F496035

General Info

Members Datasets Scaffolds Average Seq Length
1909 564 1894 141

Family's Representative Sequence

Representative Sequence 3300049568|Ga0501031_0114079|Ga0501031_0114079_871_1362
Length 163
Sequence VAAVLKIELTAGQATPAPPVGTALGPHGVNIMEFCKQYNAATQAQAGSVVPVEITIYEDRTFSFVLKTPPAAVLLRKAAGVEKGSAEPHREKVGSVTRDQVREIAEIKMPDLNARDVEAAMKVIEGTARSMGITVACCRSPPHVGGAGTPAGPAGPQEGSHER

Samples

Sample ID Description Type Environment
1 2547132424 Nocardia nova SH22a Isolate Unclassified
2 2622736626 Micromonospora rhizosphaerae DSM 45431 Isolate Rhizosphere
3 2675903060 Nonomuraea wenchangensis CGMCC 4.5598 Isolate Rhizosphere
4 2684623219 Planctomyces sp. SH-PL14 Isolate Unclassified
5 2738541264 Mycobacterium sp. OK889 Isolate Unclassified
6 2738541274 Mycobacterium sp. YR708 Isolate Unclassified
7 2738541356 Mycobacterium sp. OK887 Isolate Unclassified
8 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
9 2873314349 Sphaerisporangium siamense DSM 45784 Isolate Rhizosphere
10 2902799365 Mycolicibacterium sp. P1-5 Isolate Unclassified
11 2919713450 Nocardia kruczakiae 4272 Isolate Rhizosphere
12 3002998708 Actinomadura barringtoniae GKU 128 Isolate Unclassified
13 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
14 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
15 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
16 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
17 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
18 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
19 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
20 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
21 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
22 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
23 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
24 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
25 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
26 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
27 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
28 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
29 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
30 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
31 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
32 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
33 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
34 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
35 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
36 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
37 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
38 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
39 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
40 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
41 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
42 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
43 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
44 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
45 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
46 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
47 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
48 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
49 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
50 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
51 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
52 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
53 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
54 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
55 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
56 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
57 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
58 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
59 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
60 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
61 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
62 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
63 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
64 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
65 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
66 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
67 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
68 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
69 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
70 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
71 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
72 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
73 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
74 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
75 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
76 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
77 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
78 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
79 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
80 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
81 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
82 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
83 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
84 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
85 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
86 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
87 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
88 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
89 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
90 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
91 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
92 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
93 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
94 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
95 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
96 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
97 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
98 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
99 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
100 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
101 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
102 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
103 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
104 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
105 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
106 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
107 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
108 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
109 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
110 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
111 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
112 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
113 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
114 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
115 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
116 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
117 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
118 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
