ga0207426_1005169
2245 Ga0207426_1030815
2246 Ga0209051_1000015
2247 Ga0209051_1000056
2248 Ga0209051_1000255
2249 Ga0209051_1001521
2250 Ga0209051_1001607
2251 Ga0209051_1001786
2252 Ga0209257_1000037
2253 Ga0209257_1000162
2254 Ga0209257_1000628
2255 Ga0209257_1001388
2256 Ga0209257_1007486
2257 Ga0207697_10102770
2258 Ga0207655_1000813
2259 Ga0207655_1004027
2260 Ga0207692_10094256
2261 Ga0207710_10004120
2262 Ga0207710_10057214
2263 Ga0207688_10060613
2264 Ga0207688_10093993
2265 Ga0207647_10042546
2266 Ga0207647_10063619
2267 Ga0207654_10065634
2268 Ga0207654_10162760
2269 Ga0207707_10000088
2270 Ga0207695_10007898
2271 Ga0207695_10010192
2272 Ga0207695_10014849
2273 Ga0207695_10023548
2274 Ga0207695_10034101
2275 Ga0207695_10146385
2276 Ga0207671_10001730
2277 Ga0207671_10012019
2278 Ga0207671_10026884
2279 Ga0207671_10112730
2280 Ga0207671_10197339
2281 Ga0207671_10229451
2282 Ga0207671_10304825
2283 Ga0207693_10021622
2284 Ga0207693_10027933
2285 Ga0207663_10023414
2286 Ga0207663_10037822
2287 Ga0207663_10049775
2288 Ga0207652_10002304
2289 Ga0207646_10238801
2290 Ga0207646_10240143
2291 Ga0207694_10000359
2292 Ga0207694_10008580
2293 Ga0207694_10066667
2294 Ga0207694_10099331
2295 Ga0207694_10137283
2296 Ga0207694_10147710
2297 Ga0207700_10017947
2298 Ga0207700_10061106
2299 Ga0207700_10372731
2300 Ga0207644_10142936
2301 Ga0207706_10015728
2302 Ga0207706_10032627
2303 Ga0207706_10157047
2304 Ga0207709_10000208
2305 Ga0207709_10005471
2306 Ga0207709_10019781
2307 Ga0207709_10087954
2308 Ga0207709_10106251
2309 Ga0207670_10190001
2310 Ga0207669_10010599
2311 Ga0207704_10204921
2312 Ga0207665_10078289
2313 Ga0207691_10063332
2314 Ga0207691_10150921
2315 Ga0207711_10114161
2316 Ga0207711_10150353
2317 Ga0207689_10131829
2318 Ga0207689_10182153
2319 Ga0207661_10000538
2320 Ga0207679_10046418
2321 Ga0207679_10209071
2322 Ga0207667_10000028
2323 Ga0207667_10045866
2324 Ga0207667_10263609
2325 Ga0207667_10391715
2326 Ga0207651_10050213
2327 Ga0207668_10096896
2328 Ga0207677_10047677
2329 Ga0207703_10096053
2330 Ga0207703_10237906
2331 Ga0207639_10070306
2332 Ga0207639_10073067
2333 Ga0207678_10027560
2334 Ga0207678_10057818
2335 Ga0207708_10156921
2336 Ga0207648_10079358
2337 Ga0207676_10244279
2338 Ga0207674_10366442
2339 Ga0207675_100046602
2340 Ga0207675_100186611
2341 Ga0207683_10059000
2342 Ga0207683_10061761
2343 Ga0207698_10003809
2344 Ga0207698_10069974
2345 Ga0207698_10198535
2346 Ga0207698_10493658
2347 Ga0209281_1000512
2348 Ga0209389_1000001
2349 Ga0209389_1000010
2350 Ga0209589_1000001
2351 Ga0209589_1000016
2352 Ga0209489_100001
2353 Ga0209489_100016
2354 Ga0209489_110021
2355 Ga0209700_100001
2356 Ga0209700_100007
2357 Ga0209179_1002435
2358 Ga0209282_1002635
2359 Ga0209588_1044125
2360 Ga0209974_10010658
2361 Ga0268266_10003707
2362 Ga0268266_10063457
2363 Ga0268264_10000048
2364 Ga0268264_10014815
2365 Ga0265337_1002039
2366 Ga0265326_10000558
2367 Ga0265319_1004781
2368 Ga0265334_10000665
2369 Ga0265318_10001512
2370 Ga0265323_10000345
2371 Ga0265322_10010782
2372 Ga0265336_10000091
2373 Ga0307517_10000522
2374 Ga0307515_10000178
2375 Ga0307515_10011180
2376 Ga0307515_10043688
2377 Ga0265338_10000094
2378 Ga0311001_1006093
2379 Ga0265324_10001898
2380 Ga0307511_10059359
2381 Ga0314311_1034047
2382 Ga0316181_1099951
2383 Ga0265330_10002898
2384 Ga0265340_10005711
2385 Ga0265339_10035116
2386 Ga0307513_10007700
2387 Ga0307513_10018055
2388 Ga0307513_10211997
2389 Ga0307509_10017893
2390 Ga0307509_10105271
2391 Ga0307408_100000087
2392 Ga0307408_100253548
2393 Ga0307508_10000003
2394 Ga0265314_10038746
2395 Ga0265314_10133948
2396 Ga0307516_10000181
2397 Ga0307516_10007742
2398 Ga0307516_10021070
2399 Ga0307516_10075763
2400 Ga0307413_10199961
2401 Ga0307406_10000960
2402 Ga0307412_10028205
2403 Ga0307412_10100058
2404 Ga0307416_100522012
2405 Ga0307414_10023747
2406 Ga0307414_10028258
2407 Ga0307414_10050876
