metagRoot

F496033

General Info

Members	Datasets	Scaffolds	Average Seq Length
1908	666	1758	226

Family's Representative Sequence

Representative Sequence	3300046516\|Ga0495628_0161075\|Ga0495628_0161075_332_967
Length	211
Sequence	VLVVEDEDSFSDAISYLLRKEGFEVAVCSTGPDALETFDRTGADLVLLDLMLPGLPGSEVCKSLREKSNVPVIMLTAKDSEIDKVFSSRELVARMRAVLRRRGEPEDTPESALESGPVRMDVDRHVVTVRGGNVQLPLKEFELLQVLLRNADRVLTRMQLIDRVWGADYVGDTKTLDVHIKRLRAKIELDPARPQHIVTVRGLGYKFESAA

Samples

	Sample ID	Description	Type	Environment
1	2506783011	Frankia datiscae Dg1	Isolate	Nodule
2	2527291627	Frankia casuarinae Thr	Isolate	Nodule
3	2527291629	Frankia sp. BMG5.23	Isolate	Nodule
4	2546825537	Frankia sp. CcI6	Isolate	Rhizoplane
5	2547132111	Streptomyces sp. TOR3209	Isolate	Rhizosphere
6	2554235005	Streptomyces violaceusniger SPC6	Isolate	Rhizosphere
7	2576861822	Frankia sp. CeD	Isolate	Nodule
8	2579778521	Frankia torreyi CpI1-S	Isolate	Unclassified
9	2582581312	Streptomyces atratus OK008	Isolate	Rhizosphere
10	2582581313	Streptomyces mirabilis OV308	Isolate	Rhizosphere
11	2582581314	Streptomyces mirabilis YR139	Isolate	Rhizosphere
12	2616644814	Streptomyces mirabilis OK461	Isolate	Rhizosphere
13	2616644941	Streptomyces atratus OK807	Isolate	Rhizosphere
14	2619618881	Frankia sp. ACN1ag	Isolate	Unclassified
15	2619619003	Frankia sp. CpI1-P	Isolate	Nodule
16	2622736605	Geodermatophilus ruber DSM 45317	Isolate	Rhizosphere
17	2626541554	Frankia sp. AvcI.1	Isolate	Nodule
18	2643221548	Streptomyces sp. Root55	Isolate	Unclassified
19	2643221549	Agromyces sp. Root1464	Isolate	Unclassified
20	2643221567	Phycicoccus sp. Root563	Isolate	Unclassified
21	2643221578	Streptomyces sp. Root63	Isolate	Unclassified
22	2643221587	Streptomyces sp. Root66D1	Isolate	Unclassified
23	2643221619	Agromyces sp. Root81	Isolate	Unclassified
24	2643221624	Phycicoccus sp. Root101	Isolate	Unclassified
25	2643221632	Leifsonia sp. Root112D2	Isolate	Unclassified
26	2643221647	Streptomyces sp. Root369	Isolate	Unclassified
27	2643221670	Streptomyces sp. Root431	Isolate	Unclassified
28	2643221673	Streptomyces sp. Root1295	Isolate	Unclassified
29	2643221677	Streptomyces sp. Root1304	Isolate	Unclassified
30	2643221678	Streptomyces sp. Root1310	Isolate	Unclassified
31	2643221679	Angustibacter sp. Root456	Isolate	Unclassified
32	2643221682	Streptomyces sp. Root1319	Isolate	Unclassified
33	2643221711	Terrabacter sp. Root85	Isolate	Unclassified
34	2643221714	Streptomyces sp. Root264	Isolate	Unclassified
35	2684623036	Frankia sp. CgIM4	Isolate	Nodule
36	2731639228	Motilibacter peucedani DSM 45328	Isolate	Rhizosphere
37	2767802112	Streptomyces avicenniae NRRL B-24776	Isolate	Rhizosphere
38	2773857924	Frankia sp. CgIS1	Isolate	Nodule
39	2773857933	Frankia sp. BMG5.30	Isolate	Nodule
40	2784132109	Dermacoccus sp. DS28 SAI-028	Isolate	Unclassified
41	2784132148	Streptomyces sp. E5N91 SAI-083	Isolate	Unclassified
42	2784746763	Streptomyces ossamyceticus SAI-001	Isolate	Unclassified
43	2784746768	Streptomyces griseorubiginosus SAI-142	Isolate	Unclassified
44	2786546132	Streptomyces sp. W SAI-097	Isolate	Unclassified
45	2791355406	Streptomyces rhizosphaericus NRRL B-24304	Isolate	Unclassified
46	2799112218	Motilibacter rhizosphaerae DSM 45622	Isolate	Rhizosphere
47	2802429296	Streptomyces sampsonii KJ40	Isolate	Rhizosphere
48	2808606359	Streptomyces sp. RJA2910	Isolate	Unclassified
49	2808606365	Phycicoccus sp. SLBN-51	Isolate	Unclassified
50	2808606375	Streptomyces sp. SLBN-31	Isolate	Unclassified
51	2808606448	Streptomyces sp. 193411	Isolate	Unclassified
52	2808606700	Arthrobacter agilis UMCV2	Isolate	Rhizosphere
53	2808606982	Streptomyces sp. SLBN-118	Isolate	Unclassified
54	2811994879	Streptomyces sp. 4-17	Isolate	Unclassified
55	2811994882	Terrabacter sp. SLBN-196	Isolate	Unclassified
56	2811994917	Streptomyces sp. SLBN-134	Isolate	Unclassified
57	2816332305	Kocuria rhizophila FDAARGOS_302	Isolate	Rhizosphere
58	2818991318	Humibacillus xanthopallidus SLBN-155	Isolate	Unclassified
59	2818991458	Terrabacter sp. 3211	Isolate	Rhizosphere
60	2818991462	Terrabacter sp. 3264	Isolate	Rhizosphere
61	2818991463	Streptomyces argenteolus 3259	Isolate	Rhizosphere
62	2818991469	Terrabacter lapilli 3265	Isolate	Rhizosphere
63	2852635781	Streptomyces sp. AK010	Isolate	Rhizosphere
64	2856741275	Microbispora triticiradicis NEAU-HRDPA2-9	Isolate	Unclassified
65	2862178590	Streptomyces sp. SDr-06	Isolate	Rhizosphere
66	2862281513	Streptomyces sp. Act143	Isolate	Rhizosphere
67	2862290372	Streptomyces triticagri NEAU-YY421	Isolate	Rhizosphere
68	2862382967	Streptomyces scabiei NRRL B-2795	Isolate	Nodule
69	2862507626	Streptomyces sp. NWU339	Isolate	Unclassified
70	2862574272	Streptomyces sp. AcE210	Isolate	Nodule
71	2862705112	Streptomyces triticirhizae NEAU-YY642	Isolate	Rhizosphere
72	2863404153	Streptomyces scabiei SAI-025 (Annotation) (version 2)	Isolate	Unclassified
73	2867346516	Streptomyces radicis AZ1-7	Isolate	Unclassified
74	2867369537	Streptomyces sp. Z26	Isolate	Unclassified
75	2867428634	Streptomyces sp. RP5T	Isolate	Unclassified
76	2867475112	Streptomyces sp. TM32	Isolate	Unclassified
77	2873151551	Streptomyces silaceus ACCC40021	Isolate	Rhizosphere
78	2873314349	Sphaerisporangium siamense DSM 45784	Isolate	Rhizosphere
79	2875391855	Streptomyces cavourensis 1AS2a	Isolate	Rhizosphere
80	2877676314	Streptomyces griseorubiginosus 3E-1	Isolate	Unclassified
81	2891395885	Microbispora catharanthi CR1-09	Isolate	Unclassified
82	2891554331	Microbispora sp. CL1-1	Isolate	Unclassified
83	2891562705	Microbispora tritici MT50	Isolate	Unclassified
84	2893684298	Kocuria palustris DSM 11925	Isolate	Rhizosphere
85	2905926851	Arthrobacter sedimenti MIC A30	Isolate	Rhizosphere
86	2912715099	Streptomyces sp. Z423-1	Isolate	Rhizosphere
87	2912723979	Streptomyces sp. NEAU-sy36	Isolate	Rhizosphere
88	2912757875	Streptomyces sp. S4.7	Isolate	Rhizosphere
89	2918501144	Streptomyces sp. PvR006	Isolate	Rhizosphere
90	2919446982	Phycicoccus sp. 3266	Isolate	Rhizosphere
91	2919468124	Streptomyces sp. 3330	Isolate	Rhizosphere
92	2935390628	Streptomyces sp. PvR034	Isolate	Rhizosphere
93	2946003308	Arthrobacter agilis W3I6	Isolate	Rhizosphere
94	2946045630	Streptomyces sp. W4I9-2	Isolate	Rhizosphere
95	2946064051	Streptomyces luteogriseus W4I19-1	Isolate	Rhizosphere
96	2946072368	Streptomyces achromogenes W4I19-2	Isolate	Rhizosphere
97	2947224130	Streptomyces afghaniensis W1I20	Isolate	Rhizosphere
98	2954002825	Streptomyces turgidiscabies W2I16	Isolate	Rhizosphere
99	2954380949	Streptomyces ciscaucasicus W1I15	Isolate	Rhizosphere
100	2954673503	Streptomyces sp. SAI-119	Isolate	Rhizosphere
101	2954682443	Streptomyces sp. SAI-149	Isolate	Rhizosphere
102	2954691527	Streptomyces sp. SAI-127	Isolate	Rhizosphere
103	2954701450	Streptomyces sp. SAI-144	Isolate	Rhizosphere
104	2954711539	Streptomyces sp. SAI-090	Isolate	Rhizosphere
105	2954721474	Streptomyces sp. SAI-117	Isolate	Rhizosphere
106	2954731030	Streptomyces sp. SAI-133	Isolate	Rhizosphere
107	2954740390	Streptomyces sp. SAI-041	Isolate	Rhizosphere
108	2954749733	Streptomyces sp. SAI-135	Isolate	Rhizosphere
109	2954759201	Streptomyces sp. SAI-208	Isolate	Rhizosphere
110	2964326757	Planctomonas psychrotolerans J5903	Isolate	Rhizosphere
111	2966598605	Kitasatospora papulosa SLBN-177	Isolate	Rhizosphere
112	2966924647	Frigoribacterium sp. 2355	Isolate	Rhizosphere
113	2990044586	Streptomyces sedi JCM 16909	Isolate	Unclassified
114	2990059506	Streptomyces sp. CAP261	Isolate	Unclassified
115	2990088156	Streptomyces albidus CAP 215	Isolate	Unclassified
116	2997451912	Streptomyces piniterrae jys28	Isolate	Rhizosphere
117	2997600082	Streptomyces coffeae CA1R205	Isolate	Unclassified
118	3002998708	Actinomadura barringtoniae GKU 128	Isolate	Unclassified
119	3006321560	Actinacidiphila epipremni PRB2-1	Isolate	Unclassified
120	3006393351	Streptomyces sp. SID4985	Isolate	Unclassified
121	3006425503	Streptomyces zingiberis PLAI1-29	Isolate	Unclassified
122	3006486233	Streptomyces sp. BR123	Isolate	Rhizosphere
123	3006493962	Streptomyces grisecoloratus TRM S81-3	Isolate	Rhizosphere
124	3300002067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1	Metagenome	Rhizosphere
125	3300002075	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4	Metagenome	Rhizosphere
126	3300003215	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF	Metagenome	Endosphere
127	3300003323	Sugarcane root Sample H1	Metagenome	Unclassified
128	3300003354	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS	Metagenome	Endosphere
129	3300003578	Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only)	Metatranscriptome	Unclassified
130	3300005288	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2)	Metagenome	Rhizosphere
131	3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Metagenome	Rhizosphere
132	3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Metagenome	Rhizosphere
133	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
134	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
135	3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Metagenome	Rhizosphere
136	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
137	3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Metagenome	Rhizosphere
138	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
139	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
140	3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Metagenome	Rhizosphere
141	3300005341	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG	Metagenome	Rhizosphere
142	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
143	3300005345	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG	Metagenome	Rhizosphere
144	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
145	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
146	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
147	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
148	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
149	3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Metagenome	Rhizosphere
150	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
151	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
152	3300005406	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG	Metagenome	Rhizosphere
153	3300005434	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG	Metagenome	Rhizosphere
154	3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Metagenome	Rhizosphere
155	3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Metagenome	Rhizosphere
156	3300005437	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG	Metagenome	Rhizosphere
157	3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Metagenome	Rhizosphere
158	3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Metagenome	Rhizosphere
159	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
160	3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Metagenome	Rhizosphere
161	3300005445	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG	Metagenome	Rhizosphere
162	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
163	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
164	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
165	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
166	3300005466	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG	Metagenome	Rhizosphere
167	3300005467	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG	Metagenome	Rhizosphere
168	3300005468	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG	Metagenome	Rhizosphere
169	3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Metagenome	Rhizosphere
170	3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Metagenome	Rhizosphere
171	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
172	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
173	3300005536	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG	Metagenome	Rhizosphere
174	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
175	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
176	3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Metagenome	Rhizosphere
177	3300005545	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG	Metagenome	Rhizosphere
178	3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Metagenome	Rhizosphere
179	3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Metagenome	Rhizosphere
180	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
181	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
182	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
183	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
184	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
185	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
186	3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Metagenome	Rhizosphere
187	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
188	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
189	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
190	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
191	3300005840	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2	Metagenome	Rhizosphere
192	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
193	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
194	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
195	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
196	3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
197	3300005983	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1	Metagenome	Rhizosphere
198	3300005985	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
199	3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Metagenome	Rhizosphere
200	3300006038	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Metagenome	Endosphere
201	3300006042	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3	Metagenome	Endosphere
202	3300006048	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3	Metagenome	Endosphere
203	3300006163	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG	Metagenome	Rhizosphere
204	3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Metagenome	Rhizosphere
205	3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Metagenome	Rhizosphere
206	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
207	3300006353	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5	Metagenome	Endosphere
208	3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Metagenome	Rhizosphere
209	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
210	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
211	3300006852	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Metagenome	Rhizosphere
212	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
213	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
214	3300006914	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5	Metagenome	Rhizosphere
215	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
216	3300007076	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Metagenome	Rhizosphere
217	3300009011	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG	Metagenome	Rhizosphere
218	3300009036	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG	Metagenome	Rhizosphere
219	3300009092	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG	Metagenome	Rhizosphere
220	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
221	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
222	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
223	3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Metagenome	Rhizosphere
224	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
225	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
226	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
227	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
228	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
229	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
230	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
231	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
232	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
233	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
234	3300012498	Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410	Metagenome	Rhizosphere
235	3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Metagenome	Rhizosphere
236	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
237	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
238	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
239	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
240	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
241	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
242	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
243	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
244	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
245	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
246	3300014497	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG	Metagenome	Rhizosphere
247	3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Metagenome	Rhizosphere
248	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
249	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
250	3300015262	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG	Metagenome	Rhizosphere
251	3300015688	Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01	Metagenome	Rhizosphere
252	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
253	3300020069	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
254	3300020070	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
255	3300020076	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3)	Metatranscriptome	Rhizosphere
256	3300020081	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
257	3300020082	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
258	3300021377	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7	Metagenome	Unclassified
259	3300021388	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8	Metagenome	Unclassified
260	3300022467	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
261	3300025297	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2)	Metagenome	Endosphere
262	3300025302	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2)	Metagenome	Endosphere
263	3300025711	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
264	3300025735	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
265	3300025885	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
266	3300025898	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
267	3300025900	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
268	3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2)	Metagenome	Rhizosphere
269	3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
270	3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2)	Metagenome	Rhizosphere
271	3300025905	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
272	3300025906	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
273	3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
274	3300025908	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
275	3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
276	3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
277	3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
278	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
279	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
280	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
281	3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
282	3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
283	3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
284	3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
285	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
286	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
287	3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
288	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
289	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
290	3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
291	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
292	3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
293	3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
294	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
295	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
296	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
297	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
298	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
299	3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
300	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
301	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
302	3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
303	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
304	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
305	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
306	3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
307	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
308	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
309	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
310	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
311	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
312	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
313	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
314	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
315	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
316	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
317	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
318	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
319	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
320	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
321	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
322	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
323	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
324	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
325	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
326	3300027312	Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2)	Metagenome	Rhizosphere
327	3300027512	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2)	Metagenome	Rhizosphere
328	3300027666	Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2)	Metagenome	Nodule
329	3300027907	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3)	Metagenome	Rhizosphere
330	3300028023	Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5	Metagenome	Rhizosphere
331	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
332	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
333	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
334	3300028556	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG	Metagenome	Rhizosphere
335	3300028558	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG	Metagenome	Rhizosphere
336	3300028563	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG	Metagenome	Rhizosphere
337	3300028573	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG	Metagenome	Rhizosphere
338	3300028577	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG	Metagenome	Rhizosphere
339	3300028653	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG	Metagenome	Rhizosphere
340	3300028654	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG	Metagenome	Rhizosphere
341	3300028666	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG	Metagenome	Rhizosphere
342	3300028786	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM	Metagenome	Unclassified
343	3300028794	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM	Metagenome	Unclassified
344	3300028800	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG	Metagenome	Rhizosphere
345	3300029957	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG	Metagenome	Rhizosphere
346	3300030500	Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3)	Metagenome	Rhizosphere
347	3300030521	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM	Metagenome	Unclassified
348	3300030522	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM	Metagenome	Unclassified
349	3300030863	Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU2 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
350	3300031238	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG	Metagenome	Rhizosphere
351	3300031240	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG	Metagenome	Rhizosphere
352	3300031241	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG	Metagenome	Rhizosphere
353	3300031247	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG	Metagenome	Rhizosphere
354	3300031249	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG	Metagenome	Rhizosphere
355	3300031344	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG	Metagenome	Rhizosphere
356	3300031456	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM	Metagenome	Unclassified
357	3300031507	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM	Metagenome	Unclassified
358	3300031616	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM	Metagenome	Unclassified
359	3300031649	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM	Metagenome	Unclassified
360	3300031691	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA	Metagenome	Rhizosphere
361	3300031711	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG	Metagenome	Rhizosphere
362	3300031712	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG	Metagenome	Rhizosphere
363	3300031727	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5	Metagenome	Rhizosphere
364	3300031728	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC	Metagenome	Rhizosphere
365	3300031730	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM	Metagenome	Unclassified
366	3300031733	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1	Metagenome	Rhizosphere
367	3300031852	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3	Metagenome	Rhizosphere
368	3300031901	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2	Metagenome	Rhizosphere
369	3300031903	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1	Metagenome	Rhizosphere
370	3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Metagenome	Rhizosphere
371	3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Metagenome	Rhizosphere
372	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
373	3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Metagenome	Rhizosphere
374	3300032126	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2	Metagenome	Rhizosphere
375	3300032133	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA	Metagenome	Rhizosphere
376	3300032139	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB	Metagenome	Rhizosphere
377	3300033179	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM	Metagenome	Unclassified
378	3300033180	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM	Metagenome	Unclassified
379	3300033545	Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4	Metagenome	Unclassified
380	3300034816	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3	Metagenome	Rhizosphere
381	3300034820	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2	Metagenome	Rhizosphere
382	3300034957	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2	Metagenome	Rhizosphere
383	3300035083	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17	Metagenome	Rhizosphere
384	3300035086	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4	Metagenome	Rhizosphere
385	3300035088	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4	Metagenome	Rhizosphere
386	3300035089	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2	Metagenome	Rhizosphere
387	3300035090	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2	Metagenome	Rhizosphere
388	3300035091	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4	Metagenome	Rhizosphere
389	3300035092	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11	Metagenome	Rhizosphere
390	3300035111	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11	Metagenome	Rhizosphere
391	3300035112	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16	Metagenome	Rhizosphere
392	3300035113	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12	Metagenome	Rhizosphere
393	3300035114	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3	Metagenome	Rhizosphere
394	3300035115	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11	Metagenome	Rhizosphere
395	3300035116	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3	Metagenome	Rhizosphere
396	3300035117	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1	Metagenome	Rhizosphere
397	3300035118	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2	Metagenome	Rhizosphere
398	3300035119	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4	Metagenome	Rhizosphere
399	3300035120	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5	Metagenome	Rhizosphere
400	3300035121	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3	Metagenome	Rhizosphere
401	3300035170	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1	Metagenome	Rhizosphere
402	3300035171	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4	Metagenome	Rhizosphere
403	3300035172	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3	Metagenome	Rhizosphere
404	3300035207	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16	Metagenome	Rhizosphere
405	3300035242	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11	Metagenome	Rhizosphere
406	3300035398	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1	Metagenome	Rhizosphere
407	3300035410	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12	Metagenome	Rhizosphere
408	3300035691	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4	Metagenome	Rhizosphere
409	3300035692	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11	Metagenome	Rhizosphere
410	3300035695	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19	Metagenome	Rhizosphere
411	3300035724	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1	Metagenome	Rhizosphere
412	3300035725	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8	Metagenome	Rhizosphere
413	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
414	3300036647	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA	Metagenome	Rhizosphere
415	3300036712	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA	Metagenome	Rhizosphere
416	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
417	3300037312	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2	Metagenome	Rhizosphere
418	3300037418	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3	Metagenome	Rhizosphere
419	3300037466	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1	Metagenome	Rhizosphere
420	3300037853	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2	Metagenome	Unclassified
421	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
422	3300039437	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2	Metagenome	Unclassified
423	3300039438	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2	Metagenome	Rhizosphere
424	3300039450	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2	Metagenome	Unclassified
425	3300039453	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2	Metagenome	Rhizosphere
426	3300041404	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272	Metagenome	Rhizosphere
427	3300041406	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284	Metagenome	Rhizosphere
428	3300041411	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708	Metagenome	Rhizosphere
429	3300041443	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG	Metagenome	Rhizoplane
430	3300041452	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG	Metagenome	Rhizoplane
431	3300041491	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG	Metagenome	Unclassified
432	3300041494	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG	Metagenome	Unclassified
433	3300041999	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297	Metagenome	Rhizosphere
434	3300042005	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216	Metagenome	Rhizosphere
435	3300042007	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290	Metagenome	Rhizosphere
436	3300042014	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275	Metagenome	Rhizosphere
437	3300042015	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287	Metagenome	Rhizosphere
438	3300042126	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87	Metagenome	Rhizosphere
439	3300042127	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91	Metagenome	Rhizosphere
440	3300042128	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123	Metagenome	Rhizosphere
441	3300042131	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130	Metagenome	Rhizosphere
442	3300042132	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133	Metagenome	Rhizosphere
443	3300042133	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134	Metagenome	Rhizosphere
444	3300042134	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126	Metagenome	Rhizosphere
445	3300042136	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294	Metagenome	Rhizosphere
446	3300042137	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519	Metagenome	Rhizosphere
447	3300042138	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379	Metagenome	Rhizosphere
448	3300042145	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581	Metagenome	Rhizosphere
449	3300042157	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210	Metagenome	Rhizosphere
450	3300042184	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630	Metagenome	Rhizosphere
451	3300042461	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366	Metagenome	Rhizosphere
452	3300044656	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R	Metagenome	Rhizosphere
453	3300044658	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R	Metagenome	Rhizosphere
454	3300044683	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R	Metagenome	Rhizosphere
455	3300044684	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R	Metagenome	Rhizosphere
456	3300044693	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R	Metagenome	Rhizosphere
457	3300044694	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R	Metagenome	Rhizosphere
458	3300044706	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R	Metagenome	Rhizosphere
459	3300044719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R	Metagenome	Rhizosphere
460	3300044765	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R	Metagenome	Rhizosphere
461	3300044842	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R	Metagenome	Rhizosphere
462	3300044901	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R	Metagenome	Rhizosphere
463	3300045049	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R	Metagenome	Rhizosphere
464	3300045836	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R	Metagenome	Rhizosphere
465	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
466	3300046452	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere	Metagenome	Rhizosphere
467	3300046453	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere	Metagenome	Rhizosphere
468	3300046454	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere	Metagenome	Rhizosphere
469	3300046455	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere	Metagenome	Rhizosphere
470	3300046457	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere	Metagenome	Rhizosphere
471	3300046459	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere	Metagenome	Rhizosphere
472	3300046460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere	Metagenome	Rhizosphere
473	3300046461	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere	Metagenome	Rhizosphere
474	3300046462	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere	Metagenome	Rhizosphere
475	3300046463	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere	Metagenome	Rhizosphere
476	3300046472	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere	Metagenome	Rhizosphere
477	3300046473	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere	Metagenome	Rhizosphere
478	3300046474	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere	Metagenome	Rhizosphere
479	3300046475	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere	Metagenome	Rhizosphere
480	3300046476	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere	Metagenome	Rhizosphere
481	3300046477	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere	Metagenome	Rhizosphere
482	3300046492	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere	Metagenome	Rhizosphere
483	3300046499	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere	Metagenome	Rhizosphere
484	3300046500	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere	Metagenome	Rhizosphere
485	3300046501	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere	Metagenome	Rhizosphere
486	3300046507	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere	Metagenome	Rhizosphere
487	3300046511	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere	Metagenome	Rhizosphere
488	3300046512	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere	Metagenome	Rhizosphere
489	3300046513	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere	Metagenome	Rhizosphere
490	3300046514	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere	Metagenome	Rhizosphere
491	3300046515	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere	Metagenome	Rhizosphere
492	3300046516	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere	Metagenome	Rhizosphere
493	3300046517	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere	Metagenome	Rhizosphere
494	3300046518	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere	Metagenome	Rhizosphere
495	3300046520	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere	Metagenome	Rhizosphere
496	3300046522	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere	Metagenome	Rhizosphere
497	3300046524	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere	Metagenome	Rhizosphere
498	3300046526	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere	Metagenome	Rhizosphere
499	3300046528	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere	Metagenome	Rhizosphere
500	3300046529	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere	Metagenome	Rhizosphere
501	3300046530	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere	Metagenome	Rhizosphere
502	3300046531	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere	Metagenome	Rhizosphere
503	3300046533	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere	Metagenome	Rhizosphere
504	3300046535	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere	Metagenome	Rhizosphere
505	3300046536	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere	Metagenome	Rhizosphere
506	3300046538	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere	Metagenome	Rhizosphere
507	3300046542	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere	Metagenome	Rhizosphere
508	3300046543	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere	Metagenome	Rhizosphere
509	3300046557	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere	Metagenome	Rhizosphere
510	3300046558	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere	Metagenome	Rhizosphere
511	3300046559	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere	Metagenome	Rhizosphere
512	3300046642	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere	Metagenome	Rhizosphere
513	3300046648	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere	Metagenome	Rhizosphere
514	3300046660	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere	Metagenome	Rhizosphere
515	3300046663	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere	Metagenome	Rhizosphere
516	3300046664	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere	Metagenome	Rhizosphere
517	3300046665	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere	Metagenome	Rhizosphere
518	3300046674	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere	Metagenome	Rhizosphere
519	3300046675	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere	Metagenome	Rhizosphere
520	3300046678	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere	Metagenome	Rhizosphere
521	3300046679	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere	Metagenome	Rhizosphere
522	3300046680	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere	Metagenome	Rhizosphere
523	3300046681	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere	Metagenome	Rhizosphere
524	3300046683	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere	Metagenome	Rhizosphere
525	3300046689	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere	Metagenome	Rhizosphere
526	3300046690	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere	Metagenome	Rhizosphere
527	3300046691	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere	Metagenome	Rhizosphere
528	3300046692	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere	Metagenome	Rhizosphere
529	3300046694	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere	Metagenome	Rhizosphere
530	3300046794	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere	Metagenome	Rhizosphere
531	3300046809	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere	Metagenome	Rhizosphere
532	3300046810	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere	Metagenome	Rhizosphere
533	3300047315	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere	Metagenome	Rhizosphere
534	3300047317	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere	Metagenome	Rhizosphere
535	3300047318	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere	Metagenome	Rhizosphere
536	3300047319	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere	Metagenome	Rhizosphere
537	3300047320	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere	Metagenome	Rhizosphere
538	3300047321	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere	Metagenome	Rhizosphere
539	3300047322	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere	Metagenome	Rhizosphere
540	3300047443	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere	Metagenome	Rhizosphere
541	3300047444	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere	Metagenome	Rhizosphere
542	3300047445	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere	Metagenome	Rhizosphere
543	3300047447	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere	Metagenome	Rhizosphere
544	3300047470	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere	Metagenome	Rhizosphere
545	3300047471	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere	Metagenome	Rhizosphere
546	3300047472	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere	Metagenome	Rhizosphere
547	3300047673	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere	Metagenome	Rhizosphere
548	3300048088	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere	Metagenome	Rhizosphere
549	3300048089	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere	Metagenome	Rhizosphere
550	3300048090	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere	Metagenome	Rhizosphere
551	3300048091	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere	Metagenome	Rhizosphere
552	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
553	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
554	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
555	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
556	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
557	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
558	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
559	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
560	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
561	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
562	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
563	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
564	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
565	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
566	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
567	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
568	3300048922	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15	Metagenome	Unclassified
569	3300048923	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15	Metagenome	Unclassified
570	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
571	3300048928	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15	Metagenome	Unclassified
572	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
573	3300049459	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere	Metagenome	Rhizosphere
574	3300049460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere	Metagenome	Rhizosphere
575	3300049568	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01	Metagenome	Rhizosphere
576	3300049569	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02	Metagenome	Rhizosphere
577	3300049570	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03	Metagenome	Rhizosphere
578	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
579	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
580	3300049573	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01	Metagenome	Rhizosphere
581	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
582	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
583	3300049576	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01	Metagenome	Rhizosphere
584	3300049577	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02	Metagenome	Rhizosphere
585	3300049578	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03	Metagenome	Rhizosphere
586	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
587	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
588	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
589	3300049582	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03	Metagenome	Rhizosphere
590	3300049583	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01	Metagenome	Rhizosphere
591	3300049584	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02	Metagenome	Rhizosphere
592	3300049585	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03	Metagenome	Rhizosphere
593	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
594	3300049587	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02	Metagenome	Rhizosphere
595	3300049588	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03	Metagenome	Rhizosphere
596	3300049589	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01	Metagenome	Rhizosphere
597	3300049590	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02	Metagenome	Rhizosphere
598	3300049591	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03	Metagenome	Rhizosphere
599	3300049592	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01	Metagenome	Rhizosphere
600	3300049593	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02	Metagenome	Rhizosphere
601	3300049741	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01	Metagenome	Rhizosphere
602	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
603	3300049743	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03	Metagenome	Rhizosphere
604	3300049744	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02	Metagenome	Rhizosphere
605	3300049767	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought	Metagenome	Rhizosphere
606	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
607	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
608	3300049824	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03	Metagenome	Rhizosphere
609	3300050490	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation	Metagenome	Endosphere
610	3300050492	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation	Metagenome	Endosphere
611	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
612	3300050510	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation	Metagenome	Rhizosphere
613	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
614	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
615	3300050513	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation	Metagenome	Rhizosphere
616	3300050514	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation	Metagenome	Rhizosphere
617	3300050515	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation	Metagenome	Rhizosphere
618	3300053077	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere	Metagenome	Rhizosphere
619	3300053078	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere	Metagenome	Rhizosphere
620	3300053083	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere	Metagenome	Rhizosphere
621	3300053084	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere	Metagenome	Rhizosphere
622	3300053085	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere	Metagenome	Rhizosphere
623	3300053086	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere	Metagenome	Endosphere
624	3300053092	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere	Metagenome	Endosphere
625	3300053099	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere	Metagenome	Endosphere
626	3300053106	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 endosphere	Metagenome	Endosphere
627	3300053107	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere	Metagenome	Endosphere
628	3300053131	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere	Metagenome	Endosphere
629	3300053134	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere	Metagenome	Endosphere
630	3300053139	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere	Metagenome	Endosphere
631	3300053140	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere	Metagenome	Endosphere
632	3300053149	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere	Metagenome	Endosphere
633	3300053153	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere	Metagenome	Endosphere
634	3300053157	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere	Metagenome	Endosphere
635	3300053161	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere	Metagenome	Endosphere
636	3300053732	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere	Metagenome	Endosphere
637	3300054114	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03	Metagenome	Rhizosphere
638	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere
639	3300061719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1	Metagenome	Rhizosphere
640	3300061734	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2)	Metagenome	Rhizosphere
641	637000116	Frankia casuarinae CcI3	Isolate	Nodule
642	8008485437	Streptomyces mimosae 3MP-10	Isolate	Unclassified
643	8008558824	Streptomyces scabiei NRRL B-2795	Isolate	Nodule
644	8008574985	Streptomyces sp. Jing01	Isolate	Rhizosphere
645	8023623736	Streptomyces sp. 111WW2	Isolate	Unclassified
646	8025478263	Streptomyces telluris AA8	Isolate	Rhizosphere
647	8025524527	Streptomyces sp. 3MP-14	Isolate	Unclassified
648	8025530807	Streptomyces sp. 4R-3d	Isolate	Unclassified
649	8033684223	Streptomyces phytophilus PIP175	Isolate	Unclassified
650	8047893842	Streptomyces cangkringensis DSM 41769	Isolate	Rhizosphere
651	8048127548	Streptomyces samsunensis DSM 42010	Isolate	Rhizosphere
652	8048356638	Streptomyces rhizosphaericus DSM 41760	Isolate	Rhizosphere
653	8048369669	Streptomyces indonesiensis DSM 41759	Isolate	Rhizoplane
654	8048379754	Streptomyces asiaticus DSM 41761	Isolate	Rhizosphere
655	8048406513	Streptomyces heilongjiangensis NEAU-W2	Isolate	Unclassified
656	8053945823	Actinomadura terrae OS3-83	Isolate	Rhizosphere
657	8054160619	Streptomyces rhizoryzae RS10V-4	Isolate	Rhizosphere
658	8054913762	Frankia gtarii Agncl-10	Isolate	Nodule
659	8054920844	Frankia tisae Agncl-8	Isolate	Nodule
660	8055066027	Sphaerisporangium corydalis NEAU-YHS15	Isolate	Unclassified
661	8055157932	Frankia umida Ag45/Mut15	Isolate	Nodule
662	8055172936	Sphaerisporangium perillae NEAU-ZS1	Isolate	Unclassified
663	8056060235	Nocardiopsis endophytica RSe5-2	Isolate	Unclassified
664	8056447290	Streptomyces huiliensis SCA2-4	Isolate	Rhizosphere
665	8056667051	Streptomyces sichuanensis SCA3-4	Isolate	Rhizosphere
666	8056829672	Streptomyces barringtoniae JA03	Isolate	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	91.25
Metatranscriptomes	0.94
Isolates	7.81

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	1.57
Nodule	0.89
Rhizoplane	7.02
Rhizosphere	83.28
Stem	0
Stem Tuber	0
Unclassified	7.23