119 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
120 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
121 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
122 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
123 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
124 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
125 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
126 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
127 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
128 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
129 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
130 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
131 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
132 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
133 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
134 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
135 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
136 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
137 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
138 3300012492 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 Metagenome Rhizosphere
139 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
140 3300012508 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 Metagenome Rhizosphere
141 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
142 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
143 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
144 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
145 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
146 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
147 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
148 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
149 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
150 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
151 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
152 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
153 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
154 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
155 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
156 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
157 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
158 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
159 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
160 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
161 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
162 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
163 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
164 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
165 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
166 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
167 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
168 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
169 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
170 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
231 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
232 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
233 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
234 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
235 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
236 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
237 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
238 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
239 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
240 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
241 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
242 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
243 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
244 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
245 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
246 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
247 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
248 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
249 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
250 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
251 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
252 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
253 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
254 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
255 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
256 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
257 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
258 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
259 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
260 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
261 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
262 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
263 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
264 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
265 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
266 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
267 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
268 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
269 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
270 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
271 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
272 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
273 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
274 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
275 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
276 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
277 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
278 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
279 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
280 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
281 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
282 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
283 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
284 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
285 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
286 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
287 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
288 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
289 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
290 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
291 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
292 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
293 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
294 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
295 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
296 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
297 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
298 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
299 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
300 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
301 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
302 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