2408 Ga0307414_10244839
2409 Ga0307411_10004044
2410 Ga0307411_10014765
2411 Ga0307411_10211845
2412 Ga0307510_10019636
2413 Ga0307510_10023745
2414 Ga0307510_10108002
2415 Ga0307510_10158482
2416 Ga0315911_1000002
2417 Ga0316588_1036982
2418 Ga0316587_1002993
2419 Ga0373934_0005394
2420 Ga0373940_0019654
2421 Ga0373951_0030681
2422 Ga0373923_0104101
2423 Ga0373936_0010388
2424 Ga0373939_0000137
2425 Ga0373945_0002690
2426 Ga0373954_0012016
2427 Ga0373957_0056713
2428 Ga0373960_0000875
2429 Ga0373960_0032180
2430 Ga0373943_0037355
2431 Ga0373946_0076568
2432 Ga0373924_0109108
2433 Ga0373931_0000475
2434 Ga0373931_0047581
2435 Ga0373935_0008025
2436 Ga0373935_0042149
2437 Ga0373927_0036503
2438 Ga0373927_0087381
2439 Ga0373933_0103423
2440 Ga0373947_0009434
2441 Ga0373947_0047708
2442 Ga0373947_0053203
2443 Ga0373937_0058036
2444 Ga0373937_0068010
2445 Ga0373937_0135512
2446 Ga0373925_0024373
2447 Ga0373925_0036535
2448 Ga0395899_0031041
2449 Ga0395900_0012199
2450 Ga0395900_0291496
2451 Ga0395900_0311367
2452 Ga0395900_0369845
2453 Ga0395898_0002134
2454 Ga0395898_0006688
2455 Ga0395898_0084747
2456 Ga0395898_0120827
2457 Ga0395898_0133300
2458 Ga0395898_0201205
2459 Ga0395898_0213258
2460 Ga0395905_0005302
2461 Ga0395905_0029147
2462 Ga0395905_0044811
2463 Ga0395905_0051745
2464 Ga0395905_0265694
2465 Ga0436364_0788772
2466 Ga0436364_1504240
2467 Ga0395901_0020552
2468 Ga0395901_0030925
2469 Ga0395901_0118732
2470 Ga0400483_126795
2471 Ga0400483_218802
2472 Ga0436365_0072519
2473 Ga0436365_0340068
2474 Ga0436365_1152325
2475 Ga0436365_1416771
2476 Ga0436365_1784783
2477 Ga0436360_0671955
2478 Ga0436360_1274595
2479 Ga0436361_0351327
2480 Ga0436361_0607915
2481 Ga0436361_0997954
2482 Ga0436361_1200916
2483 Ga0436362_0320951
2484 Ga0439466_0011207
2485 Ga0439466_0013490
2486 Ga0439465_0000696
2487 Ga0439465_0047352
2488 Ga0451807_1217081
2489 Ga0439431_0027595
2490 Ga0439437_000814
2491 Ga0450917_001519
2492 Ga0450888_000366
2493 Ga0450890_000263
2494 Ga0450890_004048
2495 Ga0450891_000524
2496 Ga0450892_001674
2497 Ga0450889_000411
2498 Ga0450918_000966
2499 Ga0450893_0000325
2500 Ga0451577_0000068
2501 Ga0466969_0000006
2502 Ga0466972_0000223
2503 Ga0453683_0060794
2504 Ga0466965_0093537
2505 Ga0466966_0003259
2506 Ga0466961_0000057
2507 Ga0466961_0006649
2508 Ga0466964_0016413
2509 Ga0466964_0021195
2510 Ga0453684_0000126
2511 Ga0453684_0002989
2512 Ga0453684_0091867
2513 Ga0466968_0004560
2514 Ga0466968_0011463
2515 Ga0466970_0038329
2516 Ga0466960_0014675
2517 Ga0466960_0019271
2518 Ga0466960_0052949
2519 Ga0466959_0006458
2520 Ga0466959_0011786
2521 Ga0451576_0012737
2522 Ga0451576_0038144
2523 Ga0451576_0247990
2524 Ga0495603_0000154
2525 Ga0495603_0086554
2526 Ga0495590_0038433
2527 Ga0495629_0000093
2528 Ga0495629_0003355
2529 Ga0495629_0006301
2530 Ga0495629_0048131
2531 Ga0495638_0000961
2532 Ga0495638_0011724
2533 Ga0495638_0025611
2534 Ga0495638_0043109
2535 Ga0495641_0003998
2536 Ga0495641_0110475
2537 Ga0495651_0021206
2538 Ga0495651_0027213
2539 Ga0495651_0090494
2540 Ga0495653_0001714
2541 Ga0495580_0001670
2542 Ga0495580_0016571
2543 Ga0495582_0000010
2544 Ga0495605_0000121
2545 Ga0495639_0000071
2546 Ga0495664_0003905
2547 Ga0495664_0005970
2548 Ga0495664_0046231
2549 Ga0495584_0006864
2550 Ga0495594_0000116
2551 Ga0495607_0002118
2552 Ga0495607_0024270
2553 Ga0495583_0000150
2554 Ga0495606_0000201
2555 Ga0495606_0014543
2556 Ga0495606_0017637
2557 Ga0495608_0003465
2558 Ga0495608_0071873
2559 Ga0495610_0011547
2560 Ga0495610_0043716
2561 Ga0495616_0006237
2562 Ga0495616_0016466
2563 Ga0495628_0000929
2564 Ga0495628_0012592
2565 Ga0495628_0129391
2566 Ga0495630_0000418
2567 Ga0495630_0011159
2568 Ga0495643_0026786
2569 Ga0495644_0000423
2570 Ga0495644_0001030
2571 Ga0495648_0004025
2572 Ga0495648_0077901
2573 Ga0495663_0023783
2574 Ga0495652_0002952
2575 Ga0495652_0011030
2576 Ga0495652_0011959
2577 Ga0495652_0059818