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	JGI24735J21928_10011146	3300002067	Bacteria	2855
2	JGI24738J21930_10011186	3300002075	Bacteria	1978
3	JGI25153J46596_10032512	3300003215	Bacteria	1739
4	rootH1_10002967	3300003323	Bacteria	2103
5	JGI25160J50197_1016566	3300003354	Bacteria	2371
6	Ga0006562J51391_1011721	3300003578	Bacteria	3437
7	Ga0006562J51391_1011722	3300003578	Bacteria	3240
8	Ga0006562J51391_1056397	3300003578	Bacteria	2982
9	Ga0006562J51391_1071703	3300003578	Bacteria	1630
10	Ga0006562J51391_1071704	3300003578	Bacteria	2500
11	Ga0065714_10006949	3300005288	Bacteria	4902
12	Ga0070658_10001387	3300005327	Bacteria	20694
13	Ga0070658_10184078	3300005327	Bacteria	1758
14	Ga0070658_10250538	3300005327	Bacteria	1502
15	Ga0070676_10072473	3300005328	Bacteria	2071
16	Ga0070683_100166867	3300005329	Bacteria	2089
17	Ga0070683_100348384	3300005329	Bacteria	1410
18	Ga0068869_100036149	3300005334	Bacteria	3506
19	Ga0068869_100364963	3300005334	Bacteria	1180
20	Ga0070666_10007558	3300005335	Bacteria	6702
21	Ga0070666_10061196	3300005335	Bacteria	2549
22	Ga0070666_10136575	3300005335	Bacteria	1706
23	Ga0070680_100013093	3300005336	Bacteria	6456
24	Ga0070680_100035119	3300005336	Bacteria	4046
25	Ga0070680_100337751	3300005336	Bacteria	1280
26	Ga0070682_100005056	3300005337	Bacteria	7328
27	Ga0068868_100067018	3300005338	Bacteria	2856
28	Ga0070660_100038049	3300005339	Bacteria	3650
29	Ga0070660_100084706	3300005339	Bacteria	2492
30	Ga0070660_100559084	3300005339	Bacteria	955
31	Ga0070689_100028136	3300005340	Bacteria	4246
32	Ga0070691_10014121	3300005341	Bacteria	3661
33	Ga0070691_10017039	3300005341	Bacteria	3343
34	Ga0070661_100228940	3300005344	Bacteria	1428
35	Ga0070661_100560851	3300005344	Bacteria	920
36	Ga0070692_10021193	3300005345	Bacteria	3159
37	Ga0070692_10170923	3300005345	Bacteria	1253
38	Ga0070668_100022918	3300005347	Bacteria	4721
39	Ga0070668_100046575	3300005347	Bacteria	3330
40	Ga0070668_100067218	3300005347	Bacteria	2784
41	Ga0070675_100221788	3300005354	Bacteria	1647
42	Ga0070675_100300602	3300005354	Bacteria	1414
43	Ga0070671_100014896	3300005355	Bacteria	6282
44	Ga0070671_100132739	3300005355	Bacteria	2098
45	Ga0070674_100201836	3300005356	Bacteria	1536
46	Ga0070674_100228758	3300005356	Bacteria	1450
47	Ga0070673_100059069	3300005364	Bacteria	3035
48	Ga0070673_100066970	3300005364	Bacteria	2870
49	Ga0070673_100274444	3300005364	Bacteria	1477
50	Ga0070688_100080165	3300005365	Bacteria	2111
51	Ga0070659_100051008	3300005366	Bacteria	3252
52	Ga0070667_100018998	3300005367	Bacteria	5698
53	Ga0070667_100349927	3300005367	Bacteria	1337
54	Ga0070703_10017010	3300005406	Bacteria	2093
55	Ga0070709_10000220	3300005434	Bacteria	37035
56	Ga0070709_10003796	3300005434	Bacteria	8125
57	Ga0070709_10026469	3300005434	Bacteria	3438
58	Ga0070709_10093584	3300005434	Bacteria	1987
59	Ga0070714_100000010	3300005435	Bacteria	262871
60	Ga0070714_100001618	3300005435	Bacteria	16378
61	Ga0070714_100012670	3300005435	Bacteria	6735
62	Ga0070714_100044829	3300005435	Bacteria	3745
63	Ga0070714_100053229	3300005435	Bacteria	3454
64	Ga0070714_100070235	3300005435	Bacteria	3027
65	Ga0070714_100077141	3300005435	Bacteria	2894
66	Ga0070714_100136718	3300005435	Bacteria	2196
67	Ga0070714_100325816	3300005435	Bacteria	1437
68	Ga0070714_100489764	3300005435	Bacteria	1171
69	Ga0070714_100805068	3300005435	Bacteria	910
70	Ga0070713_100002276	3300005436	Bacteria	12477
71	Ga0070713_100033632	3300005436	Bacteria	4109
72	Ga0070713_100040074	3300005436	Bacteria	3806
73	Ga0070713_100059945	3300005436	Bacteria	3180
74	Ga0070713_100124310	3300005436	Bacteria	2267
75	Ga0070713_100154448	3300005436	Bacteria	2044
76	Ga0070713_100234602	3300005436	Bacteria	1669
77	Ga0070713_100263889	3300005436	Bacteria	1575
78	Ga0070710_10000122	3300005437	Bacteria	36506
79	Ga0070710_10002549	3300005437	Bacteria	8642
80	Ga0070710_10005500	3300005437	Bacteria	6022
81	Ga0070710_10024969	3300005437	Bacteria	3159
82	Ga0070710_10041832	3300005437	Bacteria	2531
83	Ga0070710_10071555	3300005437	Bacteria	2000
84	Ga0070710_10117994	3300005437	Bacteria	1602
85	Ga0070711_100000421	3300005439	Bacteria	21991
86	Ga0070711_100023470	3300005439	Bacteria	4012
87	Ga0070711_100052212	3300005439	Bacteria	2812
88	Ga0070711_100426264	3300005439	Bacteria	1082
89	Ga0070711_100484054	3300005439	Bacteria	1018
90	Ga0070711_100682168	3300005439	Bacteria	864
91	Ga0070705_100003344	3300005440	Bacteria	7872
92	Ga0070700_100000064	3300005441	Bacteria	78318
93	Ga0070694_100173076	3300005444	Bacteria	1592
94	Ga0070708_100026861	3300005445	Bacteria	4932
95	Ga0070708_100043452	3300005445	Bacteria	3949
96	Ga0070708_100104614	3300005445	Bacteria	2596
97	Ga0070708_100132463	3300005445	Bacteria	2308
98	Ga0070708_100364242	3300005445	Bacteria	1362
99	Ga0070708_100366596	3300005445	Bacteria	1358
100	Ga0070708_101081058	3300005445	Bacteria	751
101	Ga0070663_100063514	3300005455	Bacteria	2666
102	Ga0070663_100155171	3300005455	Bacteria	1758
103	Ga0070678_100010423	3300005456	Bacteria	5677
104	Ga0070678_100030918	3300005456	Bacteria	3687
105	Ga0070678_100139558	3300005456	Bacteria	1937
106	Ga0070681_10014130	3300005458	Bacteria	7946
107	Ga0070681_10318200	3300005458	Bacteria	1465
108	Ga0070681_10396346	3300005458	Bacteria	1291
109	Ga0068867_100151666	3300005459	Bacteria	1821
110	Ga0068867_100702227	3300005459	Bacteria	893
111	Ga0070685_10173891	3300005466	Bacteria	1382
112	Ga0070685_10215640	3300005466	Bacteria	1255
113	Ga0070706_100004020	3300005467	Bacteria	14287
114	Ga0070706_100005122	3300005467	Bacteria	12505
115	Ga0070706_100005997	3300005467	Bacteria	11485
116	Ga0070706_100008150	3300005467	Bacteria	9773
117	Ga0070706_100009991	3300005467	Bacteria	8813
118	Ga0070706_100021245	3300005467	Bacteria	5979
119	Ga0070706_100026563	3300005467	Bacteria	5326
120	Ga0070706_100064829	3300005467	Bacteria	3377
121	Ga0070706_100106943	3300005467	Bacteria	2602
122	Ga0070706_100125381	3300005467	Bacteria	2394
123	Ga0070706_100276953	3300005467	Bacteria	1566
124	Ga0070707_100000293	3300005468	Bacteria	49051
125	Ga0070707_100003142	3300005468	Bacteria	15629
126	Ga0070707_100005742	3300005468	Bacteria	11572
127	Ga0070707_100015007	3300005468	Bacteria	7270
128	Ga0070707_100021756	3300005468	Bacteria	6061
129	Ga0070707_100029552	3300005468	Bacteria	5217
130	Ga0070707_100058063	3300005468	Bacteria	3712
131	Ga0070707_100090007	3300005468	Bacteria	2970
132	Ga0070698_100000106	3300005471	Bacteria	69519
133	Ga0070698_100000546	3300005471	Bacteria	40175
134	Ga0070698_100004555	3300005471	Bacteria	15224
135	Ga0070698_100007047	3300005471	Bacteria	12176
136	Ga0070698_100014280	3300005471	Bacteria	8396
137	Ga0070698_100018347	3300005471	Bacteria	7367
138	Ga0070698_100019863	3300005471	Bacteria	7048
139	Ga0070698_100046444	3300005471	Bacteria	4440
140	Ga0070698_100070830	3300005471	Bacteria	3498
141	Ga0070698_100079441	3300005471	Bacteria	3277
142	Ga0070698_100206013	3300005471	Bacteria	1902
143	Ga0070699_100000577	3300005518	Bacteria	34742
144	Ga0070699_100459552	3300005518	Bacteria	1154
145	Ga0070679_100084639	3300005530	Bacteria	3159
146	Ga0070679_100093574	3300005530	Bacteria	2993
147	Ga0070684_100013575	3300005535	Bacteria	6572
148	Ga0070684_100604614	3300005535	Bacteria	1020
149	Ga0070684_100621911	3300005535	Bacteria	1005
150	Ga0070697_100029422	3300005536	Bacteria	4404
151	Ga0070697_100069331	3300005536	Bacteria	2888
152	Ga0070697_100357258	3300005536	Bacteria	1263
153	Ga0068853_100073071	3300005539	Bacteria	2989
154	Ga0068853_100275373	3300005539	Bacteria	1550
155	Ga0070672_100075534	3300005543	Bacteria	2690
156	Ga0070672_100143140	3300005543	Bacteria	1974
157	Ga0070686_100026601	3300005544	Bacteria	3493
158	Ga0070686_100035430	3300005544	Bacteria	3082
159	Ga0070695_100059329	3300005545	Bacteria	2477
160	Ga0070695_100341141	3300005545	Bacteria	1119
161	Ga0070696_100097078	3300005546	Bacteria	2106
162	Ga0070696_100187297	3300005546	Bacteria	1538
163	Ga0070693_100035744	3300005547	Bacteria	2758
164	Ga0070665_100000401	3300005548	Bacteria	63343
165	Ga0070665_100032363	3300005548	Bacteria	5263
166	Ga0070665_100087185	3300005548	Bacteria	3126
167	Ga0070665_100141565	3300005548	Bacteria	2408
168	Ga0068855_100050361	3300005563	Bacteria	4908
169	Ga0068855_100077738	3300005563	Bacteria	3851
170	Ga0070664_100078425	3300005564	Bacteria	2841
171	Ga0070664_100422789	3300005564	Bacteria	1221
172	Ga0068857_100138478	3300005577	Bacteria	2199
173	Ga0068857_100153423	3300005577	Bacteria	2088
174	Ga0068857_100319118	3300005577	Bacteria	1434
175	Ga0068854_100020711	3300005578	Bacteria	4456
176	Ga0068854_100270222	3300005578	Bacteria	1365
177	Ga0068854_100560443	3300005578	Bacteria	970
178	Ga0068856_100015966	3300005614	Bacteria	7260
179	Ga0068856_100025089	3300005614	Bacteria	5809
180	Ga0068856_100035500	3300005614	Bacteria	4887
181	Ga0068856_100042199	3300005614	Bacteria	4487
182	Ga0068856_100268510	3300005614	Bacteria	1722
183	Ga0068856_100749395	3300005614	Bacteria	997
184	Ga0070702_100014799	3300005615	Bacteria	3967
185	Ga0070702_100022796	3300005615	Bacteria	3317
186	Ga0070702_100291093	3300005615	Bacteria	1125
187	Ga0068852_100022811	3300005616	Bacteria	5026
188	Ga0068852_100050239	3300005616	Bacteria	3572
189	Ga0068852_100148003	3300005616	Bacteria	2180
190	Ga0068852_100203210	3300005616	Bacteria	1876
191	Ga0068852_100212067	3300005616	Bacteria	1838
192	Ga0068852_100395840	3300005616	Bacteria	1358
193	Ga0068859_100099277	3300005617	Bacteria	2967
194	Ga0068859_100145116	3300005617	Bacteria	2448
195	Ga0068859_100575966	3300005617	Bacteria	1219
196	Ga0068864_100006862	3300005618	Bacteria	9328
197	Ga0068864_100064036	3300005618	Bacteria	3187
198	Ga0068864_100193491	3300005618	Bacteria	1865
199	Ga0068861_100337992	3300005719	Bacteria	1317
200	Ga0068870_10118853	3300005840	Bacteria	1520
201	Ga0068870_10266306	3300005840	Bacteria	1069
202	Ga0068863_100001365	3300005841	Bacteria	24282
203	Ga0068863_100043562	3300005841	Bacteria	4260
204	Ga0068863_100055890	3300005841	Bacteria	3737
205	Ga0068863_100080467	3300005841	Bacteria	3086
206	Ga0068863_100306575	3300005841	Bacteria	1541
207	Ga0068858_100000732	3300005842	Bacteria	34375
208	Ga0068858_100027030	3300005842	Bacteria	5329
209	Ga0068858_100059448	3300005842	Bacteria	3532
210	Ga0068858_100382570	3300005842	Bacteria	1350
211	Ga0068860_100000114	3300005843	Bacteria	128789
212	Ga0068860_100038551	3300005843	Bacteria	4572
213	Ga0068860_100054813	3300005843	Bacteria	3789
214	Ga0068860_100254576	3300005843	Bacteria	1710
215	Ga0068862_100077659	3300005844	Bacteria	2875
216	Ga0068862_100220064	3300005844	Bacteria	1718
217	Ga0081455_10000575	3300005937	Bacteria	47885
218	Ga0081455_10020190	3300005937	Bacteria	6283
219	Ga0081455_10167176	3300005937	Bacteria	1679
220	Ga0081455_10540228	3300005937	Bacteria	773
221	Ga0081540_1000171	3300005983	Bacteria	67920
222	Ga0081540_1001613	3300005983	Bacteria	19226
223	Ga0081540_1038105	3300005983	Bacteria	2538
224	Ga0081540_1042201	3300005983	Bacteria	2355
225	Ga0081539_10001059	3300005985	Bacteria	50280
226	Ga0070717_10022210	3300006028	Bacteria	5012
227	Ga0070717_10028429	3300006028	Bacteria	4476
228	Ga0070717_10045339	3300006028	Bacteria	3594
229	Ga0070717_10067916	3300006028	Bacteria	2967
230	Ga0070717_10115085	3300006028	Bacteria	2298
231	Ga0070717_10115967	3300006028	Bacteria	2289
232	Ga0070717_10355399	3300006028	Bacteria	1310
233	Ga0075365_10281722	3300006038	Bacteria	1170
234	Ga0075365_10498273	3300006038	Bacteria	861
235	Ga0075368_10265944	3300006042	Bacteria	735
236	Ga0075363_100007574	3300006048	Bacteria	5003
237	Ga0070715_10001293	3300006163	Bacteria	7179
238	Ga0070715_10130593	3300006163	Bacteria	1208
239	Ga0070715_10254649	3300006163	Bacteria	919
240	Ga0070716_100003270	3300006173	Bacteria	7612
241	Ga0070716_100027653	3300006173	Bacteria	3049
242	Ga0070712_100005041	3300006175	Bacteria	8181
243	Ga0070712_100005233	3300006175	Bacteria	8028
244	Ga0070712_100021380	3300006175	Bacteria	4250
245	Ga0070712_100088909	3300006175	Bacteria	2258
246	Ga0070712_100110354	3300006175	Bacteria	2051
247	Ga0070712_100571470	3300006175	Bacteria	954
248	Ga0070712_100717585	3300006175	Bacteria	853
249	Ga0097621_100024496	3300006237	Bacteria	4714
250	Ga0097621_100117863	3300006237	Bacteria	2250
251	Ga0075370_10103451	3300006353	Bacteria	1650
252	Ga0068871_100036095	3300006358	Bacteria	3933
253	Ga0068871_100704884	3300006358	Bacteria	925
254	Ga0075428_100042278	3300006844	Bacteria	5011
255	Ga0075428_100366688	3300006844	Bacteria	1545
256	Ga0075431_100146985	3300006847	Bacteria	2429
257	Ga0075433_10010525	3300006852	Bacteria	7430
258	Ga0075433_10052150	3300006852	Bacteria	3564
259	Ga0075433_10198443	3300006852	Bacteria	1784
260	Ga0075434_100019525	3300006871	Bacteria	6560
261	Ga0075434_100023481	3300006871	Bacteria	6011
262	Ga0075434_100061569	3300006871	Bacteria	3734
263	Ga0075434_100394683	3300006871	Bacteria	1404
264	Ga0068865_100468726	3300006881	Bacteria	1044
265	Ga0075436_100011256	3300006914	Bacteria	6136
266	Ga0075436_100095199	3300006914	Bacteria	2071
267	Ga0075436_100204030	3300006914	Bacteria	1401
268	Ga0075436_100215724	3300006914	Bacteria	1361
269	Ga0097620_100099277	3300006931	Bacteria	2967
270	Ga0097620_100145123	3300006931	Bacteria	2448
271	Ga0097620_100575958	3300006931	Bacteria	1219
272	Ga0075435_100061791	3300007076	Bacteria	3039
273	Ga0075435_100310246	3300007076	Bacteria	1350
274	Ga0105251_10008325	3300009011	Bacteria	6260
275	Ga0105251_10009100	3300009011	Bacteria	5910
276	Ga0105251_10030150	3300009011	Bacteria	2726
277	Ga0105244_10201807	3300009036	Bacteria	937
278	Ga0105250_10016018	3300009092	Bacteria	3060
279	Ga0105240_10058787	3300009093	Bacteria	4799
280	Ga0105240_10085449	3300009093	Bacteria	3865
281	Ga0105240_10088061	3300009093	Bacteria	3800
282	Ga0111539_10015815	3300009094	Bacteria	9372
283	Ga0111539_10143921	3300009094	Bacteria	2791
284	Ga0105245_10008898	3300009098	Bacteria	8764
285	Ga0105245_10090979	3300009098	Bacteria	2807
286	Ga0105245_10104042	3300009098	Bacteria	2631
287	Ga0105245_10360280	3300009098	Bacteria	1443
288	Ga0105245_10373998	3300009098	Bacteria	1417
289	Ga0105247_10000038	3300009101	Bacteria	164083
290	Ga0105247_10003476	3300009101	Bacteria	10268
291	Ga0105247_10030438	3300009101	Bacteria	3272
292	Ga0105247_10186374	3300009101	Bacteria	1387
293	Ga0114129_10011093	3300009147	Bacteria	12838
294	Ga0114129_10093489	3300009147	Bacteria	4165
295	Ga0105243_10007184	3300009148	Bacteria	8559
296	Ga0105243_10013663	3300009148	Bacteria	6143
297	Ga0105243_10021441	3300009148	Bacteria	4905
298	Ga0105243_10037350	3300009148	Bacteria	3774
299	Ga0105243_10126903	3300009148	Bacteria	2160
300	Ga0105243_10470862	3300009148	Bacteria	1183
301	Ga0105241_10021949	3300009174	Bacteria	4726
302	Ga0105241_10026480	3300009174	Bacteria	4315
303	Ga0105241_10026744	3300009174	Bacteria	4294
304	Ga0105242_10040426	3300009176	Bacteria	3758
305	Ga0105242_10055746	3300009176	Bacteria	3233
306	Ga0105242_10172795	3300009176	Bacteria	1900
307	Ga0105248_10004635	3300009177	Bacteria	15206
308	Ga0105248_10150351	3300009177	Bacteria	2627
309	Ga0105248_10299483	3300009177	Bacteria	1811
310	Ga0105248_10785059	3300009177	Bacteria	1075
311	Ga0105237_10095315	3300009545	Bacteria	2965
312	Ga0105237_10201033	3300009545	Bacteria	1993
313	Ga0105237_10797605	3300009545	Bacteria	951
314	Ga0105238_10009629	3300009551	Bacteria	9667
315	Ga0105238_10089976	3300009551	Bacteria	3057
316	Ga0105238_10107688	3300009551	Bacteria	2768
317	Ga0105238_10603642	3300009551	Bacteria	1106
318	Ga0105249_10011339	3300009553	Bacteria	7826
319	Ga0105249_10059762	3300009553	Bacteria	3496
320	Ga0105249_10109889	3300009553	Bacteria	2604
321	Ga0105249_10460205	3300009553	Bacteria	1312
322	Ga0105249_10523618	3300009553	Bacteria	1233
323	Ga0105249_10523642	3300009553	Bacteria	1233
324	Ga0105239_10031946	3300010375	Bacteria	5784
325	Ga0105239_10088101	3300010375	Bacteria	3422
326	Ga0105239_10191487	3300010375	Bacteria	2289
327	Ga0105239_10537759	3300010375	Bacteria	1330
328	Ga0105239_10624742	3300010375	Bacteria	1229
329	Ga0105239_10770420	3300010375	Bacteria	1102
330	Ga0105246_10029622	3300011119	Bacteria	3606
331	Ga0105246_10034148	3300011119	Bacteria	3386
332	Ga0105246_10046747	3300011119	Bacteria	2953
333	Ga0105246_10066977	3300011119	Bacteria	2515
334	Ga0157345_1003149	3300012498	Bacteria	1193
335	Ga0157373_10137647	3300013100	Bacteria	1717
336	Ga0157371_10317202	3300013102	Bacteria	1130
337	Ga0157370_10070210	3300013104	Bacteria	3307
338	Ga0157370_10130425	3300013104	Bacteria	2345
339	Ga0157370_10337002	3300013104	Bacteria	1390
340	Ga0157370_10608524	3300013104	Bacteria	1000
341	Ga0157369_10007003	3300013105	Bacteria	13010
342	Ga0157369_10007588	3300013105	Bacteria	12482
343	Ga0157369_10071651	3300013105	Bacteria	3720
344	Ga0157369_10135443	3300013105	Bacteria	2608
345	Ga0157369_10483585	3300013105	Bacteria	1281
346	Ga0157374_10022784	3300013296	Bacteria	5592
347	Ga0157374_10229451	3300013296	Bacteria	1823
348	Ga0157374_10266988	3300013296	Bacteria	1687
349	Ga0157374_10801467	3300013296	Bacteria	958
350	Ga0157378_10284544	3300013297	Bacteria	1595
351	Ga0163162_10127024	3300013306	Bacteria	2657
352	Ga0163162_10217095	3300013306	Bacteria	2043
353	Ga0163162_10255261	3300013306	Bacteria	1885
354	Ga0163162_10400351	3300013306	Bacteria	1505
355	Ga0163162_10793150	3300013306	Bacteria	1065
356	Ga0157372_10000658	3300013307	Bacteria	37942
357	Ga0157372_10084295	3300013307	Bacteria	3602
358	Ga0157372_10158826	3300013307	Bacteria	2612
359	Ga0157375_10026112	3300013308	Bacteria	5438
360	Ga0157375_10306208	3300013308	Bacteria	1753
361	Ga0157375_10381066	3300013308	Bacteria	1577
362	Ga0157375_10421579	3300013308	Bacteria	1501
363	Ga0157375_10544018	3300013308	Bacteria	1323
364	Ga0157375_11064287	3300013308	Bacteria	946
365	Ga0163163_10021634	3300014325	Bacteria	6073
366	Ga0163163_10022975	3300014325	Bacteria	5913
367	Ga0163163_10058181	3300014325	Bacteria	3822
368	Ga0163163_10061951	3300014325	Bacteria	3706
369	Ga0157380_10019875	3300014326	Bacteria	5012
370	Ga0157380_10051491	3300014326	Bacteria	3256
371	Ga0157380_10091361	3300014326	Bacteria	2513
372	Ga0182008_10001457	3300014497	Bacteria	15816
373	Ga0157377_10061621	3300014745	Bacteria	2144
374	Ga0157377_10094225	3300014745	Bacteria	1773
375	Ga0157379_10085479	3300014968	Bacteria	2827
376	Ga0157379_10115944	3300014968	Bacteria	2408
377	Ga0157379_10140904	3300014968	Bacteria	2174
378	Ga0157376_10253081	3300014969	Bacteria	1646
379	Ga0157376_10306358	3300014969	Bacteria	1505
380	Ga0182007_10011898	3300015262	Bacteria	3367
381	Ga0183367_1005	3300015688	Bacteria	652063
382	Ga0163161_10102864	3300017792	Bacteria	2128
383	Ga0163161_10192161	3300017792	Bacteria	1570
384	Ga0163161_10334050	3300017792	Bacteria	1201
385	Ga0197907_11486011	3300020069	Bacteria	1055
386	Ga0206356_10464819	3300020070	Bacteria	1199
387	Ga0206355_1573660	3300020076	Bacteria	2383
388	Ga0206354_10632267	3300020081	Bacteria	1102
389	Ga0206353_10972019	3300020082	Bacteria	1345
390	Ga0206353_11335110	3300020082	Bacteria	784
391	Ga0213874_10059141	3300021377	Bacteria	1196
392	Ga0213875_10000537	3300021388	Bacteria	31171
393	Ga0213875_10001614	3300021388	Bacteria	14256
394	Ga0213875_10016464	3300021388	Bacteria	3583
395	Ga0213875_10024228	3300021388	Bacteria	2895
396	Ga0213875_10299394	3300021388	Bacteria	761
397	Ga0224712_10004812	3300022467	Bacteria	3687
398	Ga0224712_10012350	3300022467	Bacteria	2684
399	Ga0224712_10016046	3300022467	Bacteria	2451
400	Ga0224712_10050508	3300022467	Bacteria	1616
401	Ga0224712_10122252	3300022467	Bacteria	1128
402	Ga0224712_10138911	3300022467	Bacteria	1068
403	Ga0209758_1005482	3300025297	Bacteria	9735
404	Ga0207426_1004843	3300025302	Bacteria	6378
405	Ga0207426_1008083	3300025302	Bacteria	4310
406	Ga0207426_1010813	3300025302	Bacteria	3520
407	Ga0207426_1048669	3300025302	Bacteria	1272
408	Ga0207696_1048405	3300025711	Bacteria	1222
409	Ga0207713_1005803	3300025735	Bacteria	7640
410	Ga0207653_10009551	3300025885	Bacteria	3024
411	Ga0207692_10002006	3300025898	Bacteria	7775
412	Ga0207692_10012366	3300025898	Bacteria	3664
413	Ga0207692_10015787	3300025898	Bacteria	3330
414	Ga0207692_10026337	3300025898	Bacteria	2727
415	Ga0207692_10056251	3300025898	Bacteria	2017
416	Ga0207692_10118251	3300025898	Bacteria	1480
417	Ga0207710_10000054	3300025900	Bacteria	180103
418	Ga0207710_10000199	3300025900	Bacteria	56491
419	Ga0207710_10009019	3300025900	Bacteria	4198
420	Ga0207688_10013036	3300025901	Bacteria	4521
421	Ga0207688_10022652	3300025901	Bacteria	3438
422	Ga0207680_10024029	3300025903	Bacteria	3338
423	Ga0207680_10121741	3300025903	Bacteria	1707
424	Ga0207647_10013191	3300025904	Bacteria	5738
425	Ga0207647_10027943	3300025904	Bacteria	3673
426	Ga0207647_10052960	3300025904	Bacteria	2503
427	Ga0207685_10008336	3300025905	Bacteria	2947
428	Ga0207685_10021703	3300025905	Bacteria	2157
429	Ga0207699_10000684	3300025906	Bacteria	16276
430	Ga0207699_10002656	3300025906	Bacteria	8440
431	Ga0207699_10005707	3300025906	Bacteria	5983
432	Ga0207699_10014662	3300025906	Bacteria	4048
433	Ga0207699_10014727	3300025906	Bacteria	4041
434	Ga0207699_10037612	3300025906	Bacteria	2768
435	Ga0207699_10337033	3300025906	Bacteria	1062
436	Ga0207645_10051702	3300025907	Bacteria	2625
437	Ga0207643_10022418	3300025908	Bacteria	3477
438	Ga0207643_10166592	3300025908	Bacteria	1328
439	Ga0207705_10000573	3300025909	Bacteria	30814
440	Ga0207684_10000571	3300025910	Bacteria	44831
441	Ga0207684_10001806	3300025910	Bacteria	22396
442	Ga0207684_10014224	3300025910	Bacteria	6868
443	Ga0207684_10019030	3300025910	Bacteria	5874
444	Ga0207684_10025959	3300025910	Bacteria	4994
445	Ga0207684_10061832	3300025910	Bacteria	3179
446	Ga0207684_10066992	3300025910	Bacteria	3050
447	Ga0207684_10073685	3300025910	Bacteria	2900
448	Ga0207684_10144332	3300025910	Bacteria	2047
449	Ga0207684_10236281	3300025910	Bacteria	1577
450	Ga0207684_10282490	3300025910	Bacteria	1431
451	Ga0207654_10024354	3300025911	Bacteria	3253
452	Ga0207654_10036321	3300025911	Bacteria	2752
453	Ga0207654_10534008	3300025911	Bacteria	832
454	Ga0207707_10003446	3300025912	Bacteria	14027
455	Ga0207707_10258377	3300025912	Bacteria	1512
456	Ga0207695_10008627	3300025913	Bacteria	12733
457	Ga0207695_10195826	3300025913	Bacteria	1937
458	Ga0207695_10236258	3300025913	Bacteria	1730
459	Ga0207695_10380506	3300025913	Bacteria	1297
460	Ga0207671_10000188	3300025914	Bacteria	95365
461	Ga0207671_10047172	3300025914	Bacteria	3189
462	Ga0207671_10074718	3300025914	Bacteria	2533
463	Ga0207693_10003796	3300025915	Bacteria	12867
464	Ga0207693_10006369	3300025915	Bacteria	9780
465	Ga0207693_10007211	3300025915	Bacteria	9152
466	Ga0207693_10010872	3300025915	Bacteria	7385
467	Ga0207693_10018090	3300025915	Bacteria	5615
468	Ga0207693_10055665	3300025915	Bacteria	3103
469	Ga0207693_10240941	3300025915	Bacteria	1420
470	Ga0207693_10599488	3300025915	Bacteria	858
471	Ga0207663_10001400	3300025916	Bacteria	11181
472	Ga0207663_10003417	3300025916	Bacteria	7767
473	Ga0207663_10016411	3300025916	Bacteria	4106
474	Ga0207663_10022703	3300025916	Bacteria	3591
475	Ga0207663_10034580	3300025916	Bacteria	3024
476	Ga0207663_10056942	3300025916	Bacteria	2461
477	Ga0207663_10129919	3300025916	Bacteria	1739
478	Ga0207663_10494520	3300025916	Bacteria	949
479	Ga0207660_10237112	3300025917	Bacteria	1436
480	Ga0207660_10304771	3300025917	Bacteria	1269
481	Ga0207660_10380767	3300025917	Bacteria	1134
482	Ga0207662_10008460	3300025918	Bacteria	5634
483	Ga0207662_10083704	3300025918	Bacteria	1950
484	Ga0207657_10004980	3300025919	Bacteria	13974
485	Ga0207657_10028697	3300025919	Bacteria	5072
486	Ga0207657_10037201	3300025919	Bacteria	4349
487	Ga0207652_10031799	3300025921	Bacteria	4433
488	Ga0207652_10078417	3300025921	Bacteria	2884
489	Ga0207652_10236479	3300025921	Bacteria	1647
490	Ga0207646_10000050	3300025922	Bacteria	171554
491	Ga0207646_10001770	3300025922	Bacteria	26156
492	Ga0207646_10002450	3300025922	Bacteria	21909
493	Ga0207646_10009108	3300025922	Bacteria	9854
494	Ga0207646_10011667	3300025922	Bacteria	8497
495	Ga0207646_10123924	3300025922	Bacteria	2323
496	Ga0207694_10004684	3300025924	Bacteria	10647
497	Ga0207694_10127303	3300025924	Bacteria	2039
498	Ga0207694_10369184	3300025924	Bacteria	1190
499	Ga0207650_10356812	3300025925	Bacteria	1204
500	Ga0207659_10279814	3300025926	Bacteria	1364
501	Ga0207687_10017480	3300025927	Bacteria	4723
502	Ga0207687_10076551	3300025927	Bacteria	2404
503	Ga0207687_10106279	3300025927	Bacteria	2075
504	Ga0207687_10118225	3300025927	Bacteria	1978
505	Ga0207687_10264640	3300025927	Bacteria	1372
506	Ga0207687_10346363	3300025927	Bacteria	1209
507	Ga0207700_10001148	3300025928	Bacteria	15212
508	Ga0207700_10011993	3300025928	Bacteria	5562
509	Ga0207700_10041144	3300025928	Bacteria	3379
510	Ga0207700_10046488	3300025928	Bacteria	3210
511	Ga0207700_10060814	3300025928	Bacteria	2862
512	Ga0207700_10077499	3300025928	Bacteria	2582
513	Ga0207700_10078444	3300025928	Bacteria	2569
514	Ga0207700_10089443	3300025928	Bacteria	2427
515	Ga0207700_10188450	3300025928	Bacteria	1732
516	Ga0207700_10529867	3300025928	Bacteria	1044
517	Ga0207664_10000009	3300025929	Bacteria	299246
518	Ga0207664_10000298	3300025929	Bacteria	37109
519	Ga0207664_10003123	3300025929	Bacteria	11003
520	Ga0207664_10004567	3300025929	Bacteria	9378
521	Ga0207664_10006510	3300025929	Bacteria	8038
522	Ga0207664_10012203	3300025929	Bacteria	6141
523	Ga0207664_10016910	3300025929	Bacteria	5334
524	Ga0207664_10028591	3300025929	Bacteria	4238
525	Ga0207664_10033127	3300025929	Bacteria	3967
526	Ga0207664_10067915	3300025929	Bacteria	2862
527	Ga0207664_10193522	3300025929	Bacteria	1752
528	Ga0207664_10194744	3300025929	Bacteria	1747
529	Ga0207664_10265488	3300025929	Bacteria	1502
530	Ga0207664_10672954	3300025929	Bacteria	930
531	Ga0207644_10376549	3300025931	Bacteria	1157
532	Ga0207690_10715941	3300025932	Bacteria	824
533	Ga0207706_10020091	3300025933	Bacteria	6002
534	Ga0207686_10118300	3300025934	Bacteria	1799
535	Ga0207709_10047213	3300025935	Bacteria	2616
536	Ga0207709_10066719	3300025935	Bacteria	2268
537	Ga0207670_10010705	3300025936	Bacteria	5294
538	Ga0207670_10459137	3300025936	Bacteria	1028
539	Ga0207669_10178475	3300025937	Bacteria	1520
540	Ga0207669_10191156	3300025937	Bacteria	1477
541	Ga0207704_10219204	3300025938	Bacteria	1406
542	Ga0207665_10001293	3300025939	Bacteria	16911
543	Ga0207665_10006161	3300025939	Bacteria	7965
544	Ga0207665_10007145	3300025939	Bacteria	7391
545	Ga0207665_10009393	3300025939	Bacteria	6417
546	Ga0207665_10009599	3300025939	Bacteria	6355
547	Ga0207665_10022631	3300025939	Bacteria	4136
548	Ga0207665_10027491	3300025939	Bacteria	3758
549	Ga0207665_10422739	3300025939	Bacteria	1018
550	Ga0207691_10018488	3300025940	Bacteria	6606
551	Ga0207691_10220118	3300025940	Bacteria	1646
552	Ga0207711_10038262	3300025941	Bacteria	4078
553	Ga0207711_10069180	3300025941	Bacteria	3059
554	Ga0207711_10143807	3300025941	Bacteria	2147
555	Ga0207711_10474577	3300025941	Bacteria	1165
556	Ga0207689_10011071	3300025942	Bacteria	7751
557	Ga0207689_10116096	3300025942	Bacteria	2200
558	Ga0207689_10886559	3300025942	Bacteria	753
559	Ga0207661_10044710	3300025944	Bacteria	3502
560	Ga0207661_10295793	3300025944	Bacteria	1450
561	Ga0207661_10761574	3300025944	Bacteria	891
562	Ga0207679_10088282	3300025945	Bacteria	2390
563	Ga0207667_10034292	3300025949	Bacteria	5451
564	Ga0207667_10067860	3300025949	Bacteria	3715
565	Ga0207667_10114334	3300025949	Bacteria	2782
566	Ga0207667_10338389	3300025949	Bacteria	1536
567	Ga0207667_10664637	3300025949	Bacteria	1046
568	Ga0207667_10692040	3300025949	Bacteria	1022
569	Ga0207667_10740105	3300025949	Bacteria	983
570	Ga0207651_10126687	3300025960	Bacteria	1947
571	Ga0207651_10298946	3300025960	Bacteria	1338
572	Ga0207712_10056414	3300025961	Bacteria	2767
573	Ga0207712_10164450	3300025961	Bacteria	1728
574	Ga0207668_10024607	3300025972	Bacteria	3889
575	Ga0207668_10130099	3300025972	Bacteria	1921
576	Ga0207668_10328361	3300025972	Bacteria	1272
577	Ga0207640_10031406	3300025981	Bacteria	3281
578	Ga0207640_10560147	3300025981	Bacteria	962
579	Ga0207658_10042016	3300025986	Bacteria	3314
580	Ga0207677_10038407	3300026023	Bacteria	3139
581	Ga0207677_10405190	3300026023	Bacteria	1157
582	Ga0207677_10900324	3300026023	Bacteria	797
583	Ga0207703_10000047	3300026035	Bacteria	151177
584	Ga0207703_10033367	3300026035	Bacteria	4080
585	Ga0207639_10019625	3300026041	Bacteria	4824
586	Ga0207639_10055105	3300026041	Bacteria	3042
587	Ga0207639_10087274	3300026041	Bacteria	2486
588	Ga0207678_10006256	3300026067	Bacteria	10574
589	Ga0207678_10007661	3300026067	Bacteria	9536
590	Ga0207678_10016809	3300026067	Bacteria	6426
591	Ga0207678_10032239	3300026067	Bacteria	4567
592	Ga0207678_10327538	3300026067	Bacteria	1318
593	Ga0207708_10000076	3300026075	Bacteria	78340
594	Ga0207708_10453641	3300026075	Bacteria	1068
595	Ga0207702_10018387	3300026078	Bacteria	5783
596	Ga0207702_10211140	3300026078	Bacteria	1805
597	Ga0207702_10230973	3300026078	Bacteria	1729
598	Ga0207702_10357366	3300026078	Bacteria	1399
599	Ga0207702_10655929	3300026078	Bacteria	1032
600	Ga0207702_10659437	3300026078	Bacteria	1029
601	Ga0207702_10866727	3300026078	Bacteria	894
602	Ga0207641_10043271	3300026088	Bacteria	3781
603	Ga0207641_10315816	3300026088	Bacteria	1480
604	Ga0207676_10071926	3300026095	Bacteria	2778
605	Ga0207676_10112106	3300026095	Bacteria	2284
606	Ga0207674_10105018	3300026116	Bacteria	2803
607	Ga0207674_10161644	3300026116	Bacteria	2194
608	Ga0207674_10190137	3300026116	Bacteria	2003
609	Ga0207674_10470158	3300026116	Bacteria	1215
610	Ga0207674_10672536	3300026116	Bacteria	1000
611	Ga0207675_100036213	3300026118	Bacteria	4603
612	Ga0207675_100083772	3300026118	Bacteria	2991
613	Ga0207683_10008027	3300026121	Bacteria	9026
614	Ga0207683_10010511	3300026121	Bacteria	7896
615	Ga0207683_10019796	3300026121	Bacteria	5748
616	Ga0207683_10118006	3300026121	Bacteria	2380
617	Ga0207683_10591025	3300026121	Bacteria	1027
618	Ga0207683_10785520	3300026121	Bacteria	884
619	Ga0207698_10014788	3300026142	Bacteria	5201
620	Ga0207698_10070428	3300026142	Bacteria	2771
621	Ga0207698_10215039	3300026142	Bacteria	1732
622	Ga0207698_10299760	3300026142	Bacteria	1496
623	Ga0207698_10464844	3300026142	Bacteria	1224
624	Ga0209371_1036492	3300027312	Bacteria	1027
625	Ga0209179_1013955	3300027512	Bacteria	1468
626	Ga0209282_1104653	3300027666	Bacteria	1450
627	Ga0207428_10109901	3300027907	Bacteria	2123
628	Ga0265357_1000648	3300028023	Bacteria	2169
629	Ga0268266_10003295	3300028379	Bacteria	16228
630	Ga0268266_10113916	3300028379	Bacteria	2399
631	Ga0268266_10318640	3300028379	Bacteria	1455
632	Ga0268266_10543717	3300028379	Bacteria	1112
633	Ga0268265_10482871	3300028380	Bacteria	1164
634	Ga0268264_10000147	3300028381	Bacteria	164790
635	Ga0268264_10024763	3300028381	Bacteria	4902
636	Ga0268264_10472530	3300028381	Bacteria	1218
637	Ga0265337_1010294	3300028556	Bacteria	3282
638	Ga0265326_10016736	3300028558	Bacteria	2117
639	Ga0265319_1002778	3300028563	Bacteria	9388
640	Ga0265334_10001473	3300028573	Bacteria	11343
641	Ga0265334_10010969	3300028573	Bacteria	3823
642	Ga0265318_10013803	3300028577	Bacteria	3403
643	Ga0265323_10007434	3300028653	Bacteria	4552
644	Ga0265322_10128498	3300028654	Bacteria	722
645	Ga0265336_10009823	3300028666	Bacteria	3297
646	Ga0307517_10010734	3300028786	Bacteria	12774
647	Ga0307517_10016489	3300028786	Bacteria	9705
648	Ga0307515_10003702	3300028794	Bacteria	32085
649	Ga0307515_10043028	3300028794	Bacteria	7038
650	Ga0307515_10078912	3300028794	Bacteria	4321
651	Ga0307515_10113925	3300028794	Bacteria	3130
652	Ga0307515_10346082	3300028794	Bacteria	1136
653	Ga0307515_10355630	3300028794	Bacteria	1108
654	Ga0307515_10421519	3300028794	Bacteria	955
655	Ga0265338_10000125	3300028800	Bacteria	141151
656	Ga0265338_10001588	3300028800	Bacteria	36478
657	Ga0265338_10003580	3300028800	Bacteria	21688
658	Ga0265338_10012554	3300028800	Bacteria	9650
659	Ga0265324_10005383	3300029957	Bacteria	5539
660	Ga0268256_1030226	3300030500	Bacteria	1315
661	Ga0307511_10001286	3300030521	Bacteria	26612
662	Ga0307511_10056779	3300030521	Bacteria	3055
663	Ga0307512_10001726	3300030522	Bacteria	29809
664	Ga0307512_10006664	3300030522	Bacteria	11634
665	Ga0265766_1003975	3300030863	Bacteria	886
666	Ga0265332_10059749	3300031238	Bacteria	1631
667	Ga0265320_10007329	3300031240	Bacteria	6851
668	Ga0265325_10018697	3300031241	Bacteria	3842
669	Ga0265340_10000127	3300031247	Bacteria	37974
670	Ga0265340_10047965	3300031247	Bacteria	2077
671	Ga0265339_10036771	3300031249	Bacteria	2738
672	Ga0265316_10374245	3300031344	Bacteria	1028
673	Ga0307513_10003878	3300031456	Bacteria	20119
674	Ga0307513_10069197	3300031456	Bacteria	3694
675	Ga0307509_10079436	3300031507	Bacteria	3396
676	Ga0307509_10114455	3300031507	Bacteria	2692
677	Ga0307508_10008805	3300031616	Bacteria	9311
678	Ga0307508_10063253	3300031616	Bacteria	3265
679	Ga0307508_10075915	3300031616	Bacteria	2938
680	Ga0307514_10011203	3300031649	Bacteria	7460
681	Ga0307514_10074227	3300031649	Bacteria	2539
682	Ga0307514_10153866	3300031649	Bacteria	1537
683	Ga0307514_10236484	3300031649	Bacteria	1100
684	Ga0316579_10000077	3300031691	Bacteria	24927
685	Ga0316579_10007071	3300031691	Bacteria	4617
686	Ga0316579_10032470	3300031691	Bacteria	2394
687	Ga0265314_10010681	3300031711	Bacteria	7641
688	Ga0265342_10013026	3300031712	Bacteria	5603
689	Ga0316576_10038983	3300031727	Bacteria	3409
690	Ga0316576_10168165	3300031727	Bacteria	1654
691	Ga0316576_10258203	3300031727	Bacteria	1307
692	Ga0316578_10037179	3300031728	Bacteria	2804
693	Ga0307516_10053784	3300031730	Bacteria	3936
694	Ga0307516_10085042	3300031730	Bacteria	3001
695	Ga0307516_10212121	3300031730	Bacteria	1650
696	Ga0316577_10051727	3300031733	Bacteria	2292
697	Ga0307410_10062443	3300031852	Bacteria	2553
698	Ga0307410_10401842	3300031852	Bacteria	1107
699	Ga0307406_10051528	3300031901	Bacteria	2614
700	Ga0307407_10100086	3300031903	Bacteria	1797
701	Ga0307407_10261421	3300031903	Bacteria	1191
702	Ga0307412_10311139	3300031911	Bacteria	1249
703	Ga0307409_100007448	3300031995	Bacteria	6547
704	Ga0307409_100102486	3300031995	Bacteria	2378
705	Ga0307409_100257551	3300031995	Bacteria	1599
706	Ga0307409_100418407	3300031995	Bacteria	1285
707	Ga0307409_100423753	3300031995	Bacteria	1277
708	Ga0307409_100502748	3300031995	Bacteria	1181
709	Ga0307409_100720625	3300031995	Bacteria	999
710	Ga0307409_100778800	3300031995	Bacteria	962
711	Ga0307409_101051235	3300031995	Bacteria	834
712	Ga0307416_100010494	3300032002	Bacteria	6121
713	Ga0307416_100748499	3300032002	Bacteria	1070
714	Ga0307411_10179029	3300032005	Bacteria	1607
715	Ga0307415_100017174	3300032126	Bacteria	4332
716	Ga0307415_100670522	3300032126	Bacteria	932
717	Ga0316583_10037382	3300032133	Bacteria	1721
718	Ga0316580_10083713	3300032139	Bacteria	975
719	Ga0307507_10000009	3300033179	Bacteria	265992
720	Ga0307507_10065207	3300033179	Bacteria	3351
721	Ga0307507_10152268	3300033179	Bacteria	1736
722	Ga0307507_10198775	3300033179	Bacteria	1392
723	Ga0307510_10046657	3300033180	Bacteria	4654
724	Ga0316214_1000866	3300033545	Bacteria	3319
725	Ga0316214_1001110	3300033545	Bacteria	3027
726	Ga0316214_1029015	3300033545	Bacteria	784
727	Ga0373930_0013153	3300034816	Bacteria	1521
728	Ga0373959_0009081	3300034820	Bacteria	1706
729	Ga0373938_0001761	3300034957	Bacteria	3454
730	Ga0373926_0000156	3300035083	Bacteria	15071
731	Ga0373926_0000832	3300035083	Bacteria	8754
732	Ga0373926_0035486	3300035083	Bacteria	1769
733	Ga0373926_0048779	3300035083	Bacteria	1523
734	Ga0373934_0000058	3300035086	Bacteria	37451
735	Ga0373934_0004599	3300035086	Bacteria	5101
736	Ga0373934_0025399	3300035086	Bacteria	2294
737	Ga0373934_0035510	3300035086	Bacteria	1961
738	Ga0373934_0039886	3300035086	Bacteria	1851
739	Ga0373940_0005394	3300035088	Bacteria	2768
740	Ga0373944_0000925	3300035089	Bacteria	7261
741	Ga0373944_0003386	3300035089	Bacteria	4112
742	Ga0373949_0036185	3300035090	Bacteria	1196
743	Ga0373951_0005589	3300035091	Bacteria	2914
744	Ga0373952_0005808	3300035092	Bacteria	2267
745	Ga0373923_0003028	3300035111	Bacteria	5313
746	Ga0373923_0015058	3300035111	Bacteria	2914
747	Ga0373923_0033594	3300035111	Bacteria	2077
748	Ga0373923_0044608	3300035111	Bacteria	1838
749	Ga0373923_0156828	3300035111	Bacteria	1036
750	Ga0373932_0026901	3300035112	Bacteria	1569
751	Ga0373936_0005337	3300035113	Bacteria	4837
752	Ga0373936_0017711	3300035113	Bacteria	2745
753	Ga0373939_0015568	3300035114	Bacteria	1992
754	Ga0373941_0066178	3300035115	Bacteria	1188
755	Ga0373945_0000023	3300035116	Bacteria	31398
756	Ga0373945_0047461	3300035116	Bacteria	1570
757	Ga0373953_0000217	3300035117	Bacteria	15671
758	Ga0373953_0003800	3300035117	Bacteria	4753
759	Ga0373953_0008649	3300035117	Bacteria	3467
760	Ga0373953_0022344	3300035117	Bacteria	2384
761	Ga0373954_0004267	3300035118	Bacteria	6144
762	Ga0373954_0008892	3300035118	Bacteria	4419
763	Ga0373954_0009716	3300035118	Bacteria	4236
764	Ga0373954_0013477	3300035118	Bacteria	3643
765	Ga0373954_0055904	3300035118	Bacteria	1857
766	Ga0373954_0212017	3300035118	Bacteria	952
767	Ga0373954_0325356	3300035118	Bacteria	759
768	Ga0373956_0002963	3300035119	Bacteria	6871
769	Ga0373956_0025873	3300035119	Bacteria	2538
770	Ga0373956_0067870	3300035119	Bacteria	1624
771	Ga0373956_0070348	3300035119	Bacteria	1596
772	Ga0373956_0080149	3300035119	Bacteria	1497
773	Ga0373956_0086580	3300035119	Bacteria	1442
774	Ga0373956_0155156	3300035119	Bacteria	1078
775	Ga0373957_0001086	3300035120	Bacteria	7184
776	Ga0373957_0004423	3300035120	Bacteria	4277
777	Ga0373957_0009415	3300035120	Bacteria	3196
778	Ga0373957_0018314	3300035120	Bacteria	2451
779	Ga0373957_0062251	3300035120	Bacteria	1447
780	Ga0373957_0084453	3300035120	Bacteria	1256
781	Ga0373957_0102878	3300035120	Bacteria	1145
782	Ga0373960_0006179	3300035121	Bacteria	2801
783	Ga0373960_0056719	3300035121	Bacteria	1177
784	Ga0373943_0013589	3300035170	Bacteria	3678
785	Ga0373943_0017395	3300035170	Bacteria	3289
786	Ga0373943_0073664	3300035170	Bacteria	1735
787	Ga0373943_0095458	3300035170	Bacteria	1546
788	Ga0373943_0163722	3300035170	Bacteria	1213
789	Ga0373946_0000155	3300035171	Bacteria	20705
790	Ga0373946_0026077	3300035171	Bacteria	2302
791	Ga0373946_0169938	3300035171	Bacteria	1028
792	Ga0373955_0000156	3300035172	Bacteria	27424
793	Ga0373955_0001996	3300035172	Bacteria	8807
794	Ga0373955_0036158	3300035172	Bacteria	2619
795	Ga0373955_0107816	3300035172	Bacteria	1607
796	Ga0373955_0242601	3300035172	Bacteria	1079
797	Ga0373955_0267249	3300035172	Bacteria	1027
798	Ga0373955_0291805	3300035172	Bacteria	982
799	Ga0373942_0007720	3300035207	Bacteria	2502
800	Ga0373942_0012258	3300035207	Bacteria	2045
801	Ga0373942_0143813	3300035207	Bacteria	761
802	Ga0373962_0010234	3300035242	Bacteria	2334
803	Ga0316574_0001785	3300035398	Bacteria	10457
804	Ga0316574_0053143	3300035398	Bacteria	2528
805	Ga0316574_0378355	3300035398	Bacteria	893
806	Ga0373924_0001561	3300035410	Bacteria	7480
807	Ga0373924_0004802	3300035410	Bacteria	4748
808	Ga0373924_0021005	3300035410	Bacteria	2543
809	Ga0373924_0173181	3300035410	Bacteria	949
810	Ga0373931_0042796	3300035691	Bacteria	2382
811	Ga0373931_0086392	3300035691	Bacteria	1740
812	Ga0373931_0262341	3300035691	Bacteria	1054
813	Ga0373935_0002708	3300035692	Bacteria	10195
814	Ga0373935_0005390	3300035692	Bacteria	7535
815	Ga0373935_0034511	3300035692	Bacteria	3153
816	Ga0373935_0138420	3300035692	Bacteria	1642
817	Ga0373927_0019143	3300035695	Bacteria	4489
818	Ga0373927_0137679	3300035695	Bacteria	1596
819	Ga0373927_0159577	3300035695	Bacteria	1477
820	Ga0373927_0477572	3300035695	Bacteria	824
821	Ga0373933_0000009	3300035724	Bacteria	112662
822	Ga0373933_0004934	3300035724	Bacteria	7277
823	Ga0373933_0029843	3300035724	Bacteria	3155
824	Ga0373933_0069097	3300035724	Bacteria	2146
825	Ga0373933_0103878	3300035724	Bacteria	1766
826	Ga0373933_0130932	3300035724	Bacteria	1577
827	Ga0373947_0000075	3300035725	Bacteria	50183
828	Ga0373947_0137705	3300035725	Bacteria	1563
829	Ga0373937_0000012	3300036401	Bacteria	159418
830	Ga0373937_0035586	3300036401	Bacteria	4533
831	Ga0373937_0046636	3300036401	Bacteria	3963
832	Ga0373937_0085585	3300036401	Bacteria	2917
833	Ga0373937_0092882	3300036401	Bacteria	2797
834	Ga0373937_0133778	3300036401	Bacteria	2317
835	Ga0373937_0214266	3300036401	Bacteria	1812
836	Ga0373937_0355260	3300036401	Bacteria	1388
837	Ga0316582_0013111	3300036647	Bacteria	4655
838	Ga0316582_0029915	3300036647	Bacteria	3312
839	Ga0316582_0220683	3300036647	Bacteria	1296
840	Ga0316584_0060140	3300036712	Bacteria	2845
841	Ga0373925_0000262	3300037068	Bacteria	54852
842	Ga0373925_0001964	3300037068	Bacteria	17017
843	Ga0373925_0011639	3300037068	Bacteria	6362
844	Ga0373925_0015148	3300037068	Bacteria	5574
845	Ga0373925_0146501	3300037068	Bacteria	1851
846	Ga0373925_0202415	3300037068	Bacteria	1579
847	Ga0373925_0254379	3300037068	Bacteria	1409
848	Ga0373925_0254485	3300037068	Bacteria	1409
849	Ga0395899_0007409	3300037312	Bacteria	8479
850	Ga0395899_0065818	3300037312	Bacteria	2663
851	Ga0395900_0030148	3300037418	Bacteria	5568
852	Ga0395900_0110138	3300037418	Bacteria	2829
853	Ga0395900_0248527	3300037418	Bacteria	1781
854	Ga0395898_0005654	3300037466	Bacteria	13479
855	Ga0395898_0005710	3300037466	Bacteria	13410
856	Ga0395898_0048693	3300037466	Bacteria	4155
857	Ga0395898_0066020	3300037466	Bacteria	3507
858	Ga0395898_0117049	3300037466	Bacteria	2553
859	Ga0395898_0123137	3300037466	Bacteria	2485
860	Ga0395898_0139143	3300037466	Bacteria	2324
861	Ga0395898_0182253	3300037466	Bacteria	2007
862	Ga0395898_0431093	3300037466	Bacteria	1256
863	Ga0436364_0109924	3300037853	Bacteria	16000
864	Ga0436364_0138124	3300037853	Bacteria	7843
865	Ga0436364_0392443	3300037853	Bacteria	1867
866	Ga0436364_0647259	3300037853	Bacteria	794
867	Ga0436364_0858481	3300037853	Bacteria	17713
868	Ga0436364_0891745	3300037853	Bacteria	1734
869	Ga0436364_0932176	3300037853	Bacteria	1054
870	Ga0436364_1059010	3300037853	Bacteria	60327
871	Ga0395901_0020046	3300038443	Bacteria	6842
872	Ga0395901_0029954	3300038443	Bacteria	5606
873	Ga0395901_0043581	3300038443	Bacteria	4653
874	Ga0395901_0203596	3300038443	Bacteria	2074
875	Ga0395901_0362343	3300038443	Bacteria	1495
876	Ga0395901_0373590	3300038443	Bacteria	1468
877	Ga0395901_0488586	3300038443	Bacteria	1255
878	Ga0395901_0516645	3300038443	Bacteria	1214