303 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
304 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
305 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
306 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
307 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
308 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
309 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
310 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
311 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
312 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
313 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
314 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
315 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
316 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
317 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
318 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
319 3300042119 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218L_E14_082316_1902 Metagenome Rhizosphere
320 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
321 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
322 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
323 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
324 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
325 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
326 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
327 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
328 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
329 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
330 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
331 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
332 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
333 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
334 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
335 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
336 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
337 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
338 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
339 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
340 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
341 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
342 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
343 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
344 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
345 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
346 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
347 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
348 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
349 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
350 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
351 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
352 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
353 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
354 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
355 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
356 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
357 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
358 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
359 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
360 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
361 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
362 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
363 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
364 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
365 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
366 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
367 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
368 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
369 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
370 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
371 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
372 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
373 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
374 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
375 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
376 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
377 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
378 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
379 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
380 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
381 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
382 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
383 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
384 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
385 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
386 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
387 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
388 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
389 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
390 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
391 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
392 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
393 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
394 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
395 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
396 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
397 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
398 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
399 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
400 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
401 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
402 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
403 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
404 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
405 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
406 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
407 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
408 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
409 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
410 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
411 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
412 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
413 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
414 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
415 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
416 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
417 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
418 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
419 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
420 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
421 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
422 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
423 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
424 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
425 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
426 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
427 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