2578 Ga0495654_0000766
2579 Ga0495665_0000667
2580 Ga0495640_0022624
2581 Ga0495640_0079011
2582 Ga0495587_0027187
2583 Ga0495609_0000606
2584 Ga0495621_0086369
2585 Ga0495622_0002831
2586 Ga0495622_0012054
2587 Ga0495622_0037577
2588 Ga0495633_0001660
2589 Ga0495633_0003523
2590 Ga0495667_0012123
2591 Ga0495656_0002603
2592 Ga0495656_0063323
2593 Ga0495668_0068265
2594 Ga0495634_0000234
2595 Ga0495634_0096698
2596 Ga0495634_0117958
2597 Ga0495634_0126814
2598 Ga0495611_0008141
2599 Ga0495625_0000294
2600 Ga0495625_0106458
2601 Ga0495635_0035101
2602 Ga0495635_0044523
2603 Ga0495635_0050991
2604 Ga0495659_0001353
2605 Ga0495588_0027888
2606 Ga0495588_0029182
2607 Ga0495657_0002015
2608 Ga0495657_0033153
2609 Ga0495623_0001689
2610 Ga0495623_0017026
2611 Ga0495646_0075821
2612 Ga0495647_0001855
2613 Ga0495658_0012316
2614 Ga0495669_0073623
2615 Ga0495669_0145799
2616 Ga0495613_0001996
2617 Ga0495613_0004247
2618 Ga0495624_0000183
2619 Ga0495670_0003004
2620 Ga0495649_0009712
2621 Ga0495649_0017146
2622 Ga0495600_0000151
2623 Ga0495600_0028531
2624 Ga0495660_0111004
2625 Ga0495581_0000027
2626 Ga0495581_0010220
2627 Ga0495604_0000753
2628 Ga0495604_0002785
2629 Ga0495604_0087661
2630 Ga0495636_0000857
2631 Ga0495674_0000050
2632 Ga0495674_0010179
2633 Ga0495672_0000864
2634 Ga0495672_0010360
2635 Ga0495672_0010731
2636 Ga0495672_0022707
2637 Ga0495676_0064396
2638 Ga0495676_0073733
2639 Ga0495676_0081762
2640 Ga0495676_0092044
2641 Ga0495676_0096470
2642 Ga0495683_0000903
2643 Ga0495687_000057
2644 Ga0495687_003007
2645 Ga0495675_0034798
2646 Ga0495677_0000232
2647 Ga0495685_000310
2648 Ga0495673_0005301
2649 Ga0495684_0004001
2650 Ga0495684_0128880
2651 Ga0495686_0001619
2652 Ga0495686_0008869
2653 Ga0495686_0028428
2654 Ga0495686_0145518
2655 Ga0495593_0000014
2656 Ga0495593_0029281
2657 Ga0495593_0040884
2658 Ga0495602_0027011
2659 Ga0495602_0123494
2660 Ga0495602_0169153
2661 Ga0495614_0009048
2662 Ga0496100_0060435
2663 Ga0496100_0066674
2664 Ga0496101_0033412
2665 Ga0496101_0077446
2666 Ga0496101_0100457
2667 Ga0496102_0006280
2668 Ga0496102_0010092
2669 Ga0496102_0030892
2670 Ga0496102_0301877
2671 Ga0496103_0053005
2672 Ga0496104_0005472
2673 Ga0496104_0119404
2674 Ga0496104_0119736
2675 Ga0496104_0163249
2676 Ga0496104_0239967
2677 Ga0496105_0003472
2678 Ga0496105_0019879
2679 Ga0496105_0109358
2680 Ga0496105_0366462
2681 Ga0496106_0004614
2682 Ga0496106_0008372
2683 Ga0496106_0268173
2684 Ga0496107_0003403
2685 Ga0496107_0015918
2686 Ga0496107_0073660
2687 Ga0496107_0158388
2688 Ga0496108_0019176
2689 Ga0496108_0033014
2690 Ga0496109_0050080
2691 Ga0496110_0007655
2692 Ga0496110_0010803
2693 Ga0496110_0105397
2694 Ga0496111_0013224
2695 Ga0496111_0044835
2696 Ga0496111_0052347
2697 Ga0496111_0057268
2698 Ga0496112_0000004
2699 Ga0496112_0015093
2700 Ga0496112_0189634
2701 Ga0496113_0069020
2702 Ga0496114_0338989
2703 Ga0496115_0045853
2704 Ga0496115_0198585
2705 Ga0496116_0024957
2706 Ga0496116_0069686
2707 Ga0496117_0000005
2708 Ga0496117_0035133
2709 Ga0496117_0132592
2710 Ga0496118_0000022
2711 Ga0496118_0016427
2712 Ga0496118_0033145
2713 Ga0496118_0138624
2714 Ga0496119_0001100
2715 Ga0496119_0006291
2716 Ga0496119_0013474
2717 Ga0496120_0019305
2718 Ga0496121_0000710
2719 Ga0496121_0004128
2720 Ga0496121_0004801
2721 Ga0496121_0007150
2722 Ga0496121_0009764
2723 Ga0496121_0021033
2724 Ga0496121_0025806
2725 Ga0496121_0040194
2726 Ga0496121_0110799
2727 Ga0496122_0000074
2728 Ga0496122_0000249
2729 Ga0496122_0007646
2730 Ga0496122_0048754
2731 Ga0496122_0049627
2732 Ga0496123_0000062
2733 Ga0496123_0000347
2734 Ga0496123_0000524
2735 Ga0496123_0020386
2736 Ga0496123_0099472
2737 Ga0496124_0003294
2738 Ga0496124_0006546
2739 Ga0496124_0010080
2740 Ga0496124_0013552
2741 Ga0496124_0029377
2742 Ga0496124_0056911
2743 Ga0496124_0078334
2744 Ga0496124_0102060
2745 Ga0496124_0180853
2746 Ga0496125_0000420