879	Ga0395901_0594418	3300038443	Bacteria	1116
880	Ga0395901_0749100	3300038443	Bacteria	970
881	Ga0395901_1081816	3300038443	Bacteria	773
882	Ga0436365_0144311	3300039437	Bacteria	2167
883	Ga0436365_0789144	3300039437	Bacteria	4499
884	Ga0436365_1434079	3300039437	Bacteria	3109
885	Ga0436360_0666661	3300039438	Bacteria	1110
886	Ga0436363_0382238	3300039450	Bacteria	980
887	Ga0436363_0859415	3300039450	Bacteria	1353
888	Ga0436363_0995323	3300039450	Bacteria	822
889	Ga0436362_0025783	3300039453	Bacteria	1834
890	Ga0436362_0488032	3300039453	Bacteria	1153
891	Ga0436362_0638503	3300039453	Bacteria	900
892	Ga0436362_0944772	3300039453	Bacteria	1445
893	Ga0439436_0000221	3300041404	Bacteria	13685
894	Ga0439436_0000369	3300041404	Bacteria	11193
895	Ga0439436_0008523	3300041404	Bacteria	3154
896	Ga0439439_0004672	3300041406	Bacteria	3094
897	Ga0439439_0071063	3300041406	Bacteria	932
898	Ga0439439_0076794	3300041406	Bacteria	899
899	Ga0439466_0037874	3300041411	Bacteria	1622
900	Ga0451789_0394708	3300041443	Bacteria	864
901	Ga0451793_1930165	3300041452	Bacteria	1084
902	Ga0451833_1303516	3300041491	Bacteria	1405
903	Ga0451837_0319373	3300041494	Bacteria	3822
904	Ga0439433_0001075	3300041999	Bacteria	5544
905	Ga0439433_0007557	3300041999	Bacteria	2348
906	Ga0439448_0049198	3300042005	Bacteria	1378
907	Ga0439448_0085699	3300042005	Bacteria	1061
908	Ga0439449_0001351	3300042007	Bacteria	9619
909	Ga0439449_0047792	3300042007	Bacteria	1584
910	Ga0439449_0139201	3300042007	Bacteria	903
911	Ga0439457_000912	3300042014	Bacteria	8905
912	Ga0439457_003251	3300042014	Bacteria	4457
913	Ga0439462_0003322	3300042015	Bacteria	3850
914	Ga0450888_023225	3300042126	Bacteria	800
915	Ga0450890_004402	3300042127	Bacteria	1841
916	Ga0450897_002158	3300042128	Bacteria	1441
917	Ga0450894_000165	3300042131	Bacteria	11729
918	Ga0450895_001091	3300042132	Bacteria	1809
919	Ga0450896_000843	3300042133	Bacteria	3488
920	Ga0450898_026543	3300042134	Bacteria	1044
921	Ga0450900_017926	3300042136	Bacteria	968
922	Ga0450902_004816	3300042137	Bacteria	2018
923	Ga0450903_003902	3300042138	Bacteria	2562
924	Ga0450906_002967	3300042145	Bacteria	3681
925	Ga0439458_0005305	3300042157	Bacteria	2899
926	Ga0450908_000484	3300042184	Bacteria	7648
927	Ga0439460_0064916	3300042461	Bacteria	1121
928	Ga0466969_0011075	3300044656	Bacteria	4776
929	Ga0466969_0014683	3300044656	Bacteria	4117
930	Ga0466969_0029467	3300044656	Bacteria	2802
931	Ga0466969_0140123	3300044656	Bacteria	1118
932	Ga0466972_0003842	3300044658	Bacteria	7474
933	Ga0466972_0003903	3300044658	Bacteria	7432
934	Ga0466972_0010829	3300044658	Bacteria	4578
935	Ga0466972_0143263	3300044658	Bacteria	1124
936	Ga0466965_0000304	3300044683	Bacteria	16357
937	Ga0466965_0028551	3300044683	Bacteria	2711
938	Ga0466965_0042100	3300044683	Bacteria	2251
939	Ga0466965_0104011	3300044683	Bacteria	1454
940	Ga0466965_0171166	3300044683	Bacteria	1143
941	Ga0466965_0198379	3300044683	Bacteria	1064
942	Ga0466966_0008603	3300044684	Bacteria	6757
943	Ga0466966_0043489	3300044684	Bacteria	2879
944	Ga0466966_0045850	3300044684	Bacteria	2793
945	Ga0466966_0050263	3300044684	Bacteria	2653
946	Ga0466966_0063589	3300044684	Bacteria	2325
947	Ga0466966_0457228	3300044684	Bacteria	767
948	Ga0466961_0006417	3300044693	Bacteria	7468
949	Ga0466961_0009741	3300044693	Bacteria	6114
950	Ga0466961_0094517	3300044693	Bacteria	1886
951	Ga0466961_0219468	3300044693	Bacteria	1172
952	Ga0466961_0219638	3300044693	Bacteria	1172
953	Ga0466961_0281864	3300044693	Bacteria	1017
954	Ga0466963_0001543	3300044694	Bacteria	12482
955	Ga0466963_0001954	3300044694	Bacteria	11303
956	Ga0466963_0004547	3300044694	Bacteria	8078
957	Ga0466963_0032003	3300044694	Bacteria	3403
958	Ga0466963_0038082	3300044694	Bacteria	3144
959	Ga0466963_0054026	3300044694	Bacteria	2669
960	Ga0466963_0074239	3300044694	Bacteria	2293
961	Ga0466963_0083702	3300044694	Bacteria	2164
962	Ga0466963_0096421	3300044694	Bacteria	2020
963	Ga0466963_0318529	3300044694	Bacteria	1094
964	Ga0466964_0009875	3300044706	Bacteria	3597
965	Ga0466971_0006461	3300044719	Bacteria	5092
966	Ga0466971_0011590	3300044719	Bacteria	3861
967	Ga0466971_0028559	3300044719	Bacteria	2495
968	Ga0466971_0034980	3300044719	Bacteria	2252
969	Ga0466971_0041072	3300044719	Bacteria	2077
970	Ga0466971_0041165	3300044719	Bacteria	2075
971	Ga0466971_0280450	3300044719	Bacteria	797
972	Ga0466970_0000179	3300044765	Bacteria	30305
973	Ga0466970_0006119	3300044765	Bacteria	5995
974	Ga0466970_0096053	3300044765	Bacteria	1611
975	Ga0466970_0119935	3300044765	Bacteria	1440
976	Ga0466970_0272429	3300044765	Bacteria	951
977	Ga0466957_0001101	3300044842	Bacteria	13974
978	Ga0466957_0046598	3300044842	Bacteria	2632
979	Ga0466957_0047119	3300044842	Bacteria	2618
980	Ga0466957_0236810	3300044842	Bacteria	1210
981	Ga0466957_0269937	3300044842	Bacteria	1136
982	Ga0466957_0355331	3300044842	Bacteria	995
983	Ga0466960_0002996	3300044901	Bacteria	6441
984	Ga0466960_0043520	3300044901	Bacteria	2136
985	Ga0466960_0184606	3300044901	Bacteria	1132
986	Ga0466960_0310670	3300044901	Bacteria	890
987	Ga0466959_0002789	3300045049	Bacteria	11249
988	Ga0466959_0064052	3300045049	Bacteria	2669
989	Ga0466959_0080783	3300045049	Bacteria	2343
990	Ga0466959_0353256	3300045049	Bacteria	1002
991	Ga0466958_0010946	3300045836	Bacteria	5096
992	Ga0466958_0014015	3300045836	Bacteria	4573
993	Ga0466958_0019871	3300045836	Bacteria	3913
994	Ga0466958_0032131	3300045836	Bacteria	3121
995	Ga0466958_0241273	3300045836	Bacteria	1155
996	Ga0466958_0248102	3300045836	Bacteria	1138
997	Ga0466958_0315677	3300045836	Bacteria	1004
998	Ga0466967_0011410	3300045976	Bacteria	6728
999	Ga0466967_0028007	3300045976	Bacteria	4696
1000	Ga0466967_0031778	3300045976	Bacteria	4450
1001	Ga0466967_0065600	3300045976	Bacteria	3232
1002	Ga0466967_0128608	3300045976	Bacteria	2349
1003	Ga0466967_0155973	3300045976	Bacteria	2138
1004	Ga0466967_0211964	3300045976	Bacteria	1837
1005	Ga0466967_0415282	3300045976	Bacteria	1311
1006	Ga0466967_0519108	3300045976	Bacteria	1170
1007	Ga0466967_0678940	3300045976	Bacteria	1019
1008	Ga0466967_0776438	3300045976	Bacteria	951
1009	Ga0466967_1004868	3300045976	Bacteria	830
1010	Ga0466967_1075215	3300045976	Bacteria	801
1011	Ga0466967_1298927	3300045976	Bacteria	725
1012	Ga0495617_002534	3300046452	Bacteria	7221
1013	Ga0495617_157897	3300046452	Bacteria	720
1014	Ga0495627_013158	3300046453	Bacteria	2916
1015	Ga0495627_042990	3300046453	Bacteria	1383
1016	Ga0495592_0000049	3300046454	Bacteria	113704
1017	Ga0495592_0014903	3300046454	Bacteria	5899
1018	Ga0495592_0040961	3300046454	Bacteria	3473
1019	Ga0495592_0046032	3300046454	Bacteria	3253
1020	Ga0495592_0070946	3300046454	Bacteria	2536
1021	Ga0495592_0074524	3300046454	Bacteria	2465
1022	Ga0495592_0099155	3300046454	Bacteria	2078
1023	Ga0495603_0001554	3300046455	Bacteria	13423
1024	Ga0495603_0001594	3300046455	Bacteria	13301
1025	Ga0495603_0013288	3300046455	Bacteria	4977
1026	Ga0495603_0016215	3300046455	Bacteria	4507
1027	Ga0495603_0031472	3300046455	Bacteria	3194
1028	Ga0495603_0046082	3300046455	Bacteria	2599
1029	Ga0495603_0082929	3300046455	Bacteria	1877
1030	Ga0495603_0146545	3300046455	Bacteria	1372
1031	Ga0495603_0364295	3300046455	Bacteria	829
1032	Ga0495590_0022011	3300046457	Bacteria	2256
1033	Ga0495590_0044639	3300046457	Bacteria	1545
1034	Ga0495590_0093346	3300046457	Bacteria	1066
1035	Ga0495629_0002112	3300046459	Bacteria	15396
1036	Ga0495629_0010288	3300046459	Bacteria	6813
1037	Ga0495629_0048873	3300046459	Bacteria	2965
1038	Ga0495629_0050531	3300046459	Bacteria	2911
1039	Ga0495629_0056568	3300046459	Bacteria	2742
1040	Ga0495629_0093561	3300046459	Bacteria	2097
1041	Ga0495629_0109496	3300046459	Bacteria	1926
1042	Ga0495629_0186003	3300046459	Bacteria	1439
1043	Ga0495629_0188609	3300046459	Bacteria	1427
1044	Ga0495629_0366042	3300046459	Bacteria	982
1045	Ga0495638_0051975	3300046460	Bacteria	2554
1046	Ga0495638_0077718	3300046460	Bacteria	2020
1047	Ga0495638_0152161	3300046460	Bacteria	1341
1048	Ga0495638_0163491	3300046460	Bacteria	1282
1049	Ga0495641_0006736	3300046461	Bacteria	7379
1050	Ga0495641_0016436	3300046461	Bacteria	3899
1051	Ga0495641_0025068	3300046461	Bacteria	2930
1052	Ga0495641_0065678	3300046461	Bacteria	1633
1053	Ga0495641_0122110	3300046461	Bacteria	1162
1054	Ga0495641_0174597	3300046461	Bacteria	961
1055	Ga0495651_0000007	3300046462	Bacteria	158577
1056	Ga0495651_0001322	3300046462	Bacteria	19203
1057	Ga0495651_0001709	3300046462	Bacteria	16956
1058	Ga0495651_0011440	3300046462	Bacteria	6817
1059	Ga0495651_0013776	3300046462	Bacteria	6252
1060	Ga0495651_0032077	3300046462	Bacteria	4098
1061	Ga0495651_0047460	3300046462	Bacteria	3320
1062	Ga0495651_0196207	3300046462	Bacteria	1416
1063	Ga0495651_0276742	3300046462	Bacteria	1135
1064	Ga0495653_0002706	3300046463	Bacteria	14128
1065	Ga0495653_0009356	3300046463	Bacteria	8017
1066	Ga0495653_0011729	3300046463	Bacteria	7155
1067	Ga0495653_0069063	3300046463	Bacteria	2648
1068	Ga0495653_0069203	3300046463	Bacteria	2645
1069	Ga0495653_0072394	3300046463	Bacteria	2573
1070	Ga0495653_0076433	3300046463	Bacteria	2489
1071	Ga0495653_0105415	3300046463	Bacteria	2035
1072	Ga0495653_0187823	3300046463	Bacteria	1412
1073	Ga0495580_0088787	3300046472	Bacteria	2152
1074	Ga0495580_0116065	3300046472	Bacteria	1859
1075	Ga0495580_0203805	3300046472	Bacteria	1362
1076	Ga0495582_0008843	3300046473	Bacteria	5555
1077	Ga0495582_0018157	3300046473	Bacteria	3849
1078	Ga0495582_0019820	3300046473	Bacteria	3677
1079	Ga0495582_0034601	3300046473	Bacteria	2777
1080	Ga0495582_0097616	3300046473	Bacteria	1643
1081	Ga0495582_0173155	3300046473	Bacteria	1229
1082	Ga0495605_0019223	3300046474	Bacteria	3654
1083	Ga0495605_0081391	3300046474	Bacteria	1514
1084	Ga0495605_0145250	3300046474	Bacteria	1061
1085	Ga0495639_0008986	3300046475	Bacteria	4283
1086	Ga0495639_0010613	3300046475	Bacteria	3967
1087	Ga0495639_0022556	3300046475	Bacteria	2762
1088	Ga0495639_0077375	3300046475	Bacteria	1544
1089	Ga0495639_0142709	3300046475	Bacteria	1152
1090	Ga0495662_0000163	3300046476	Bacteria	26131
1091	Ga0495662_0010357	3300046476	Bacteria	4568
1092	Ga0495662_0015181	3300046476	Bacteria	3741
1093	Ga0495662_0051644	3300046476	Bacteria	1985
1094	Ga0495662_0065279	3300046476	Bacteria	1759
1095	Ga0495662_0103865	3300046476	Bacteria	1390
1096	Ga0495664_0001047	3300046477	Bacteria	14288
1097	Ga0495664_0005749	3300046477	Bacteria	6829
1098	Ga0495664_0012698	3300046477	Bacteria	4770
1099	Ga0495664_0032570	3300046477	Bacteria	3059
1100	Ga0495664_0049010	3300046477	Bacteria	2507
1101	Ga0495664_0049582	3300046477	Bacteria	2492
1102	Ga0495664_0051332	3300046477	Bacteria	2448
1103	Ga0495664_0077271	3300046477	Bacteria	1993
1104	Ga0495664_0198339	3300046477	Bacteria	1216
1105	Ga0495664_0299212	3300046477	Bacteria	971
1106	Ga0495585_0003798	3300046492	Bacteria	10058
1107	Ga0495585_0031254	3300046492	Bacteria	3023
1108	Ga0495594_0016102	3300046499	Bacteria	3934
1109	Ga0495594_0020549	3300046499	Bacteria	3517
1110	Ga0495594_0057855	3300046499	Bacteria	2141
1111	Ga0495594_0113890	3300046499	Bacteria	1526
1112	Ga0495594_0128827	3300046499	Bacteria	1432
1113	Ga0495594_0326107	3300046499	Bacteria	874
1114	Ga0495596_0050341	3300046500	Bacteria	1632
1115	Ga0495607_0254833	3300046501	Bacteria	843
1116	Ga0495606_0013625	3300046507	Bacteria	6410
1117	Ga0495608_0000015	3300046511	Bacteria	200266
1118	Ga0495608_0017575	3300046511	Bacteria	4946
1119	Ga0495608_0021907	3300046511	Bacteria	4382
1120	Ga0495608_0024177	3300046511	Bacteria	4156
1121	Ga0495608_0155193	3300046511	Bacteria	1457
1122	Ga0495608_0159614	3300046511	Bacteria	1434
1123	Ga0495608_0202332	3300046511	Bacteria	1251
1124	Ga0495608_0366617	3300046511	Bacteria	885
1125	Ga0495610_0004959	3300046512	Bacteria	9640
1126	Ga0495616_0008463	3300046513	Bacteria	6094
1127	Ga0495618_0006907	3300046514	Bacteria	6881
1128	Ga0495618_0024295	3300046514	Bacteria	3753
1129	Ga0495618_0089136	3300046514	Bacteria	1972
1130	Ga0495618_0092236	3300046514	Bacteria	1936
1131	Ga0495618_0101126	3300046514	Bacteria	1845
1132	Ga0495618_0154577	3300046514	Bacteria	1464
1133	Ga0495618_0167406	3300046514	Bacteria	1399
1134	Ga0495618_0179717	3300046514	Bacteria	1345
1135	Ga0495620_0047482	3300046515	Bacteria	1847
1136	Ga0495620_0224594	3300046515	Bacteria	718
1137	Ga0495628_0001681	3300046516	Bacteria	20199
1138	Ga0495628_0002433	3300046516	Bacteria	16783
1139	Ga0495628_0025594	3300046516	Bacteria	4820
1140	Ga0495628_0074087	3300046516	Bacteria	2653
1141	Ga0495628_0095221	3300046516	Bacteria	2300
1142	Ga0495628_0116863	3300046516	Bacteria	2048
1143	Ga0495628_0161075	3300046516	Bacteria	1705
1144	Ga0495628_0184372	3300046516	Bacteria	1577
1145	Ga0495628_0219730	3300046516	Bacteria	1427
1146	Ga0495630_0003597	3300046517	Bacteria	10796
1147	Ga0495630_0030861	3300046517	Bacteria	3989
1148	Ga0495630_0131528	3300046517	Bacteria	1900
1149	Ga0495630_0303413	3300046517	Bacteria	1220
1150	Ga0495630_0333377	3300046517	Bacteria	1160
1151	Ga0495631_0005911	3300046518	Bacteria	6370
1152	Ga0495637_0058397	3300046520	Bacteria	1590
1153	Ga0495643_0012121	3300046522	Bacteria	5211
1154	Ga0495648_0151473	3300046524	Bacteria	1209
1155	Ga0495666_0026609	3300046526	Bacteria	2850
1156	Ga0495666_0093232	3300046526	Bacteria	1420
1157	Ga0495666_0123361	3300046526	Bacteria	1212
1158	Ga0495666_0179321	3300046526	Bacteria	978
1159	Ga0495642_0287921	3300046528	Bacteria	719
1160	Ga0495652_0001157	3300046529	Bacteria	29740
1161	Ga0495652_0001969	3300046529	Bacteria	21864
1162	Ga0495652_0046161	3300046529	Bacteria	3741
1163	Ga0495652_0049508	3300046529	Bacteria	3597
1164	Ga0495652_0061099	3300046529	Bacteria	3182
1165	Ga0495652_0064207	3300046529	Bacteria	3088
1166	Ga0495652_0073989	3300046529	Bacteria	2834
1167	Ga0495652_0284389	3300046529	Bacteria	1209
1168	Ga0495652_0389385	3300046529	Bacteria	989
1169	Ga0495654_0052892	3300046530	Bacteria	1975
1170	Ga0495665_0004214	3300046531	Bacteria	7765
1171	Ga0495665_0004805	3300046531	Bacteria	7292
1172	Ga0495665_0034731	3300046531	Bacteria	2696
1173	Ga0495665_0046298	3300046531	Bacteria	2310
1174	Ga0495665_0166448	3300046531	Bacteria	1148
1175	Ga0495640_0005364	3300046533	Bacteria	10196
1176	Ga0495640_0008144	3300046533	Bacteria	8232
1177	Ga0495640_0056612	3300046533	Bacteria	2678
1178	Ga0495640_0074622	3300046533	Bacteria	2267
1179	Ga0495640_0088651	3300046533	Bacteria	2044
1180	Ga0495640_0099308	3300046533	Bacteria	1912
1181	Ga0495640_0104125	3300046533	Bacteria	1860
1182	Ga0495640_0165867	3300046533	Bacteria	1413
1183	Ga0495640_0176501	3300046533	Bacteria	1363
1184	Ga0495640_0268862	3300046533	Bacteria	1063
1185	Ga0495586_0030108	3300046535	Bacteria	2905
1186	Ga0495586_0071294	3300046535	Bacteria	1898
1187	Ga0495587_0000032	3300046536	Bacteria	124143
1188	Ga0495587_0004304	3300046536	Bacteria	9399
1189	Ga0495587_0030319	3300046536	Bacteria	3280
1190	Ga0495587_0036355	3300046536	Bacteria	2962
1191	Ga0495587_0046097	3300046536	Bacteria	2588
1192	Ga0495587_0157803	3300046536	Bacteria	1292
1193	Ga0495587_0167586	3300046536	Bacteria	1248
1194	Ga0495609_0008249	3300046538	Bacteria	5114
1195	Ga0495597_0073531	3300046542	Bacteria	1469
1196	Ga0495645_0013643	3300046543	Bacteria	5755
1197	Ga0495645_0016859	3300046543	Bacteria	5228
1198	Ga0495645_0061156	3300046543	Bacteria	2729
1199	Ga0495645_0062886	3300046543	Bacteria	2688
1200	Ga0495645_0068949	3300046543	Bacteria	2552
1201	Ga0495645_0096810	3300046543	Bacteria	2102
1202	Ga0495645_0099814	3300046543	Bacteria	2065
1203	Ga0495645_0162284	3300046543	Bacteria	1544
1204	Ga0495645_0242182	3300046543	Bacteria	1203
1205	Ga0495645_0267136	3300046543	Bacteria	1130
1206	Ga0495622_0005947	3300046557	Bacteria	5669
1207	Ga0495622_0021107	3300046557	Bacteria	3034
1208	Ga0495633_0288298	3300046558	Bacteria	746
1209	Ga0495667_0008628	3300046559	Bacteria	6920
1210	Ga0495667_0014297	3300046559	Bacteria	5361
1211	Ga0495667_0127095	3300046559	Bacteria	1644
1212	Ga0495667_0144359	3300046559	Bacteria	1533
1213	Ga0495667_0162988	3300046559	Bacteria	1434
1214	Ga0495667_0194755	3300046559	Bacteria	1298
1215	Ga0495634_0006405	3300046642	Bacteria	8947
1216	Ga0495634_0006867	3300046642	Bacteria	8606
1217	Ga0495634_0016697	3300046642	Bacteria	5245
1218	Ga0495634_0024117	3300046642	Bacteria	4271
1219	Ga0495634_0029978	3300046642	Bacteria	3761
1220	Ga0495634_0030299	3300046642	Bacteria	3738
1221	Ga0495634_0233947	3300046642	Bacteria	1129
1222	Ga0495611_0069557	3300046648	Bacteria	1608
1223	Ga0495611_0090842	3300046648	Bacteria	1411
1224	Ga0495625_0001776	3300046660	Bacteria	24861
1225	Ga0495625_0038628	3300046660	Bacteria	3493
1226	Ga0495625_0070707	3300046660	Bacteria	2450
1227	Ga0495625_0150283	3300046660	Bacteria	1566
1228	Ga0495635_0002928	3300046663	Bacteria	11723
1229	Ga0495635_0006534	3300046663	Bacteria	8136
1230	Ga0495635_0014928	3300046663	Bacteria	5434
1231	Ga0495635_0016716	3300046663	Bacteria	5125
1232	Ga0495635_0030421	3300046663	Bacteria	3752
1233	Ga0495635_0041587	3300046663	Bacteria	3174
1234	Ga0495635_0231708	3300046663	Bacteria	1248
1235	Ga0495659_0115846	3300046664	Bacteria	1051
1236	Ga0495661_0021386	3300046665	Bacteria	4218
1237	Ga0495588_0005660	3300046674	Bacteria	5572
1238	Ga0495588_0030229	3300046674	Bacteria	2722
1239	Ga0495588_0053948	3300046674	Bacteria	2073
1240	Ga0495657_0000106	3300046675	Bacteria	74585
1241	Ga0495657_0002543	3300046675	Bacteria	15305
1242	Ga0495657_0005981	3300046675	Bacteria	9551
1243	Ga0495657_0012582	3300046675	Bacteria	6279
1244	Ga0495657_0016670	3300046675	Bacteria	5347
1245	Ga0495657_0020771	3300046675	Bacteria	4720
1246	Ga0495657_0036983	3300046675	Bacteria	3368
1247	Ga0495657_0060941	3300046675	Bacteria	2497
1248	Ga0495657_0111171	3300046675	Bacteria	1735
1249	Ga0495657_0265243	3300046675	Bacteria	1031
1250	Ga0495657_0409050	3300046675	Bacteria	797
1251	Ga0495599_0000414	3300046678	Bacteria	24387
1252	Ga0495599_0006481	3300046678	Bacteria	7065
1253	Ga0495599_0016216	3300046678	Bacteria	4624
1254	Ga0495599_0032519	3300046678	Bacteria	3274
1255	Ga0495599_0054425	3300046678	Bacteria	2506
1256	Ga0495599_0089821	3300046678	Bacteria	1917
1257	Ga0495623_0009879	3300046679	Bacteria	6182
1258	Ga0495623_0019308	3300046679	Bacteria	4406
1259	Ga0495623_0025742	3300046679	Bacteria	3789
1260	Ga0495623_0050810	3300046679	Bacteria	2625
1261	Ga0495623_0107046	3300046679	Bacteria	1698
1262	Ga0495623_0252520	3300046679	Bacteria	991
1263	Ga0495623_0332636	3300046679	Bacteria	831
1264	Ga0495646_0002859	3300046680	Bacteria	10688
1265	Ga0495646_0018949	3300046680	Bacteria	4357
1266	Ga0495646_0020936	3300046680	Bacteria	4135
1267	Ga0495646_0036623	3300046680	Bacteria	3038
1268	Ga0495646_0038583	3300046680	Bacteria	2948
1269	Ga0495646_0080871	3300046680	Bacteria	1894
1270	Ga0495646_0122320	3300046680	Bacteria	1471
1271	Ga0495647_0084457	3300046681	Bacteria	1292
1272	Ga0495658_0047240	3300046683	Bacteria	2423
1273	Ga0495658_0048373	3300046683	Bacteria	2398
1274	Ga0495658_0065618	3300046683	Bacteria	2094
1275	Ga0495658_0105565	3300046683	Bacteria	1687
1276	Ga0495658_0456303	3300046683	Bacteria	816
1277	Ga0495613_0002345	3300046689	Bacteria	14347
1278	Ga0495613_0024867	3300046689	Bacteria	4462
1279	Ga0495613_0048617	3300046689	Bacteria	3132
1280	Ga0495613_0052053	3300046689	Bacteria	3016
1281	Ga0495613_0094091	3300046689	Bacteria	2168
1282	Ga0495613_0159831	3300046689	Bacteria	1603
1283	Ga0495613_0250314	3300046689	Bacteria	1236
1284	Ga0495613_0524589	3300046689	Bacteria	795
1285	Ga0495613_0601785	3300046689	Bacteria	731
1286	Ga0495624_0001191	3300046690	Bacteria	20556
1287	Ga0495624_0002632	3300046690	Bacteria	13550
1288	Ga0495624_0042798	3300046690	Bacteria	2893
1289	Ga0495624_0057229	3300046690	Bacteria	2451
1290	Ga0495624_0082408	3300046690	Bacteria	1991
1291	Ga0495624_0129313	3300046690	Bacteria	1549
1292	Ga0495624_0275902	3300046690	Bacteria	1015
1293	Ga0495624_0284273	3300046690	Bacteria	998
1294	Ga0495624_0359452	3300046690	Bacteria	875
1295	Ga0495670_0034029	3300046691	Bacteria	2536
1296	Ga0495670_0073647	3300046691	Bacteria	1731
1297	Ga0495671_0104479	3300046692	Bacteria	1383
1298	Ga0495649_0058252	3300046694	Bacteria	2082
1299	Ga0495649_0070923	3300046694	Bacteria	1867
1300	Ga0495589_0004731	3300046794	Bacteria	7225
1301	Ga0495589_0043120	3300046794	Bacteria	2246
1302	Ga0495589_0045168	3300046794	Bacteria	2189
1303	Ga0495589_0168512	3300046794	Bacteria	1041
1304	Ga0495600_0001446	3300046809	Bacteria	13159
1305	Ga0495600_0004594	3300046809	Bacteria	8270
1306	Ga0495600_0012322	3300046809	Bacteria	5344
1307	Ga0495600_0016101	3300046809	Bacteria	4739
1308	Ga0495600_0020341	3300046809	Bacteria	4246
1309	Ga0495600_0022349	3300046809	Bacteria	4059
1310	Ga0495600_0096553	3300046809	Bacteria	1926
1311	Ga0495600_0112553	3300046809	Bacteria	1772
1312	Ga0495600_0309098	3300046809	Bacteria	996
1313	Ga0495660_0012621	3300046810	Bacteria	4903
1314	Ga0495660_0255896	3300046810	Bacteria	810
1315	Ga0495581_0030122	3300047315	Bacteria	3145
1316	Ga0495581_0037431	3300047315	Bacteria	2808
1317	Ga0495581_0040774	3300047315	Bacteria	2685
1318	Ga0495581_0053224	3300047315	Bacteria	2338
1319	Ga0495581_0064372	3300047315	Bacteria	2118
1320	Ga0495604_0000062	3300047317	Bacteria	93264
1321	Ga0495604_0000878	3300047317	Bacteria	25046
1322	Ga0495604_0016358	3300047317	Bacteria	5929
1323	Ga0495604_0031341	3300047317	Bacteria	4216
1324	Ga0495604_0053909	3300047317	Bacteria	3105
1325	Ga0495604_0063208	3300047317	Bacteria	2824
1326	Ga0495604_0074780	3300047317	Bacteria	2552
1327	Ga0495604_0097092	3300047317	Bacteria	2173
1328	Ga0495604_0136584	3300047317	Bacteria	1756
1329	Ga0495604_0199151	3300047317	Bacteria	1390
1330	Ga0495604_0199416	3300047317	Bacteria	1389
1331	Ga0495604_0262792	3300047317	Bacteria	1172
1332	Ga0495636_0023512	3300047318	Bacteria	2495
1333	Ga0495636_0127015	3300047318	Bacteria	1132
1334	Ga0495674_0000654	3300047319	Bacteria	32473
1335	Ga0495674_0014303	3300047319	Bacteria	7431
1336	Ga0495674_0028679	3300047319	Bacteria	5070
1337	Ga0495674_0042670	3300047319	Bacteria	4044
1338	Ga0495674_0103586	3300047319	Bacteria	2419
1339	Ga0495674_0120346	3300047319	Bacteria	2218
1340	Ga0495674_0169028	3300047319	Bacteria	1825
1341	Ga0495672_0051574	3300047320	Bacteria	2422
1342	Ga0495676_0000150	3300047321	Bacteria	53407
1343	Ga0495676_0001728	3300047321	Bacteria	19083
1344	Ga0495676_0005833	3300047321	Bacteria	11302
1345	Ga0495676_0007138	3300047321	Bacteria	10251
1346	Ga0495676_0023708	3300047321	Bacteria	5321
1347	Ga0495676_0036064	3300047321	Bacteria	4132
1348	Ga0495676_0066375	3300047321	Bacteria	2796
1349	Ga0495676_0096520	3300047321	Bacteria	2197
1350	Ga0495676_0103858	3300047321	Bacteria	2097
1351	Ga0495676_0198921	3300047321	Bacteria	1393
1352	Ga0495680_0001896	3300047322	Bacteria	21959
1353	Ga0495680_0016084	3300047322	Bacteria	6432
1354	Ga0495680_0018955	3300047322	Bacteria	5827
1355	Ga0495680_0020371	3300047322	Bacteria	5581
1356	Ga0495680_0022021	3300047322	Bacteria	5322
1357	Ga0495680_0047137	3300047322	Bacteria	3392
1358	Ga0495680_0050025	3300047322	Bacteria	3269
1359	Ga0495680_0057203	3300047322	Bacteria	3016
1360	Ga0495680_0060126	3300047322	Bacteria	2931
1361	Ga0495680_0089175	3300047322	Bacteria	2315
1362	Ga0495680_0102082	3300047322	Bacteria	2136
1363	Ga0495680_0144920	3300047322	Bacteria	1735
1364	Ga0495687_002534	3300047443	Bacteria	14481
1365	Ga0495675_0014468	3300047444	Bacteria	4986
1366	Ga0495675_0017619	3300047444	Bacteria	4528
1367	Ga0495675_0023625	3300047444	Bacteria	3918
1368	Ga0495675_0102866	3300047444	Bacteria	1786
1369	Ga0495675_0161720	3300047444	Bacteria	1378
1370	Ga0495677_0057656	3300047445	Bacteria	1436
1371	Ga0495685_001035	3300047447	Bacteria	8466
1372	Ga0495685_018250	3300047447	Bacteria	2406
1373	Ga0495685_136430	3300047447	Bacteria	800
1374	Ga0495685_166961	3300047447	Bacteria	711
1375	Ga0495681_0001177	3300047470	Bacteria	19878
1376	Ga0495681_0011246	3300047470	Bacteria	5348
1377	Ga0495681_0102854	3300047470	Bacteria	1246
1378	Ga0495684_0004087	3300047471	Bacteria	11395
1379	Ga0495684_0007997	3300047471	Bacteria	8174
1380	Ga0495684_0016230	3300047471	Bacteria	5734
1381	Ga0495684_0041054	3300047471	Bacteria	3546
1382	Ga0495684_0050658	3300047471	Bacteria	3170
1383	Ga0495684_0076311	3300047471	Bacteria	2545
1384	Ga0495684_0116805	3300047471	Bacteria	2011
1385	Ga0495684_0392390	3300047471	Bacteria	976
1386	Ga0495686_0044711	3300047472	Bacteria	2803
1387	Ga0495686_0374598	3300047472	Bacteria	769
1388	Ga0495593_0008567	3300047673	Bacteria	5948
1389	Ga0495593_0023902	3300047673	Bacteria	3391
1390	Ga0495593_0059745	3300047673	Bacteria	1997
1391	Ga0495593_0071813	3300047673	Bacteria	1797
1392	Ga0495593_0115501	3300047673	Bacteria	1368
1393	Ga0495602_0002545	3300048088	Bacteria	18578
1394	Ga0495602_0028807	3300048088	Bacteria	5305
1395	Ga0495602_0063161	3300048088	Bacteria	3210
1396	Ga0495602_0094928	3300048088	Bacteria	2463
1397	Ga0495602_0135146	3300048088	Bacteria	1960
1398	Ga0495602_0148791	3300048088	Bacteria	1843
1399	Ga0495602_0194062	3300048088	Bacteria	1554
1400	Ga0495602_0215765	3300048088	Bacteria	1452
1401	Ga0495602_0363396	3300048088	Bacteria	1041
1402	Ga0495602_0449376	3300048088	Bacteria	910
1403	Ga0495614_0000611	3300048089	Bacteria	14956
1404	Ga0495614_0037662	3300048089	Bacteria	2075
1405	Ga0495614_0044088	3300048089	Bacteria	1913
1406	Ga0495614_0184814	3300048089	Bacteria	939
1407	Ga0495615_0113718	3300048090	Bacteria	777
1408	Ga0495626_0006328	3300048091	Bacteria	6752
1409	Ga0496100_0027737	3300048903	Bacteria	3485
1410	Ga0496100_0036636	3300048903	Bacteria	3096
1411	Ga0496100_0078631	3300048903	Bacteria	2220
1412	Ga0496100_0140651	3300048903	Bacteria	1710
1413	Ga0496100_0150672	3300048903	Bacteria	1658
1414	Ga0496100_0189882	3300048903	Bacteria	1491
1415	Ga0496100_0229831	3300048903	Bacteria	1364
1416	Ga0496101_0014873	3300048904	Bacteria	5237
1417	Ga0496101_0028793	3300048904	Bacteria	3881
1418	Ga0496101_0039436	3300048904	Bacteria	3359
1419	Ga0496101_0057875	3300048904	Bacteria	2805
1420	Ga0496101_0321634	3300048904	Bacteria	1214
1421	Ga0496101_0344703	3300048904	Bacteria	1170
1422	Ga0496101_0457770	3300048904	Bacteria	1007
1423	Ga0496102_0006769	3300048905	Bacteria	9780
1424	Ga0496102_0014285	3300048905	Bacteria	6901
1425	Ga0496102_0027853	3300048905	Bacteria	5047
1426	Ga0496102_0084947	3300048905	Bacteria	2922
1427	Ga0496102_0093131	3300048905	Bacteria	2791
1428	Ga0496102_0209726	3300048905	Bacteria	1837
1429	Ga0496102_0509021	3300048905	Bacteria	1126
1430	Ga0496102_0533770	3300048905	Bacteria	1096
1431	Ga0496102_0653434	3300048905	Bacteria	975
1432	Ga0496103_0020725	3300048906	Bacteria	3952
1433	Ga0496103_0039720	3300048906	Bacteria	2891
1434	Ga0496103_0044364	3300048906	Bacteria	2740
1435	Ga0496103_0641226	3300048906	Bacteria	675
1436	Ga0496104_0006175	3300048907	Bacteria	10521
1437	Ga0496104_0008256	3300048907	Bacteria	9245
1438	Ga0496104_0016097	3300048907	Bacteria	6787
1439	Ga0496104_0072280	3300048907	Bacteria	3280
1440	Ga0496104_0145656	3300048907	Bacteria	2274
1441	Ga0496104_0162629	3300048907	Bacteria	2141
1442	Ga0496104_0322655	3300048907	Bacteria	1457
1443	Ga0496104_0334357	3300048907	Bacteria	1427
1444	Ga0496104_0500953	3300048907	Bacteria	1126
1445	Ga0496104_0570064	3300048907	Bacteria	1042
1446	Ga0496104_0947992	3300048907	Bacteria	765
1447	Ga0496105_0000770	3300048908	Bacteria	21786
1448	Ga0496105_0001849	3300048908	Bacteria	15180
1449	Ga0496105_0018813	3300048908	Bacteria	5562
1450	Ga0496105_0032974	3300048908	Bacteria	4251
1451	Ga0496105_0059034	3300048908	Bacteria	3165
1452	Ga0496105_0066420	3300048908	Bacteria	2977
1453	Ga0496105_0192886	3300048908	Bacteria	1665
1454	Ga0496105_0387757	3300048908	Bacteria	1111
1455	Ga0496106_0105759	3300048909	Bacteria	2187
1456	Ga0496106_0260206	3300048909	Bacteria	1388
1457	Ga0496106_0267558	3300048909	Bacteria	1368
1458	Ga0496106_0351626	3300048909	Bacteria	1184
1459	Ga0496106_0552765	3300048909	Bacteria	924
1460	Ga0496107_0013004	3300048910	Bacteria	5815
1461	Ga0496107_0025724	3300048910	Bacteria	4168
1462	Ga0496107_0027912	3300048910	Bacteria	4009
1463	Ga0496107_0151938	3300048910	Bacteria	1713
1464	Ga0496107_0163235	3300048910	Bacteria	1652
1465	Ga0496107_0197521	3300048910	Bacteria	1495
1466	Ga0496107_0314608	3300048910	Bacteria	1165
1467	Ga0496107_0360825	3300048910	Bacteria	1081
1468	Ga0496107_0687800	3300048910	Bacteria	753
1469	Ga0496108_0001256	3300048911	Bacteria	19832
1470	Ga0496108_0056003	3300048911	Bacteria	3312
1471	Ga0496108_0076757	3300048911	Bacteria	2824
1472	Ga0496108_0077787	3300048911	Bacteria	2806
1473	Ga0496108_0156347	3300048911	Bacteria	1969
1474	Ga0496108_0170435	3300048911	Bacteria	1883
1475	Ga0496108_0242654	3300048911	Bacteria	1567
1476	Ga0496108_0274873	3300048911	Bacteria	1467
1477	Ga0496108_0347647	3300048911	Bacteria	1294
1478	Ga0496108_0373293	3300048911	Bacteria	1245
1479	Ga0496108_0778364	3300048911	Bacteria	826
1480	Ga0496109_0022092	3300048912	Bacteria	5631
1481	Ga0496109_0028644	3300048912	Bacteria	4984
1482	Ga0496109_0028918	3300048912	Bacteria	4962
1483	Ga0496109_0074823	3300048912	Bacteria	3114
1484	Ga0496109_0105066	3300048912	Bacteria	2622
1485	Ga0496109_0117542	3300048912	Bacteria	2475
1486	Ga0496109_0131240	3300048912	Bacteria	2338
1487	Ga0496109_0154342	3300048912	Bacteria	2150
1488	Ga0496109_0236245	3300048912	Bacteria	1720
1489	Ga0496109_0251297	3300048912	Bacteria	1665
1490	Ga0496109_0474045	3300048912	Bacteria	1182
1491	Ga0496110_0022947	3300048913	Bacteria	5303
1492	Ga0496110_0046500	3300048913	Bacteria	3797
1493	Ga0496110_0049751	3300048913	Bacteria	3678
1494	Ga0496110_0064333	3300048913	Bacteria	3241
1495	Ga0496110_0126849	3300048913	Bacteria	2303
1496	Ga0496110_0171323	3300048913	Bacteria	1969
1497	Ga0496110_0193491	3300048913	Bacteria	1847
1498	Ga0496110_0223498	3300048913	Bacteria	1712
1499	Ga0496110_0402112	3300048913	Bacteria	1248
1500	Ga0496110_0571790	3300048913	Bacteria	1026
1501	Ga0496110_0874104	3300048913	Bacteria	804
1502	Ga0496111_0001697	3300048914	Bacteria	12845
1503	Ga0496111_0017359	3300048914	Bacteria	4976
1504	Ga0496111_0019743	3300048914	Bacteria	4686
1505	Ga0496111_0020319	3300048914	Bacteria	4622
1506	Ga0496111_0035970	3300048914	Bacteria	3540
1507	Ga0496111_0044283	3300048914	Bacteria	3199
1508	Ga0496111_0347448	3300048914	Bacteria	1098
1509	Ga0496111_0490330	3300048914	Bacteria	905
1510	Ga0496112_0000586	3300048915	Bacteria	24986
1511	Ga0496112_0028415	3300048915	Bacteria	5398
1512	Ga0496112_0048959	3300048915	Bacteria	4141
1513	Ga0496112_0088303	3300048915	Bacteria	3068
1514	Ga0496112_0193140	3300048915	Bacteria	1997
1515	Ga0496112_0674093	3300048915	Bacteria	963
1516	Ga0496112_0905039	3300048915	Bacteria	804
1517	Ga0496113_0015052	3300048916	Bacteria	5299
1518	Ga0496113_0041324	3300048916	Bacteria	3402
1519	Ga0496113_0059184	3300048916	Bacteria	2885
1520	Ga0496113_0105996	3300048916	Bacteria	2183
1521	Ga0496113_0119118	3300048916	Bacteria	2062
1522	Ga0496113_0119629	3300048916	Bacteria	2058
1523	Ga0496114_0004150	3300048917	Bacteria	11208
1524	Ga0496114_0009285	3300048917	Bacteria	7804
1525	Ga0496114_0028823	3300048917	Bacteria	4559
1526	Ga0496114_0031007	3300048917	Bacteria	4398
1527	Ga0496114_0067269	3300048917	Bacteria	3005
1528	Ga0496114_0102807	3300048917	Bacteria	2441
1529	Ga0496114_0134724	3300048917	Bacteria	2135
1530	Ga0496114_0157514	3300048917	Bacteria	1972
1531	Ga0496114_0278431	3300048917	Bacteria	1474
1532	Ga0496114_0852798	3300048917	Bacteria	791
1533	Ga0496114_0908831	3300048917	Bacteria	762
1534	Ga0496115_0021963	3300048918	Bacteria	4935
1535	Ga0496115_0028311	3300048918	Bacteria	4390
1536	Ga0496115_0047442	3300048918	Bacteria	3435
1537	Ga0496115_0207876	3300048918	Bacteria	1617
1538	Ga0496115_0707159	3300048918	Bacteria	792
1539	Ga0496119_0000200	3300048922	Bacteria	84506
1540	Ga0496119_0000475	3300048922	Bacteria	54868
1541	Ga0496119_0026206	3300048922	Bacteria	4047
1542	Ga0496119_0054433	3300048922	Bacteria	2436
1543	Ga0496120_0000353	3300048923	Bacteria	75672
1544	Ga0496120_0002957	3300048923	Bacteria	16188
1545	Ga0496121_0014747	3300048924	Bacteria	8256
1546	Ga0496125_0293085	3300048928	Bacteria	1001
1547	Ga0496126_0004952	3300048929	Bacteria	15533
1548	Ga0496126_0026965	3300048929	Bacteria	5499
1549	Ga0496126_0043878	3300048929	Bacteria	4121
1550	Ga0496126_0184836	3300048929	Bacteria	1768
1551	Ga0496126_0438497	3300048929	Bacteria	1053
1552	Ga0495678_027678	3300049459	Bacteria	2402
1553	Ga0495682_0041301	3300049460	Bacteria	1691
1554	Ga0501031_0013166	3300049568	Bacteria	5398
1555	Ga0501031_0014095	3300049568	Bacteria	5201
1556	Ga0501031_0096162	3300049568	Bacteria	1933
1557	Ga0501031_0310468	3300049568	Bacteria	1022
1558	Ga0501031_0547186	3300049568	Bacteria	746
1559	Ga0501031_0577604	3300049568	Bacteria	723
1560	Ga0501032_0038311	3300049569	Bacteria	3265
1561	Ga0501032_0076296	3300049569	Bacteria	2232
1562	Ga0501032_0388240	3300049569	Bacteria	897
1563	Ga0501033_0006244	3300049570	Bacteria	9338
1564	Ga0501033_0032215	3300049570	Bacteria	3936
1565	Ga0501033_0034045	3300049570	Bacteria	3822
1566	Ga0501033_0111002	3300049570	Bacteria	1995
1567	Ga0501033_0144725	3300049570	Bacteria	1717
1568	Ga0501033_0150444	3300049570	Bacteria	1679
1569	Ga0501034_0007085	3300049571	Bacteria	11960
1570	Ga0501034_0008257	3300049571	Bacteria	11019
1571	Ga0501034_0036552	3300049571	Bacteria	4974
1572	Ga0501034_0062389	3300049571	Bacteria	3742
1573	Ga0501034_0581792	3300049571	Bacteria	1026
1574	Ga0501036_0000154	3300049572	Bacteria	45221
1575	Ga0501036_0007966	3300049572	Bacteria	8671
1576	Ga0501036_0010321	3300049572	Bacteria	7707
1577	Ga0501036_0017214	3300049572	Bacteria	6041
1578	Ga0501036_0046676	3300049572	Bacteria	3667
1579	Ga0501036_0304204	3300049572	Bacteria	1333
1580	Ga0501037_0006107	3300049573	Bacteria	8799
1581	Ga0501037_0016220	3300049573	Bacteria	5482
1582	Ga0501037_0050588	3300049573	Bacteria	3041
1583	Ga0501037_0093624	3300049573	Bacteria	2172
1584	Ga0501037_0629464	3300049573	Bacteria	718
1585	Ga0501038_0008899	3300049574	Bacteria	9212
1586	Ga0501038_0011859	3300049574	Bacteria	7955
1587	Ga0501038_0029152	3300049574	Bacteria	4894
1588	Ga0501038_0065187	3300049574	Bacteria	3104
1589	Ga0501038_0181013	3300049574	Bacteria	1700
1590	Ga0501038_0410994	3300049574	Bacteria	1045
1591	Ga0501039_0015284	3300049575	Bacteria	5875
1592	Ga0501039_0027179	3300049575	Bacteria	4399
1593	Ga0501039_0095901	3300049575	Bacteria	2312
1594	Ga0501039_0143434	3300049575	Bacteria	1876
1595	Ga0501039_0730034	3300049575	Bacteria	774
1596	Ga0501040_0028569	3300049576	Bacteria	3760
1597	Ga0501040_0092810	3300049576	Bacteria	2099
1598	Ga0501040_0267729	3300049576	Bacteria	1220
1599	Ga0501041_0016820	3300049577	Bacteria	4352
1600	Ga0501041_0020014	3300049577	Bacteria	3997
1601	Ga0501042_0003066	3300049578	Bacteria	10404
1602	Ga0501042_0033230	3300049578	Bacteria	3656
1603	Ga0501042_0034260	3300049578	Bacteria	3601
1604	Ga0501042_0084146	3300049578	Bacteria	2280
1605	Ga0501042_0506112	3300049578	Bacteria	877
1606	Ga0501043_0003227	3300049579	Bacteria	13459
1607	Ga0501043_0005709	3300049579	Bacteria	10024
1608	Ga0501043_0010922	3300049579	Bacteria	7112
1609	Ga0501043_0013418	3300049579	Bacteria	6407
1610	Ga0501043_0165569	3300049579	Bacteria	1726
1611	Ga0501043_0233097	3300049579	Bacteria	1421
1612	Ga0501046_0021502	3300049580	Bacteria	5323
1613	Ga0501046_0046370	3300049580	Bacteria	3449
1614	Ga0501046_0047282	3300049580	Bacteria	3411
1615	Ga0501046_0181215	3300049580	Bacteria	1575
1616	Ga0501047_0000033	3300049581	Bacteria	206961
1617	Ga0501047_0000369	3300049581	Bacteria	50837
1618	Ga0501047_0001481	3300049581	Bacteria	22897
1619	Ga0501047_0029209	3300049581	Bacteria	5317
1620	Ga0501047_0058613	3300049581	Bacteria	3719
1621	Ga0501047_0099451	3300049581	Bacteria	2787
1622	Ga0501047_0127143	3300049581	Bacteria	2429
1623	Ga0501047_0183674	3300049581	Bacteria	1957
1624	Ga0501047_0461742	3300049581	Bacteria	1098
1625	Ga0501048_0003583	3300049582	Bacteria	11820
1626	Ga0501048_0006936	3300049582	Bacteria	8607
1627	Ga0501048_0007884	3300049582	Bacteria	8067
1628	Ga0501048_0033083	3300049582	Bacteria	3736
1629	Ga0501048_0287186	3300049582	Bacteria	1170
1630	Ga0501067_0021266	3300049583	Bacteria	3589
1631	Ga0501067_0339433	3300049583	Bacteria	837
1632	Ga0501068_0013033	3300049584	Bacteria	4726
1633	Ga0501068_0066962	3300049584	Bacteria	2188
1634	Ga0501068_0126056	3300049584	Bacteria	1599
1635	Ga0501068_0388112	3300049584	Bacteria	899
1636	Ga0501069_0010447	3300049585	Bacteria	4913
1637	Ga0501069_0066819	3300049585	Bacteria	2011
1638	Ga0501069_0155485	3300049585	Bacteria	1315
1639	Ga0501070_0005487	3300049586	Bacteria	10819
1640	Ga0501070_0008402	3300049586	Bacteria	8720
1641	Ga0501070_0040771	3300049586	Bacteria	3871
1642	Ga0501070_0749249	3300049586	Bacteria	770
1643	Ga0501071_0000622	3300049587	Bacteria	18372
1644	Ga0501071_0015459	3300049587	Bacteria	5238
1645	Ga0501072_0042082	3300049588	Bacteria	3588
1646	Ga0501072_0097045	3300049588	Bacteria	2342
1647	Ga0501073_0061740	3300049589	Bacteria	2614
1648	Ga0501073_0206183	3300049589	Bacteria	1359
1649	Ga0501073_0306197	3300049589	Bacteria	1096
1650	Ga0501074_0003420	3300049590	Bacteria	11243
1651	Ga0501074_0004389	3300049590	Bacteria	10081
1652	Ga0501074_0012014	3300049590	Bacteria	6293
1653	Ga0501074_0062681	3300049590	Bacteria	2678
1654	Ga0501075_0056288	3300049591	Bacteria	2960
1655	Ga0501075_0234055	3300049591	Bacteria	1401
1656	Ga0501076_0002267	3300049592	Bacteria	13155
1657	Ga0501076_0096796	3300049592	Bacteria	2377
1658	Ga0501077_0048562	3300049593	Bacteria	2697
1659	Ga0501077_0067104	3300049593	Bacteria	2275
1660	Ga0501079_0016047	3300049741	Bacteria	5722
1661	Ga0501079_0103124	3300049741	Bacteria	2212
1662	Ga0501080_0032359	3300049742	Bacteria	4877
1663	Ga0501080_0057577	3300049742	Bacteria	3618
1664	Ga0501080_0064310	3300049742	Bacteria	3413
1665	Ga0501081_0036447	3300049743	Bacteria	3354
1666	Ga0501083_0001270	3300049744	Bacteria	17091
1667	Ga0501083_0151204	3300049744	Bacteria	1520
1668	Ga0501270_033114	3300049767	Bacteria	864
1669	Ga0501035_0050911	3300049822	Bacteria	3709
1670	Ga0501035_0151202	3300049822	Bacteria	2014
1671	Ga0501035_0171437	3300049822	Bacteria	1874
1672	Ga0501044_0003451	3300049823	Bacteria	17804
1673	Ga0501044_0014764	3300049823	Bacteria	8420
1674	Ga0501044_0032181	3300049823	Bacteria	5513
1675	Ga0501044_0042581	3300049823	Bacteria	4721
1676	Ga0501044_0043290	3300049823	Bacteria	4678
1677	Ga0501044_0117041	3300049823	Bacteria	2669
1678	Ga0501044_0168139	3300049823	Bacteria	2165
1679	Ga0501044_0292757	3300049823	Bacteria	1559
1680	Ga0501044_0677524	3300049823	Bacteria	918
1681	Ga0501045_0000424	3300049824	Bacteria	25806
1682	Ga0501045_0037402	3300049824	Bacteria	3527
1683	Ga0501045_0057284	3300049824	Bacteria	2852
1684	nmdc:mga03n38_7371_c1	3300050490	Bacteria	3889
1685	nmdc:mga0yw44_510969_c1	3300050492	Bacteria	815
1686	nmdc:mga05p37_145975_c1	3300050507	Bacteria	2897
1687	nmdc:mga05p37_37397_c1	3300050507	Bacteria	5951
1688	nmdc:mga06r32_521174_c1	3300050510	Bacteria	1164
1689	nmdc:mga08y16_127471_c1	3300050511	Bacteria	2647
1690	nmdc:mga08y16_198046_c1	3300050511	Bacteria	2082
1691	nmdc:mga0n895_21840_c1	3300050512	Bacteria	5992
1692	nmdc:mga0n895_23116_c1	3300050512	Bacteria	5839
1693	nmdc:mga0n895_261667_c1	3300050512	Bacteria	1756
1694	nmdc:mga0n895_303043_c1	3300050512	Bacteria	1620
1695	nmdc:mga0rr50_67504_c1	3300050513	Bacteria	2717
1696	nmdc:mga0rr50_93982_c1	3300050513	Bacteria	2341
1697	nmdc:mga08x19_12213_c1	3300050514	Bacteria	5170
1698	nmdc:mga08x19_135827_c1	3300050514	Bacteria	1658
1699	nmdc:mga08x19_19788_c1	3300050514	Bacteria	4137
1700	nmdc:mga08x19_253060_c1	3300050514	Bacteria	1216
1701	nmdc:mga0a205_12233_c1	3300050515	Bacteria	7935
1702	nmdc:mga0a205_152994_c1	3300050515	Bacteria	2205
1703	nmdc:mga0a205_18672_c1	3300050515	Bacteria	6525
1704	Ga0495601_0029968	3300053077	Bacteria	3378
1705	Ga0495601_0035862	3300053077	Bacteria	3097
1706	Ga0495601_0102025	3300053077	Bacteria	1854
1707	Ga0495601_0180603	3300053077	Bacteria	1380
1708	Ga0495601_0195085	3300053077	Bacteria	1323
1709	Ga0495601_0291558	3300053077	Bacteria	1063
1710	Ga0495601_0361339	3300053077	Bacteria	943
1711	Ga0495612_0015838	3300053078	Bacteria	3022
1712	Ga0495612_0023246	3300053078	Bacteria	2486
1713	Ga0495612_0031195	3300053078	Bacteria	2148
1714	Ga0495612_0048953	3300053078	Bacteria	1733
1715	Ga0495612_0116533	3300053078	Bacteria	1147
1716	Ga0495612_0169220	3300053078	Bacteria	956
1717	Ga0495612_0172639	3300053078	Bacteria	947
1718	Ga0495655_0004208	3300053083	Bacteria	2442
1719	Ga0495655_0048185	3300053083	Bacteria	1117
1720	Ga0495595_0004203	3300053084	Bacteria	5792
1721	Ga0495595_0010359	3300053084	Bacteria	3873
1722	Ga0495595_0027343	3300053084	Bacteria	2541
1723	Ga0495619_0005533	3300053085	Bacteria	8016
1724	Ga0495619_0055462	3300053085	Bacteria	2624
1725	Ga0495619_0062929	3300053085	Bacteria	2471
1726	Ga0495619_0095675	3300053085	Bacteria	2015
1727	Ga0495619_0111525	3300053085	Bacteria	1869
1728	Ga0495619_0137360	3300053085	Bacteria	1682
1729	Ga0500578_0102675	3300053086	Bacteria	1808
1730	Ga0500583_0160244	3300053092	Bacteria	1121
1731	Ga0500654_149730	3300053099	Bacteria	824
1732	Ga0500558_069221	3300053106	Bacteria	1459
1733	Ga0500560_002512	3300053107	Bacteria	3521
1734	Ga0500652_032895	3300053131	Bacteria	2046
1735	Ga0500658_0174001	3300053134	Bacteria	978
1736	Ga0500568_0003761	3300053139	Bacteria	8309
1737	Ga0500573_0064343	3300053140	Bacteria	2098
1738	Ga0500600_0067524	3300053149	Bacteria	1971
1739	Ga0500616_0001111	3300053153	Bacteria	27803
1740	Ga0500616_0001619	3300053153	Bacteria	20932
1741	Ga0500616_0102913	3300053153	Bacteria	1392
1742	Ga0500624_003031	3300053157	Bacteria	2220
1743	Ga0500634_0186514	3300053161	Bacteria	927
1744	Ga0500656_018751	3300053732	Bacteria	839
1745	Ga0501084_0032890	3300054114	Bacteria	4339
1746	Ga0501084_0041617	3300054114	Bacteria	3843
1747	Ga0501084_1116875	3300054114	Bacteria	662
1748	Ga0501082_0062906	3300060353	Bacteria	3195
1749	Ga0501082_0077792	3300060353	Bacteria	2860
1750	Ga0466962_0015486	3300061719	Bacteria	3677
1751	Ga0466962_0017787	3300061719	Bacteria	3421
1752	Ga0466962_0036829	3300061719	Bacteria	2342
1753	Ga0466962_0036934	3300061719	Bacteria	2338
1754	Ga0466962_0058723	3300061719	Bacteria	1836
1755	Ga0466962_0063712	3300061719	Bacteria	1760
1756	Ga0466962_0198539	3300061719	Bacteria	980
1757	Ga0530510_0020733	3300061734	Bacteria	4675
1758	Ga0530510_0052918	3300061734	Bacteria	2933