428 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
429 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
430 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
431 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
432 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
433 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
434 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
435 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
436 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
437 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
438 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
439 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
440 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
441 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
442 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
443 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
444 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
445 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
446 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
447 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
448 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
449 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
450 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
451 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
452 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
453 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
454 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
455 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
456 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
457 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
458 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
459 3300049526 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control Metagenome Rhizosphere
460 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
461 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
462 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
463 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
464 3300049552 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
465 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
466 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
467 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
468 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
469 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
470 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
471 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
472 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
473 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
474 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
475 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
476 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
477 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
478 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
479 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
480 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
481 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
482 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
483 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
484 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
485 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
486 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
487 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
488 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
489 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
490 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
491 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
492 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
493 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
494 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
495 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
496 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
497 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
498 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
499 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
500 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
501 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
502 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
503 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
504 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
505 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
506 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
507 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
508 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
509 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
510 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
511 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
512 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
513 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
514 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
515 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
516 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
517 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
518 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
519 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
520 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
521 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
522 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
523 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
524 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
525 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
526 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
527 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
528 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
529 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
530 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
531 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
532 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
533 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
534 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
535 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
536 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
537 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
538 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
539 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
540 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
541 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
542 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
543 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
544 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
545 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
546 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
547 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
548 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
549 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
550 3300059625 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 151R_CD_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