2747 Ga0496125_0001362
2748 Ga0496125_0001876
2749 Ga0496126_0008116
2750 Ga0496126_0076749
2751 Ga0495678_004356
2752 Ga0495678_084734
2753 Ga0495682_0001235
2754 Ga0501297_001375
2755 Ga0501299_005402
2756 Ga0501300_002703
2757 Ga0501034_0131647
2758 Ga0501034_0251210
2759 Ga0501037_0098257
2760 Ga0501067_0005558
2761 Ga0501067_0016830
2762 Ga0501199_003121
2763 Ga0501207_002021
2764 Ga0501211_000435
2765 Ga0501222_002800
2766 Ga0501223_004280
2767 Ga0501233_004178
2768 Ga0501235_003132
2769 Ga0501249_007428
2770 Ga0501252_004121
2771 Ga0501258_002004
2772 Ga0501259_021302
2773 Ga0501221_001691
2774 Ga0501232_006040
2775 Ga0501262_001772
2776 Ga0501264_001752
2777 Ga0501267_000820
2778 Ga0501269_007006
2779 Ga0501272_000474
2780 nmdc:mga03683_21433_c1
2781 nmdc:mga03683_2314_c1
2782 nmdc:mga03683_54900_c1
2783 nmdc:mga03n38_134745_c1
2784 nmdc:mga00v17_113_c1
2785 nmdc:mga00v17_19023_c1
2786 nmdc:mga0yw44_1577_c1
2787 nmdc:mga0yw44_51657_c1
2788 nmdc:mga0yw44_76127_c1
2789 nmdc:mga0k408_126925_c1
2790 nmdc:mga0k408_2400_c1
2791 nmdc:mga0k408_2702_c2
2792 nmdc:mga0k408_47710_c1
2793 nmdc:mga0k408_9438_c1
2794 nmdc:mga04h51_49351_c1
2795 nmdc:mga07m45_24542_c1
2796 nmdc:mga07m45_39549_c1
2797 nmdc:mga07m45_51047_c1
2798 nmdc:mga07m45_54051_c1
2799 nmdc:mga08y16_60380_c1
2800 nmdc:mga0n895_207159_c1
2801 nmdc:mga08x19_217491_c1
2802 nmdc:mga0sz30_36903_c1
2803 nmdc:mga0sz30_74014_c1
2804 nmdc:mga0sz30_7745_c1
2805 nmdc:mga0sz30_77827_c1
2806 Ga0495601_0034066
2807 Ga0500610_0009487
2808 Ga0500610_0106582
2809 Ga0495655_0013816
2810 Ga0495619_0132561
2811 Ga0500643_000272
2812 Ga0500643_024625
2813 Ga0500647_0031164
2814 Ga0500647_0080180
2815 Ga0500651_0009826
2816 Ga0500651_0028502
2817 Ga0500566_0000008
2818 Ga0500566_0001356
2819 Ga0500640_002900
2820 Ga0500641_0000812
2821 Ga0500641_0003855
2822 Ga0500650_0064541
2823 Ga0500556_0000022
2824 Ga0500557_000009
2825 Ga0500562_029587
2826 Ga0500572_022404
2827 Ga0500595_008013
2828 Ga0500607_025439
2829 Ga0500607_093591
2830 Ga0500618_000041
2831 Ga0500658_0004502
2832 Ga0500658_0023464
2833 Ga0500568_0000017
2834 Ga0500568_0062324
2835 Ga0500603_000835
2836 Ga0500616_0004990
2837 Ga0500620_035584
2838 Ga0500622_0128845
2839 Ga0500634_0005820
2840 Ga0500639_000126
2841 Ga0500636_0001047
2842 Ga0500636_0020526
2843 Ga0500636_0054464
2844 Ga0500637_0000605
2845 Ga0500596_003379
2846 Ga0500601_000769
2847 Ga0587085_004138
2848 Ga0587072_020051
2849 Ga0587100_001500
2850 Ga0530510_0013723
2851 2507507929
2852 2508542042
2853 2508692414
2854 2508727228
2855 2509077685
2856 2509108089
2857 2509153192
2858 2509376736
2859 2509391708
2860 2509447427
2861 2510134262
2862 2510302692
2863 2510839162
2864 2510895702
2865 2511131864
2866 2511186073
2867 2511199345
2868 2511246268
2869 2511248256
2870 2511384803
2871 2511388626
2872 2511399356
2873 2511497743
2874 2512035836
2875 2512528776
2876 2512969595
2877 2513228466
2878 2513567658
2879 2513577944
2880 2513584598
2881 2513599468
2882 2513607181
2883 2513618425
2884 2513622525
2885 2513631907
2886 2513639359
2887 2513647249
2888 2513653771
2889 2513674495
2890 2513695622
2891 2513700074
2892 2513707944
2893 2513715232
2894 2513856208
2895 2513870155
2896 2513877555
2897 2513883855
2898 2513887602
2899 2513902041
2900 2513908461
2901 2513918111
2902 2513928175
2903 2513988364
2904 2513997610
2905 2514008954
2906 2514009701
2907 2514017986
2908 2515113432
2909 2515612012
2910 2515626829
2911 2515635148
2912 2515645590
2913 2515655026
2914 2515739796
2915 2516206132
2916 2516896606
2917 2517037040
2918 2517077392
2919 2517096154
2920 2517103864
2921 2517407773
2922 2517565527
2923 2517891652
2924 2520376984
2925 2521556910
2926 2523106069
2927 2523466567
2928 2524441825
2929 2524452101
2930 2524458934
2931 2524466010
2932 2524536747
2933 2528853103
2934 2530646475
2935 2535486881
2936 2535517179
2937 2537873851
2938 2548498731
2939 2550697486