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300035398	Ga0316574_0378355	Ga0316574_0378355_277_876	199
2	3300048910	Ga0496107_0197521	Ga0496107_0197521_855_1478	204
3	iso_pu_bacteria	8055066027	8055072721	204
4	3300048929	Ga0496126_0184836	Ga0496126_0184836_1123_1746	206
5	3300044656	Ga0466969_0140123	Ga0466969_0140123_14_637	207
6	3300044719	Ga0466971_0280450	Ga0466971_0280450_156_779	207
7	3300044901	Ga0466960_0310670	Ga0466960_0310670_20_643	207
8	3300046459	Ga0495629_0050531	Ga0495629_0050531_12_635	207
9	3300046474	Ga0495605_0145250	Ga0495605_0145250_428_1051	207
10	3300046515	Ga0495620_0224594	Ga0495620_0224594_66_689	207
11	3300046517	Ga0495630_0303413	Ga0495630_0303413_581_1204	207
12	3300046528	Ga0495642_0287921	Ga0495642_0287921_22_645	207
13	3300046642	Ga0495634_0029978	Ga0495634_0029978_3103_3726	207
14	3300046683	Ga0495658_0105565	Ga0495658_0105565_41_664	207
15	3300046689	Ga0495613_0601785	Ga0495613_0601785_24_647	207
16	3300046794	Ga0495589_0168512	Ga0495589_0168512_25_648	207
17	3300047444	Ga0495675_0161720	Ga0495675_0161720_742_1365	207
18	3300047447	Ga0495685_136430	Ga0495685_136430_25_648	207
19	3300047447	Ga0495685_166961	Ga0495685_166961_67_690	207
20	3300047470	Ga0495681_0102854	Ga0495681_0102854_598_1221	207
21	3300048090	Ga0495615_0113718	Ga0495615_0113718_143_766	207
22	3300048907	Ga0496104_0947992	Ga0496104_0947992_118_741	207
23	3300053086	Ga0500578_0102675	Ga0500578_0102675_1170_1793	207
24	3300061719	Ga0466962_0063712	Ga0466962_0063712_23_646	207
25	3300035207	Ga0373942_0143813	Ga0373942_0143813_114_743	208
26	3300046679	Ga0495623_0252520	Ga0495623_0252520_350_979	208
27	3300048906	Ga0496103_0641226	Ga0496103_0641226_28_657	208
28	3300053077	Ga0495601_0291558	Ga0495601_0291558_35_664	208
29	3300046516	Ga0495628_0161075	Ga0495628_0161075_332_967	210
30	3300054114	Ga0501084_1116875	Ga0501084_1116875_11_646	211
31	3300046543	Ga0495645_0267136	Ga0495645_0267136_467_1114	214
32	3300035172	Ga0373955_0242601	Ga0373955_0242601_400_1059	219
33	3300048915	Ga0496112_0193140	Ga0496112_0193140_132_794	219
34	3300047321	Ga0495676_0023708	Ga0495676_0023708_236_898	220
35	3300047321	Ga0495676_0096520	Ga0495676_0096520_610_1272	220
36	3300050507	nmdc:mga05p37_145975_c1	nmdc:mga05p37_145975_c1_117_779	220
37	3300053139	Ga0500568_0003761	Ga0500568_0003761_2493_3155	220
38	iso_pu_bacteria	2622736605	2623497760	220
39	iso_pu_bacteria	2784132109	2784473081	220
40	3300009093	Ga0105240_10088061	Ga0105240_100880613	221
41	3300009174	Ga0105241_10026480	Ga0105241_100264803	221
42	3300009545	Ga0105237_10095315	Ga0105237_100953153	221
43	3300009551	Ga0105238_10009629	Ga0105238_1000962910	221
44	3300010375	Ga0105239_10088101	Ga0105239_100881013	221
45	3300013296	Ga0157374_10022784	Ga0157374_100227845	221
46	3300014969	Ga0157376_10306358	Ga0157376_103063582	221
47	3300035695	Ga0373927_0159577	Ga0373927_0159577_496_1164	221
48	3300037853	Ga0436364_0647259	Ga0436364_0647259_17_682	221
49	3300044656	Ga0466969_0011075	Ga0466969_0011075_983_1648	221
50	3300044683	Ga0466965_0028551	Ga0466965_0028551_745_1410	221
51	3300044684	Ga0466966_0050263	Ga0466966_0050263_81_746	221
52	3300044693	Ga0466961_0281864	Ga0466961_0281864_310_975	221
53	3300044694	Ga0466963_0032003	Ga0466963_0032003_1920_2585	221
54	3300044765	Ga0466970_0006119	Ga0466970_0006119_3025_3690	221
55	3300044842	Ga0466957_0046598	Ga0466957_0046598_53_718	221
56	3300045836	Ga0466958_0315677	Ga0466958_0315677_28_693	221
57	3300045976	Ga0466967_1004868	Ga0466967_1004868_104_769	221
58	3300046462	Ga0495651_0001709	Ga0495651_0001709_4013_4678	221
59	3300046516	Ga0495628_0002433	Ga0495628_0002433_6898_7563	221
60	3300046529	Ga0495652_0001157	Ga0495652_0001157_28346_29011	221
61	3300047317	Ga0495604_0199416	Ga0495604_0199416_121_786	221
62	3300053077	Ga0495601_0029968	Ga0495601_0029968_327_992	221
63	3300053078	Ga0495612_0172639	Ga0495612_0172639_222_887	221
64	3300061719	Ga0466962_0058723	Ga0466962_0058723_252_917	221
65	3300061719	Ga0466962_0198539	Ga0466962_0198539_37_702	221
66	3300044694	Ga0466963_0038082	Ga0466963_0038082_2352_3023	222
67	3300049823	Ga0501044_0677524	Ga0501044_0677524_138_806	222
68	iso_pu_bacteria	2506783011	2506868635	222
69	iso_pu_bacteria	2527291627	2528204225	222
70	iso_pu_bacteria	2527291629	2528214638	222
71	iso_pu_bacteria	2546825537	2546947015	222
72	iso_pu_bacteria	2547132111	2547408247	222
73	iso_pu_bacteria	2554235005	2554257211	222
74	iso_pu_bacteria	2576861822	2579747476	222
75	iso_pu_bacteria	2579778521	2579854487	222
76	iso_pu_bacteria	2582581312	2585299269	222
77	iso_pu_bacteria	2582581313	2585308921	222
78	iso_pu_bacteria	2582581314	2585313613	222
79	iso_pu_bacteria	2616644814	2616694936	222
80	iso_pu_bacteria	2616644941	2616904593	222
81	iso_pu_bacteria	2619618881	2619853873	222
82	iso_pu_bacteria	2619619003	2620349444	222
83	iso_pu_bacteria	2626541554	2626634784	222
84	iso_pu_bacteria	2643221548	2643765071	222
85	iso_pu_bacteria	2643221549	2643768460	222
86	iso_pu_bacteria	2643221578	2643899160	222
87	iso_pu_bacteria	2643221587	2643942410	222
88	iso_pu_bacteria	2643221619	2644111838	222
89	iso_pu_bacteria	2643221632	2644182548	222
90	iso_pu_bacteria	2643221647	2644262424	222
91	iso_pu_bacteria	2643221670	2644390034	222
92	iso_pu_bacteria	2643221673	2644403343	222
93	iso_pu_bacteria	2643221677	2644429491	222
94	iso_pu_bacteria	2643221678	2644437260	222
95	iso_pu_bacteria	2643221679	2644446901	222
96	iso_pu_bacteria	2643221682	2644461090	222
97	iso_pu_bacteria	2643221714	2644628998	222
98	iso_pu_bacteria	2684623036	2686543471	222
99	iso_pu_bacteria	2731639228	2731905894	222
100	iso_pu_bacteria	2767802112	2768643471	222
101	iso_pu_bacteria	2773857924	2774867137	222
102	iso_pu_bacteria	2773857933	2774905405	222
103	iso_pu_bacteria	2784132148	2784588713	222
104	iso_pu_bacteria	2784746763	2785343161	222
105	iso_pu_bacteria	2784746768	2785369642	222
106	iso_pu_bacteria	2786546132	2786670728	222
107	iso_pu_bacteria	2791355406	2793978334	222
108	iso_pu_bacteria	2799112218	2799185849	222
109	iso_pu_bacteria	2802429296	2804846760	222
110	iso_pu_bacteria	2808606359	2808842163	222
111	iso_pu_bacteria	2808606375	2808920696	222
112	iso_pu_bacteria	2808606448	2809232323	222
113	iso_pu_bacteria	2808606700	2810363084	222
114	iso_pu_bacteria	2808606982	2811849168	222
115	iso_pu_bacteria	2811994879	2812357965	222
116	iso_pu_bacteria	2811994917	2812480415	222
117	iso_pu_bacteria	2816332305	2817509797	222
118	iso_pu_bacteria	2818991463	2819695531	222
119	iso_pu_bacteria	2852635781	2852636533	222
120	iso_pu_bacteria	2862178590	2862179355	222
121	iso_pu_bacteria	2862281513	2862285778	222
122	iso_pu_bacteria	2862290372	2862297060	222
123	iso_pu_bacteria	2862382967	2862392144	222
124	iso_pu_bacteria	2862507626	2862511694	222
125	iso_pu_bacteria	2862574272	2862579128	222
126	iso_pu_bacteria	2862705112	2862706478	222
127	iso_pu_bacteria	2863404153	2863404461	222
128	iso_pu_bacteria	2867346516	2867348931	222
129	iso_pu_bacteria	2867369537	2867371996	222
130	iso_pu_bacteria	2867428634	2867432461	222
131	iso_pu_bacteria	2867475112	2867478816	222
132	iso_pu_bacteria	2873151551	2873155610	222
133	iso_pu_bacteria	2875391855	2875395565	222
134	iso_pu_bacteria	2877676314	2877680984	222
135	iso_pu_bacteria	2893684298	2893686216	222
136	iso_pu_bacteria	2905926851	2905930823	222
137	iso_pu_bacteria	2912715099	2912719829	222
138	iso_pu_bacteria	2912723979	2912724225	222
139	iso_pu_bacteria	2912757875	2912760902	222
140	iso_pu_bacteria	2918501144	2918505451	222
141	iso_pu_bacteria	2919468124	2919469412	222
142	iso_pu_bacteria	2935390628	2935393297	222
143	iso_pu_bacteria	2946003308	2946006964	222
144	iso_pu_bacteria	2946045630	2946049874	222
145	iso_pu_bacteria	2946064051	2946067878	222
146	iso_pu_bacteria	2946072368	2946076017	222
147	iso_pu_bacteria	2947224130	2947229069	222
148	iso_pu_bacteria	2954002825	2954007256	222
149	iso_pu_bacteria	2954380949	2954386094	222
150	iso_pu_bacteria	2954673503	2954677053	222
151	iso_pu_bacteria	2954682443	2954687103	222
152	iso_pu_bacteria	2954691527	2954696734	222
153	iso_pu_bacteria	2954701450	2954705404	222
154	iso_pu_bacteria	2954711539	2954716115	222
155	iso_pu_bacteria	2954721474	2954726058	222
156	iso_pu_bacteria	2954731030	2954735752	222
157	iso_pu_bacteria	2954740390	2954744984	222
158	iso_pu_bacteria	2954749733	2954754607	222
159	iso_pu_bacteria	2954759201	2954763956	222
160	iso_pu_bacteria	2964326757	2964328590	222
161	iso_pu_bacteria	2966598605	2966601770	222
162	iso_pu_bacteria	2966924647	2966927025	222
163	iso_pu_bacteria	2990044586	2990045326	222
164	iso_pu_bacteria	2990059506	2990063211	222
165	iso_pu_bacteria	2990088156	2990088366	222
166	iso_pu_bacteria	2997451912	2997457727	222
167	iso_pu_bacteria	2997600082	2997600299	222
168	iso_pu_bacteria	3002998708	3003004922	222
169	iso_pu_bacteria	3006321560	3006325195	222
170	iso_pu_bacteria	3006393351	3006394459	222
171	iso_pu_bacteria	3006425503	3006428808	222
172	iso_pu_bacteria	3006486233	3006490861	222
173	iso_pu_bacteria	3006493962	3006500871	222
174	iso_pu_bacteria	637000116	637877802	222
175	iso_pu_bacteria	8008485437	8008490301	222
176	iso_pu_bacteria	8008558824	8008567119	222
177	iso_pu_bacteria	8008574985	8008578779	222
178	iso_pu_bacteria	8023623736	8023627098	222
179	iso_pu_bacteria	8025478263	8025482475	222
180	iso_pu_bacteria	8025524527	8025529603	222
181	iso_pu_bacteria	8025530807	8025537899	222
182	iso_pu_bacteria	8033684223	8033690855	222
183	iso_pu_bacteria	8047893842	8047897968	222
184	iso_pu_bacteria	8048127548	8048133048	222
185	iso_pu_bacteria	8048356638	8048360926	222
186	iso_pu_bacteria	8048369669	8048374931	222
187	iso_pu_bacteria	8048379754	8048383274	222
188	iso_pu_bacteria	8048406513	8048413926	222
189	iso_pu_bacteria	8053945823	8053952145	222
190	iso_pu_bacteria	8054160619	8054161755	222
191	iso_pu_bacteria	8054913762	8054917380	222
192	iso_pu_bacteria	8054920844	8054921994	222
193	iso_pu_bacteria	8056447290	8056450884	222
194	iso_pu_bacteria	8056667051	8056671245	222
195	iso_pu_bacteria	8056829672	8056833498	222
196	3300009036	Ga0105244_10201807	Ga0105244_102018071	223
197	3300010375	Ga0105239_10537759	Ga0105239_105377591	223
198	3300011119	Ga0105246_10034148	Ga0105246_100341483	223
199	3300013307	Ga0157372_10084295	Ga0157372_100842952	223
200	3300013308	Ga0157375_11064287	Ga0157375_110642872	223
201	3300037312	Ga0395899_0007409	Ga0395899_0007409_7650_8321	223
202	3300037466	Ga0395898_0005710	Ga0395898_0005710_4505_5176	223
203	3300037466	Ga0395898_0117049	Ga0395898_0117049_1507_2178	223
204	3300037466	Ga0395898_0431093	Ga0395898_0431093_320_991	223
205	3300037853	Ga0436364_0138124	Ga0436364_0138124_1076_1747	223
206	3300037853	Ga0436364_0392443	Ga0436364_0392443_1177_1848	223
207	3300041404	Ga0439436_0000221	Ga0439436_0000221_10232_10903	223
208	3300041406	Ga0439439_0076794	Ga0439439_0076794_134_805	223
209	3300041494	Ga0451837_0319373	Ga0451837_0319373_1216_1887	223
210	3300041999	Ga0439433_0007557	Ga0439433_0007557_1447_2118	223
211	3300042005	Ga0439448_0085699	Ga0439448_0085699_106_777	223
212	3300042014	Ga0439457_000912	Ga0439457_000912_6720_7391	223
213	3300042015	Ga0439462_0003322	Ga0439462_0003322_1715_2386	223
214	3300042127	Ga0450890_004402	Ga0450890_004402_1141_1812	223
215	3300042128	Ga0450897_002158	Ga0450897_002158_641_1312	223
216	3300042131	Ga0450894_000165	Ga0450894_000165_8727_9398	223
217	3300042132	Ga0450895_001091	Ga0450895_001091_499_1170	223
218	3300042133	Ga0450896_000843	Ga0450896_000843_249_920	223
219	3300042134	Ga0450898_026543	Ga0450898_026543_182_853	223
220	3300042136	Ga0450900_017926	Ga0450900_017926_46_717	223
221	3300042137	Ga0450902_004816	Ga0450902_004816_261_932	223
222	3300042138	Ga0450903_003902	Ga0450903_003902_1848_2519	223
223	3300042145	Ga0450906_002967	Ga0450906_002967_409_1080	223
224	3300042157	Ga0439458_0005305	Ga0439458_0005305_1678_2349	223
225	3300042184	Ga0450908_000484	Ga0450908_000484_4347_5018	223
226	3300044656	Ga0466969_0014683	Ga0466969_0014683_1690_2361	223
227	3300044656	Ga0466969_0029467	Ga0466969_0029467_2015_2686	223
228	3300044658	Ga0466972_0003842	Ga0466972_0003842_5436_6107	223
229	3300044658	Ga0466972_0010829	Ga0466972_0010829_1452_2123	223
230	3300044658	Ga0466972_0010829	Ga0466972_0010829_2456_3127	223
231	3300044658	Ga0466972_0143263	Ga0466972_0143263_431_1102	223
232	3300044683	Ga0466965_0000304	Ga0466965_0000304_2705_3376	223
233	3300044683	Ga0466965_0104011	Ga0466965_0104011_180_851	223
234	3300044684	Ga0466966_0008603	Ga0466966_0008603_4202_4873	223
235	3300044684	Ga0466966_0045850	Ga0466966_0045850_51_722	223
236	3300044684	Ga0466966_0457228	Ga0466966_0457228_51_722	223
237	3300044693	Ga0466961_0006417	Ga0466961_0006417_4773_5444	223
238	3300044693	Ga0466961_0009741	Ga0466961_0009741_1331_2002	223
239	3300044694	Ga0466963_0001543	Ga0466963_0001543_10371_11042	223
240	3300044694	Ga0466963_0001954	Ga0466963_0001954_7263_7934	223
241	3300044706	Ga0466964_0009875	Ga0466964_0009875_1974_2645	223
242	3300044719	Ga0466971_0006461	Ga0466971_0006461_1420_2091	223
243	3300044719	Ga0466971_0034980	Ga0466971_0034980_1559_2230	223
244	3300044719	Ga0466971_0041072	Ga0466971_0041072_511_1182	223
245	3300044765	Ga0466970_0000179	Ga0466970_0000179_25772_26443	223
246	3300044765	Ga0466970_0096053	Ga0466970_0096053_20_691	223
247	3300044765	Ga0466970_0119935	Ga0466970_0119935_56_727	223
248	3300044765	Ga0466970_0272429	Ga0466970_0272429_207_878	223
249	3300044842	Ga0466957_0001101	Ga0466957_0001101_8250_8921	223
250	3300044842	Ga0466957_0236810	Ga0466957_0236810_338_1009	223
251	3300045049	Ga0466959_0002789	Ga0466959_0002789_5370_6041	223
252	3300045049	Ga0466959_0064052	Ga0466959_0064052_362_1033	223
253	3300045836	Ga0466958_0010946	Ga0466958_0010946_1695_2366	223
254	3300045836	Ga0466958_0032131	Ga0466958_0032131_1330_2001	223
255	3300045976	Ga0466967_0028007	Ga0466967_0028007_291_962	223
256	3300045976	Ga0466967_0211964	Ga0466967_0211964_23_694	223
257	3300045976	Ga0466967_1298927	Ga0466967_1298927_23_694	223
258	3300046452	Ga0495617_157897	Ga0495617_157897_23_694	223
259	3300046453	Ga0495627_042990	Ga0495627_042990_129_800	223
260	3300046454	Ga0495592_0014903	Ga0495592_0014903_813_1484	223
261	3300046455	Ga0495603_0001554	Ga0495603_0001554_10497_11168	223
262	3300046455	Ga0495603_0001594	Ga0495603_0001594_10137_10808	223
263	3300046455	Ga0495603_0082929	Ga0495603_0082929_1170_1841	223
264	3300046457	Ga0495590_0044639	Ga0495590_0044639_701_1372	223
265	3300046457	Ga0495590_0093346	Ga0495590_0093346_283_954	223
266	3300046459	Ga0495629_0002112	Ga0495629_0002112_11234_11905	223
267	3300046459	Ga0495629_0048873	Ga0495629_0048873_2206_2877	223
268	3300046460	Ga0495638_0051975	Ga0495638_0051975_765_1436	223
269	3300046460	Ga0495638_0077718	Ga0495638_0077718_32_703	223
270	3300046462	Ga0495651_0001322	Ga0495651_0001322_7747_8418	223
271	3300046473	Ga0495582_0008843	Ga0495582_0008843_4743_5414	223
272	3300046474	Ga0495605_0081391	Ga0495605_0081391_360_1031	223
273	3300046476	Ga0495662_0000163	Ga0495662_0000163_14472_15143	223
274	3300046492	Ga0495585_0031254	Ga0495585_0031254_987_1658	223
275	3300046499	Ga0495594_0016102	Ga0495594_0016102_2517_3188	223
276	3300046501	Ga0495607_0254833	Ga0495607_0254833_159_830	223
277	3300046533	Ga0495640_0176501	Ga0495640_0176501_560_1231	223
278	3300046536	Ga0495587_0004304	Ga0495587_0004304_6324_6995	223
279	3300046543	Ga0495645_0062886	Ga0495645_0062886_1391_2062	223
280	3300046557	Ga0495622_0005947	Ga0495622_0005947_722_1393	223
281	3300046648	Ga0495611_0069557	Ga0495611_0069557_571_1242	223
282	3300046648	Ga0495611_0090842	Ga0495611_0090842_12_683	223
283	3300046660	Ga0495625_0001776	Ga0495625_0001776_10239_10910	223
284	3300046660	Ga0495625_0038628	Ga0495625_0038628_704_1375	223
285	3300046660	Ga0495625_0070707	Ga0495625_0070707_1744_2415	223
286	3300046660	Ga0495625_0150283	Ga0495625_0150283_135_806	223
287	3300046663	Ga0495635_0002928	Ga0495635_0002928_4052_4723	223
288	3300046664	Ga0495659_0115846	Ga0495659_0115846_89_760	223
289	3300046674	Ga0495588_0005660	Ga0495588_0005660_4512_5183	223
290	3300046674	Ga0495588_0053948	Ga0495588_0053948_699_1370	223
291	3300046680	Ga0495646_0002859	Ga0495646_0002859_9573_10244	223
292	3300046683	Ga0495658_0456303	Ga0495658_0456303_24_695	223
293	3300046689	Ga0495613_0002345	Ga0495613_0002345_12265_12936	223
294	3300046689	Ga0495613_0094091	Ga0495613_0094091_53_724	223
295	3300046691	Ga0495670_0073647	Ga0495670_0073647_927_1598	223
296	3300046692	Ga0495671_0104479	Ga0495671_0104479_69_740	223
297	3300046694	Ga0495649_0058252	Ga0495649_0058252_525_1196	223
298	3300046794	Ga0495589_0004731	Ga0495589_0004731_5794_6465	223
299	3300046794	Ga0495589_0043120	Ga0495589_0043120_1217_1888	223
300	3300046809	Ga0495600_0001446	Ga0495600_0001446_2703_3374	223
301	3300046810	Ga0495660_0255896	Ga0495660_0255896_123_794	223
302	3300047317	Ga0495604_0000878	Ga0495604_0000878_14314_14985	223
303	3300047318	Ga0495636_0127015	Ga0495636_0127015_278_949	223
304	3300047321	Ga0495676_0000150	Ga0495676_0000150_10132_10803	223
305	3300047321	Ga0495676_0001728	Ga0495676_0001728_7916_8587	223
306	3300047321	Ga0495676_0005833	Ga0495676_0005833_7749_8420	223
307	3300047321	Ga0495676_0066375	Ga0495676_0066375_1806_2477	223
308	3300047445	Ga0495677_0057656	Ga0495677_0057656_491_1162	223
309	3300047447	Ga0495685_001035	Ga0495685_001035_6708_7379	223
310	3300047447	Ga0495685_018250	Ga0495685_018250_1433_2104	223
311	3300047470	Ga0495681_0001177	Ga0495681_0001177_8269_8940	223
312	3300047471	Ga0495684_0050658	Ga0495684_0050658_539_1210	223
313	3300047472	Ga0495686_0044711	Ga0495686_0044711_1871_2542	223
314	3300047673	Ga0495593_0115501	Ga0495593_0115501_464_1135	223
315	3300048089	Ga0495614_0000611	Ga0495614_0000611_10880_11551	223
316	3300048908	Ga0496105_0387757	Ga0496105_0387757_254_925	223
317	3300048909	Ga0496106_0105759	Ga0496106_0105759_335_1006	223
318	3300048917	Ga0496114_0908831	Ga0496114_0908831_72_752	223
319	3300049568	Ga0501031_0096162	Ga0501031_0096162_788_1459	223
320	3300049568	Ga0501031_0577604	Ga0501031_0577604_28_699	223
321	3300049570	Ga0501033_0006244	Ga0501033_0006244_7192_7863	223
322	3300049570	Ga0501033_0111002	Ga0501033_0111002_935_1606	223
323	3300049570	Ga0501033_0144725	Ga0501033_0144725_835_1506	223
324	3300049571	Ga0501034_0036552	Ga0501034_0036552_1579_2250	223
325	3300049571	Ga0501034_0062389	Ga0501034_0062389_68_739	223
326	3300049572	Ga0501036_0304204	Ga0501036_0304204_134_805	223
327	3300049573	Ga0501037_0016220	Ga0501037_0016220_4774_5445	223
328	3300049574	Ga0501038_0011859	Ga0501038_0011859_2405_3076	223
329	3300049574	Ga0501038_0065187	Ga0501038_0065187_2299_2970	223
330	3300049575	Ga0501039_0027179	Ga0501039_0027179_2252_2923	223
331	3300049578	Ga0501042_0506112	Ga0501042_0506112_57_728	223
332	3300049579	Ga0501043_0013418	Ga0501043_0013418_79_750	223
333	3300049580	Ga0501046_0021502	Ga0501046_0021502_1791_2462	223
334	3300049581	Ga0501047_0058613	Ga0501047_0058613_1273_1944	223
335	3300049582	Ga0501048_0033083	Ga0501048_0033083_88_759	223
336	3300049583	Ga0501067_0339433	Ga0501067_0339433_105_785	223
337	3300049584	Ga0501068_0126056	Ga0501068_0126056_527_1198	223
338	3300049585	Ga0501069_0066819	Ga0501069_0066819_834_1505	223
339	3300049586	Ga0501070_0005487	Ga0501070_0005487_5074_5745	223
340	3300049589	Ga0501073_0206183	Ga0501073_0206183_242_913	223
341	3300049590	Ga0501074_0012014	Ga0501074_0012014_3248_3919	223
342	3300049742	Ga0501080_0064310	Ga0501080_0064310_1130_1801	223
343	3300049767	Ga0501270_033114	Ga0501270_033114_93_764	223
344	3300049822	Ga0501035_0151202	Ga0501035_0151202_67_738	223
345	3300049823	Ga0501044_0014764	Ga0501044_0014764_1589_2260	223
346	3300049823	Ga0501044_0117041	Ga0501044_0117041_191_862	223
347	3300049823	Ga0501044_0168139	Ga0501044_0168139_1463_2134	223
348	3300050490	nmdc:mga03n38_7371_c1	nmdc:mga03n38_7371_c1_2872_3543	223
349	3300053078	Ga0495612_0048953	Ga0495612_0048953_526_1197	223
350	3300053083	Ga0495655_0048185	Ga0495655_0048185_17_688	223
351	3300053092	Ga0500583_0160244	Ga0500583_0160244_283_954	223
352	3300053149	Ga0500600_0067524	Ga0500600_0067524_775_1446	223
353	3300053157	Ga0500624_003031	Ga0500624_003031_1519_2190	223
354	3300053161	Ga0500634_0186514	Ga0500634_0186514_233_904	223
355	3300061719	Ga0466962_0015486	Ga0466962_0015486_974_1645	223
356	3300061719	Ga0466962_0017787	Ga0466962_0017787_377_1048	223
357	iso_pu_bacteria	2643221567	2643852315	223
358	iso_pu_bacteria	2643221624	2644136837	223
359	iso_pu_bacteria	2643221711	2644607748	223
360	iso_pu_bacteria	2808606365	2808871871	223
361	iso_pu_bacteria	2811994882	2812373249	223
362	iso_pu_bacteria	2818991318	2819426049	223
363	iso_pu_bacteria	2818991458	2819665107	223
364	iso_pu_bacteria	2818991462	2819692822	223
365	iso_pu_bacteria	2818991469	2819727221	223
366	iso_pu_bacteria	2856741275	2856742975	223
367	iso_pu_bacteria	2873314349	2873314482	223
368	iso_pu_bacteria	2891395885	2891401193	223
369	iso_pu_bacteria	2891554331	2891560109	223
370	iso_pu_bacteria	2891562705	2891563541	223
371	iso_pu_bacteria	2919446982	2919448242	223
372	iso_pu_bacteria	8055172936	8055175942	223
373	iso_pu_bacteria	8056060235	8056062084	223
374	3300009011	Ga0105251_10008325	Ga0105251_100083257	224
375	3300009177	Ga0105248_10150351	Ga0105248_101503513	224
376	3300010375	Ga0105239_10770420	Ga0105239_107704201	224
377	3300011119	Ga0105246_10029622	Ga0105246_100296225	224
378	3300013102	Ga0157371_10317202	Ga0157371_103172022	224
379	3300013105	Ga0157369_10071651	Ga0157369_100716515	224
380	3300013105	Ga0157369_10135443	Ga0157369_101354433	224
381	3300031903	Ga0307407_10261421	Ga0307407_102614212	224
382	3300031995	Ga0307409_100778800	Ga0307409_1007788002	224
383	3300034816	Ga0373930_0013153	Ga0373930_0013153_23_700	224
384	3300034820	Ga0373959_0009081	Ga0373959_0009081_642_1319	224
385	3300034957	Ga0373938_0001761	Ga0373938_0001761_2237_2914	224
386	3300035083	Ga0373926_0000832	Ga0373926_0000832_1462_2139	224
387	3300035083	Ga0373926_0035486	Ga0373926_0035486_800_1477	224
388	3300035083	Ga0373926_0048779	Ga0373926_0048779_479_1156	224
389	3300035086	Ga0373934_0000058	Ga0373934_0000058_13173_13850	224
390	3300035086	Ga0373934_0004599	Ga0373934_0004599_1173_1850	224
391	3300035086	Ga0373934_0025399	Ga0373934_0025399_1293_1970	224
392	3300035086	Ga0373934_0035510	Ga0373934_0035510_304_984	224
393	3300035086	Ga0373934_0039886	Ga0373934_0039886_1154_1831	224
394	3300035089	Ga0373944_0000925	Ga0373944_0000925_334_1011	224
395	3300035089	Ga0373944_0003386	Ga0373944_0003386_72_749	224
396	3300035090	Ga0373949_0036185	Ga0373949_0036185_206_883	224
397	3300035091	Ga0373951_0005589	Ga0373951_0005589_1277_1954	224
398	3300035092	Ga0373952_0005808	Ga0373952_0005808_450_1127	224
399	3300035111	Ga0373923_0003028	Ga0373923_0003028_2341_3018	224
400	3300035111	Ga0373923_0015058	Ga0373923_0015058_51_728	224
401	3300035111	Ga0373923_0033594	Ga0373923_0033594_1212_1889	224
402	3300035111	Ga0373923_0044608	Ga0373923_0044608_167_844	224
403	3300035111	Ga0373923_0156828	Ga0373923_0156828_339_1016	224
404	3300035112	Ga0373932_0026901	Ga0373932_0026901_252_929	224
405	3300035113	Ga0373936_0017711	Ga0373936_0017711_774_1451	224
406	3300035115	Ga0373941_0066178	Ga0373941_0066178_200_877	224
407	3300035116	Ga0373945_0000023	Ga0373945_0000023_10631_11308	224
408	3300035116	Ga0373945_0047461	Ga0373945_0047461_200_877	224
409	3300035117	Ga0373953_0000217	Ga0373953_0000217_2148_2825	224
410	3300035117	Ga0373953_0003800	Ga0373953_0003800_684_1361	224
411	3300035117	Ga0373953_0008649	Ga0373953_0008649_56_733	224
412	3300035117	Ga0373953_0022344	Ga0373953_0022344_208_885	224
413	3300035118	Ga0373954_0004267	Ga0373954_0004267_820_1497	224
414	3300035118	Ga0373954_0008892	Ga0373954_0008892_1226_1903	224
415	3300035118	Ga0373954_0009716	Ga0373954_0009716_2849_3526	224
416	3300035119	Ga0373956_0002963	Ga0373956_0002963_4447_5124	224
417	3300035119	Ga0373956_0025873	Ga0373956_0025873_1534_2211	224
418	3300035119	Ga0373956_0070348	Ga0373956_0070348_493_1173	224
419	3300035119	Ga0373956_0080149	Ga0373956_0080149_589_1266	224
420	3300035119	Ga0373956_0086580	Ga0373956_0086580_42_722	224
421	3300035120	Ga0373957_0001086	Ga0373957_0001086_559_1236	224
422	3300035120	Ga0373957_0004423	Ga0373957_0004423_224_901	224
423	3300035120	Ga0373957_0018314	Ga0373957_0018314_1022_1699	224
424	3300035120	Ga0373957_0062251	Ga0373957_0062251_20_697	224
425	3300035120	Ga0373957_0084453	Ga0373957_0084453_45_725	224
426	3300035121	Ga0373960_0056719	Ga0373960_0056719_31_708	224
427	3300035170	Ga0373943_0013589	Ga0373943_0013589_1518_2195	224
428	3300035170	Ga0373943_0017395	Ga0373943_0017395_1922_2599	224
429	3300035170	Ga0373943_0095458	Ga0373943_0095458_361_1038	224
430	3300035170	Ga0373943_0163722	Ga0373943_0163722_124_804	224
431	3300035171	Ga0373946_0000155	Ga0373946_0000155_10705_11382	224
432	3300035171	Ga0373946_0026077	Ga0373946_0026077_1484_2161	224
433	3300035171	Ga0373946_0169938	Ga0373946_0169938_21_698	224
434	3300035172	Ga0373955_0000156	Ga0373955_0000156_15573_16250	224
435	3300035172	Ga0373955_0001996	Ga0373955_0001996_5392_6069	224
436	3300035172	Ga0373955_0036158	Ga0373955_0036158_1742_2419	224
437	3300035172	Ga0373955_0107816	Ga0373955_0107816_339_1016	224
438	3300035172	Ga0373955_0291805	Ga0373955_0291805_238_915	224
439	3300035207	Ga0373942_0007720	Ga0373942_0007720_145_822	224
440	3300035242	Ga0373962_0010234	Ga0373962_0010234_280_957	224
441	3300035398	Ga0316574_0053143	Ga0316574_0053143_654_1328	224
442	3300035410	Ga0373924_0004802	Ga0373924_0004802_3013_3690	224
443	3300035410	Ga0373924_0021005	Ga0373924_0021005_1847_2524	224
444	3300035691	Ga0373931_0042796	Ga0373931_0042796_1116_1793	224
445	3300035691	Ga0373931_0086392	Ga0373931_0086392_905_1582	224
446	3300035692	Ga0373935_0005390	Ga0373935_0005390_1809_2486	224
447	3300035692	Ga0373935_0034511	Ga0373935_0034511_469_1146	224
448	3300035692	Ga0373935_0138420	Ga0373935_0138420_915_1592	224
449	3300035695	Ga0373927_0019143	Ga0373927_0019143_2708_3385	224
450	3300035724	Ga0373933_0000009	Ga0373933_0000009_78247_78924	224
451	3300035724	Ga0373933_0004934	Ga0373933_0004934_4129_4806	224
452	3300035724	Ga0373933_0069097	Ga0373933_0069097_1396_2076	224
453	3300035725	Ga0373947_0137705	Ga0373947_0137705_707_1384	224
454	3300036401	Ga0373937_0000012	Ga0373937_0000012_154287_154964	224
455	3300036401	Ga0373937_0046636	Ga0373937_0046636_117_794	224
456	3300036401	Ga0373937_0085585	Ga0373937_0085585_364_1044	224
457	3300036401	Ga0373937_0214266	Ga0373937_0214266_733_1413	224
458	3300036401	Ga0373937_0355260	Ga0373937_0355260_641_1318	224
459	3300037068	Ga0373925_0000262	Ga0373925_0000262_47566_48243	224
460	3300037068	Ga0373925_0011639	Ga0373925_0011639_1243_1920	224
461	3300037068	Ga0373925_0015148	Ga0373925_0015148_2949_3626	224
462	3300037068	Ga0373925_0146501	Ga0373925_0146501_996_1673	224
463	3300037068	Ga0373925_0202415	Ga0373925_0202415_453_1130	224
464	3300037068	Ga0373925_0254379	Ga0373925_0254379_336_1013	224
465	3300037312	Ga0395899_0065818	Ga0395899_0065818_1657_2337	224
466	3300037418	Ga0395900_0030148	Ga0395900_0030148_560_1240	224
467	3300037466	Ga0395898_0048693	Ga0395898_0048693_1958_2638	224
468	3300037466	Ga0395898_0123137	Ga0395898_0123137_496_1176	224
469	3300037466	Ga0395898_0139143	Ga0395898_0139143_1085_1762	224
470	3300037853	Ga0436364_0109924	Ga0436364_0109924_14297_14974	224
471	3300037853	Ga0436364_0858481	Ga0436364_0858481_10847_11524	224
472	3300037853	Ga0436364_0891745	Ga0436364_0891745_999_1676	224
473	3300037853	Ga0436364_1059010	Ga0436364_1059010_47057_47737	224
474	3300038443	Ga0395901_0373590	Ga0395901_0373590_398_1078	224
475	3300038443	Ga0395901_0516645	Ga0395901_0516645_510_1190	224
476	3300039438	Ga0436360_0666661	Ga0436360_0666661_222_899	224
477	3300039450	Ga0436363_0382238	Ga0436363_0382238_226_912	224
478	3300039450	Ga0436363_0859415	Ga0436363_0859415_575_1252	224
479	3300039450	Ga0436363_0995323	Ga0436363_0995323_125_802	224
480	3300039453	Ga0436362_0025783	Ga0436362_0025783_568_1254	224
481	3300039453	Ga0436362_0488032	Ga0436362_0488032_81_758	224
482	3300039453	Ga0436362_0638503	Ga0436362_0638503_126_803	224
483	3300039453	Ga0436362_0944772	Ga0436362_0944772_680_1354	224
484	3300044683	Ga0466965_0042100	Ga0466965_0042100_1308_1988	224
485	3300044693	Ga0466961_0094517	Ga0466961_0094517_153_833	224
486	3300044694	Ga0466963_0054026	Ga0466963_0054026_458_1135	224
487	3300044694	Ga0466963_0074239	Ga0466963_0074239_40_717	224
488	3300044694	Ga0466963_0083702	Ga0466963_0083702_1439_2116	224
489	3300044694	Ga0466963_0096421	Ga0466963_0096421_226_906	224
490	3300044694	Ga0466963_0318529	Ga0466963_0318529_163_843	224
491	3300044719	Ga0466971_0028559	Ga0466971_0028559_1780_2460	224
492	3300044719	Ga0466971_0041165	Ga0466971_0041165_939_1625	224
493	3300044901	Ga0466960_0002996	Ga0466960_0002996_2353_3033	224
494	3300044901	Ga0466960_0184606	Ga0466960_0184606_419_1105	224
495	3300045049	Ga0466959_0353256	Ga0466959_0353256_275_952	224
496	3300045836	Ga0466958_0248102	Ga0466958_0248102_207_887	224
497	3300045976	Ga0466967_0031778	Ga0466967_0031778_2512_3192	224
498	3300045976	Ga0466967_0155973	Ga0466967_0155973_91_771	224
499	3300045976	Ga0466967_0776438	Ga0466967_0776438_101_787	224
500	3300046454	Ga0495592_0000049	Ga0495592_0000049_33763_34440	224