551 3300059628 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 160R_AD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
552 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
553 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
554 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
555 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
556 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
557 3300059659 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 157R_AD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
558 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
559 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
560 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
561 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
562 8053945823 Actinomadura terrae OS3-83 Isolate Rhizosphere
563 8055066027 Sphaerisporangium corydalis NEAU-YHS15 Isolate Unclassified
564 8055172936 Sphaerisporangium perillae NEAU-ZS1 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 94.6
Metatranscriptomes 4.61
Isolates 0.79

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.15
Nodule 0
Rhizoplane 4.5
Rhizosphere 91.88
Stem 0
Stem Tuber 0
Unclassified 2.46

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24752J21851_1003622 3300001976 Unclassified 2035
2 JGI24033J26618_1005831 3300002155 Unclassified 1369
3 JGI24751J29686_10008254 3300002459 Unclassified 2130
4 JGI25406J46586_10019070 3300003203 Bacteria 2804
5 JGI25406J46586_10093540 3300003203 Bacteria 904
6 rootH1_10143336 3300003316 Bacteria 1498
7 JGI25407J50210_10017081 3300003373 Bacteria 1882
8 JGI25407J50210_10026065 3300003373 Bacteria 1516
9 JGI25407J50210_10031389 3300003373 Bacteria 1375
10 JGI25407J50210_10079880 3300003373 Bacteria 813
11 JGI25407J50210_10124971 3300003373 Bacteria 633
12 Ga0055540_1000243 3300003792 Bacteria 49933
13 JGI25405J52794_10019214 3300003911 Bacteria 1369
14 Ga0058859_10014036 3300004798 Bacteria 609
15 Ga0058863_11935938 3300004799 Bacteria 766
16 Ga0058863_11950030 3300004799 Bacteria 1912
17 Ga0058861_10023301 3300004800 Bacteria 2763
18 Ga0058861_12021382 3300004800 Bacteria 662
19 Ga0058860_10073518 3300004801 Bacteria 1973
20 Ga0058860_12135301 3300004801 Bacteria 609
21 Ga0058862_10101869 3300004803 Bacteria 5370
22 Ga0058862_10126566 3300004803 Bacteria 1758
23 Ga0058862_12490756 3300004803 Bacteria 1817
24 Ga0065704_10071230 3300005289 Bacteria 12371
25 Ga0065707_10409817 3300005295 Bacteria 843
26 Ga0070658_10014764 3300005327 Bacteria 6261
27 Ga0070658_10035033 3300005327 Bacteria 4042
28 Ga0070683_100011704 3300005329 Bacteria 7596
29 Ga0070683_100026360 3300005329 Bacteria 5232
30 Ga0070683_100198608 3300005329 Bacteria 1905
31 Ga0070683_100293815 3300005329 Bacteria 1546
32 Ga0070683_100317032 3300005329 Bacteria 1484
33 Ga0070683_100791674 3300005329 Bacteria 909
34 Ga0070683_100797981 3300005329 Bacteria 905
35 Ga0070690_100034485 3300005330 Bacteria 3171
36 Ga0070677_10492967 3300005333 Bacteria 663
37 Ga0068869_101239048 3300005334 Bacteria 657
38 Ga0070666_10013777 3300005335 Bacteria 5136
39 Ga0070666_10387561 3300005335 Bacteria 1004
40 Ga0070666_11281072 3300005335 Bacteria 547
41 Ga0070666_11407830 3300005335 Bacteria 521
42 Ga0070680_100015218 3300005336 Bacteria 6027
43 Ga0070680_100042259 3300005336 Bacteria 3698
44 Ga0070680_100047518 3300005336 Bacteria 3495
45 Ga0070680_100076658 3300005336 Bacteria 2753
46 Ga0070680_100116264 3300005336 Bacteria 2229
47 Ga0070680_100315205 3300005336 Bacteria 1327
48 Ga0070680_100580707 3300005336 Bacteria 961
49 Ga0070680_101670268 3300005336 Bacteria 552
50 Ga0070682_100083447 3300005337 Bacteria 2074
51 Ga0070682_100249664 3300005337 Bacteria 1278
52 Ga0070682_100300196 3300005337 Bacteria 1178
53 Ga0070682_100645906 3300005337 Bacteria 842
54 Ga0070682_101374425 3300005337 Bacteria 603
55 Ga0068868_100251446 3300005338 Bacteria 1488
56 Ga0068868_100294601 3300005338 Bacteria 1376
57 Ga0070660_100152796 3300005339 Bacteria 1857
58 Ga0070660_100154658 3300005339 Bacteria 1846
59 Ga0070689_101134405 3300005340 Bacteria 700
60 Ga0070691_10122346 3300005341 Bacteria 1311
61 Ga0070687_100467198 3300005343 Bacteria 843
62 Ga0070661_100015324 3300005344 Bacteria 5409
63 Ga0070661_100020569 3300005344 Bacteria 4708
64 Ga0070661_100021563 3300005344 Bacteria 4603
65 Ga0070661_100570075 3300005344 Bacteria 913
66 Ga0070661_100752750 3300005344 Bacteria 797
67 Ga0070692_10264294 3300005345 Bacteria 1036
68 Ga0070692_10550806 3300005345 Bacteria 755
69 Ga0070668_100218565 3300005347 Bacteria 1570
70 Ga0070675_100147487 3300005354 Bacteria 2015
71 Ga0070671_100756732 3300005355 Bacteria 845
72 Ga0070674_100502480 3300005356 Bacteria 1010
73 Ga0070688_100157639 3300005365 Bacteria 1557
74 Ga0070688_100384845 3300005365 Bacteria 1035
75 Ga0070688_101222746 3300005365 Bacteria 604
76 Ga0070659_100271280 3300005366 Bacteria 1410
77 Ga0070659_100360731 3300005366 Bacteria 1221
78 Ga0070659_100582553 3300005366 Bacteria 960
79 Ga0070667_100000544 3300005367 Bacteria 37580
80 Ga0070667_100588452 3300005367 Bacteria 1025
81 Ga0070703_10000983 3300005406 Bacteria 9005
82 Ga0070703_10007641 3300005406 Bacteria 3037
83 Ga0070703_10026932 3300005406 Bacteria 1711
84 Ga0070703_10168997 3300005406 Bacteria 836
85 Ga0070709_10043405 3300005434 Bacteria 2780
86 Ga0070709_10069991 3300005434 Bacteria 2261
87 Ga0070709_10071663 3300005434 Bacteria 2238
88 Ga0070709_10094749 3300005434 Bacteria 1976
89 Ga0070709_10194527 3300005434 Bacteria 1433
90 Ga0070714_100022383 3300005435 Bacteria 5182
91 Ga0070714_100075107 3300005435 Bacteria 2932
92 Ga0070714_100120880 3300005435 Bacteria 2330
93 Ga0070714_100185204 3300005435 Bacteria 1897
94 Ga0070713_100005886 3300005436 Bacteria 8431
95 Ga0070713_100053385 3300005436 Bacteria 3349
96 Ga0070713_100136965 3300005436 Bacteria 2164
97 Ga0070713_100190131 3300005436 Bacteria 1849
98 Ga0070701_10003620 3300005438 Bacteria 6142
99 Ga0070711_100000917 3300005439 Bacteria 15553
100 Ga0070711_100016949 3300005439 Bacteria 4632
101 Ga0070711_100101320 3300005439 Bacteria 2095
102 Ga0070711_100212888 3300005439 Bacteria 1498
103 Ga0070711_100254630 3300005439 Bacteria 1379
104 Ga0070711_100295565 3300005439 Bacteria 1286
105 Ga0070705_100011364 3300005440 Bacteria 4490
106 Ga0070705_100056282 3300005440 Bacteria 2315
107 Ga0070705_100286614 3300005440 Bacteria 1173
108 Ga0070705_100436821 3300005440 Bacteria 978
109 Ga0070705_101040521 3300005440 Bacteria 667
110 Ga0070700_100178251 3300005441 Bacteria 1477
111 Ga0070700_100520580 3300005441 Bacteria 919
112 Ga0070700_101035486 3300005441 Bacteria 677
113 Ga0070694_100015237 3300005444 Bacteria 4823
114 Ga0070694_100038193 3300005444 Bacteria 3189
115 Ga0070694_100046524 3300005444 Bacteria 2913
116 Ga0070694_100058269 3300005444 Bacteria 2627
117 Ga0070694_100132303 3300005444 Bacteria 1803
118 Ga0070694_100137976 3300005444 Bacteria 1768
119 Ga0070694_100200138 3300005444 Bacteria 1488
120 Ga0070694_100225175 3300005444 Bacteria 1408
121 Ga0070694_100252121 3300005444 Bacteria 1335
122 Ga0070694_100667555 3300005444 Bacteria 843
123 Ga0070694_100983382 3300005444 Bacteria 700
124 Ga0070708_100000449 3300005445 Bacteria 30862
125 Ga0070708_100001875 3300005445 Bacteria 16140