2940 2551681464
2941 2551684699
2942 2551692703
2943 2551700299
2944 2551713046
2945 2551718166
2946 2551722867
2947 2551731540
2948 2551737057
2949 2551744385
2950 2553004700
2951 2554248467
2952 2558863900
2953 2559295583
2954 2561467978
2955 2585167519
2956 2585201926
2957 2585225322
2958 2585228603
2959 2585259418
2960 2585265745
2961 2585271425
2962 2585279362
2963 2585323032
2964 2585331146
2965 2585388951
2966 2585395136
2967 2585401036
2968 2585524822
2969 2585531153
2970 2585538501
2971 2585547878
2972 2585552923
2973 2585559168
2974 2585822063
2975 2585836454
2976 2585898550
2977 2585903886
2978 2585996302
2979 2586000914
2980 2587729919
2981 2587733465
2982 2587759868
2983 2587980996
2984 2588294445
2985 2596371702
2986 2599106587
2987 2599332055
2988 2599416935
2989 2599601906
2990 2599620758
2991 2599674057
2992 2599678626
2993 2599690269
2994 2599720420
2995 2600196130
2996 2600373158
2997 2601609840
2998 2601671415
2999 2601746615
3000 2616293052
3001 2616311105
3002 2616554544
3003 2617346531
3004 2617378636
3005 2617385394
3006 2643746753
3007 2643804324
3008 2643814015
3009 2643856506
3010 2643865514
3011 2643920099
3012 2643933564
3013 2643968887
3014 2643992053
3015 2644006962
3016 2644050159
3017 2644063243
3018 2644065095
3019 2644071726
3020 2644105398
3021 2644139808
3022 2644145732
3023 2644161447
3024 2644191738
3025 2644204782
3026 2644221233
3027 2644222298
3028 2644242633
3029 2644245662
3030 2644257004
3031 2644273802
3032 2644296224
3033 2644311375
3034 2644315064
3035 2644324164
3036 2644331226
3037 2644377504
3038 2644400593
3039 2644416767
3040 2644449807
3041 2644465113
3042 2644483080
3043 2644494249
3044 2644497726
3045 2644521722
3046 2644544679
3047 2644617049
3048 2644649461
3049 2644652262
3050 2644672836
3051 2644689941
3052 2645722043
3053 2645724894
3054 2657684902
3055 2671111139
3056 2671118578
3057 2692315229
3058 2719182102
3059 2719386729
3060 2719666467
3061 2719732818
3062 2720492887
3063 2720614351
3064 2720621123
3065 2720632452
3066 2720776174
3067 2721148193
3068 2721159646
3069 2721165029
3070 2721400435
3071 2722841199
3072 2723027771
3073 2723561401
3074 2723568024
3075 2723846870
3076 2724039248
3077 2724045574
3078 2724090781
3079 2724105289
3080 2724111116
3081 2725950334
3082 2728749412
3083 2730108707
3084 2730165337
3085 2730299278
3086 2738720603
3087 2738884194
3088 2739033143
3089 2739246357
3090 2739250250
3091 2739279802
3092 2739348410
3093 2745081281
3094 2753359990
3095 2753463402
3096 2757572104
3097 2758642308
3098 2765469134
3099 2765568105
3100 2766066187
3101 2770196386
3102 2774871391
3103 2776261896
3104 2776268499
3105 2776285420
3106 2778175721
3107 2792581498
3108 2792620529
3109 2792625887
3110 2792638826
3111 2793060839
3112 2793067017
3113 2793080050
3114 2793181672
3115 2793294128
3116 2793318124
3117 2793319481
3118 2793328892
3119 2793334887
3120 2793343024
3121 2793346945
3122 2793351531
3123 2793362463
3124 2793367580
3125 2802716025
3126 2802722951
3127 2802728918
3128 2802735283
3129 2802742112
3130 2802748560
3131 2804752970
3132 2805918435
3133 2805926765
3134 2805932673
3135 2806045282
3136 2806049923
3137 2806056761
3138 2806064143
3139 2806071411
3140 2808983648
3141 2808987684
3142 2809129312
3143 2809149633
3144 2816475428
3145 2818236287
3146 2819542824
3147 2819559299
3148 2819595585
3149 2819601289
3150 2819609431
3151 2819616908
3152 2819641258
3153 2819686925
3154 2819721946
3155 2821128814
3156 2821448518
3157 2824607137
3158 2824616562
3159 2824624519
3160 2824633434
3161 2824642098
3162 2824651772
3163 2824659504
3164 2824669264
3165 2824675697
3166 2824685768
3167 2824693380
3168 2824700399
3169 2824708121
3170 2824721988
3171 2824731830
3172 2824735763
3173 2824751117
3174 2824755742
3175 2824766406
3176 2824774789
3177 2831269305
3178 2835313887
3179 2838020042
3180 2838023542
3181 2838033304
3182 2838041736
3183 2838045279