501	3300046454	Ga0495592_0040961	Ga0495592_0040961_1339_2016	224
502	3300046454	Ga0495592_0070946	Ga0495592_0070946_707_1384	224
503	3300046454	Ga0495592_0074524	Ga0495592_0074524_1653_2330	224
504	3300046455	Ga0495603_0146545	Ga0495603_0146545_313_990	224
505	3300046459	Ga0495629_0186003	Ga0495629_0186003_710_1387	224
506	3300046459	Ga0495629_0188609	Ga0495629_0188609_328_1005	224
507	3300046459	Ga0495629_0366042	Ga0495629_0366042_232_909	224
508	3300046461	Ga0495641_0006736	Ga0495641_0006736_3787_4464	224
509	3300046461	Ga0495641_0016436	Ga0495641_0016436_518_1195	224
510	3300046461	Ga0495641_0174597	Ga0495641_0174597_45_722	224
511	3300046462	Ga0495651_0000007	Ga0495651_0000007_83040_83717	224
512	3300046462	Ga0495651_0011440	Ga0495651_0011440_6105_6785	224
513	3300046462	Ga0495651_0013776	Ga0495651_0013776_21_698	224
514	3300046462	Ga0495651_0032077	Ga0495651_0032077_136_813	224
515	3300046462	Ga0495651_0047460	Ga0495651_0047460_473_1150	224
516	3300046462	Ga0495651_0276742	Ga0495651_0276742_42_719	224
517	3300046463	Ga0495653_0002706	Ga0495653_0002706_9814_10491	224
518	3300046463	Ga0495653_0009356	Ga0495653_0009356_2164_2841	224
519	3300046463	Ga0495653_0011729	Ga0495653_0011729_5121_5798	224
520	3300046463	Ga0495653_0069063	Ga0495653_0069063_1951_2628	224
521	3300046463	Ga0495653_0072394	Ga0495653_0072394_734_1411	224
522	3300046463	Ga0495653_0105415	Ga0495653_0105415_1293_1970	224
523	3300046463	Ga0495653_0187823	Ga0495653_0187823_67_744	224
524	3300046472	Ga0495580_0116065	Ga0495580_0116065_562_1239	224
525	3300046472	Ga0495580_0203805	Ga0495580_0203805_570_1247	224
526	3300046473	Ga0495582_0018157	Ga0495582_0018157_2626_3303	224
527	3300046473	Ga0495582_0034601	Ga0495582_0034601_1399_2076	224
528	3300046473	Ga0495582_0097616	Ga0495582_0097616_496_1173	224
529	3300046475	Ga0495639_0008986	Ga0495639_0008986_3385_4062	224
530	3300046475	Ga0495639_0077375	Ga0495639_0077375_728_1405	224
531	3300046475	Ga0495639_0142709	Ga0495639_0142709_200_877	224
532	3300046476	Ga0495662_0010357	Ga0495662_0010357_3185_3862	224
533	3300046476	Ga0495662_0015181	Ga0495662_0015181_1223_1900	224
534	3300046476	Ga0495662_0065279	Ga0495662_0065279_20_697	224
535	3300046476	Ga0495662_0103865	Ga0495662_0103865_103_780	224
536	3300046477	Ga0495664_0001047	Ga0495664_0001047_9283_9960	224
537	3300046477	Ga0495664_0005749	Ga0495664_0005749_5511_6188	224
538	3300046477	Ga0495664_0012698	Ga0495664_0012698_1516_2193	224
539	3300046477	Ga0495664_0051332	Ga0495664_0051332_1308_1985	224
540	3300046477	Ga0495664_0077271	Ga0495664_0077271_1291_1968	224
541	3300046477	Ga0495664_0198339	Ga0495664_0198339_151_828	224
542	3300046499	Ga0495594_0020549	Ga0495594_0020549_215_892	224
543	3300046499	Ga0495594_0057855	Ga0495594_0057855_1400_2077	224
544	3300046511	Ga0495608_0000015	Ga0495608_0000015_195158_195835	224
545	3300046511	Ga0495608_0021907	Ga0495608_0021907_2263_2940	224
546	3300046511	Ga0495608_0024177	Ga0495608_0024177_2025_2702	224
547	3300046511	Ga0495608_0159614	Ga0495608_0159614_250_927	224
548	3300046514	Ga0495618_0006907	Ga0495618_0006907_2816_3493	224
549	3300046514	Ga0495618_0089136	Ga0495618_0089136_904_1581	224
550	3300046514	Ga0495618_0101126	Ga0495618_0101126_374_1051	224
551	3300046514	Ga0495618_0154577	Ga0495618_0154577_220_897	224
552	3300046514	Ga0495618_0167406	Ga0495618_0167406_614_1291	224
553	3300046516	Ga0495628_0001681	Ga0495628_0001681_4437_5114	224
554	3300046516	Ga0495628_0025594	Ga0495628_0025594_2263_2940	224
555	3300046516	Ga0495628_0219730	Ga0495628_0219730_520_1197	224
556	3300046517	Ga0495630_0003597	Ga0495630_0003597_4527_5204	224
557	3300046517	Ga0495630_0030861	Ga0495630_0030861_2611_3288	224
558	3300046517	Ga0495630_0131528	Ga0495630_0131528_432_1109	224
559	3300046517	Ga0495630_0333377	Ga0495630_0333377_311_988	224
560	3300046526	Ga0495666_0026609	Ga0495666_0026609_434_1111	224
561	3300046526	Ga0495666_0093232	Ga0495666_0093232_622_1299	224
562	3300046526	Ga0495666_0123361	Ga0495666_0123361_501_1178	224
563	3300046529	Ga0495652_0001969	Ga0495652_0001969_4436_5113	224
564	3300046529	Ga0495652_0061099	Ga0495652_0061099_894_1571	224
565	3300046529	Ga0495652_0073989	Ga0495652_0073989_2137_2814	224
566	3300046529	Ga0495652_0284389	Ga0495652_0284389_21_698	224
567	3300046529	Ga0495652_0389385	Ga0495652_0389385_202_879	224
568	3300046531	Ga0495665_0004805	Ga0495665_0004805_4400_5077	224
569	3300046531	Ga0495665_0034731	Ga0495665_0034731_1239_1916	224
570	3300046531	Ga0495665_0166448	Ga0495665_0166448_357_1034	224
571	3300046533	Ga0495640_0008144	Ga0495640_0008144_3958_4635	224
572	3300046533	Ga0495640_0074622	Ga0495640_0074622_140_817	224
573	3300046533	Ga0495640_0099308	Ga0495640_0099308_790_1467	224
574	3300046533	Ga0495640_0104125	Ga0495640_0104125_665_1342	224
575	3300046533	Ga0495640_0165867	Ga0495640_0165867_365_1042	224
576	3300046533	Ga0495640_0268862	Ga0495640_0268862_13_690	224
577	3300046535	Ga0495586_0071294	Ga0495586_0071294_188_865	224
578	3300046536	Ga0495587_0000032	Ga0495587_0000032_72060_72737	224
579	3300046536	Ga0495587_0036355	Ga0495587_0036355_959_1636	224
580	3300046536	Ga0495587_0046097	Ga0495587_0046097_1522_2199	224
581	3300046543	Ga0495645_0013643	Ga0495645_0013643_15_692	224
582	3300046543	Ga0495645_0016859	Ga0495645_0016859_3499_4176	224
583	3300046543	Ga0495645_0096810	Ga0495645_0096810_863_1540	224
584	3300046543	Ga0495645_0099814	Ga0495645_0099814_1323_2000	224
585	3300046543	Ga0495645_0162284	Ga0495645_0162284_373_1050	224
586	3300046543	Ga0495645_0242182	Ga0495645_0242182_232_909	224
587	3300046559	Ga0495667_0008628	Ga0495667_0008628_1790_2467	224
588	3300046559	Ga0495667_0014297	Ga0495667_0014297_1246_1923	224
589	3300046559	Ga0495667_0127095	Ga0495667_0127095_369_1046	224
590	3300046642	Ga0495634_0006867	Ga0495634_0006867_3257_3934	224
591	3300046642	Ga0495634_0016697	Ga0495634_0016697_621_1298	224
592	3300046642	Ga0495634_0030299	Ga0495634_0030299_2836_3513	224
593	3300046642	Ga0495634_0233947	Ga0495634_0233947_279_956	224
594	3300046663	Ga0495635_0006534	Ga0495635_0006534_6866_7543	224
595	3300046663	Ga0495635_0041587	Ga0495635_0041587_1309_1986	224
596	3300046674	Ga0495588_0030229	Ga0495588_0030229_1104_1781	224
597	3300046675	Ga0495657_0000106	Ga0495657_0000106_40192_40869	224
598	3300046675	Ga0495657_0012582	Ga0495657_0012582_2342_3019	224
599	3300046675	Ga0495657_0016670	Ga0495657_0016670_873_1553	224
600	3300046675	Ga0495657_0060941	Ga0495657_0060941_1114_1791	224
601	3300046675	Ga0495657_0111171	Ga0495657_0111171_623_1300	224
602	3300046678	Ga0495599_0000414	Ga0495599_0000414_4451_5128	224
603	3300046678	Ga0495599_0006481	Ga0495599_0006481_5278_5955	224
604	3300046678	Ga0495599_0016216	Ga0495599_0016216_2143_2820	224
605	3300046678	Ga0495599_0054425	Ga0495599_0054425_1241_1918	224
606	3300046678	Ga0495599_0089821	Ga0495599_0089821_101_778	224
607	3300046679	Ga0495623_0019308	Ga0495623_0019308_1858_2535	224
608	3300046679	Ga0495623_0025742	Ga0495623_0025742_1522_2202	224
609	3300046679	Ga0495623_0050810	Ga0495623_0050810_1252_1929	224
610	3300046679	Ga0495623_0107046	Ga0495623_0107046_975_1655	224
611	3300046680	Ga0495646_0018949	Ga0495646_0018949_784_1461	224
612	3300046680	Ga0495646_0020936	Ga0495646_0020936_38_715	224
613	3300046680	Ga0495646_0036623	Ga0495646_0036623_1076_1753	224
614	3300046680	Ga0495646_0080871	Ga0495646_0080871_40_717	224
615	3300046681	Ga0495647_0084457	Ga0495647_0084457_578_1255	224
616	3300046683	Ga0495658_0048373	Ga0495658_0048373_370_1047	224
617	3300046683	Ga0495658_0065618	Ga0495658_0065618_251_928	224
618	3300046689	Ga0495613_0052053	Ga0495613_0052053_1471_2148	224
619	3300046689	Ga0495613_0250314	Ga0495613_0250314_199_876	224
620	3300046690	Ga0495624_0001191	Ga0495624_0001191_13826_14503	224
621	3300046690	Ga0495624_0002632	Ga0495624_0002632_3790_4467	224
622	3300046690	Ga0495624_0057229	Ga0495624_0057229_981_1658	224
623	3300046690	Ga0495624_0275902	Ga0495624_0275902_119_796	224
624	3300046690	Ga0495624_0359452	Ga0495624_0359452_20_697	224
625	3300046809	Ga0495600_0012322	Ga0495600_0012322_3110_3787	224
626	3300046809	Ga0495600_0016101	Ga0495600_0016101_2535_3212	224
627	3300046809	Ga0495600_0020341	Ga0495600_0020341_190_870	224
628	3300046809	Ga0495600_0022349	Ga0495600_0022349_1509_2186	224
629	3300046809	Ga0495600_0096553	Ga0495600_0096553_339_1016	224
630	3300047315	Ga0495581_0030122	Ga0495581_0030122_153_830	224
631	3300047315	Ga0495581_0037431	Ga0495581_0037431_836_1513	224
632	3300047315	Ga0495581_0053224	Ga0495581_0053224_929_1606	224
633	3300047315	Ga0495581_0064372	Ga0495581_0064372_191_868	224
634	3300047317	Ga0495604_0000062	Ga0495604_0000062_79325_80002	224
635	3300047317	Ga0495604_0016358	Ga0495604_0016358_2169_2846	224
636	3300047317	Ga0495604_0031341	Ga0495604_0031341_411_1088	224
637	3300047317	Ga0495604_0053909	Ga0495604_0053909_38_715	224
638	3300047317	Ga0495604_0199151	Ga0495604_0199151_196_873	224
639	3300047317	Ga0495604_0262792	Ga0495604_0262792_150_827	224
640	3300047319	Ga0495674_0000654	Ga0495674_0000654_10090_10767	224
641	3300047319	Ga0495674_0014303	Ga0495674_0014303_5955_6632	224
642	3300047319	Ga0495674_0103586	Ga0495674_0103586_707_1384	224
643	3300047319	Ga0495674_0169028	Ga0495674_0169028_317_994	224
644	3300047321	Ga0495676_0007138	Ga0495676_0007138_7592_8269	224
645	3300047321	Ga0495676_0103858	Ga0495676_0103858_982_1659	224
646	3300047321	Ga0495676_0198921	Ga0495676_0198921_542_1219	224
647	3300047322	Ga0495680_0001896	Ga0495680_0001896_16845_17522	224
648	3300047322	Ga0495680_0016084	Ga0495680_0016084_4343_5020	224
649	3300047322	Ga0495680_0020371	Ga0495680_0020371_3018_3695	224
650	3300047322	Ga0495680_0022021	Ga0495680_0022021_2792_3469	224
651	3300047322	Ga0495680_0047137	Ga0495680_0047137_1597_2277	224
652	3300047322	Ga0495680_0050025	Ga0495680_0050025_1035_1712	224
653	3300047322	Ga0495680_0057203	Ga0495680_0057203_1599_2276	224
654	3300047322	Ga0495680_0089175	Ga0495680_0089175_309_986	224
655	3300047322	Ga0495680_0144920	Ga0495680_0144920_399_1076	224
656	3300047444	Ga0495675_0017619	Ga0495675_0017619_1783_2460	224
657	3300047444	Ga0495675_0023625	Ga0495675_0023625_2314_2994	224
658	3300047444	Ga0495675_0102866	Ga0495675_0102866_270_947	224
659	3300047471	Ga0495684_0004087	Ga0495684_0004087_8913_9590	224
660	3300047471	Ga0495684_0007997	Ga0495684_0007997_4699_5376	224
661	3300047471	Ga0495684_0016230	Ga0495684_0016230_4292_4969	224
662	3300047471	Ga0495684_0041054	Ga0495684_0041054_567_1244	224
663	3300047471	Ga0495684_0076311	Ga0495684_0076311_1590_2267	224
664	3300047471	Ga0495684_0392390	Ga0495684_0392390_157_834	224
665	3300047673	Ga0495593_0008567	Ga0495593_0008567_4754_5431	224
666	3300047673	Ga0495593_0059745	Ga0495593_0059745_1060_1737	224
667	3300047673	Ga0495593_0071813	Ga0495593_0071813_15_692	224
668	3300048088	Ga0495602_0002545	Ga0495602_0002545_13263_13940	224
669	3300048088	Ga0495602_0028807	Ga0495602_0028807_2326_3006	224
670	3300048088	Ga0495602_0094928	Ga0495602_0094928_488_1165	224
671	3300048088	Ga0495602_0135146	Ga0495602_0135146_766_1443	224
672	3300048088	Ga0495602_0194062	Ga0495602_0194062_24_701	224
673	3300048088	Ga0495602_0215765	Ga0495602_0215765_232_909	224
674	3300048088	Ga0495602_0363396	Ga0495602_0363396_347_1024	224
675	3300048089	Ga0495614_0044088	Ga0495614_0044088_949_1626	224
676	3300048903	Ga0496100_0078631	Ga0496100_0078631_355_1032	224
677	3300048903	Ga0496100_0150672	Ga0496100_0150672_873_1550	224
678	3300048904	Ga0496101_0014873	Ga0496101_0014873_2586_3263	224
679	3300048905	Ga0496102_0093131	Ga0496102_0093131_1273_1950	224
680	3300048905	Ga0496102_0653434	Ga0496102_0653434_40_717	224
681	3300048906	Ga0496103_0039720	Ga0496103_0039720_280_957	224
682	3300048907	Ga0496104_0008256	Ga0496104_0008256_6876_7553	224
683	3300048907	Ga0496104_0334357	Ga0496104_0334357_314_991	224
684	3300048908	Ga0496105_0001849	Ga0496105_0001849_12811_13488	224
685	3300048908	Ga0496105_0066420	Ga0496105_0066420_1956_2633	224
686	3300048909	Ga0496106_0260206	Ga0496106_0260206_434_1111	224
687	3300048909	Ga0496106_0552765	Ga0496106_0552765_74_751	224
688	3300048910	Ga0496107_0025724	Ga0496107_0025724_687_1364	224
689	3300048910	Ga0496107_0027912	Ga0496107_0027912_303_980	224
690	3300048910	Ga0496107_0163235	Ga0496107_0163235_368_1045	224
691	3300048911	Ga0496108_0001256	Ga0496108_0001256_12459_13136	224
692	3300048911	Ga0496108_0076757	Ga0496108_0076757_704_1381	224
693	3300048911	Ga0496108_0077787	Ga0496108_0077787_1253_1930	224
694	3300048911	Ga0496108_0156347	Ga0496108_0156347_748_1425	224
695	3300048912	Ga0496109_0028644	Ga0496109_0028644_3131_3808	224
696	3300048912	Ga0496109_0105066	Ga0496109_0105066_802_1479	224
697	3300048912	Ga0496109_0236245	Ga0496109_0236245_978_1655	224
698	3300048913	Ga0496110_0049751	Ga0496110_0049751_2895_3572	224
699	3300048913	Ga0496110_0064333	Ga0496110_0064333_889_1566	224
700	3300048913	Ga0496110_0402112	Ga0496110_0402112_457_1134	224
701	3300048914	Ga0496111_0017359	Ga0496111_0017359_2954_3631	224
702	3300048914	Ga0496111_0019743	Ga0496111_0019743_1084_1761	224
703	3300048915	Ga0496112_0048959	Ga0496112_0048959_1259_1936	224
704	3300048915	Ga0496112_0905039	Ga0496112_0905039_113_790	224
705	3300048916	Ga0496113_0059184	Ga0496113_0059184_362_1039	224
706	3300048916	Ga0496113_0119118	Ga0496113_0119118_879_1556	224
707	3300048916	Ga0496113_0119629	Ga0496113_0119629_629_1306	224
708	3300048917	Ga0496114_0102807	Ga0496114_0102807_1086_1763	224
709	3300048917	Ga0496114_0134724	Ga0496114_0134724_179_856	224
710	3300048918	Ga0496115_0028311	Ga0496115_0028311_3626_4303	224
711	3300048918	Ga0496115_0047442	Ga0496115_0047442_2120_2797	224
712	3300048918	Ga0496115_0207876	Ga0496115_0207876_721_1398	224
713	3300048922	Ga0496119_0054433	Ga0496119_0054433_68_745	224
714	3300048929	Ga0496126_0004952	Ga0496126_0004952_8963_9640	224
715	3300048929	Ga0496126_0043878	Ga0496126_0043878_3387_4064	224
716	3300048929	Ga0496126_0438497	Ga0496126_0438497_73_750	224
717	3300049569	Ga0501032_0076296	Ga0501032_0076296_773_1450	224
718	3300049571	Ga0501034_0007085	Ga0501034_0007085_6154_6831	224
719	3300049572	Ga0501036_0000154	Ga0501036_0000154_41723_42400	224
720	3300049573	Ga0501037_0006107	Ga0501037_0006107_16_693	224
721	3300049574	Ga0501038_0029152	Ga0501038_0029152_3935_4612	224
722	3300049575	Ga0501039_0143434	Ga0501039_0143434_973_1650	224
723	3300049578	Ga0501042_0033230	Ga0501042_0033230_2656_3333	224
724	3300049579	Ga0501043_0003227	Ga0501043_0003227_9533_10210	224
725	3300049580	Ga0501046_0181215	Ga0501046_0181215_18_695	224
726	3300049581	Ga0501047_0029209	Ga0501047_0029209_470_1147	224
727	3300049581	Ga0501047_0099451	Ga0501047_0099451_245_922	224
728	3300049582	Ga0501048_0003583	Ga0501048_0003583_2619_3296	224
729	3300049590	Ga0501074_0004389	Ga0501074_0004389_5288_5965	224
730	3300049823	Ga0501044_0043290	Ga0501044_0043290_80_757	224
731	3300050507	nmdc:mga05p37_37397_c1	nmdc:mga05p37_37397_c1_1952_2629	224
732	3300050510	nmdc:mga06r32_521174_c1	nmdc:mga06r32_521174_c1_122_799	224
733	3300050511	nmdc:mga08y16_198046_c1	nmdc:mga08y16_198046_c1_1377_2054	224
734	3300050512	nmdc:mga0n895_261667_c1	nmdc:mga0n895_261667_c1_378_1055	224
735	3300050512	nmdc:mga0n895_303043_c1	nmdc:mga0n895_303043_c1_311_988	224
736	3300050513	nmdc:mga0rr50_67504_c1	nmdc:mga0rr50_67504_c1_681_1358	224
737	3300050514	nmdc:mga08x19_135827_c1	nmdc:mga08x19_135827_c1_311_988	224
738	3300050514	nmdc:mga08x19_19788_c1	nmdc:mga08x19_19788_c1_860_1537	224
739	3300050514	nmdc:mga08x19_253060_c1	nmdc:mga08x19_253060_c1_397_1074	224
740	3300050515	nmdc:mga0a205_12233_c1	nmdc:mga0a205_12233_c1_4632_5309	224
741	3300050515	nmdc:mga0a205_152994_c1	nmdc:mga0a205_152994_c1_815_1492	224
742	3300053077	Ga0495601_0035862	Ga0495601_0035862_182_859	224
743	3300053077	Ga0495601_0102025	Ga0495601_0102025_547_1224	224
744	3300053077	Ga0495601_0195085	Ga0495601_0195085_497_1174	224
745	3300053078	Ga0495612_0015838	Ga0495612_0015838_1010_1687	224
746	3300053078	Ga0495612_0023246	Ga0495612_0023246_1550_2227	224
747	3300053078	Ga0495612_0031195	Ga0495612_0031195_693_1370	224
748	3300053078	Ga0495612_0169220	Ga0495612_0169220_71_748	224
749	3300053084	Ga0495595_0010359	Ga0495595_0010359_1410_2087	224
750	3300053084	Ga0495595_0027343	Ga0495595_0027343_571_1248	224
751	3300053085	Ga0495619_0055462	Ga0495619_0055462_1430_2107	224
752	3300053085	Ga0495619_0095675	Ga0495619_0095675_442_1119	224
753	3300053085	Ga0495619_0111525	Ga0495619_0111525_122_799	224
754	3300005334	Ga0068869_100036149	Ga0068869_1000361493	225
755	3300005335	Ga0070666_10007558	Ga0070666_100075588	225
756	3300005335	Ga0070666_10136575	Ga0070666_101365752	225
757	3300005337	Ga0070682_100005056	Ga0070682_1000050564	225
758	3300005339	Ga0070660_100559084	Ga0070660_1005590842	225
759	3300005340	Ga0070689_100028136	Ga0070689_1000281362	225
760	3300005344	Ga0070661_100228940	Ga0070661_1002289402	225
761	3300005345	Ga0070692_10021193	Ga0070692_100211932	225
762	3300005347	Ga0070668_100022918	Ga0070668_1000229182	225
763	3300005355	Ga0070671_100014896	Ga0070671_1000148965	225
764	3300005355	Ga0070671_100132739	Ga0070671_1001327392	225
765	3300005364	Ga0070673_100059069	Ga0070673_1000590692	225
766	3300005366	Ga0070659_100051008	Ga0070659_1000510082	225
767	3300005367	Ga0070667_100349927	Ga0070667_1003499272	225
768	3300005406	Ga0070703_10017010	Ga0070703_100170102	225
769	3300005435	Ga0070714_100000010	Ga0070714_10000001035	225
770	3300005436	Ga0070713_100154448	Ga0070713_1001544482	225
771	3300005439	Ga0070711_100023470	Ga0070711_1000234702	225
772	3300005439	Ga0070711_100682168	Ga0070711_1006821681	225
773	3300005440	Ga0070705_100003344	Ga0070705_1000033446	225
774	3300005441	Ga0070700_100000064	Ga0070700_10000006442	225
775	3300005456	Ga0070678_100010423	Ga0070678_1000104233	225
776	3300005539	Ga0068853_100073071	Ga0068853_1000730713	225
777	3300005544	Ga0070686_100026601	Ga0070686_1000266012	225
778	3300005545	Ga0070695_100059329	Ga0070695_1000593292	225
779	3300005547	Ga0070693_100035744	Ga0070693_1000357442	225
780	3300005548	Ga0070665_100000401	Ga0070665_10000040161	225
781	3300005548	Ga0070665_100032363	Ga0070665_1000323632	225
782	3300005578	Ga0068854_100270222	Ga0068854_1002702222	225
783	3300005614	Ga0068856_100042199	Ga0068856_1000421993	225
784	3300005615	Ga0070702_100022796	Ga0070702_1000227962	225
785	3300005616	Ga0068852_100022811	Ga0068852_1000228114	225
786	3300005616	Ga0068852_100203210	Ga0068852_1002032102	225
787	3300005617	Ga0068859_100099277	Ga0068859_1000992774	225
788	3300005618	Ga0068864_100006862	Ga0068864_1000068623	225
789	3300005841	Ga0068863_100001365	Ga0068863_10000136514	225
790	3300005841	Ga0068863_100080467	Ga0068863_1000804674	225
791	3300005842	Ga0068858_100027030	Ga0068858_1000270304	225
792	3300005842	Ga0068858_100059448	Ga0068858_1000594482	225
793	3300005843	Ga0068860_100000114	Ga0068860_10000011461	225
794	3300005843	Ga0068860_100054813	Ga0068860_1000548133	225
795	3300005844	Ga0068862_100077659	Ga0068862_1000776591	225
796	3300005937	Ga0081455_10000575	Ga0081455_1000057511	225
797	3300006175	Ga0070712_100005233	Ga0070712_1000052332	225
798	3300006237	Ga0097621_100024496	Ga0097621_1000244962	225
799	3300006358	Ga0068871_100036095	Ga0068871_1000360953	225
800	3300006871	Ga0075434_100023481	Ga0075434_1000234817	225
801	3300006914	Ga0075436_100095199	Ga0075436_1000951992	225
802	3300006931	Ga0097620_100099277	Ga0097620_1000992771	225
803	3300009093	Ga0105240_10058787	Ga0105240_100587872	225
804	3300009093	Ga0105240_10085449	Ga0105240_100854493	225
805	3300009094	Ga0111539_10143921	Ga0111539_101439213	225
806	3300009098	Ga0105245_10008898	Ga0105245_1000889810	225
807	3300009101	Ga0105247_10030438	Ga0105247_100304382	225
808	3300009148	Ga0105243_10013663	Ga0105243_100136636	225
809	3300009174	Ga0105241_10021949	Ga0105241_100219495	225
810	3300009551	Ga0105238_10089976	Ga0105238_100899762	225
811	3300009553	Ga0105249_10011339	Ga0105249_100113398	225
812	3300009553	Ga0105249_10523642	Ga0105249_105236422	225
813	3300011119	Ga0105246_10046747	Ga0105246_100467472	225
814	3300013104	Ga0157370_10130425	Ga0157370_101304252	225
815	3300013104	Ga0157370_10337002	Ga0157370_103370022	225
816	3300013296	Ga0157374_10266988	Ga0157374_102669882	225
817	3300013296	Ga0157374_10801467	Ga0157374_108014671	225
818	3300013297	Ga0157378_10284544	Ga0157378_102845442	225
819	3300013306	Ga0163162_10793150	Ga0163162_107931502	225
820	3300013307	Ga0157372_10000658	Ga0157372_1000065827	225
821	3300013308	Ga0157375_10421579	Ga0157375_104215792	225
822	3300014325	Ga0163163_10061951	Ga0163163_100619513	225
823	3300014745	Ga0157377_10094225	Ga0157377_100942252	225
824	3300014968	Ga0157379_10085479	Ga0157379_100854792	225
825	3300014968	Ga0157379_10140904	Ga0157379_101409042	225
826	3300014969	Ga0157376_10253081	Ga0157376_102530812	225
827	3300025903	Ga0207680_10024029	Ga0207680_100240293	225
828	3300025903	Ga0207680_10121741	Ga0207680_101217412	225
829	3300025904	Ga0207647_10052960	Ga0207647_100529602	225
830	3300025911	Ga0207654_10036321	Ga0207654_100363212	225
831	3300025913	Ga0207695_10236258	Ga0207695_102362582	225
832	3300025913	Ga0207695_10380506	Ga0207695_103805061	225
833	3300025915	Ga0207693_10006369	Ga0207693_100063698	225
834	3300025916	Ga0207663_10022703	Ga0207663_100227032	225
835	3300025918	Ga0207662_10083704	Ga0207662_100837041	225
836	3300025919	Ga0207657_10004980	Ga0207657_100049808	225
837	3300025924	Ga0207694_10369184	Ga0207694_103691842	225
838	3300025927	Ga0207687_10017480	Ga0207687_100174804	225
839	3300025927	Ga0207687_10106279	Ga0207687_101062792	225
840	3300025929	Ga0207664_10000009	Ga0207664_10000009240	225
841	3300025929	Ga0207664_10265488	Ga0207664_102654881	225
842	3300025933	Ga0207706_10020091	Ga0207706_100200917	225
843	3300025934	Ga0207686_10118300	Ga0207686_101183001	225
844	3300025936	Ga0207670_10459137	Ga0207670_104591371	225
845	3300025937	Ga0207669_10178475	Ga0207669_101784752	225
846	3300025941	Ga0207711_10143807	Ga0207711_101438072	225
847	3300025949	Ga0207667_10114334	Ga0207667_101143343	225
848	3300025949	Ga0207667_10664637	Ga0207667_106646372	225
849	3300025960	Ga0207651_10126687	Ga0207651_101266872	225
850	3300025972	Ga0207668_10024607	Ga0207668_100246072	225
851	3300025981	Ga0207640_10560147	Ga0207640_105601472	225
852	3300026035	Ga0207703_10033367	Ga0207703_100333672	225
853	3300026041	Ga0207639_10055105	Ga0207639_100551054	225
854	3300026067	Ga0207678_10007661	Ga0207678_100076618	225
855	3300026075	Ga0207708_10000076	Ga0207708_1000007630	225
856	3300026078	Ga0207702_10230973	Ga0207702_102309732	225
857	3300026088	Ga0207641_10043271	Ga0207641_100432712	225
858	3300026088	Ga0207641_10315816	Ga0207641_103158162	225
859	3300026095	Ga0207676_10112106	Ga0207676_101121061	225
860	3300026118	Ga0207675_100083772	Ga0207675_1000837723	225
861	3300026121	Ga0207683_10010511	Ga0207683_100105115	225
862	3300026142	Ga0207698_10014788	Ga0207698_100147884	225
863	3300026142	Ga0207698_10464844	Ga0207698_104648441	225
864	3300028379	Ga0268266_10003295	Ga0268266_1000329511	225
865	3300028379	Ga0268266_10318640	Ga0268266_103186402	225
866	3300028381	Ga0268264_10000147	Ga0268264_1000014761	225
867	3300028381	Ga0268264_10472530	Ga0268264_104725301	225
868	3300035088	Ga0373940_0005394	Ga0373940_0005394_1945_2685	225
869	3300035114	Ga0373939_0015568	Ga0373939_0015568_1219_1899	225
870	3300035118	Ga0373954_0212017	Ga0373954_0212017_147_827	225
871	3300035121	Ga0373960_0006179	Ga0373960_0006179_1398_2138	225
872	3300035207	Ga0373942_0012258	Ga0373942_0012258_1044_1784	225
873	3300035691	Ga0373931_0262341	Ga0373931_0262341_51_731	225
874	3300035695	Ga0373927_0137679	Ga0373927_0137679_639_1319	225
875	3300037068	Ga0373925_0254485	Ga0373925_0254485_63_803	225
876	3300038443	Ga0395901_0749100	Ga0395901_0749100_41_721	225
877	3300039437	Ga0436365_0144311	Ga0436365_0144311_113_793	225
878	3300039437	Ga0436365_0789144	Ga0436365_0789144_1675_2355	225
879	3300039437	Ga0436365_1434079	Ga0436365_1434079_812_1492	225
880	3300044658	Ga0466972_0003903	Ga0466972_0003903_4784_5464	225
881	3300044693	Ga0466961_0219468	Ga0466961_0219468_422_1102	225
882	3300044694	Ga0466963_0004547	Ga0466963_0004547_6120_6800	225
883	3300044719	Ga0466971_0011590	Ga0466971_0011590_2458_3138	225
884	3300044842	Ga0466957_0047119	Ga0466957_0047119_892_1572	225
885	3300044842	Ga0466957_0269937	Ga0466957_0269937_172_852	225
886	3300045836	Ga0466958_0019871	Ga0466958_0019871_1815_2495	225
887	3300045976	Ga0466967_0011410	Ga0466967_0011410_701_1381	225
888	3300045976	Ga0466967_0065600	Ga0466967_0065600_927_1607	225
889	3300045976	Ga0466967_0519108	Ga0466967_0519108_310_990	225
890	3300046455	Ga0495603_0364295	Ga0495603_0364295_28_708	225
891	3300046461	Ga0495641_0065678	Ga0495641_0065678_909_1589	225
892	3300048904	Ga0496101_0028793	Ga0496101_0028793_2583_3263	225
893	3300048905	Ga0496102_0014285	Ga0496102_0014285_4057_4797	225
894	3300048905	Ga0496102_0209726	Ga0496102_0209726_349_1029	225
895	3300048907	Ga0496104_0016097	Ga0496104_0016097_2869_3609	225
896	3300048907	Ga0496104_0322655	Ga0496104_0322655_508_1188	225
897	3300048908	Ga0496105_0018813	Ga0496105_0018813_2067_2807	225
898	3300048910	Ga0496107_0013004	Ga0496107_0013004_1024_1764	225
899	3300048911	Ga0496108_0373293	Ga0496108_0373293_166_846	225
900	3300048911	Ga0496108_0778364	Ga0496108_0778364_19_699	225
901	3300048912	Ga0496109_0028918	Ga0496109_0028918_2625_3305	225
902	3300048912	Ga0496109_0131240	Ga0496109_0131240_917_1597	225
903	3300048913	Ga0496110_0046500	Ga0496110_0046500_1287_1967	225
904	3300048913	Ga0496110_0193491	Ga0496110_0193491_743_1423	225
905	3300048914	Ga0496111_0001697	Ga0496111_0001697_6212_6952	225
906	3300048914	Ga0496111_0020319	Ga0496111_0020319_2271_2951	225
907	3300048915	Ga0496112_0028415	Ga0496112_0028415_2644_3384	225
908	3300048916	Ga0496113_0015052	Ga0496113_0015052_822_1562	225
909	3300048917	Ga0496114_0009285	Ga0496114_0009285_3008_3748	225
910	3300048918	Ga0496115_0021963	Ga0496115_0021963_1240_1920	225
911	3300048922	Ga0496119_0000200	Ga0496119_0000200_51558_52238	225
912	3300048923	Ga0496120_0002957	Ga0496120_0002957_8129_8809	225
913	3300049568	Ga0501031_0310468	Ga0501031_0310468_101_793	225
914	3300050511	nmdc:mga08y16_127471_c1	nmdc:mga08y16_127471_c1_619_1359	225
915	3300050512	nmdc:mga0n895_23116_c1	nmdc:mga0n895_23116_c1_3556_4236	225
916	3300050515	nmdc:mga0a205_18672_c1	nmdc:mga0a205_18672_c1_5583_6263	225
917	3300061719	Ga0466962_0036934	Ga0466962_0036934_585_1265	225
918	3300002075	JGI24738J21930_10011186	JGI24738J21930_100111862	226
919	3300003215	JGI25153J46596_10032512	JGI25153J46596_100325122	226
920	3300003323	rootH1_10002967	rootH1_100029672	226
921	3300003354	JGI25160J50197_1016566	JGI25160J50197_10165662	226
922	3300003578	Ga0006562J51391_1011721	Ga0006562J51391_10117212	226
923	3300003578	Ga0006562J51391_1011722	Ga0006562J51391_10117223	226
924	3300003578	Ga0006562J51391_1056397	Ga0006562J51391_10563973	226
925	3300003578	Ga0006562J51391_1071703	Ga0006562J51391_10717032	226
926	3300003578	Ga0006562J51391_1071704	Ga0006562J51391_10717042	226
927	3300005288	Ga0065714_10006949	Ga0065714_100069495	226
928	3300005327	Ga0070658_10001387	Ga0070658_1000138712	226
929	3300005344	Ga0070661_100560851	Ga0070661_1005608512	226
930	3300005367	Ga0070667_100018998	Ga0070667_1000189986	226
931	3300005435	Ga0070714_100012670	Ga0070714_1000126708	226
932	3300005435	Ga0070714_100805068	Ga0070714_1008050682	226
933	3300005436	Ga0070713_100234602	Ga0070713_1002346022	226
934	3300005459	Ga0068867_100702227	Ga0068867_1007022272	226
935	3300005466	Ga0070685_10173891	Ga0070685_101738912	226
936	3300005548	Ga0070665_100087185	Ga0070665_1000871852	226
937	3300005548	Ga0070665_100141565	Ga0070665_1001415652	226
938	3300005563	Ga0068855_100050361	Ga0068855_1000503613	226
939	3300005578	Ga0068854_100020711	Ga0068854_1000207113	226
940	3300005614	Ga0068856_100035500	Ga0068856_1000355006	226
941	3300005614	Ga0068856_100268510	Ga0068856_1002685102	226
942	3300005614	Ga0068856_100749395	Ga0068856_1007493952	226
943	3300005616	Ga0068852_100050239	Ga0068852_1000502394	226
944	3300005616	Ga0068852_100212067	Ga0068852_1002120672	226
945	3300005842	Ga0068858_100000732	Ga0068858_1000007324	226
946	3300005937	Ga0081455_10020190	Ga0081455_100201907	226
947	3300005937	Ga0081455_10540228	Ga0081455_105402282	226
948	3300005983	Ga0081540_1038105	Ga0081540_10381054	226
949	3300005985	Ga0081539_10001059	Ga0081539_1000105925	226
950	3300006038	Ga0075365_10281722	Ga0075365_102817222	226
951	3300006038	Ga0075365_10498273	Ga0075365_104982731	226
952	3300006042	Ga0075368_10265944	Ga0075368_102659441	226
953	3300006048	Ga0075363_100007574	Ga0075363_1000075743	226
954	3300006353	Ga0075370_10103451	Ga0075370_101034512	226
955	3300006844	Ga0075428_100042278	Ga0075428_1000422782	226
956	3300009011	Ga0105251_10009100	Ga0105251_100091005	226
957	3300009011	Ga0105251_10030150	Ga0105251_100301503	226
958	3300009092	Ga0105250_10016018	Ga0105250_100160182	226
959	3300009098	Ga0105245_10373998	Ga0105245_103739982	226
960	3300009101	Ga0105247_10000038	Ga0105247_1000003859	226
961	3300009101	Ga0105247_10003476	Ga0105247_100034764	226
962	3300009147	Ga0114129_10093489	Ga0114129_100934891	226
963	3300009148	Ga0105243_10021441	Ga0105243_100214415	226
964	3300009148	Ga0105243_10470862	Ga0105243_104708622	226
965	3300009177	Ga0105248_10004635	Ga0105248_1000463511	226