126 Ga0070708_100009872 3300005445 Bacteria 7712
127 Ga0070708_100010715 3300005445 Bacteria 7440
128 Ga0070708_100026021 3300005445 Bacteria 5005
129 Ga0070708_100038311 3300005445 Bacteria 4188
130 Ga0070708_100051089 3300005445 Bacteria 3662
131 Ga0070708_100051683 3300005445 Bacteria 3641
132 Ga0070708_100052256 3300005445 Bacteria 3623
133 Ga0070708_100113806 3300005445 Bacteria 2489
134 Ga0070708_100349465 3300005445 Bacteria 1393
135 Ga0070708_100530437 3300005445 Bacteria 1110
136 Ga0070708_100530943 3300005445 Bacteria 1110
137 Ga0070708_100590627 3300005445 Bacteria 1047
138 Ga0070708_100647704 3300005445 Bacteria 996
139 Ga0070708_100647765 3300005445 Bacteria 995
140 Ga0070708_100693880 3300005445 Bacteria 958
141 Ga0070663_100021709 3300005455 Bacteria 4276
142 Ga0070663_100115078 3300005455 Bacteria 2025
143 Ga0070663_100147031 3300005455 Bacteria 1804
144 Ga0070663_100856075 3300005455 Bacteria 783
145 Ga0070678_100237683 3300005456 Bacteria 1522
146 Ga0070678_101332872 3300005456 Bacteria 669
147 Ga0070662_100118743 3300005457 Bacteria 2024
148 Ga0070681_10001680 3300005458 Bacteria 19775
149 Ga0070681_10030203 3300005458 Bacteria 5437
150 Ga0070681_10041150 3300005458 Bacteria 4630
151 Ga0070681_10135397 3300005458 Bacteria 2394
152 Ga0070681_10144387 3300005458 Bacteria 2309
153 Ga0070681_10242250 3300005458 Bacteria 1717
154 Ga0070681_10264322 3300005458 Bacteria 1632
155 Ga0070681_11473456 3300005458 Bacteria 605
156 Ga0068867_100236889 3300005459 Bacteria 1478
157 Ga0070685_10185335 3300005466 Bacteria 1343
158 Ga0070706_100000384 3300005467 Bacteria 53019
159 Ga0070706_100030317 3300005467 Bacteria 4983
160 Ga0070706_100037613 3300005467 Bacteria 4469
161 Ga0070706_100102019 3300005467 Bacteria 2667
162 Ga0070706_100117955 3300005467 Bacteria 2472
163 Ga0070706_100150532 3300005467 Bacteria 2172
164 Ga0070706_100155616 3300005467 Bacteria 2134
165 Ga0070706_100173963 3300005467 Bacteria 2010
166 Ga0070706_100199255 3300005467 Bacteria 1870
167 Ga0070706_100228118 3300005467 Bacteria 1739
168 Ga0070706_100247090 3300005467 Bacteria 1666
169 Ga0070706_100293089 3300005467 Bacteria 1518
170 Ga0070706_100437885 3300005467 Bacteria 1217
171 Ga0070706_100863136 3300005467 Bacteria 837
172 Ga0070706_101013581 3300005467 Bacteria 765
173 Ga0070706_101136300 3300005467 Bacteria 719
174 Ga0070707_100028509 3300005468 Bacteria 5315
175 Ga0070707_100054063 3300005468 Bacteria 3849
176 Ga0070707_100094854 3300005468 Bacteria 2889
177 Ga0070707_100165308 3300005468 Bacteria 2156
178 Ga0070707_100616431 3300005468 Bacteria 1048
179 Ga0070707_100683975 3300005468 Bacteria 989
180 Ga0070698_100026998 3300005471 Bacteria 5971
181 Ga0070698_100027177 3300005471 Bacteria 5952
182 Ga0070698_100040356 3300005471 Bacteria 4797
183 Ga0070698_100049234 3300005471 Bacteria 4302
184 Ga0070698_100057554 3300005471 Bacteria 3933
185 Ga0070698_100094795 3300005471 Bacteria 2963
186 Ga0070698_100145799 3300005471 Bacteria 2317
187 Ga0070698_100215775 3300005471 Bacteria 1853
188 Ga0070698_100225212 3300005471 Bacteria 1808
189 Ga0070698_100235028 3300005471 Bacteria 1766
190 Ga0070698_100286489 3300005471 Bacteria 1578
191 Ga0070698_100349738 3300005471 Bacteria 1409
192 Ga0070698_100601583 3300005471 Bacteria 1040
193 Ga0070698_100758318 3300005471 Bacteria 914
194 Ga0070698_100895945 3300005471 Bacteria 833
195 Ga0070698_101212669 3300005471 Bacteria 704
196 Ga0070699_100019723 3300005518 Bacteria 5811
197 Ga0070699_100023042 3300005518 Bacteria 5365
198 Ga0070699_100027338 3300005518 Bacteria 4922
199 Ga0070699_100065718 3300005518 Bacteria 3148
200 Ga0070699_100134042 3300005518 Bacteria 2184
201 Ga0070699_100179263 3300005518 Bacteria 1880
202 Ga0070699_100350035 3300005518 Bacteria 1331
203 Ga0070699_100350131 3300005518 Bacteria 1330
204 Ga0070699_100514661 3300005518 Bacteria 1088
205 Ga0070699_100552240 3300005518 Bacteria 1048
206 Ga0070699_100717750 3300005518 Bacteria 914
207 Ga0070699_101024870 3300005518 Bacteria 757
208 Ga0070679_100019462 3300005530 Bacteria 6600
209 Ga0070679_100039848 3300005530 Bacteria 4670
210 Ga0070679_100088718 3300005530 Bacteria 3079
211 Ga0070679_100091370 3300005530 Bacteria 3032
212 Ga0070679_100103099 3300005530 Bacteria 2839
213 Ga0070679_100152956 3300005530 Bacteria 2283
214 Ga0070679_100969612 3300005530 Bacteria 794
215 Ga0070679_101149856 3300005530 Unclassified 721
216 Ga0070684_100016520 3300005535 Bacteria 6033
217 Ga0070684_100018918 3300005535 Bacteria 5688
218 Ga0070684_100037015 3300005535 Bacteria 4184
219 Ga0070684_100296257 3300005535 Bacteria 1484
220 Ga0070684_100422388 3300005535 Bacteria 1231
221 Ga0070684_101226261 3300005535 Bacteria 706
222 Ga0070697_100040377 3300005536 Bacteria 3775
223 Ga0070697_100061382 3300005536 Bacteria 3066
224 Ga0070697_100132720 3300005536 Bacteria 2089
225 Ga0070697_100155598 3300005536 Bacteria 1929
226 Ga0070697_100161103 3300005536 Bacteria 1895
227 Ga0070697_100165774 3300005536 Bacteria 1868
228 Ga0070697_100196691 3300005536 Bacteria 1713
229 Ga0070697_100232385 3300005536 Bacteria 1573
230 Ga0070697_100463401 3300005536 Bacteria 1105
231 Ga0070697_100649992 3300005536 Bacteria 929
232 Ga0070697_101055613 3300005536 Bacteria 723
233 Ga0070697_101503881 3300005536 Bacteria 602
234 Ga0068853_100340975 3300005539 Bacteria 1392
235 Ga0070672_100330601 3300005543 Bacteria 1296
236 Ga0070686_100032929 3300005544 Bacteria 3181
237 Ga0070686_100105943 3300005544 Bacteria 1907
238 Ga0070695_100018705 3300005545 Bacteria 4208
239 Ga0070695_100026513 3300005545 Bacteria 3586
240 Ga0070695_100032559 3300005545 Bacteria 3259
241 Ga0070695_100487002 3300005545 Bacteria 951
242 Ga0070695_100538508 3300005545 Bacteria 908
243 Ga0070695_100609289 3300005545 Bacteria 858
244 Ga0070696_100000705 3300005546 Bacteria 21330
245 Ga0070696_100009190 3300005546 Bacteria 6616
246 Ga0070696_100027226 3300005546 Bacteria 3893
247 Ga0070696_100032039 3300005546 Bacteria 3605
248 Ga0070696_100107603 3300005546 Bacteria 2005
249 Ga0070696_100172942 3300005546 Bacteria 1598
250 Ga0070696_100236030 3300005546 Bacteria 1377
251 Ga0070696_100477081 3300005546 Bacteria 988
252 Ga0070696_100503715 3300005546 Bacteria 964
253 Ga0070696_100940237 3300005546 Bacteria 719
254 Ga0070696_101330320 3300005546 Bacteria 611
255 Ga0070696_101470010 3300005546 Bacteria 583
256 Ga0070693_100070064 3300005547 Bacteria 2062
257 Ga0070665_100596180 3300005548 Bacteria 1118
258 Ga0070665_101538031 3300005548 Bacteria 674
259 Ga0070704_100004759 3300005549 Bacteria 7854
260 Ga0070704_100006224 3300005549 Bacteria 7019
261 Ga0070704_100047974 3300005549 Bacteria 2988
262 Ga0070704_100079084 3300005549 Bacteria 2414
263 Ga0070704_100289918 3300005549 Bacteria 1359
264 Ga0070704_100295050 3300005549 Bacteria 1348
265 Ga0070704_100389989 3300005549 Bacteria 1186
266 Ga0070704_100609218 3300005549 Bacteria 960
267 Ga0070704_101096926 3300005549 Bacteria 723
268 Ga0070704_101248973 3300005549 Bacteria 679
269 Ga0068855_100008080 3300005563 Bacteria 12714
270 Ga0068855_100411958 3300005563 Bacteria 1479
271 Ga0068855_100487608 3300005563 Bacteria 1341
272 Ga0070664_100007420 3300005564 Bacteria 8846
273 Ga0070664_100092346 3300005564 Bacteria 2621
274 Ga0070664_100182955 3300005564 Bacteria 1864