3184 2838052852
3185 2838055299
3186 2838065110
3187 2838069837
3188 2838079729
3189 2838122931
3190 2838661290
3191 2838674831
3192 2838675530
3193 2838683133
3194 2838686733
3195 2838697923
3196 2838707116
3197 2838711038
3198 2838714411
3199 2838721787
3200 2838725172
3201 2838730309
3202 2838742018
3203 2838742676
3204 2839097602
3205 2839997558
3206 2840770653
3207 2841763053
3208 2841845853
3209 2841848770
3210 2841854561
3211 2841862372
3212 2841867277
3213 2841944787
3214 2841950806
3215 2841959971
3216 2841973743
3217 2841978629
3218 2841988999
3219 2842040383
3220 2842046672
3221 2842079213
3222 2842112953
3223 2842118276
3224 2842125199
3225 2842130425
3226 2842145557
3227 2842151760
3228 2842154405
3229 2842158420
3230 2842170205
3231 2842170654
3232 2842178025
3233 2842182035
3234 2842187520
3235 2842195742
3236 2842199056
3237 2842209501
3238 2842211831
3239 2842218271
3240 2842226549
3241 2842229966
3242 2842240190
3243 2842243855
3244 2842256954
3245 2842258060
3246 2842267763
3247 2842271729
3248 2842282955
3249 2842285299
3250 2842292875
3251 2842298286
3252 2842305362
3253 2842313912
3254 2842319852
3255 2842338120
3256 2842347914
3257 2842360114
3258 2842368411
3259 2842373763
3260 2842379272
3261 2842384787
3262 2842400694
3263 2842402658
3264 2842409970
3265 2842416619
3266 2842423451
3267 2842430407
3268 2842436781
3269 2842443377
3270 2842449247
3271 2842466661
3272 2842471349
3273 2842480031
3274 2842483779
3275 2842493607
3276 2842497758
3277 2842505184
3278 2842514196
3279 2842519156
3280 2842522147
3281 2842679447
3282 2842749771
3283 2842876074
3284 2842924390
3285 2844109077
3286 2844163947
3287 2844319756
3288 2844458030
3289 2844534206
3290 2846958232
3291 2847419714
3292 2847937080
3293 2847947471
3294 2848864714
3295 2848994716
3296 2849078654
3297 2850081738
3298 2851182317
3299 2851251184
3300 2852390570
3301 2852619785
3302 2854901112
3303 2854912654
3304 2854918503
3305 2855828562
3306 2855843687
3307 2855877231
3308 2856748202
3309 2857513054
3310 2857517108
3311 2857534033
3312 2857548748
3313 2858807068
3314 2861524979
3315 2874599034
3316 2874611170
3317 2874617195
3318 2874626668
3319 2874635289
3320 2874650521
3321 2876764288
3322 2876779073
3323 2876810555
3324 2876822677
3325 2879082866
3326 2879083399
3327 2879101546
3328 2879114411
3329 2879133069
3330 2879149356
3331 2881364657
3332 2881672035
3333 2882460195
3334 2884816873
3335 2884839098
3336 2884855389
3337 2885082124
3338 2885197182
3339 2885201640
3340 2885215649
3341 2885369632
3342 2885380980
3343 2885385695
3344 2885418215
3345 2888385182
3346 2888393057
3347 2888425326
3348 2889038335
3349 2889307160
3350 2894233990
3351 2894657281
3352 2894819809
3353 2894821915
3354 2896159104
3355 2896391158
3356 2897808546
3357 2899795555
3358 2899804081
3359 2899848843
3360 2899927364
3361 2903730567
3362 2903753235
3363 2903769435
3364 2904440388
3365 2904450896
3366 2904459601
3367 2904530697
3368 2904549254
3369 2904584067
3370 2904585890
3371 2904592297
3372 2904601567
3373 2904672008
3374 2904697847
3375 2904704617
3376 2904712256
3377 2906609629
3378 2906616826
3379 2906628928
3380 2906642864
3381 2906651228
3382 2906667153
3383 2908742004
3384 2908759671
3385 2908780882
3386 2909043367
3387 2909043368
3388 2913296178
3389 2915653374
3390 2915983690
3391 2915988614
3392 2916000226
3393 2916007332
3394 2916013466
3395 2916020750
3396 2916028092
3397 2916031151
3398 2916041557
3399 2916043674
3400 2916054048
3401 2916057787
3402 2916068327
3403 2916072229
3404 2916082554
3405 2917558064
3406 2917700224
3407 2919049710
3408 2919082781
3409 2919106140
3410 2919114447
3411 2919124967
3412 2919169571
3413 2919174606
3414 2919410295
3415 2919453697
3416 2919462576
3417 2919707682
3418 2920761249
3419 2920825551
3420 2921204321
3421 2921213256
3422 2921243245
3423 2921245727
3424 2921256929
3425 2921258307
3426 2921266558
3427 2921284672