966	3300009177	Ga0105248_10785059	Ga0105248_107850592	226
967	3300009545	Ga0105237_10797605	Ga0105237_107976051	226
968	3300009551	Ga0105238_10603642	Ga0105238_106036421	226
969	3300009553	Ga0105249_10523618	Ga0105249_105236182	226
970	3300010375	Ga0105239_10624742	Ga0105239_106247422	226
971	3300012498	Ga0157345_1003149	Ga0157345_10031492	226
972	3300013105	Ga0157369_10007003	Ga0157369_100070034	226
973	3300013105	Ga0157369_10007588	Ga0157369_1000758813	226
974	3300013105	Ga0157369_10483585	Ga0157369_104835852	226
975	3300013307	Ga0157372_10158826	Ga0157372_101588262	226
976	3300013308	Ga0157375_10381066	Ga0157375_103810661	226
977	3300014325	Ga0163163_10021634	Ga0163163_100216344	226
978	3300014325	Ga0163163_10022975	Ga0163163_100229752	226
979	3300014326	Ga0157380_10051491	Ga0157380_100514912	226
980	3300014497	Ga0182008_10001457	Ga0182008_1000145713	226
981	3300014745	Ga0157377_10061621	Ga0157377_100616212	226
982	3300015262	Ga0182007_10011898	Ga0182007_100118983	226
983	3300015688	Ga0183367_1005	Ga0183367_100599	226
984	3300017792	Ga0163161_10334050	Ga0163161_103340502	226
985	3300021388	Ga0213875_10016464	Ga0213875_100164642	226
986	3300021388	Ga0213875_10299394	Ga0213875_102993941	226
987	3300022467	Ga0224712_10004812	Ga0224712_100048122	226
988	3300022467	Ga0224712_10122252	Ga0224712_101222521	226
989	3300025297	Ga0209758_1005482	Ga0209758_10054826	226
990	3300025302	Ga0207426_1004843	Ga0207426_10048432	226
991	3300025302	Ga0207426_1008083	Ga0207426_10080836	226
992	3300025302	Ga0207426_1010813	Ga0207426_10108132	226
993	3300025302	Ga0207426_1048669	Ga0207426_10486692	226
994	3300025711	Ga0207696_1048405	Ga0207696_10484052	226
995	3300025735	Ga0207713_1005803	Ga0207713_10058037	226
996	3300025900	Ga0207710_10000054	Ga0207710_1000005428	226
997	3300025900	Ga0207710_10000199	Ga0207710_100001993	226
998	3300025904	Ga0207647_10013191	Ga0207647_100131915	226
999	3300025904	Ga0207647_10027943	Ga0207647_100279434	226
1000	3300025909	Ga0207705_10000573	Ga0207705_1000057323	226
1001	3300025911	Ga0207654_10024354	Ga0207654_100243544	226
1002	3300025912	Ga0207707_10258377	Ga0207707_102583771	226
1003	3300025913	Ga0207695_10008627	Ga0207695_1000862711	226
1004	3300025914	Ga0207671_10000188	Ga0207671_100001884	226
1005	3300025916	Ga0207663_10129919	Ga0207663_101299191	226
1006	3300025921	Ga0207652_10236479	Ga0207652_102364793	226
1007	3300025924	Ga0207694_10004684	Ga0207694_1000468410	226
1008	3300025924	Ga0207694_10127303	Ga0207694_101273032	226
1009	3300025928	Ga0207700_10046488	Ga0207700_100464882	226
1010	3300025928	Ga0207700_10188450	Ga0207700_101884502	226
1011	3300025929	Ga0207664_10003123	Ga0207664_100031237	226
1012	3300025932	Ga0207690_10715941	Ga0207690_107159411	226
1013	3300025935	Ga0207709_10066719	Ga0207709_100667193	226
1014	3300025939	Ga0207665_10422739	Ga0207665_104227392	226
1015	3300025941	Ga0207711_10069180	Ga0207711_100691802	226
1016	3300025944	Ga0207661_10044710	Ga0207661_100447102	226
1017	3300025949	Ga0207667_10067860	Ga0207667_100678602	226
1018	3300025949	Ga0207667_10692040	Ga0207667_106920402	226
1019	3300025981	Ga0207640_10031406	Ga0207640_100314061	226
1020	3300025986	Ga0207658_10042016	Ga0207658_100420162	226
1021	3300026023	Ga0207677_10900324	Ga0207677_109003241	226
1022	3300026035	Ga0207703_10000047	Ga0207703_10000047159	226
1023	3300026041	Ga0207639_10019625	Ga0207639_100196251	226
1024	3300026067	Ga0207678_10327538	Ga0207678_103275382	226
1025	3300026078	Ga0207702_10211140	Ga0207702_102111402	226
1026	3300026078	Ga0207702_10659437	Ga0207702_106594371	226
1027	3300026121	Ga0207683_10591025	Ga0207683_105910252	226
1028	3300026121	Ga0207683_10785520	Ga0207683_107855201	226
1029	3300026142	Ga0207698_10070428	Ga0207698_100704282	226
1030	3300026142	Ga0207698_10215039	Ga0207698_102150392	226
1031	3300027312	Ga0209371_1036492	Ga0209371_10364921	226
1032	3300027666	Ga0209282_1104653	Ga0209282_11046531	226
1033	3300028379	Ga0268266_10543717	Ga0268266_105437171	226
1034	3300028573	Ga0265334_10001473	Ga0265334_1000147311	226
1035	3300028786	Ga0307517_10010734	Ga0307517_100107347	226
1036	3300028786	Ga0307517_10016489	Ga0307517_100164898	226
1037	3300028794	Ga0307515_10003702	Ga0307515_1000370228	226
1038	3300028794	Ga0307515_10043028	Ga0307515_100430282	226
1039	3300028794	Ga0307515_10078912	Ga0307515_100789123	226
1040	3300028794	Ga0307515_10113925	Ga0307515_101139252	226
1041	3300028794	Ga0307515_10346082	Ga0307515_103460822	226
1042	3300028794	Ga0307515_10355630	Ga0307515_103556301	226
1043	3300028794	Ga0307515_10421519	Ga0307515_104215192	226
1044	3300030500	Ga0268256_1030226	Ga0268256_10302261	226
1045	3300030521	Ga0307511_10001286	Ga0307511_1000128621	226
1046	3300030521	Ga0307511_10056779	Ga0307511_100567793	226
1047	3300030522	Ga0307512_10001726	Ga0307512_100017268	226
1048	3300030522	Ga0307512_10006664	Ga0307512_100066649	226
1049	3300031247	Ga0265340_10000127	Ga0265340_1000012717	226
1050	3300031456	Ga0307513_10003878	Ga0307513_1000387821	226
1051	3300031456	Ga0307513_10069197	Ga0307513_100691974	226
1052	3300031507	Ga0307509_10079436	Ga0307509_100794362	226
1053	3300031507	Ga0307509_10114455	Ga0307509_101144552	226
1054	3300031616	Ga0307508_10008805	Ga0307508_100088056	226
1055	3300031616	Ga0307508_10063253	Ga0307508_100632532	226
1056	3300031616	Ga0307508_10075915	Ga0307508_100759152	226
1057	3300031649	Ga0307514_10011203	Ga0307514_100112037	226
1058	3300031649	Ga0307514_10074227	Ga0307514_100742273	226
1059	3300031649	Ga0307514_10153866	Ga0307514_101538662	226
1060	3300031649	Ga0307514_10236484	Ga0307514_102364842	226
1061	3300031691	Ga0316579_10000077	Ga0316579_1000007713	226
1062	3300031691	Ga0316579_10007071	Ga0316579_100070714	226
1063	3300031691	Ga0316579_10032470	Ga0316579_100324702	226
1064	3300031727	Ga0316576_10038983	Ga0316576_100389832	226
1065	3300031727	Ga0316576_10168165	Ga0316576_101681652	226
1066	3300031727	Ga0316576_10258203	Ga0316576_102582032	226
1067	3300031728	Ga0316578_10037179	Ga0316578_100371794	226
1068	3300031730	Ga0307516_10053784	Ga0307516_100537843	226
1069	3300031730	Ga0307516_10085042	Ga0307516_100850422	226
1070	3300031730	Ga0307516_10212121	Ga0307516_102121212	226
1071	3300031733	Ga0316577_10051727	Ga0316577_100517273	226
1072	3300031852	Ga0307410_10062443	Ga0307410_100624433	226
1073	3300031852	Ga0307410_10401842	Ga0307410_104018422	226
1074	3300031903	Ga0307407_10100086	Ga0307407_101000862	226
1075	3300031995	Ga0307409_100257551	Ga0307409_1002575511	226
1076	3300031995	Ga0307409_100423753	Ga0307409_1004237532	226
1077	3300032002	Ga0307416_100748499	Ga0307416_1007484992	226
1078	3300032005	Ga0307411_10179029	Ga0307411_101790292	226
1079	3300032126	Ga0307415_100017174	Ga0307415_1000171743	226
1080	3300032133	Ga0316583_10037382	Ga0316583_100373822	226
1081	3300032139	Ga0316580_10083713	Ga0316580_100837132	226
1082	3300033179	Ga0307507_10000009	Ga0307507_10000009179	226
1083	3300033179	Ga0307507_10065207	Ga0307507_100652072	226
1084	3300033179	Ga0307507_10152268	Ga0307507_101522681	226
1085	3300033179	Ga0307507_10198775	Ga0307507_101987752	226
1086	3300033180	Ga0307510_10046657	Ga0307510_100466573	226
1087	3300035120	Ga0373957_0102878	Ga0373957_0102878_164_844	226
1088	3300035398	Ga0316574_0001785	Ga0316574_0001785_7744_8424	226
1089	3300036647	Ga0316582_0013111	Ga0316582_0013111_2883_3563	226
1090	3300036647	Ga0316582_0029915	Ga0316582_0029915_1690_2370	226
1091	3300036647	Ga0316582_0220683	Ga0316582_0220683_396_1076	226
1092	3300036712	Ga0316584_0060140	Ga0316584_0060140_1719_2399	226
1093	3300037418	Ga0395900_0110138	Ga0395900_0110138_1123_1803	226
1094	3300037466	Ga0395898_0182253	Ga0395898_0182253_166_846	226
1095	3300038443	Ga0395901_0029954	Ga0395901_0029954_2947_3627	226
1096	3300038443	Ga0395901_0362343	Ga0395901_0362343_725_1405	226
1097	3300038443	Ga0395901_1081816	Ga0395901_1081816_53_733	226
1098	3300041404	Ga0439436_0000369	Ga0439436_0000369_7107_7787	226
1099	3300041404	Ga0439436_0008523	Ga0439436_0008523_264_944	226
1100	3300041406	Ga0439439_0004672	Ga0439439_0004672_174_854	226
1101	3300041406	Ga0439439_0071063	Ga0439439_0071063_51_731	226
1102	3300041411	Ga0439466_0037874	Ga0439466_0037874_72_752	226
1103	3300041443	Ga0451789_0394708	Ga0451789_0394708_148_828	226
1104	3300041452	Ga0451793_1930165	Ga0451793_1930165_390_1070	226
1105	3300041999	Ga0439433_0001075	Ga0439433_0001075_4213_4893	226
1106	3300042005	Ga0439448_0049198	Ga0439448_0049198_568_1248	226
1107	3300042007	Ga0439449_0001351	Ga0439449_0001351_6367_7047	226
1108	3300042007	Ga0439449_0047792	Ga0439449_0047792_891_1571	226
1109	3300042007	Ga0439449_0139201	Ga0439449_0139201_120_800	226
1110	3300042014	Ga0439457_003251	Ga0439457_003251_2781_3461	226
1111	3300042126	Ga0450888_023225	Ga0450888_023225_47_727	226
1112	3300042461	Ga0439460_0064916	Ga0439460_0064916_363_1043	226
1113	3300044683	Ga0466965_0171166	Ga0466965_0171166_268_948	226
1114	3300044684	Ga0466966_0043489	Ga0466966_0043489_1110_1790	226
1115	3300044684	Ga0466966_0063589	Ga0466966_0063589_1568_2248	226
1116	3300044693	Ga0466961_0219638	Ga0466961_0219638_453_1133	226
1117	3300044842	Ga0466957_0355331	Ga0466957_0355331_204_884	226
1118	3300044901	Ga0466960_0043520	Ga0466960_0043520_183_863	226
1119	3300045049	Ga0466959_0080783	Ga0466959_0080783_292_972	226
1120	3300045836	Ga0466958_0014015	Ga0466958_0014015_2140_2820	226
1121	3300045836	Ga0466958_0241273	Ga0466958_0241273_323_1003	226
1122	3300045976	Ga0466967_0128608	Ga0466967_0128608_1548_2228	226
1123	3300045976	Ga0466967_0415282	Ga0466967_0415282_249_929	226
1124	3300045976	Ga0466967_0678940	Ga0466967_0678940_138_818	226
1125	3300045976	Ga0466967_1075215	Ga0466967_1075215_88_768	226
1126	3300046452	Ga0495617_002534	Ga0495617_002534_4544_5224	226
1127	3300046453	Ga0495627_013158	Ga0495627_013158_2200_2880	226
1128	3300046454	Ga0495592_0046032	Ga0495592_0046032_2532_3212	226
1129	3300046455	Ga0495603_0013288	Ga0495603_0013288_2796_3476	226
1130	3300046455	Ga0495603_0016215	Ga0495603_0016215_1656_2336	226
1131	3300046455	Ga0495603_0031472	Ga0495603_0031472_2448_3128	226
1132	3300046455	Ga0495603_0046082	Ga0495603_0046082_959_1639	226
1133	3300046457	Ga0495590_0022011	Ga0495590_0022011_96_776	226
1134	3300046459	Ga0495629_0056568	Ga0495629_0056568_1460_2140	226
1135	3300046459	Ga0495629_0093561	Ga0495629_0093561_171_851	226
1136	3300046459	Ga0495629_0109496	Ga0495629_0109496_115_795	226
1137	3300046460	Ga0495638_0152161	Ga0495638_0152161_77_757	226
1138	3300046460	Ga0495638_0163491	Ga0495638_0163491_76_756	226
1139	3300046461	Ga0495641_0122110	Ga0495641_0122110_149_829	226
1140	3300046472	Ga0495580_0088787	Ga0495580_0088787_459_1139	226
1141	3300046474	Ga0495605_0019223	Ga0495605_0019223_2007_2687	226
1142	3300046475	Ga0495639_0022556	Ga0495639_0022556_46_726	226
1143	3300046476	Ga0495662_0051644	Ga0495662_0051644_1244_1924	226
1144	3300046477	Ga0495664_0049010	Ga0495664_0049010_1641_2321	226
1145	3300046477	Ga0495664_0299212	Ga0495664_0299212_202_882	226
1146	3300046492	Ga0495585_0003798	Ga0495585_0003798_1323_2003	226
1147	3300046499	Ga0495594_0113890	Ga0495594_0113890_58_738	226
1148	3300046499	Ga0495594_0128827	Ga0495594_0128827_229_909	226
1149	3300046499	Ga0495594_0326107	Ga0495594_0326107_86_766	226
1150	3300046500	Ga0495596_0050341	Ga0495596_0050341_916_1596	226
1151	3300046507	Ga0495606_0013625	Ga0495606_0013625_4476_5156	226
1152	3300046511	Ga0495608_0155193	Ga0495608_0155193_327_1007	226
1153	3300046511	Ga0495608_0366617	Ga0495608_0366617_12_692	226
1154	3300046512	Ga0495610_0004959	Ga0495610_0004959_8351_9031	226
1155	3300046513	Ga0495616_0008463	Ga0495616_0008463_232_912	226
1156	3300046514	Ga0495618_0092236	Ga0495618_0092236_13_693	226
1157	3300046515	Ga0495620_0047482	Ga0495620_0047482_492_1172	226
1158	3300046516	Ga0495628_0095221	Ga0495628_0095221_550_1230	226
1159	3300046518	Ga0495631_0005911	Ga0495631_0005911_2596_3276	226
1160	3300046520	Ga0495637_0058397	Ga0495637_0058397_530_1210	226
1161	3300046522	Ga0495643_0012121	Ga0495643_0012121_2057_2737	226
1162	3300046524	Ga0495648_0151473	Ga0495648_0151473_19_699	226
1163	3300046526	Ga0495666_0179321	Ga0495666_0179321_269_949	226
1164	3300046529	Ga0495652_0064207	Ga0495652_0064207_2039_2719	226
1165	3300046530	Ga0495654_0052892	Ga0495654_0052892_1276_1956	226
1166	3300046531	Ga0495665_0046298	Ga0495665_0046298_511_1191	226
1167	3300046533	Ga0495640_0005364	Ga0495640_0005364_3533_4213	226
1168	3300046533	Ga0495640_0088651	Ga0495640_0088651_493_1173	226
1169	3300046538	Ga0495609_0008249	Ga0495609_0008249_3540_4220	226
1170	3300046542	Ga0495597_0073531	Ga0495597_0073531_392_1072	226
1171	3300046557	Ga0495622_0021107	Ga0495622_0021107_524_1204	226
1172	3300046558	Ga0495633_0288298	Ga0495633_0288298_36_716	226
1173	3300046559	Ga0495667_0144359	Ga0495667_0144359_385_1065	226
1174	3300046559	Ga0495667_0194755	Ga0495667_0194755_519_1199	226
1175	3300046642	Ga0495634_0006405	Ga0495634_0006405_6843_7523	226
1176	3300046663	Ga0495635_0016716	Ga0495635_0016716_3743_4423	226
1177	3300046663	Ga0495635_0231708	Ga0495635_0231708_130_810	226
1178	3300046665	Ga0495661_0021386	Ga0495661_0021386_2484_3164	226
1179	3300046675	Ga0495657_0002543	Ga0495657_0002543_11094_11774	226
1180	3300046675	Ga0495657_0036983	Ga0495657_0036983_2644_3324	226
1181	3300046675	Ga0495657_0265243	Ga0495657_0265243_44_724	226
1182	3300046675	Ga0495657_0409050	Ga0495657_0409050_50_730	226
1183	3300046683	Ga0495658_0047240	Ga0495658_0047240_1713_2393	226
1184	3300046689	Ga0495613_0024867	Ga0495613_0024867_3367_4047	226
1185	3300046689	Ga0495613_0048617	Ga0495613_0048617_2402_3082	226
1186	3300046689	Ga0495613_0524589	Ga0495613_0524589_86_766	226
1187	3300046690	Ga0495624_0082408	Ga0495624_0082408_409_1089	226
1188	3300046690	Ga0495624_0284273	Ga0495624_0284273_138_818	226
1189	3300046691	Ga0495670_0034029	Ga0495670_0034029_1034_1714	226
1190	3300046694	Ga0495649_0070923	Ga0495649_0070923_1124_1804	226
1191	3300046794	Ga0495589_0045168	Ga0495589_0045168_693_1373	226
1192	3300046810	Ga0495660_0012621	Ga0495660_0012621_4175_4855	226
1193	3300047315	Ga0495581_0040774	Ga0495581_0040774_1282_1962	226
1194	3300047317	Ga0495604_0063208	Ga0495604_0063208_1882_2562	226
1195	3300047317	Ga0495604_0097092	Ga0495604_0097092_840_1520	226
1196	3300047317	Ga0495604_0136584	Ga0495604_0136584_244_924	226
1197	3300047318	Ga0495636_0023512	Ga0495636_0023512_358_1038	226
1198	3300047319	Ga0495674_0042670	Ga0495674_0042670_2307_2987	226
1199	3300047320	Ga0495672_0051574	Ga0495672_0051574_1236_1916	226
1200	3300047321	Ga0495676_0036064	Ga0495676_0036064_1465_2145	226
1201	3300047322	Ga0495680_0018955	Ga0495680_0018955_1513_2193	226
1202	3300047443	Ga0495687_002534	Ga0495687_002534_12306_12986	226
1203	3300047444	Ga0495675_0014468	Ga0495675_0014468_2019_2699	226
1204	3300047470	Ga0495681_0011246	Ga0495681_0011246_3696_4376	226
1205	3300047472	Ga0495686_0374598	Ga0495686_0374598_63_743	226
1206	3300048089	Ga0495614_0184814	Ga0495614_0184814_222_902	226
1207	3300048091	Ga0495626_0006328	Ga0495626_0006328_1293_1973	226
1208	3300048903	Ga0496100_0189882	Ga0496100_0189882_205_885	226
1209	3300048905	Ga0496102_0533770	Ga0496102_0533770_159_839	226
1210	3300048907	Ga0496104_0072280	Ga0496104_0072280_632_1312	226
1211	3300048907	Ga0496104_0162629	Ga0496104_0162629_189_869	226
1212	3300048907	Ga0496104_0500953	Ga0496104_0500953_52_732	226
1213	3300048909	Ga0496106_0351626	Ga0496106_0351626_80_760	226
1214	3300048910	Ga0496107_0314608	Ga0496107_0314608_434_1114	226
1215	3300048910	Ga0496107_0687800	Ga0496107_0687800_12_692	226
1216	3300048911	Ga0496108_0170435	Ga0496108_0170435_597_1277	226
1217	3300048912	Ga0496109_0022092	Ga0496109_0022092_4887_5567	226
1218	3300048912	Ga0496109_0154342	Ga0496109_0154342_523_1203	226
1219	3300048912	Ga0496109_0251297	Ga0496109_0251297_180_860	226
1220	3300048913	Ga0496110_0022947	Ga0496110_0022947_2615_3295	226
1221	3300048913	Ga0496110_0171323	Ga0496110_0171323_1260_1940	226
1222	3300048913	Ga0496110_0571790	Ga0496110_0571790_132_812	226
1223	3300048913	Ga0496110_0874104	Ga0496110_0874104_29_709	226
1224	3300048914	Ga0496111_0035970	Ga0496111_0035970_2387_3067	226
1225	3300048914	Ga0496111_0044283	Ga0496111_0044283_2294_2974	226
1226	3300048915	Ga0496112_0088303	Ga0496112_0088303_2057_2737	226
1227	3300048917	Ga0496114_0004150	Ga0496114_0004150_2322_3002	226
1228	3300048917	Ga0496114_0278431	Ga0496114_0278431_339_1019	226
1229	3300048917	Ga0496114_0852798	Ga0496114_0852798_41_721	226
1230	3300048918	Ga0496115_0707159	Ga0496115_0707159_95_775	226
1231	3300048922	Ga0496119_0000475	Ga0496119_0000475_40964_41644	226
1232	3300048922	Ga0496119_0026206	Ga0496119_0026206_364_1044	226
1233	3300048923	Ga0496120_0000353	Ga0496120_0000353_62776_63456	226
1234	3300048924	Ga0496121_0014747	Ga0496121_0014747_2782_3462	226
1235	3300048928	Ga0496125_0293085	Ga0496125_0293085_85_765	226
1236	3300048929	Ga0496126_0026965	Ga0496126_0026965_1417_2097	226
1237	3300049459	Ga0495678_027678	Ga0495678_027678_401_1081	226
1238	3300049460	Ga0495682_0041301	Ga0495682_0041301_129_809	226
1239	3300049568	Ga0501031_0014095	Ga0501031_0014095_3643_4323	226
1240	3300049569	Ga0501032_0038311	Ga0501032_0038311_833_1513	226
1241	3300049570	Ga0501033_0032215	Ga0501033_0032215_137_817	226
1242	3300049570	Ga0501033_0034045	Ga0501033_0034045_1200_1880	226
1243	3300049570	Ga0501033_0150444	Ga0501033_0150444_792_1472	226
1244	3300049571	Ga0501034_0008257	Ga0501034_0008257_833_1513	226
1245	3300049571	Ga0501034_0581792	Ga0501034_0581792_11_691	226
1246	3300049572	Ga0501036_0007966	Ga0501036_0007966_7332_8012	226
1247	3300049572	Ga0501036_0010321	Ga0501036_0010321_5473_6153	226
1248	3300049572	Ga0501036_0017214	Ga0501036_0017214_4989_5669	226
1249	3300049573	Ga0501037_0093624	Ga0501037_0093624_660_1340	226
1250	3300049573	Ga0501037_0629464	Ga0501037_0629464_25_705	226
1251	3300049574	Ga0501038_0008899	Ga0501038_0008899_7654_8334	226
1252	3300049574	Ga0501038_0181013	Ga0501038_0181013_15_695	226
1253	3300049574	Ga0501038_0410994	Ga0501038_0410994_51_731	226
1254	3300049575	Ga0501039_0095901	Ga0501039_0095901_973_1653	226
1255	3300049575	Ga0501039_0730034	Ga0501039_0730034_78_758	226
1256	3300049576	Ga0501040_0028569	Ga0501040_0028569_1881_2561	226
1257	3300049577	Ga0501041_0020014	Ga0501041_0020014_2269_2949	226
1258	3300049578	Ga0501042_0084146	Ga0501042_0084146_683_1363	226
1259	3300049579	Ga0501043_0005709	Ga0501043_0005709_8685_9365	226
1260	3300049579	Ga0501043_0010922	Ga0501043_0010922_711_1391	226
1261	3300049579	Ga0501043_0165569	Ga0501043_0165569_701_1381	226
1262	3300049579	Ga0501043_0233097	Ga0501043_0233097_717_1397	226
1263	3300049580	Ga0501046_0046370	Ga0501046_0046370_687_1367	226
1264	3300049581	Ga0501047_0000033	Ga0501047_0000033_94991_95671	226
1265	3300049581	Ga0501047_0000369	Ga0501047_0000369_13_693	226
1266	3300049581	Ga0501047_0001481	Ga0501047_0001481_15621_16301	226
1267	3300049581	Ga0501047_0127143	Ga0501047_0127143_1406_2086	226
1268	3300049581	Ga0501047_0183674	Ga0501047_0183674_417_1097	226
1269	3300049581	Ga0501047_0461742	Ga0501047_0461742_210_890	226
1270	3300049582	Ga0501048_0006936	Ga0501048_0006936_7049_7729	226
1271	3300049583	Ga0501067_0021266	Ga0501067_0021266_900_1580	226
1272	3300049584	Ga0501068_0013033	Ga0501068_0013033_1860_2540	226
1273	3300049585	Ga0501069_0010447	Ga0501069_0010447_2046_2726	226
1274	3300049586	Ga0501070_0008402	Ga0501070_0008402_6486_7166	226
1275	3300049586	Ga0501070_0040771	Ga0501070_0040771_1191_1871	226
1276	3300049586	Ga0501070_0749249	Ga0501070_0749249_21_701	226
1277	3300049587	Ga0501071_0000622	Ga0501071_0000622_3768_4448	226
1278	3300049588	Ga0501072_0042082	Ga0501072_0042082_1873_2553	226
1279	3300049589	Ga0501073_0061740	Ga0501073_0061740_1873_2553	226
1280	3300049589	Ga0501073_0306197	Ga0501073_0306197_227_907	226
1281	3300049590	Ga0501074_0003420	Ga0501074_0003420_5115_5795	226
1282	3300049592	Ga0501076_0096796	Ga0501076_0096796_818_1498	226
1283	3300049593	Ga0501077_0048562	Ga0501077_0048562_819_1499	226
1284	3300049741	Ga0501079_0103124	Ga0501079_0103124_846_1526	226
1285	3300049742	Ga0501080_0032359	Ga0501080_0032359_16_696	226
1286	3300049742	Ga0501080_0057577	Ga0501080_0057577_938_1618	226
1287	3300049744	Ga0501083_0001270	Ga0501083_0001270_9419_10099	226
1288	3300049822	Ga0501035_0050911	Ga0501035_0050911_833_1513	226
1289	3300049822	Ga0501035_0171437	Ga0501035_0171437_139_819	226
1290	3300049823	Ga0501044_0003451	Ga0501044_0003451_8685_9365	226
1291	3300049823	Ga0501044_0032181	Ga0501044_0032181_1271_1951	226
1292	3300049823	Ga0501044_0042581	Ga0501044_0042581_2209_2889	226
1293	3300049823	Ga0501044_0292757	Ga0501044_0292757_721_1401	226
1294	3300049824	Ga0501045_0037402	Ga0501045_0037402_2188_2868	226
1295	3300049824	Ga0501045_0057284	Ga0501045_0057284_640_1320	226
1296	3300050492	nmdc:mga0yw44_510969_c1	nmdc:mga0yw44_510969_c1_26_706	226
1297	3300053083	Ga0495655_0004208	Ga0495655_0004208_1459_2139	226
1298	3300053099	Ga0500654_149730	Ga0500654_149730_57_737	226
1299	3300053106	Ga0500558_069221	Ga0500558_069221_86_766	226
1300	3300053107	Ga0500560_002512	Ga0500560_002512_1257_1937	226
1301	3300053131	Ga0500652_032895	Ga0500652_032895_830_1510	226
1302	3300053134	Ga0500658_0174001	Ga0500658_0174001_227_907	226
1303	3300053140	Ga0500573_0064343	Ga0500573_0064343_1070_1750	226
1304	3300053153	Ga0500616_0001111	Ga0500616_0001111_41_721	226
1305	3300053153	Ga0500616_0001619	Ga0500616_0001619_36_716	226
1306	3300053153	Ga0500616_0102913	Ga0500616_0102913_72_752	226
1307	3300053732	Ga0500656_018751	Ga0500656_018751_45_725	226
1308	3300054114	Ga0501084_0041617	Ga0501084_0041617_2600_3280	226
1309	3300060353	Ga0501082_0077792	Ga0501082_0077792_1937_2617	226
1310	3300061719	Ga0466962_0036829	Ga0466962_0036829_387_1067	226
1311	3300061734	Ga0530510_0052918	Ga0530510_0052918_431_1111	226
1312	iso_pu_bacteria	8055157932	8055160494	226
1313	3300002067	JGI24735J21928_10011146	JGI24735J21928_100111462	227
1314	3300005327	Ga0070658_10184078	Ga0070658_101840782	227
1315	3300005327	Ga0070658_10250538	Ga0070658_102505382	227
1316	3300005328	Ga0070676_10072473	Ga0070676_100724732	227
1317	3300005329	Ga0070683_100166867	Ga0070683_1001668672	227
1318	3300005329	Ga0070683_100348384	Ga0070683_1003483842	227
1319	3300005334	Ga0068869_100364963	Ga0068869_1003649632	227
1320	3300005335	Ga0070666_10061196	Ga0070666_100611962	227
1321	3300005336	Ga0070680_100013093	Ga0070680_1000130938	227
1322	3300005336	Ga0070680_100035119	Ga0070680_1000351192	227
1323	3300005336	Ga0070680_100337751	Ga0070680_1003377512	227
1324	3300005338	Ga0068868_100067018	Ga0068868_1000670183	227
1325	3300005339	Ga0070660_100038049	Ga0070660_1000380494	227
1326	3300005339	Ga0070660_100084706	Ga0070660_1000847063	227
1327	3300005341	Ga0070691_10014121	Ga0070691_100141213	227
1328	3300005341	Ga0070691_10017039	Ga0070691_100170392	227
1329	3300005345	Ga0070692_10170923	Ga0070692_101709232	227
1330	3300005347	Ga0070668_100046575	Ga0070668_1000465753	227
1331	3300005347	Ga0070668_100067218	Ga0070668_1000672182	227
1332	3300005354	Ga0070675_100221788	Ga0070675_1002217882	227
1333	3300005354	Ga0070675_100300602	Ga0070675_1003006022	227
1334	3300005356	Ga0070674_100201836	Ga0070674_1002018362	227
1335	3300005356	Ga0070674_100228758	Ga0070674_1002287582	227
1336	3300005364	Ga0070673_100066970	Ga0070673_1000669702	227
1337	3300005364	Ga0070673_100274444	Ga0070673_1002744442	227
1338	3300005365	Ga0070688_100080165	Ga0070688_1000801652	227
1339	3300005434	Ga0070709_10000220	Ga0070709_1000022015	227
1340	3300005434	Ga0070709_10003796	Ga0070709_100037961	227
1341	3300005434	Ga0070709_10026469	Ga0070709_100264693	227
1342	3300005434	Ga0070709_10093584	Ga0070709_100935843	227
1343	3300005435	Ga0070714_100001618	Ga0070714_10000161817	227
1344	3300005435	Ga0070714_100044829	Ga0070714_1000448292	227
1345	3300005435	Ga0070714_100053229	Ga0070714_1000532293	227
1346	3300005435	Ga0070714_100070235	Ga0070714_1000702353	227
1347	3300005435	Ga0070714_100077141	Ga0070714_1000771413	227
1348	3300005435	Ga0070714_100136718	Ga0070714_1001367183	227
1349	3300005435	Ga0070714_100325816	Ga0070714_1003258162	227
1350	3300005435	Ga0070714_100489764	Ga0070714_1004897642	227
1351	3300005436	Ga0070713_100002276	Ga0070713_10000227615	227
1352	3300005436	Ga0070713_100033632	Ga0070713_1000336323	227
1353	3300005436	Ga0070713_100040074	Ga0070713_1000400743	227
1354	3300005436	Ga0070713_100059945	Ga0070713_1000599453	227
1355	3300005436	Ga0070713_100124310	Ga0070713_1001243101	227
1356	3300005436	Ga0070713_100263889	Ga0070713_1002638891	227
1357	3300005437	Ga0070710_10000122	Ga0070710_1000012217	227
1358	3300005437	Ga0070710_10002549	Ga0070710_100025492	227
1359	3300005437	Ga0070710_10005500	Ga0070710_100055004	227
1360	3300005437	Ga0070710_10024969	Ga0070710_100249694	227
1361	3300005437	Ga0070710_10041832	Ga0070710_100418322	227
1362	3300005437	Ga0070710_10071555	Ga0070710_100715553	227
1363	3300005437	Ga0070710_10117994	Ga0070710_101179941	227
1364	3300005439	Ga0070711_100000421	Ga0070711_1000004218	227
1365	3300005439	Ga0070711_100052212	Ga0070711_1000522123	227
1366	3300005439	Ga0070711_100426264	Ga0070711_1004262642	227
1367	3300005439	Ga0070711_100484054	Ga0070711_1004840541	227
1368	3300005444	Ga0070694_100173076	Ga0070694_1001730762	227
1369	3300005445	Ga0070708_100026861	Ga0070708_1000268612	227
1370	3300005445	Ga0070708_100043452	Ga0070708_1000434523	227
1371	3300005445	Ga0070708_100104614	Ga0070708_1001046143	227
1372	3300005445	Ga0070708_100132463	Ga0070708_1001324632	227
1373	3300005445	Ga0070708_100364242	Ga0070708_1003642422	227
1374	3300005445	Ga0070708_100366596	Ga0070708_1003665962	227
1375	3300005445	Ga0070708_101081058	Ga0070708_1010810581	227
1376	3300005455	Ga0070663_100063514	Ga0070663_1000635142	227
1377	3300005455	Ga0070663_100155171	Ga0070663_1001551712	227
1378	3300005456	Ga0070678_100030918	Ga0070678_1000309182	227
1379	3300005456	Ga0070678_100139558	Ga0070678_1001395582	227
1380	3300005458	Ga0070681_10014130	Ga0070681_100141304	227
1381	3300005458	Ga0070681_10318200	Ga0070681_103182002	227
1382	3300005458	Ga0070681_10396346	Ga0070681_103963462	227
1383	3300005459	Ga0068867_100151666	Ga0068867_1001516662	227
1384	3300005466	Ga0070685_10215640	Ga0070685_102156401	227
1385	3300005467	Ga0070706_100004020	Ga0070706_1000040209	227
1386	3300005467	Ga0070706_100005122	Ga0070706_1000051223	227
1387	3300005467	Ga0070706_100005997	Ga0070706_10000599713	227
1388	3300005467	Ga0070706_100008150	Ga0070706_1000081503	227
1389	3300005467	Ga0070706_100009991	Ga0070706_1000099913	227
1390	3300005467	Ga0070706_100021245	Ga0070706_1000212452	227
1391	3300005467	Ga0070706_100026563	Ga0070706_1000265632	227
1392	3300005467	Ga0070706_100064829	Ga0070706_1000648294	227
1393	3300005467	Ga0070706_100106943	Ga0070706_1001069433	227
1394	3300005467	Ga0070706_100125381	Ga0070706_1001253812	227
1395	3300005467	Ga0070706_100276953	Ga0070706_1002769532	227
1396	3300005468	Ga0070707_100000293	Ga0070707_10000029310	227
1397	3300005468	Ga0070707_100003142	Ga0070707_1000031426	227
1398	3300005468	Ga0070707_100005742	Ga0070707_1000057425	227
1399	3300005468	Ga0070707_100015007	Ga0070707_1000150077	227
1400	3300005468	Ga0070707_100021756	Ga0070707_1000217564	227
1401	3300005468	Ga0070707_100029552	Ga0070707_1000295527	227
1402	3300005468	Ga0070707_100058063	Ga0070707_1000580633	227
1403	3300005468	Ga0070707_100090007	Ga0070707_1000900072	227
1404	3300005471	Ga0070698_100000106	Ga0070698_10000010610	227
1405	3300005471	Ga0070698_100000546	Ga0070698_10000054610	227
1406	3300005471	Ga0070698_100004555	Ga0070698_10000455511	227
1407	3300005471	Ga0070698_100007047	Ga0070698_10000704710	227
1408	3300005471	Ga0070698_100014280	Ga0070698_1000142806	227
1409	3300005471	Ga0070698_100018347	Ga0070698_1000183475	227
1410	3300005471	Ga0070698_100019863	Ga0070698_1000198639	227
1411	3300005471	Ga0070698_100046444	Ga0070698_1000464444	227
1412	3300005471	Ga0070698_100070830	Ga0070698_1000708303	227
1413	3300005471	Ga0070698_100079441	Ga0070698_1000794415	227
1414	3300005471	Ga0070698_100206013	Ga0070698_1002060132	227
1415	3300005518	Ga0070699_100000577	Ga0070699_10000057715	227
1416	3300005518	Ga0070699_100459552	Ga0070699_1004595522	227
1417	3300005530	Ga0070679_100084639	Ga0070679_1000846395	227
1418	3300005530	Ga0070679_100093574	Ga0070679_1000935742	227
1419	3300005535	Ga0070684_100013575	Ga0070684_1000135756	227
1420	3300005535	Ga0070684_100604614	Ga0070684_1006046142	227
1421	3300005535	Ga0070684_100621911	Ga0070684_1006219112	227
1422	3300005536	Ga0070697_100029422	Ga0070697_1000294221	227
1423	3300005536	Ga0070697_100069331	Ga0070697_1000693312	227
1424	3300005536	Ga0070697_100357258	Ga0070697_1003572582	227
1425	3300005539	Ga0068853_100275373	Ga0068853_1002753732	227
1426	3300005543	Ga0070672_100075534	Ga0070672_1000755342	227
1427	3300005543	Ga0070672_100143140	Ga0070672_1001431402	227
1428	3300005544	Ga0070686_100035430	Ga0070686_1000354302	227
1429	3300005545	Ga0070695_100341141	Ga0070695_1003411412	227
1430	3300005546	Ga0070696_100097078	Ga0070696_1000970781	227
1431	3300005546	Ga0070696_100187297	Ga0070696_1001872972	227
1432	3300005563	Ga0068855_100077738	Ga0068855_1000777382	227
1433	3300005564	Ga0070664_100078425	Ga0070664_1000784254	227
1434	3300005564	Ga0070664_100422789	Ga0070664_1004227892	227