275 Ga0068857_100370052 3300005577 Bacteria 1329
276 Ga0068857_100921128 3300005577 Bacteria 839
277 Ga0068857_102364720 3300005577 Bacteria 522
278 Ga0068854_100014129 3300005578 Bacteria 5257
279 Ga0068854_100092185 3300005578 Bacteria 2256
280 Ga0068854_101174050 3300005578 Bacteria 687
281 Ga0068856_100033862 3300005614 Bacteria 5003
282 Ga0070702_100007522 3300005615 Bacteria 5219
283 Ga0070702_101511613 3300005615 Bacteria 553
284 Ga0070702_101752067 3300005615 Bacteria 518
285 Ga0068852_100044214 3300005616 Bacteria 3781
286 Ga0068852_100350283 3300005616 Bacteria 1442
287 Ga0068852_100427538 3300005616 Bacteria 1307
288 Ga0068859_100000840 3300005617 Bacteria 31198
289 Ga0068859_100123839 3300005617 Bacteria 2653
290 Ga0068859_100312537 3300005617 Bacteria 1665
291 Ga0068859_101318581 3300005617 Bacteria 796
292 Ga0068864_100035591 3300005618 Bacteria 4239
293 Ga0068861_100021820 3300005719 Bacteria 4605
294 Ga0068861_100182233 3300005719 Bacteria 1749
295 Ga0068861_100263519 3300005719 Bacteria 1476
296 Ga0068861_100436007 3300005719 Bacteria 1171
297 Ga0068861_100863875 3300005719 Bacteria 854
298 Ga0068861_101203318 3300005719 Bacteria 733
299 Ga0068870_10000596 3300005840 Bacteria 13739
300 Ga0068863_100014900 3300005841 Bacteria 7468
301 Ga0068858_101223083 3300005842 Bacteria 739
302 Ga0068860_100486737 3300005843 Bacteria 1230
303 Ga0068860_100624425 3300005843 Bacteria 1084
304 Ga0068860_101154077 3300005843 Bacteria 795
305 Ga0068860_101373537 3300005843 Bacteria 728
306 Ga0068862_100739256 3300005844 Bacteria 956
307 Ga0068862_101624863 3300005844 Bacteria 653
308 Ga0081455_10007316 3300005937 Bacteria 11644
309 Ga0081455_10024251 3300005937 Bacteria 5623
310 Ga0081455_10054317 3300005937 Bacteria 3415
311 Ga0081455_10069173 3300005937 Bacteria 2937
312 Ga0081455_10154898 3300005937 Bacteria 1763
313 Ga0081455_10195605 3300005937 Bacteria 1519
314 Ga0081455_10241249 3300005937 Bacteria 1328
315 Ga0081455_10245518 3300005937 Bacteria 1313
316 Ga0081455_10466592 3300005937 Bacteria 858
317 Ga0081455_10497736 3300005937 Bacteria 819
318 Ga0081455_10499439 3300005937 Bacteria 817
319 Ga0081455_10625587 3300005937 Bacteria 697
320 Ga0081538_10001047 3300005981 Bacteria 29464
321 Ga0081538_10006583 3300005981 Bacteria 10197
322 Ga0081538_10015184 3300005981 Bacteria 5978
323 Ga0081538_10015781 3300005981 Bacteria 5828
324 Ga0081538_10022340 3300005981 Bacteria 4586
325 Ga0081538_10028727 3300005981 Bacteria 3816
326 Ga0081538_10032288 3300005981 Bacteria 3512
327 Ga0081539_10005702 3300005985 Bacteria 12472
328 Ga0081539_10016636 3300005985 Bacteria 5232
329 Ga0081539_10050718 3300005985 Bacteria 2346
330 Ga0081539_10070455 3300005985 Bacteria 1877
331 Ga0081539_10144729 3300005985 Bacteria 1151
332 Ga0081539_10281444 3300005985 Bacteria 724
333 Ga0081539_10388515 3300005985 Bacteria 581
334 Ga0081539_10410951 3300005985 Bacteria 562
335 Ga0081539_10412960 3300005985 Bacteria 561
336 Ga0070717_10007434 3300006028 Bacteria 8138
337 Ga0075365_10351828 3300006038 Bacteria 1038
338 Ga0075363_100184664 3300006048 Bacteria 1187
339 Ga0075363_100652925 3300006048 Bacteria 633
340 Ga0075364_10643831 3300006051 Bacteria 724
341 Ga0075432_10009313 3300006058 Bacteria 3343
342 Ga0070715_10203574 3300006163 Bacteria 1007
343 Ga0070716_100060728 3300006173 Bacteria 2185
344 Ga0070716_100407425 3300006173 Bacteria 979
345 Ga0070716_100408267 3300006173 Bacteria 979
346 Ga0070712_100004359 3300006175 Bacteria 8726
347 Ga0070712_100032442 3300006175 Bacteria 3527
348 Ga0070712_100045807 3300006175 Bacteria 3021
349 Ga0070712_100099934 3300006175 Bacteria 2142
350 Ga0070712_100604318 3300006175 Bacteria 929
351 Ga0075369_10067338 3300006186 Bacteria 1572
352 Ga0075369_10172165 3300006186 Bacteria 995
353 Ga0097621_100853940 3300006237 Bacteria 846
354 Ga0097621_100976122 3300006237 Bacteria 792
355 Ga0068871_100921738 3300006358 Bacteria 811
356 Ga0075428_100004546 3300006844 Bacteria 15340
357 Ga0075428_100006433 3300006844 Bacteria 13069
358 Ga0075428_100033498 3300006844 Bacteria 5672
359 Ga0075428_100037031 3300006844 Bacteria 5373
360 Ga0075428_100062749 3300006844 Bacteria 4068
361 Ga0075428_100092808 3300006844 Bacteria 3291
362 Ga0075428_100230334 3300006844 Bacteria 1999
363 Ga0075428_100247837 3300006844 Bacteria 1920
364 Ga0075428_100448665 3300006844 Bacteria 1382
365 Ga0075428_100453423 3300006844 Bacteria 1374
366 Ga0075428_100461323 3300006844 Bacteria 1360
367 Ga0075428_100463640 3300006844 Bacteria 1356
368 Ga0075428_100471747 3300006844 Bacteria 1343
369 Ga0075428_100779765 3300006844 Bacteria 1016
370 Ga0075428_101026126 3300006844 Bacteria 873
371 Ga0075428_101640271 3300006844 Bacteria 672
372 Ga0075430_100008456 3300006846 Bacteria 8695
373 Ga0075430_100045729 3300006846 Bacteria 3697
374 Ga0075430_100062640 3300006846 Bacteria 3124
375 Ga0075430_100210180 3300006846 Bacteria 1614
376 Ga0075430_100222262 3300006846 Bacteria 1567
377 Ga0075430_100364831 3300006846 Bacteria 1192
378 Ga0075430_100462684 3300006846 Bacteria 1047
379 Ga0075431_100011289 3300006847 Bacteria 8999
380 Ga0075431_100015177 3300006847 Bacteria 7805
381 Ga0075431_100193165 3300006847 Bacteria 2085
382 Ga0075431_100224550 3300006847 Bacteria 1915
383 Ga0075431_100240589 3300006847 Bacteria 1841
384 Ga0075431_100691601 3300006847 Bacteria 998
385 Ga0075431_100699339 3300006847 Bacteria 991
386 Ga0075431_100701838 3300006847 Bacteria 989
387 Ga0075433_10001327 3300006852 Bacteria 18108
388 Ga0075433_10008588 3300006852 Bacteria 8150
389 Ga0075433_10042950 3300006852 Bacteria 3923
390 Ga0075433_10065623 3300006852 Bacteria 3183
391 Ga0075433_10094593 3300006852 Bacteria 2644
392 Ga0075433_10110719 3300006852 Bacteria 2436
393 Ga0075433_10614945 3300006852 Bacteria 953
394 Ga0075433_10617269 3300006852 Bacteria 951
395 Ga0075434_100011885 3300006871 Bacteria 8231
396 Ga0075434_100034497 3300006871 Bacteria 4996
397 Ga0075434_100092666 3300006871 Bacteria 3024
398 Ga0075434_100125284 3300006871 Bacteria 2586
399 Ga0075434_100169509 3300006871 Bacteria 2203
400 Ga0075434_100221168 3300006871 Bacteria 1913
401 Ga0075434_100372571 3300006871 Bacteria 1449
402 Ga0075434_100588458 3300006871 Bacteria 1132
403 Ga0075434_100712675 3300006871 Bacteria 1021
404 Ga0075434_100719353 3300006871 Bacteria 1016
405 Ga0075434_101271735 3300006871 Bacteria 747
406 Ga0075434_101756077 3300006871 Bacteria 628
407 Ga0075429_100032360 3300006880 Bacteria 4545
408 Ga0075429_100040192 3300006880 Bacteria 4071
409 Ga0075429_100167367 3300006880 Bacteria 1925
410 Ga0075429_100205731 3300006880 Bacteria 1724
411 Ga0075429_100336178 3300006880 Bacteria 1322
412 Ga0075429_100344337 3300006880 Bacteria 1305
413 Ga0075429_100390565 3300006880 Bacteria 1218
414 Ga0075429_100432853 3300006880 Bacteria 1152
415 Ga0075429_100507320 3300006880 Bacteria 1057
416 Ga0075429_100573817 3300006880 Bacteria 988
417 Ga0075429_101182442 3300006880 Bacteria 668
418 Ga0068865_100223348 3300006881 Bacteria 1474
419 Ga0075436_100010583 3300006914 Bacteria 6325
420 Ga0075436_100019936 3300006914 Bacteria 4600
421 Ga0075436_100030981 3300006914 Bacteria 3680
422 Ga0075436_100043508 3300006914 Bacteria 3096
423 Ga0075436_100078807 3300006914 Bacteria 2282
424 Ga0075436_100091533 3300006914 Bacteria 2114