3428 2921290724
3429 2921302630
3430 2922362561
3431 2922372713
3432 2922387635
3433 2922397344
3434 2922431112
3435 2923515528
3436 2923560180
3437 2924148112
3438 2924158264
3439 2924164272
3440 2924168446
3441 2924174834
3442 2924182029
3443 2924188905
3444 2924195755
3445 2924202975
3446 2924210009
3447 2924217082
3448 2924222656
3449 2924231047
3450 2926755462
3451 2926762593
3452 2928042724
3453 2928048849
3454 2928055182
3455 2928068608
3456 2928073484
3457 2928089963
3458 2928118316
3459 2928127961
3460 2928134449
3461 2928525723
3462 2929141100
3463 2929161430
3464 2929521700
3465 2929620529
3466 2929626422
3467 2932415928
3468 2932422059
3469 2932784707
3470 2932795405
3471 2932805936
3472 2932809687
3473 2932818569
3474 2932828475
3475 2933009050
3476 2933014670
3477 2933018561
3478 2933571169
3479 2933582447
3480 2933588990
3481 2933596351
3482 2933600643
3483 2935609572
3484 2935617448
3485 2935639070
3486 2935652277
3487 2935660859
3488 2935666078
3489 2935675726
3490 2935685264
3491 2935694954
3492 2935704077
3493 2935713817
3494 2935724436
3495 2935733206
3496 2935742585
3497 2935751229
3498 2935760247
3499 2935769963
3500 2935782017
3501 2935785795
3502 2935794277
3503 2935802160
3504 2935810983
3505 2935822734
3506 2935828565
3507 2935839941
3508 2935848316
3509 2935856073
3510 2935865983
3511 2935877692
3512 2935883701
3513 2935896692
3514 2935901639
3515 2935909881
3516 2935917605
3517 2935927361
3518 2935936794
3519 2935944903
3520 2935953340
3521 2935961163
3522 2935970180
3523 2935980474
3524 2935986746
3525 2935992636
3526 2936002508
3527 2936014915
3528 2936022104
3529 2936032792
3530 2936037598
3531 2936050656
3532 2936059568
3533 2936371729
3534 2936379564
3535 2936383302
3536 2937001555
3537 2937005563
3538 2937014275
3539 2937019199
3540 2937026133
3541 2937035042
3542 2937036976
3543 2937045917
3544 2937054068
3545 2937056832
3546 2937066107
3547 2937077654
3548 2937084314
3549 2937090716
3550 2937093319
3551 2937105072
3552 2937111497
3553 2937118862
3554 2937120705
3555 2937128967
3556 2940557969
3557 2941504662
3558 2941536797
3559 2941540719
3560 2945914085
3561 2945949633
3562 2945973670
3563 2945990522
3564 2954012188
3565 2954770708
3566 2957381018
3567 2957382980
3568 2957391938
3569 2957401395
3570 2957402968
3571 2957411324
3572 2957418329
3573 2957422836
3574 2957436134
3575 2957442267
3576 2957443904
3577 2957454875
3578 2957464077
3579 2957464860
3580 2957477503
3581 2957480495
3582 2957487062
3583 2957491725
3584 2957498982
3585 2957510118
3586 2960584634
3587 2960596514
3588 2960598432
3589 2960604973
3590 2960613641
3591 2960622155
3592 2960625734
3593 2960634410
3594 2960640714
3595 2960645676
3596 2960658134
3597 2960662778
3598 2960669739
3599 2960680355
3600 2960683362
3601 2960690850
3602 2960695213
3603 2964610797
3604 2964615987
3605 2964624173
3606 2964632532
3607 2964637324
3608 2964644570
3609 2964655591
3610 2964657553
3611 2964666789
3612 2964677164
3613 2964681966
3614 2964685594
3615 2964698597
3616 2964703254
3617 2964711620
3618 2964714032
3619 2964721114
3620 2967669632
3621 2967677051
3622 2967679175
3623 2967692142
3624 2967698837
3625 2967703151
3626 2967708938
3627 2967716962
3628 2967723529
3629 2967728833
3630 2967740676
3631 2967747846
3632 2967750825
3633 2967761853
3634 2967765086
3635 2967772311
3636 2967777579
3637 2970022413
3638 2970032739
3639 2970039035
3640 2970047136
3641 2970053742
3642 2970058637
3643 2970067945
3644 2970071274
3645 2970078400
3646 2970083957
3647 2970090178
3648 2970097376
3649 2970105649
3650 2970109798
3651 2970121545
3652 2970126647
3653 2970135045
3654 2970139154
3655 2970143933
3656 2970154137
3657 2970162925
3658 2970167729
3659 2970176655
3660 2970179505
3661 2970188377
3662 2970194651
3663 2977518823
3664 2977524042
3665 2977524051
3666 2977532684
3667 2977540074
3668 2977547948
3669 2977557359
3670 2977559596