1435	3300005577	Ga0068857_100138478	Ga0068857_1001384783	227
1436	3300005577	Ga0068857_100153423	Ga0068857_1001534232	227
1437	3300005577	Ga0068857_100319118	Ga0068857_1003191182	227
1438	3300005578	Ga0068854_100560443	Ga0068854_1005604432	227
1439	3300005614	Ga0068856_100015966	Ga0068856_1000159665	227
1440	3300005614	Ga0068856_100025089	Ga0068856_1000250896	227
1441	3300005615	Ga0070702_100014799	Ga0070702_1000147994	227
1442	3300005615	Ga0070702_100291093	Ga0070702_1002910932	227
1443	3300005616	Ga0068852_100148003	Ga0068852_1001480032	227
1444	3300005616	Ga0068852_100395840	Ga0068852_1003958402	227
1445	3300005617	Ga0068859_100145116	Ga0068859_1001451163	227
1446	3300005617	Ga0068859_100575966	Ga0068859_1005759662	227
1447	3300005618	Ga0068864_100064036	Ga0068864_1000640363	227
1448	3300005618	Ga0068864_100193491	Ga0068864_1001934912	227
1449	3300005719	Ga0068861_100337992	Ga0068861_1003379922	227
1450	3300005840	Ga0068870_10118853	Ga0068870_101188532	227
1451	3300005840	Ga0068870_10266306	Ga0068870_102663062	227
1452	3300005841	Ga0068863_100043562	Ga0068863_1000435623	227
1453	3300005841	Ga0068863_100055890	Ga0068863_1000558902	227
1454	3300005841	Ga0068863_100306575	Ga0068863_1003065752	227
1455	3300005842	Ga0068858_100382570	Ga0068858_1003825701	227
1456	3300005843	Ga0068860_100038551	Ga0068860_1000385512	227
1457	3300005843	Ga0068860_100254576	Ga0068860_1002545763	227
1458	3300005844	Ga0068862_100220064	Ga0068862_1002200642	227
1459	3300005937	Ga0081455_10167176	Ga0081455_101671762	227
1460	3300005983	Ga0081540_1000171	Ga0081540_100017119	227
1461	3300005983	Ga0081540_1001613	Ga0081540_100161314	227
1462	3300005983	Ga0081540_1042201	Ga0081540_10422011	227
1463	3300006028	Ga0070717_10022210	Ga0070717_100222106	227
1464	3300006028	Ga0070717_10028429	Ga0070717_100284293	227
1465	3300006028	Ga0070717_10045339	Ga0070717_100453393	227
1466	3300006028	Ga0070717_10067916	Ga0070717_100679162	227
1467	3300006028	Ga0070717_10115085	Ga0070717_101150852	227
1468	3300006028	Ga0070717_10115967	Ga0070717_101159672	227
1469	3300006028	Ga0070717_10355399	Ga0070717_103553992	227
1470	3300006163	Ga0070715_10001293	Ga0070715_100012932	227
1471	3300006163	Ga0070715_10130593	Ga0070715_101305932	227
1472	3300006163	Ga0070715_10254649	Ga0070715_102546492	227
1473	3300006173	Ga0070716_100003270	Ga0070716_1000032704	227
1474	3300006173	Ga0070716_100027653	Ga0070716_1000276533	227
1475	3300006175	Ga0070712_100005041	Ga0070712_1000050414	227
1476	3300006175	Ga0070712_100021380	Ga0070712_1000213802	227
1477	3300006175	Ga0070712_100088909	Ga0070712_1000889092	227
1478	3300006175	Ga0070712_100110354	Ga0070712_1001103542	227
1479	3300006175	Ga0070712_100571470	Ga0070712_1005714701	227
1480	3300006175	Ga0070712_100717585	Ga0070712_1007175851	227
1481	3300006237	Ga0097621_100117863	Ga0097621_1001178632	227
1482	3300006358	Ga0068871_100704884	Ga0068871_1007048842	227
1483	3300006844	Ga0075428_100366688	Ga0075428_1003666882	227
1484	3300006847	Ga0075431_100146985	Ga0075431_1001469853	227
1485	3300006852	Ga0075433_10010525	Ga0075433_100105254	227
1486	3300006852	Ga0075433_10052150	Ga0075433_100521504	227
1487	3300006852	Ga0075433_10198443	Ga0075433_101984432	227
1488	3300006871	Ga0075434_100019525	Ga0075434_1000195252	227
1489	3300006871	Ga0075434_100061569	Ga0075434_1000615692	227
1490	3300006871	Ga0075434_100394683	Ga0075434_1003946832	227
1491	3300006881	Ga0068865_100468726	Ga0068865_1004687262	227
1492	3300006914	Ga0075436_100011256	Ga0075436_1000112563	227
1493	3300006914	Ga0075436_100204030	Ga0075436_1002040302	227
1494	3300006914	Ga0075436_100215724	Ga0075436_1002157242	227
1495	3300006931	Ga0097620_100145123	Ga0097620_1001451232	227
1496	3300006931	Ga0097620_100575958	Ga0097620_1005759582	227
1497	3300007076	Ga0075435_100061791	Ga0075435_1000617912	227
1498	3300007076	Ga0075435_100310246	Ga0075435_1003102462	227
1499	3300009094	Ga0111539_10015815	Ga0111539_100158158	227
1500	3300009098	Ga0105245_10090979	Ga0105245_100909792	227
1501	3300009098	Ga0105245_10104042	Ga0105245_101040423	227
1502	3300009098	Ga0105245_10360280	Ga0105245_103602802	227
1503	3300009101	Ga0105247_10186374	Ga0105247_101863742	227
1504	3300009147	Ga0114129_10011093	Ga0114129_1001109310	227
1505	3300009148	Ga0105243_10007184	Ga0105243_100071846	227
1506	3300009148	Ga0105243_10037350	Ga0105243_100373504	227
1507	3300009148	Ga0105243_10126903	Ga0105243_101269032	227
1508	3300009174	Ga0105241_10026744	Ga0105241_100267444	227
1509	3300009176	Ga0105242_10040426	Ga0105242_100404263	227
1510	3300009176	Ga0105242_10055746	Ga0105242_100557462	227
1511	3300009176	Ga0105242_10172795	Ga0105242_101727952	227
1512	3300009177	Ga0105248_10299483	Ga0105248_102994832	227
1513	3300009545	Ga0105237_10201033	Ga0105237_102010332	227
1514	3300009551	Ga0105238_10107688	Ga0105238_101076883	227
1515	3300009553	Ga0105249_10059762	Ga0105249_100597623	227
1516	3300009553	Ga0105249_10109889	Ga0105249_101098892	227
1517	3300009553	Ga0105249_10460205	Ga0105249_104602052	227
1518	3300010375	Ga0105239_10031946	Ga0105239_100319466	227
1519	3300010375	Ga0105239_10191487	Ga0105239_101914873	227
1520	3300011119	Ga0105246_10066977	Ga0105246_100669773	227
1521	3300013100	Ga0157373_10137647	Ga0157373_101376472	227
1522	3300013104	Ga0157370_10070210	Ga0157370_100702102	227
1523	3300013104	Ga0157370_10608524	Ga0157370_106085242	227
1524	3300013296	Ga0157374_10229451	Ga0157374_102294512	227
1525	3300013306	Ga0163162_10127024	Ga0163162_101270244	227
1526	3300013306	Ga0163162_10217095	Ga0163162_102170952	227
1527	3300013306	Ga0163162_10255261	Ga0163162_102552612	227
1528	3300013306	Ga0163162_10400351	Ga0163162_104003511	227
1529	3300013308	Ga0157375_10026112	Ga0157375_100261124	227
1530	3300013308	Ga0157375_10306208	Ga0157375_103062082	227
1531	3300013308	Ga0157375_10544018	Ga0157375_105440182	227
1532	3300014325	Ga0163163_10058181	Ga0163163_100581812	227
1533	3300014326	Ga0157380_10019875	Ga0157380_100198755	227
1534	3300014326	Ga0157380_10091361	Ga0157380_100913612	227
1535	3300014968	Ga0157379_10115944	Ga0157379_101159442	227
1536	3300017792	Ga0163161_10102864	Ga0163161_101028642	227
1537	3300017792	Ga0163161_10192161	Ga0163161_101921612	227
1538	3300020069	Ga0197907_11486011	Ga0197907_114860112	227
1539	3300020070	Ga0206356_10464819	Ga0206356_104648192	227
1540	3300020076	Ga0206355_1573660	Ga0206355_15736603	227
1541	3300020081	Ga0206354_10632267	Ga0206354_106322672	227
1542	3300020082	Ga0206353_10972019	Ga0206353_109720192	227
1543	3300020082	Ga0206353_11335110	Ga0206353_113351101	227
1544	3300021377	Ga0213874_10059141	Ga0213874_100591412	227
1545	3300021388	Ga0213875_10000537	Ga0213875_100005374	227
1546	3300021388	Ga0213875_10001614	Ga0213875_100016144	227
1547	3300021388	Ga0213875_10024228	Ga0213875_100242284	227
1548	3300022467	Ga0224712_10012350	Ga0224712_100123502	227
1549	3300022467	Ga0224712_10016046	Ga0224712_100160463	227
1550	3300022467	Ga0224712_10050508	Ga0224712_100505082	227
1551	3300022467	Ga0224712_10138911	Ga0224712_101389111	227
1552	3300025885	Ga0207653_10009551	Ga0207653_100095512	227
1553	3300025898	Ga0207692_10002006	Ga0207692_100020065	227
1554	3300025898	Ga0207692_10012366	Ga0207692_100123662	227
1555	3300025898	Ga0207692_10015787	Ga0207692_100157872	227
1556	3300025898	Ga0207692_10026337	Ga0207692_100263373	227
1557	3300025898	Ga0207692_10056251	Ga0207692_100562512	227
1558	3300025898	Ga0207692_10118251	Ga0207692_101182512	227
1559	3300025900	Ga0207710_10009019	Ga0207710_100090192	227
1560	3300025901	Ga0207688_10013036	Ga0207688_100130364	227
1561	3300025901	Ga0207688_10022652	Ga0207688_100226524	227
1562	3300025905	Ga0207685_10008336	Ga0207685_100083363	227
1563	3300025905	Ga0207685_10021703	Ga0207685_100217032	227
1564	3300025906	Ga0207699_10000684	Ga0207699_1000068414	227
1565	3300025906	Ga0207699_10002656	Ga0207699_100026565	227
1566	3300025906	Ga0207699_10005707	Ga0207699_100057075	227
1567	3300025906	Ga0207699_10014662	Ga0207699_100146623	227
1568	3300025906	Ga0207699_10014727	Ga0207699_100147274	227
1569	3300025906	Ga0207699_10037612	Ga0207699_100376122	227
1570	3300025906	Ga0207699_10337033	Ga0207699_103370332	227
1571	3300025907	Ga0207645_10051702	Ga0207645_100517022	227
1572	3300025908	Ga0207643_10022418	Ga0207643_100224186	227
1573	3300025908	Ga0207643_10166592	Ga0207643_101665922	227
1574	3300025910	Ga0207684_10000571	Ga0207684_1000057130	227
1575	3300025910	Ga0207684_10001806	Ga0207684_1000180618	227
1576	3300025910	Ga0207684_10014224	Ga0207684_100142247	227
1577	3300025910	Ga0207684_10019030	Ga0207684_100190303	227
1578	3300025910	Ga0207684_10025959	Ga0207684_100259592	227
1579	3300025910	Ga0207684_10061832	Ga0207684_100618322	227
1580	3300025910	Ga0207684_10066992	Ga0207684_100669922	227
1581	3300025910	Ga0207684_10073685	Ga0207684_100736853	227
1582	3300025910	Ga0207684_10144332	Ga0207684_101443322	227
1583	3300025910	Ga0207684_10236281	Ga0207684_102362812	227
1584	3300025910	Ga0207684_10282490	Ga0207684_102824901	227
1585	3300025911	Ga0207654_10534008	Ga0207654_105340081	227
1586	3300025912	Ga0207707_10003446	Ga0207707_100034467	227
1587	3300025913	Ga0207695_10195826	Ga0207695_101958262	227
1588	3300025914	Ga0207671_10047172	Ga0207671_100471722	227
1589	3300025914	Ga0207671_10074718	Ga0207671_100747183	227
1590	3300025915	Ga0207693_10003796	Ga0207693_100037961	227
1591	3300025915	Ga0207693_10007211	Ga0207693_100072112	227
1592	3300025915	Ga0207693_10010872	Ga0207693_100108722	227
1593	3300025915	Ga0207693_10018090	Ga0207693_100180902	227
1594	3300025915	Ga0207693_10055665	Ga0207693_100556653	227
1595	3300025915	Ga0207693_10240941	Ga0207693_102409411	227
1596	3300025915	Ga0207693_10599488	Ga0207693_105994881	227
1597	3300025916	Ga0207663_10001400	Ga0207663_1000140012	227
1598	3300025916	Ga0207663_10003417	Ga0207663_100034173	227
1599	3300025916	Ga0207663_10016411	Ga0207663_100164114	227
1600	3300025916	Ga0207663_10034580	Ga0207663_100345803	227
1601	3300025916	Ga0207663_10056942	Ga0207663_100569422	227
1602	3300025916	Ga0207663_10494520	Ga0207663_104945201	227
1603	3300025917	Ga0207660_10237112	Ga0207660_102371122	227
1604	3300025917	Ga0207660_10304771	Ga0207660_103047712	227
1605	3300025917	Ga0207660_10380767	Ga0207660_103807672	227
1606	3300025918	Ga0207662_10008460	Ga0207662_100084603	227
1607	3300025919	Ga0207657_10028697	Ga0207657_100286974	227
1608	3300025919	Ga0207657_10037201	Ga0207657_100372016	227
1609	3300025921	Ga0207652_10031799	Ga0207652_100317995	227
1610	3300025921	Ga0207652_10078417	Ga0207652_100784172	227
1611	3300025922	Ga0207646_10000050	Ga0207646_1000005047	227
1612	3300025922	Ga0207646_10001770	Ga0207646_1000177020	227
1613	3300025922	Ga0207646_10002450	Ga0207646_100024503	227
1614	3300025922	Ga0207646_10009108	Ga0207646_100091086	227
1615	3300025922	Ga0207646_10011667	Ga0207646_100116672	227
1616	3300025922	Ga0207646_10123924	Ga0207646_101239243	227
1617	3300025925	Ga0207650_10356812	Ga0207650_103568122	227
1618	3300025926	Ga0207659_10279814	Ga0207659_102798142	227
1619	3300025927	Ga0207687_10076551	Ga0207687_100765512	227
1620	3300025927	Ga0207687_10118225	Ga0207687_101182252	227
1621	3300025927	Ga0207687_10264640	Ga0207687_102646402	227
1622	3300025927	Ga0207687_10346363	Ga0207687_103463632	227
1623	3300025928	Ga0207700_10001148	Ga0207700_1000114814	227
1624	3300025928	Ga0207700_10011993	Ga0207700_100119932	227
1625	3300025928	Ga0207700_10041144	Ga0207700_100411443	227
1626	3300025928	Ga0207700_10060814	Ga0207700_100608142	227
1627	3300025928	Ga0207700_10077499	Ga0207700_100774992	227
1628	3300025928	Ga0207700_10078444	Ga0207700_100784441	227
1629	3300025928	Ga0207700_10089443	Ga0207700_100894433	227
1630	3300025928	Ga0207700_10529867	Ga0207700_105298671	227
1631	3300025929	Ga0207664_10000298	Ga0207664_100002986	227
1632	3300025929	Ga0207664_10004567	Ga0207664_100045673	227
1633	3300025929	Ga0207664_10006510	Ga0207664_100065105	227
1634	3300025929	Ga0207664_10012203	Ga0207664_100122035	227
1635	3300025929	Ga0207664_10016910	Ga0207664_100169107	227
1636	3300025929	Ga0207664_10028591	Ga0207664_100285913	227
1637	3300025929	Ga0207664_10033127	Ga0207664_100331273	227
1638	3300025929	Ga0207664_10067915	Ga0207664_100679152	227
1639	3300025929	Ga0207664_10193522	Ga0207664_101935221	227
1640	3300025929	Ga0207664_10194744	Ga0207664_101947442	227
1641	3300025929	Ga0207664_10672954	Ga0207664_106729542	227
1642	3300025931	Ga0207644_10376549	Ga0207644_103765492	227
1643	3300025935	Ga0207709_10047213	Ga0207709_100472132	227
1644	3300025936	Ga0207670_10010705	Ga0207670_100107052	227
1645	3300025937	Ga0207669_10191156	Ga0207669_101911562	227
1646	3300025938	Ga0207704_10219204	Ga0207704_102192042	227
1647	3300025939	Ga0207665_10001293	Ga0207665_1000129311	227
1648	3300025939	Ga0207665_10006161	Ga0207665_100061613	227
1649	3300025939	Ga0207665_10007145	Ga0207665_100071458	227
1650	3300025939	Ga0207665_10009393	Ga0207665_100093935	227
1651	3300025939	Ga0207665_10009599	Ga0207665_100095994	227
1652	3300025939	Ga0207665_10022631	Ga0207665_100226315	227
1653	3300025939	Ga0207665_10027491	Ga0207665_100274912	227
1654	3300025940	Ga0207691_10018488	Ga0207691_100184885	227
1655	3300025940	Ga0207691_10220118	Ga0207691_102201182	227
1656	3300025941	Ga0207711_10038262	Ga0207711_100382623	227
1657	3300025941	Ga0207711_10474577	Ga0207711_104745772	227
1658	3300025942	Ga0207689_10011071	Ga0207689_100110713	227
1659	3300025942	Ga0207689_10116096	Ga0207689_101160962	227
1660	3300025942	Ga0207689_10886559	Ga0207689_108865591	227
1661	3300025944	Ga0207661_10295793	Ga0207661_102957931	227
1662	3300025944	Ga0207661_10761574	Ga0207661_107615741	227
1663	3300025945	Ga0207679_10088282	Ga0207679_100882822	227
1664	3300025949	Ga0207667_10034292	Ga0207667_100342924	227
1665	3300025949	Ga0207667_10338389	Ga0207667_103383892	227
1666	3300025949	Ga0207667_10740105	Ga0207667_107401052	227
1667	3300025960	Ga0207651_10298946	Ga0207651_102989462	227
1668	3300025961	Ga0207712_10056414	Ga0207712_100564142	227
1669	3300025961	Ga0207712_10164450	Ga0207712_101644503	227
1670	3300025972	Ga0207668_10130099	Ga0207668_101300992	227
1671	3300025972	Ga0207668_10328361	Ga0207668_103283612	227
1672	3300026023	Ga0207677_10038407	Ga0207677_100384073	227
1673	3300026023	Ga0207677_10405190	Ga0207677_104051902	227
1674	3300026041	Ga0207639_10087274	Ga0207639_100872742	227
1675	3300026067	Ga0207678_10006256	Ga0207678_100062568	227
1676	3300026067	Ga0207678_10016809	Ga0207678_100168093	227
1677	3300026067	Ga0207678_10032239	Ga0207678_100322392	227
1678	3300026075	Ga0207708_10453641	Ga0207708_104536411	227
1679	3300026078	Ga0207702_10018387	Ga0207702_100183876	227
1680	3300026078	Ga0207702_10357366	Ga0207702_103573662	227
1681	3300026078	Ga0207702_10655929	Ga0207702_106559291	227
1682	3300026078	Ga0207702_10866727	Ga0207702_108667271	227
1683	3300026095	Ga0207676_10071926	Ga0207676_100719263	227
1684	3300026116	Ga0207674_10105018	Ga0207674_101050182	227
1685	3300026116	Ga0207674_10161644	Ga0207674_101616442	227
1686	3300026116	Ga0207674_10190137	Ga0207674_101901372	227
1687	3300026116	Ga0207674_10470158	Ga0207674_104701581	227
1688	3300026116	Ga0207674_10672536	Ga0207674_106725362	227
1689	3300026118	Ga0207675_100036213	Ga0207675_1000362134	227
1690	3300026121	Ga0207683_10008027	Ga0207683_1000802710	227
1691	3300026121	Ga0207683_10019796	Ga0207683_100197964	227
1692	3300026121	Ga0207683_10118006	Ga0207683_101180062	227
1693	3300026142	Ga0207698_10299760	Ga0207698_102997602	227
1694	3300027512	Ga0209179_1013955	Ga0209179_10139552	227
1695	3300027907	Ga0207428_10109901	Ga0207428_101099011	227
1696	3300028023	Ga0265357_1000648	Ga0265357_10006482	227
1697	3300028379	Ga0268266_10113916	Ga0268266_101139161	227
1698	3300028380	Ga0268265_10482871	Ga0268265_104828712	227
1699	3300028381	Ga0268264_10024763	Ga0268264_100247633	227
1700	3300028556	Ga0265337_1010294	Ga0265337_10102944	227
1701	3300028558	Ga0265326_10016736	Ga0265326_100167363	227
1702	3300028563	Ga0265319_1002778	Ga0265319_10027789	227
1703	3300028573	Ga0265334_10010969	Ga0265334_100109692	227
1704	3300028577	Ga0265318_10013803	Ga0265318_100138031	227
1705	3300028653	Ga0265323_10007434	Ga0265323_100074341	227
1706	3300028654	Ga0265322_10128498	Ga0265322_101284981	227
1707	3300028666	Ga0265336_10009823	Ga0265336_100098233	227
1708	3300028800	Ga0265338_10000125	Ga0265338_1000012572	227
1709	3300028800	Ga0265338_10001588	Ga0265338_1000158832	227
1710	3300028800	Ga0265338_10003580	Ga0265338_1000358015	227
1711	3300028800	Ga0265338_10012554	Ga0265338_100125549	227
1712	3300029957	Ga0265324_10005383	Ga0265324_100053835	227
1713	3300030863	Ga0265766_1003975	Ga0265766_10039752	227
1714	3300031238	Ga0265332_10059749	Ga0265332_100597492	227
1715	3300031240	Ga0265320_10007329	Ga0265320_100073293	227
1716	3300031241	Ga0265325_10018697	Ga0265325_100186975	227
1717	3300031247	Ga0265340_10047965	Ga0265340_100479653	227
1718	3300031249	Ga0265339_10036771	Ga0265339_100367713	227
1719	3300031344	Ga0265316_10374245	Ga0265316_103742451	227
1720	3300031711	Ga0265314_10010681	Ga0265314_100106815	227
1721	3300031712	Ga0265342_10013026	Ga0265342_100130262	227
1722	3300031901	Ga0307406_10051528	Ga0307406_100515282	227
1723	3300031911	Ga0307412_10311139	Ga0307412_103111392	227
1724	3300031995	Ga0307409_100007448	Ga0307409_1000074487	227
1725	3300031995	Ga0307409_100102486	Ga0307409_1001024863	227
1726	3300031995	Ga0307409_100418407	Ga0307409_1004184072	227
1727	3300031995	Ga0307409_100502748	Ga0307409_1005027482	227
1728	3300031995	Ga0307409_100720625	Ga0307409_1007206252	227
1729	3300031995	Ga0307409_101051235	Ga0307409_1010512351	227
1730	3300032002	Ga0307416_100010494	Ga0307416_1000104942	227
1731	3300032126	Ga0307415_100670522	Ga0307415_1006705222	227
1732	3300033545	Ga0316214_1000866	Ga0316214_10008665	227
1733	3300033545	Ga0316214_1001110	Ga0316214_10011102	227
1734	3300033545	Ga0316214_1029015	Ga0316214_10290151	227
1735	3300035083	Ga0373926_0000156	Ga0373926_0000156_12070_12759	227
1736	3300035113	Ga0373936_0005337	Ga0373936_0005337_2312_2998	227
1737	3300035118	Ga0373954_0013477	Ga0373954_0013477_2148_2834	227
1738	3300035118	Ga0373954_0055904	Ga0373954_0055904_1142_1828	227
1739	3300035118	Ga0373954_0325356	Ga0373954_0325356_17_703	227
1740	3300035119	Ga0373956_0067870	Ga0373956_0067870_336_1022	227
1741	3300035119	Ga0373956_0155156	Ga0373956_0155156_173_859	227
1742	3300035120	Ga0373957_0009415	Ga0373957_0009415_1081_1767	227
1743	3300035170	Ga0373943_0073664	Ga0373943_0073664_778_1464	227
1744	3300035172	Ga0373955_0267249	Ga0373955_0267249_175_861	227
1745	3300035410	Ga0373924_0001561	Ga0373924_0001561_4414_5100	227
1746	3300035410	Ga0373924_0173181	Ga0373924_0173181_116_802	227
1747	3300035692	Ga0373935_0002708	Ga0373935_0002708_2582_3271	227
1748	3300035695	Ga0373927_0477572	Ga0373927_0477572_59_745	227
1749	3300035724	Ga0373933_0029843	Ga0373933_0029843_619_1305	227
1750	3300035724	Ga0373933_0103878	Ga0373933_0103878_114_800	227
1751	3300035724	Ga0373933_0130932	Ga0373933_0130932_811_1497	227
1752	3300035725	Ga0373947_0000075	Ga0373947_0000075_37522_38211	227
1753	3300036401	Ga0373937_0035586	Ga0373937_0035586_3161_3847	227
1754	3300036401	Ga0373937_0092882	Ga0373937_0092882_400_1086	227
1755	3300036401	Ga0373937_0133778	Ga0373937_0133778_195_881	227
1756	3300037068	Ga0373925_0001964	Ga0373925_0001964_13294_13980	227
1757	3300037418	Ga0395900_0248527	Ga0395900_0248527_24_707	227
1758	3300037466	Ga0395898_0005654	Ga0395898_0005654_6682_7365	227
1759	3300037466	Ga0395898_0066020	Ga0395898_0066020_2155_2838	227
1760	3300037853	Ga0436364_0932176	Ga0436364_0932176_348_1040	227
1761	3300038443	Ga0395901_0020046	Ga0395901_0020046_1950_2633	227
1762	3300038443	Ga0395901_0043581	Ga0395901_0043581_2104_2787	227
1763	3300038443	Ga0395901_0203596	Ga0395901_0203596_1241_1924	227
1764	3300038443	Ga0395901_0488586	Ga0395901_0488586_412_1095	227
1765	3300038443	Ga0395901_0594418	Ga0395901_0594418_380_1063	227
1766	3300041491	Ga0451833_1303516	Ga0451833_1303516_217_900	227
1767	3300044683	Ga0466965_0198379	Ga0466965_0198379_76_765	227
1768	3300046454	Ga0495592_0099155	Ga0495592_0099155_69_755	227
1769	3300046459	Ga0495629_0010288	Ga0495629_0010288_2397_3083	227
1770	3300046461	Ga0495641_0025068	Ga0495641_0025068_1793_2479	227
1771	3300046462	Ga0495651_0196207	Ga0495651_0196207_184_870	227
1772	3300046463	Ga0495653_0069203	Ga0495653_0069203_819_1505	227
1773	3300046463	Ga0495653_0076433	Ga0495653_0076433_1737_2420	227
1774	3300046473	Ga0495582_0019820	Ga0495582_0019820_1528_2214	227
1775	3300046473	Ga0495582_0173155	Ga0495582_0173155_414_1097	227
1776	3300046475	Ga0495639_0010613	Ga0495639_0010613_1172_1858	227
1777	3300046477	Ga0495664_0032570	Ga0495664_0032570_1687_2373	227
1778	3300046477	Ga0495664_0049582	Ga0495664_0049582_1186_1872	227
1779	3300046511	Ga0495608_0017575	Ga0495608_0017575_3703_4389	227
1780	3300046511	Ga0495608_0202332	Ga0495608_0202332_207_890	227
1781	3300046514	Ga0495618_0024295	Ga0495618_0024295_849_1535	227
1782	3300046514	Ga0495618_0179717	Ga0495618_0179717_362_1045	227
1783	3300046516	Ga0495628_0074087	Ga0495628_0074087_1843_2529	227
1784	3300046516	Ga0495628_0116863	Ga0495628_0116863_436_1122	227
1785	3300046516	Ga0495628_0184372	Ga0495628_0184372_811_1497	227
1786	3300046529	Ga0495652_0046161	Ga0495652_0046161_1211_1897	227
1787	3300046529	Ga0495652_0049508	Ga0495652_0049508_1739_2425	227
1788	3300046531	Ga0495665_0004214	Ga0495665_0004214_3592_4278	227
1789	3300046533	Ga0495640_0056612	Ga0495640_0056612_1572_2258	227
1790	3300046535	Ga0495586_0030108	Ga0495586_0030108_1533_2219	227
1791	3300046536	Ga0495587_0030319	Ga0495587_0030319_208_894	227
1792	3300046536	Ga0495587_0157803	Ga0495587_0157803_272_958	227
1793	3300046536	Ga0495587_0167586	Ga0495587_0167586_366_1052	227
1794	3300046543	Ga0495645_0061156	Ga0495645_0061156_132_815	227
1795	3300046543	Ga0495645_0068949	Ga0495645_0068949_1692_2378	227
1796	3300046559	Ga0495667_0162988	Ga0495667_0162988_30_716	227
1797	3300046642	Ga0495634_0024117	Ga0495634_0024117_2224_2910	227
1798	3300046663	Ga0495635_0014928	Ga0495635_0014928_183_869	227
1799	3300046663	Ga0495635_0030421	Ga0495635_0030421_826_1509	227
1800	3300046675	Ga0495657_0005981	Ga0495657_0005981_1008_1694	227
1801	3300046675	Ga0495657_0020771	Ga0495657_0020771_3677_4363	227
1802	3300046678	Ga0495599_0032519	Ga0495599_0032519_2381_3067	227
1803	3300046679	Ga0495623_0009879	Ga0495623_0009879_3875_4561	227
1804	3300046679	Ga0495623_0332636	Ga0495623_0332636_74_757	227
1805	3300046680	Ga0495646_0038583	Ga0495646_0038583_1317_2003	227
1806	3300046680	Ga0495646_0122320	Ga0495646_0122320_611_1297	227
1807	3300046689	Ga0495613_0159831	Ga0495613_0159831_815_1501	227
1808	3300046690	Ga0495624_0042798	Ga0495624_0042798_2159_2845	227
1809	3300046690	Ga0495624_0129313	Ga0495624_0129313_569_1255	227
1810	3300046809	Ga0495600_0004594	Ga0495600_0004594_4210_4896	227
1811	3300046809	Ga0495600_0112553	Ga0495600_0112553_400_1086	227
1812	3300046809	Ga0495600_0309098	Ga0495600_0309098_210_893	227
1813	3300047317	Ga0495604_0074780	Ga0495604_0074780_677_1363	227
1814	3300047319	Ga0495674_0028679	Ga0495674_0028679_1084_1770	227
1815	3300047319	Ga0495674_0120346	Ga0495674_0120346_1090_1776	227
1816	3300047322	Ga0495680_0060126	Ga0495680_0060126_547_1233	227
1817	3300047322	Ga0495680_0102082	Ga0495680_0102082_1259_1945	227
1818	3300047471	Ga0495684_0116805	Ga0495684_0116805_320_1006	227
1819	3300047673	Ga0495593_0023902	Ga0495593_0023902_403_1089	227
1820	3300048088	Ga0495602_0063161	Ga0495602_0063161_806_1489	227
1821	3300048088	Ga0495602_0148791	Ga0495602_0148791_708_1394	227
1822	3300048088	Ga0495602_0449376	Ga0495602_0449376_32_724	227
1823	3300048089	Ga0495614_0037662	Ga0495614_0037662_1216_1902	227
1824	3300048903	Ga0496100_0027737	Ga0496100_0027737_347_1030	227
1825	3300048903	Ga0496100_0036636	Ga0496100_0036636_1400_2083	227
1826	3300048903	Ga0496100_0140651	Ga0496100_0140651_824_1510	227
1827	3300048903	Ga0496100_0229831	Ga0496100_0229831_89_772	227
1828	3300048904	Ga0496101_0039436	Ga0496101_0039436_540_1223	227
1829	3300048904	Ga0496101_0057875	Ga0496101_0057875_1440_2123	227
1830	3300048904	Ga0496101_0321634	Ga0496101_0321634_256_939	227
1831	3300048904	Ga0496101_0344703	Ga0496101_0344703_164_850	227
1832	3300048904	Ga0496101_0457770	Ga0496101_0457770_109_795	227
1833	3300048905	Ga0496102_0006769	Ga0496102_0006769_2627_3310	227
1834	3300048905	Ga0496102_0027853	Ga0496102_0027853_2393_3076	227
1835	3300048905	Ga0496102_0084947	Ga0496102_0084947_837_1523	227
1836	3300048905	Ga0496102_0509021	Ga0496102_0509021_279_962	227
1837	3300048906	Ga0496103_0020725	Ga0496103_0020725_3243_3926	227
1838	3300048906	Ga0496103_0044364	Ga0496103_0044364_537_1220	227
1839	3300048907	Ga0496104_0006175	Ga0496104_0006175_4863_5549	227
1840	3300048907	Ga0496104_0145656	Ga0496104_0145656_1014_1697	227
1841	3300048907	Ga0496104_0570064	Ga0496104_0570064_240_923	227
1842	3300048908	Ga0496105_0000770	Ga0496105_0000770_3119_3805	227
1843	3300048908	Ga0496105_0032974	Ga0496105_0032974_2175_2858	227
1844	3300048908	Ga0496105_0059034	Ga0496105_0059034_1031_1714	227
1845	3300048908	Ga0496105_0192886	Ga0496105_0192886_358_1041	227
1846	3300048909	Ga0496106_0267558	Ga0496106_0267558_675_1358	227
1847	3300048910	Ga0496107_0151938	Ga0496107_0151938_496_1179	227
1848	3300048910	Ga0496107_0360825	Ga0496107_0360825_85_771	227
1849	3300048911	Ga0496108_0056003	Ga0496108_0056003_760_1443	227
1850	3300048911	Ga0496108_0242654	Ga0496108_0242654_61_747	227
1851	3300048911	Ga0496108_0274873	Ga0496108_0274873_494_1177	227
1852	3300048911	Ga0496108_0347647	Ga0496108_0347647_230_913	227
1853	3300048912	Ga0496109_0074823	Ga0496109_0074823_584_1267	227
1854	3300048912	Ga0496109_0117542	Ga0496109_0117542_815_1498	227
1855	3300048912	Ga0496109_0474045	Ga0496109_0474045_100_783	227
1856	3300048913	Ga0496110_0126849	Ga0496110_0126849_580_1263	227
1857	3300048913	Ga0496110_0223498	Ga0496110_0223498_274_957	227
1858	3300048914	Ga0496111_0347448	Ga0496111_0347448_185_868	227
1859	3300048914	Ga0496111_0490330	Ga0496111_0490330_158_841	227
1860	3300048915	Ga0496112_0000586	Ga0496112_0000586_20144_20830	227
1861	3300048915	Ga0496112_0674093	Ga0496112_0674093_29_712	227
1862	3300048916	Ga0496113_0041324	Ga0496113_0041324_18_704	227
1863	3300048916	Ga0496113_0105996	Ga0496113_0105996_768_1451	227
1864	3300048917	Ga0496114_0028823	Ga0496114_0028823_2508_3191	227
1865	3300048917	Ga0496114_0031007	Ga0496114_0031007_313_996	227
1866	3300048917	Ga0496114_0067269	Ga0496114_0067269_103_786	227
1867	3300048917	Ga0496114_0157514	Ga0496114_0157514_422_1105	227
1868	3300049568	Ga0501031_0013166	Ga0501031_0013166_2154_2837	227
1869	3300049568	Ga0501031_0547186	Ga0501031_0547186_38_721	227
1870	3300049569	Ga0501032_0388240	Ga0501032_0388240_173_856	227
1871	3300049572	Ga0501036_0046676	Ga0501036_0046676_2107_2790	227
1872	3300049573	Ga0501037_0050588	Ga0501037_0050588_1581_2264	227
1873	3300049575	Ga0501039_0015284	Ga0501039_0015284_1969_2652	227
1874	3300049576	Ga0501040_0092810	Ga0501040_0092810_1330_2013	227
1875	3300049576	Ga0501040_0267729	Ga0501040_0267729_169_852	227
1876	3300049577	Ga0501041_0016820	Ga0501041_0016820_1527_2210	227
1877	3300049578	Ga0501042_0003066	Ga0501042_0003066_4264_4947	227
1878	3300049578	Ga0501042_0034260	Ga0501042_0034260_814_1500	227
1879	3300049580	Ga0501046_0047282	Ga0501046_0047282_2172_2855	227
1880	3300049582	Ga0501048_0007884	Ga0501048_0007884_3736_4419	227
1881	3300049582	Ga0501048_0287186	Ga0501048_0287186_62_745	227
1882	3300049584	Ga0501068_0066962	Ga0501068_0066962_1090_1776	227
1883	3300049584	Ga0501068_0388112	Ga0501068_0388112_100_783	227
1884	3300049585	Ga0501069_0155485	Ga0501069_0155485_61_744	227
1885	3300049587	Ga0501071_0015459	Ga0501071_0015459_3759_4442	227
1886	3300049588	Ga0501072_0097045	Ga0501072_0097045_996_1679	227
1887	3300049590	Ga0501074_0062681	Ga0501074_0062681_1062_1745	227
1888	3300049591	Ga0501075_0056288	Ga0501075_0056288_1624_2307	227
1889	3300049591	Ga0501075_0234055	Ga0501075_0234055_250_933	227
1890	3300049592	Ga0501076_0002267	Ga0501076_0002267_9911_10594	227
1891	3300049593	Ga0501077_0067104	Ga0501077_0067104_129_812	227
1892	3300049741	Ga0501079_0016047	Ga0501079_0016047_3429_4112	227
1893	3300049743	Ga0501081_0036447	Ga0501081_0036447_1162_1845	227
1894	3300049744	Ga0501083_0151204	Ga0501083_0151204_781_1464	227
1895	3300049824	Ga0501045_0000424	Ga0501045_0000424_6659_7342	227
1896	3300050512	nmdc:mga0n895_21840_c1	nmdc:mga0n895_21840_c1_815_1501	227
1897	3300050513	nmdc:mga0rr50_93982_c1	nmdc:mga0rr50_93982_c1_1522_2208	227
1898	3300050514	nmdc:mga08x19_12213_c1	nmdc:mga08x19_12213_c1_4422_5108	227
1899	3300053077	Ga0495601_0180603	Ga0495601_0180603_221_907	227
1900	3300053077	Ga0495601_0361339	Ga0495601_0361339_101_787	227
1901	3300053078	Ga0495612_0116533	Ga0495612_0116533_210_896	227
1902	3300053084	Ga0495595_0004203	Ga0495595_0004203_2196_2882	227
1903	3300053085	Ga0495619_0005533	Ga0495619_0005533_5991_6677	227
1904	3300053085	Ga0495619_0062929	Ga0495619_0062929_694_1380	227
1905	3300053085	Ga0495619_0137360	Ga0495619_0137360_31_717	227
1906	3300054114	Ga0501084_0032890	Ga0501084_0032890_2038_2721	227
1907	3300060353	Ga0501082_0062906	Ga0501082_0062906_1944_2627	227
1908	3300061734	Ga0530510_0020733	Ga0530510_0020733_1156_1839	227