3671 2977570919
3672 2977579247
3673 2977585260
3674 2978971971
3675 2979092097
3676 2979100515
3677 2979104154
3678 2984511276
3679 2984522363
3680 2984541665
3681 2984590255
3682 2984603938
3683 2990712103
3684 2996892738
3685 2996897954
3686 3002145779
3687 3003670717
3688 3003934537
3689 3005414250
3690 3005418884
3691 3005448763
3692 3005454996
3693 3005480931
3694 3005485032
3695 3005507354
3696 3005587322
3697 3005599979
3698 3005715568
3699 3005722899
3700 639649493
3701 643826610
3702 648739888
3703 650740792
3704 8001846645
3705 8003571868
3706 8003996247
3707 8004004004
3708 8005259495
3709 8005281539
3710 8005284504
3711 8005295826
3712 8005303432
3713 8005313913
3714 8005318224
3715 8005327265
3716 8005381238
3717 8005384749
3718 8005395786
3719 8005435579
3720 8005464118
3721 8005488898
3722 8005501207
3723 8005545995
3724 8005561531
3725 8005568309
3726 8005573152
3727 8005622574
3728 8005630076
3729 8005645982
3730 8005672625
3731 8005682589
3732 8005691796
3733 8005697728
3734 8006932435
3735 8006939782
3736 8006969057
3737 8006979551
3738 8006987496
3739 8006994997
3740 8016521035
3741 8016528951
3742 8016534144
3743 8016547377
3744 8016554767
3745 8016572488
3746 8016576654
3747 8016593837
3748 8016600889
3749 8016609586
3750 8016615329
3751 8016625881
3752 8016639461
3753 8017064569
3754 8018127450
3755 8018152415
3756 8018164255
3757 8018179560
3758 8019533921
3759 8019552965
3760 8019565687
3761 8019575778
3762 8019583946
3763 8019591752
3764 8019599584
3765 8019619527
3766 8019633585
3767 8019649074
3768 8019661464
3769 8019671006
3770 8019685188
3771 8023682853
3772 8024486264
3773 8024488342
3774 8024504751
3775 8045866996
3776 8046770531
3777 8049295579
3778 8054005699
3779 8054463211
3780 8055431942
3781 8055431944
3782 8055745391
3783 8056377524
3784 8056387224
3785 8056679574
3786 8056692576
3787 8056877243
3788 8056968769
3789 8057135964
3790 8057533807
3791 8057576659
3792 8057882030

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13407

Peripla_BP_4

Periplasmic binding protein domain

99

376

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
3urm-assembly1.cif.gz_A crystal structure of the periplasmic sugar binding protein chve 0.9764 28 348
4wwh-assembly2.cif.gz_B crystal structure of an abc transporter solute binding protein (ipr025997) from mycobacterium smegmatis (msmeg_1704, target efi-510967) with bound d-galactose 0.9694 29 348
3urm-assembly1.cif.gz_A crystal structure of the periplasmic sugar binding protein chve 0.9501 28 348
4wwh-assembly2.cif.gz_B crystal structure of an abc transporter solute binding protein (ipr025997) from mycobacterium smegmatis (msmeg_1704, target efi-510967) with bound d-galactose 0.9406 29 348
4ys6-assembly1.cif.gz_A crystal structure of an abc transporter solute binding protein (ipr025997) from clostridium phytofermentans (cphy_1585, target efi-511156) with bound beta-d-glucose 0.9316 31 348
ID Description Score Start End Superfamily
4ys6A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.985 31 322 3.40.50.2300
af_P37387_24_127_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9841 30 132 3.40.50.2300
4ys6A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9712 31 322 3.40.50.2300
af_P37387_24_127_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9563 30 132 3.40.50.2300
4ywhB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9556 31 133 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A0J8BFR0-F1-model_v4 Periplasmic binding protein domain-containing protein 0.9725 36 348 GO:0030246
AF-A0A423UPQ3-F1-model_v4 Sugar ABC transporter substrate-binding protein 0.9659 26 348 GO:0030246
GO:0030288
AF-A0A511GUT2-F1-model_v4 deleted 0.9612 19 348
AF-A0A7K0PZR4-F1-model_v4 Substrate-binding domain-containing protein 0.9546 239 347
AF-A0A4Q3HBY6-F1-model_v4 Sugar ABC transporter substrate-binding protein 0.9482 30 115 GO:0030246
GO:0030313

Map