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00486

Trans_reg_C

Transcriptional regulatory protein, C terminal

131

207

0.97 PF00072

Response_reg

Response regulator receiver domain

1

100

0.95 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
7cci-assembly1.cif.gz_A	acinetobacter baumannii response regulator ader with disordered n terminus	0.9685	2	120
2a9r-assembly1.cif.gz_A-2	rr02-rec phosphate in the active site	0.9534	3	118
1nxt-assembly1.cif.gz_A-2	micarec ph 4.0	0.9526	3	118
8fk2-assembly1.cif.gz_B	the n-terminal vicr from streptococcus mutans	0.9519	1	121
2iyn-assembly4.cif.gz_B	the co-factor-induced pre-active conformation in phob	0.9512	2	118

ID	Description	Score	Start	End	Superfamily
af_P9WGN1_2_80_3.40.50.2300	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator	0.9876	2	80	3.40.50.2300
af_P21866_1_80_3.40.50.2300	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator	0.9839	1	80	3.40.50.2300
af_P69228_9_89_3.40.50.2300	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator	0.9818	1	80	3.40.50.2300
af_O69730_8_88_3.40.50.2300	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator	0.98	1	80	3.40.50.2300
af_Q2FXN6_3_86_3.40.50.2300	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator	0.9791	3	82	3.40.50.2300

ID	Description	Score	Start	End	GO Terms
AF-A0A1I3A8P6-F1-model_v4	DNA-binding response regulator, OmpR family, contains REC and winged-helix (WHTH) domain	0.8096	2	227	GO:0000156 GO:0000976 GO:0005829 GO:0006355 GO:0032993
AF-A0A1I3A8P6-F1-model_v4	DNA-binding response regulator, OmpR family, contains REC and winged-helix (WHTH) domain	0.797	2	227	GO:0000156 GO:0000976 GO:0005829 GO:0006355 GO:0032993
AF-A0A158KL75-F1-model_v4	DNA-binding response regulator KdpE	0.7673	1	153	GO:0000156 GO:0000976 GO:0005829 GO:0006355 GO:0032993
AF-A0A855HH93-F1-model_v4	deleted	0.7537	2	153
AF-A0A527HBX6-F1-model_v4	Response regulator	0.7442	2	153	GO:0000156 GO:0000976 GO:0005829 GO:0006355 GO:0032993

Feature Viewer

pLDDT	pTM	Quality
89.5	0.83	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F496033

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF00486

Trans_reg_C

Transcriptional regulatory protein, C terminal

131

207

0.97

PF00072

Response_reg

Response regulator receiver domain

1

100

0.95

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map