425 Ga0075436_100244236 3300006914 Bacteria 1277
426 Ga0075436_100331600 3300006914 Bacteria 1094
427 Ga0075436_100403620 3300006914 Bacteria 990
428 Ga0075436_100456339 3300006914 Bacteria 931
429 Ga0075436_100712578 3300006914 Bacteria 744
430 Ga0075436_100945418 3300006914 Bacteria 646
431 Ga0097620_100000840 3300006931 Bacteria 31198
432 Ga0097620_100123841 3300006931 Bacteria 2653
433 Ga0097620_100312532 3300006931 Bacteria 1665
434 Ga0097620_101318520 3300006931 Bacteria 796
435 Ga0075435_100005327 3300007076 Bacteria 8961
436 Ga0075435_100035742 3300007076 Bacteria 3944
437 Ga0075435_100068471 3300007076 Bacteria 2892
438 Ga0075435_100075322 3300007076 Bacteria 2763
439 Ga0075435_100097713 3300007076 Bacteria 2430
440 Ga0075435_100185323 3300007076 Bacteria 1760
441 Ga0075435_100202213 3300007076 Bacteria 1683
442 Ga0075435_100228174 3300007076 Bacteria 1582
443 Ga0075435_100248516 3300007076 Bacteria 1514
444 Ga0075435_100583219 3300007076 Bacteria 969
445 Ga0075435_100638109 3300007076 Bacteria 924
446 Ga0075435_100771644 3300007076 Bacteria 837
447 Ga0075435_100804228 3300007076 Bacteria 819
448 Ga0075435_101365037 3300007076 Bacteria 621
449 Ga0075435_101366288 3300007076 Bacteria 621
450 Ga0075435_101766853 3300007076 Bacteria 543
451 Ga0099794_10005304 3300007265 Bacteria 5160
452 Ga0099794_10034141 3300007265 Bacteria 2394
453 Ga0099794_10523414 3300007265 Bacteria 625
454 Ga0099795_10139469 3300007788 Bacteria 985
455 Ga0099795_10492754 3300007788 Bacteria 570
456 Ga0105251_10028969 3300009011 Bacteria 2794
457 Ga0105240_10049596 3300009093 Bacteria 5298
458 Ga0105240_10085708 3300009093 Bacteria 3859
459 Ga0105240_10101067 3300009093 Bacteria 3508
460 Ga0105240_10125404 3300009093 Bacteria 3086
461 Ga0105240_11523412 3300009093 Bacteria 701
462 Ga0111539_10017154 3300009094 Bacteria 8963
463 Ga0111539_10096064 3300009094 Bacteria 3481
464 Ga0111539_10135693 3300009094 Bacteria 2882
465 Ga0111539_10380703 3300009094 Bacteria 1643
466 Ga0111539_10489628 3300009094 Bacteria 1432
467 Ga0111539_10588752 3300009094 Bacteria 1295
468 Ga0111539_11467576 3300009094 Bacteria 791
469 Ga0111539_12230289 3300009094 Bacteria 635
470 Ga0105245_10102151 3300009098 Bacteria 2655
471 Ga0105245_10260746 3300009098 Bacteria 1687
472 Ga0105245_10702623 3300009098 Bacteria 1044
473 Ga0105245_11662823 3300009098 Bacteria 690
474 Ga0105245_11876593 3300009098 Bacteria 652
475 Ga0105247_10029826 3300009101 Bacteria 3307
476 Ga0114129_10002329 3300009147 Bacteria 26367
477 Ga0114129_10017272 3300009147 Bacteria 10275
478 Ga0114129_10037539 3300009147 Bacteria 6839
479 Ga0114129_10052046 3300009147 Bacteria 5747
480 Ga0114129_10261996 3300009147 Bacteria 2316
481 Ga0114129_10330687 3300009147 Bacteria 2023
482 Ga0114129_10380158 3300009147 Bacteria 1865
483 Ga0114129_10408213 3300009147 Bacteria 1789
484 Ga0114129_10426199 3300009147 Bacteria 1744
485 Ga0114129_10577293 3300009147 Bacteria 1459
486 Ga0114129_10627820 3300009147 Bacteria 1389
487 Ga0114129_10647386 3300009147 Bacteria 1364
488 Ga0114129_11011488 3300009147 Bacteria 1046
489 Ga0114129_11044798 3300009147 Bacteria 1026
490 Ga0114129_11768075 3300009147 Bacteria 753
491 Ga0114129_12223874 3300009147 Bacteria 659
492 Ga0114129_12345368 3300009147 Bacteria 640
493 Ga0105243_10236231 3300009148 Bacteria 1624
494 Ga0105243_10800184 3300009148 Bacteria 929
495 Ga0105243_11332632 3300009148 Bacteria 736
496 Ga0105243_11743164 3300009148 Bacteria 653
497 Ga0105243_12598829 3300009148 Bacteria 546
498 Ga0105241_10497246 3300009174 Bacteria 1087
499 Ga0105241_10815188 3300009174 Bacteria 861
500 Ga0105241_11863835 3300009174 Bacteria 588
501 Ga0105242_10124771 3300009176 Bacteria 2215
502 Ga0105242_10732385 3300009176 Bacteria 971
503 Ga0105248_11186509 3300009177 Bacteria 863
504 Ga0105248_11812304 3300009177 Bacteria 692
505 Ga0105248_13058998 3300009177 Bacteria 533
506 Ga0105237_10835571 3300009545 Bacteria 928
507 Ga0105237_10935363 3300009545 Bacteria 874
508 Ga0105238_10142307 3300009551 Bacteria 2375
509 Ga0105238_10284884 3300009551 Bacteria 1634
510 Ga0105249_10013251 3300009553 Bacteria 7276
511 Ga0105249_11690130 3300009553 Bacteria 705
512 Ga0105249_12763804 3300009553 Bacteria 563
513 Ga0099796_10352435 3300010159 Bacteria 635
514 Ga0105239_10235285 3300010375 Bacteria 2056
515 Ga0105239_10714784 3300010375 Bacteria 1146
516 Ga0105246_10150916 3300011119 Bacteria 1759
517 Ga0105246_10456146 3300011119 Bacteria 1075
518 Ga0157335_1013376 3300012492 Bacteria 698
519 Ga0157319_1044966 3300012497 Bacteria 529
520 Ga0157315_1036177 3300012508 Bacteria 604
521 Ga0157373_10011804 3300013100 Bacteria 6417
522 Ga0157373_10116480 3300013100 Bacteria 1878
523 Ga0157373_10411127 3300013100 Bacteria 970
524 Ga0157370_10046409 3300013104 Bacteria 4165
525 Ga0157370_10081133 3300013104 Bacteria 3053
526 Ga0157370_10240088 3300013104 Bacteria 1676
527 Ga0157370_10791557 3300013104 Bacteria 863
528 Ga0157370_12114585 3300013104 Bacteria 504
529 Ga0157369_10128360 3300013105 Bacteria 2687
530 Ga0157374_10143989 3300013296 Bacteria 2314
531 Ga0157374_10188956 3300013296 Bacteria 2014
532 Ga0157374_10723714 3300013296 Bacteria 1009
533 Ga0157374_11097351 3300013296 Bacteria 816
534 Ga0157378_10046089 3300013297 Bacteria 3876
535 Ga0157378_11687820 3300013297 Bacteria 680
536 Ga0163162_10007855 3300013306 Bacteria 10394
537 Ga0157372_10046943 3300013307 Bacteria 4796
538 Ga0157372_10047091 3300013307 Bacteria 4789
539 Ga0157372_10099273 3300013307 Bacteria 3321
540 Ga0157372_10454914 3300013307 Bacteria 1492
541 Ga0157372_10710278 3300013307 Bacteria 1170
542 Ga0157372_11485200 3300013307 Bacteria 781
543 Ga0157375_10351657 3300013308 Bacteria 1639
544 Ga0157375_11071772 3300013308 Bacteria 943
545 Ga0157375_11124174 3300013308 Bacteria 920
546 Ga0163163_10050508 3300014325 Bacteria 4095
547 Ga0157380_10383492 3300014326 Bacteria 1327
548 Ga0157380_10561762 3300014326 Bacteria 1122
549 Ga0157380_10807157 3300014326 Bacteria 956
550 Ga0182008_10065445 3300014497 Bacteria 1788
551 Ga0182008_10128751 3300014497 Bacteria 1261
552 Ga0157379_10405622 3300014968 Bacteria 1253
553 Ga0157379_10685741 3300014968 Bacteria 961
554 Ga0157376_10137652 3300014969 Bacteria 2187
555 Ga0157376_11228898 3300014969 Bacteria 778
556 Ga0163161_10062558 3300017792 Bacteria 2712
557 Ga0197907_10289603 3300020069 Bacteria 1190
558 Ga0197907_10826265 3300020069 Bacteria 614
559 Ga0197907_11255837 3300020069 Bacteria 942
560 Ga0206356_10020515 3300020070 Bacteria 1188
561 Ga0206356_10585457 3300020070 Bacteria 1928
562 Ga0206356_11018801 3300020070 Bacteria 739
563 Ga0206349_1398502 3300020075 Bacteria 628
564 Ga0206349_1772263 3300020075 Bacteria 1392
565 Ga0206355_1329627 3300020076 Bacteria 695
566 Ga0206355_1413872 3300020076 Bacteria 1458
567 Ga0206351_10081284 3300020077 Bacteria 945
568 Ga0206351_10450698 3300020077 Bacteria 1327
569 Ga0206352_10121810 3300020078 Bacteria 657
570 Ga0206352_10445022 3300020078 Bacteria 1188
571 Ga0206350_10488094 3300020080 Bacteria 3782
572 Ga0206350_11131134 3300020080 Bacteria 1838
573 Ga0206354_10369424 3300020081 Bacteria 1695
574 Ga0206354_11623678 3300020081 Bacteria 1108
575 Ga0154015_1148597 3300020610 Bacteria 2178
576 Ga0213873_10049825 3300021358 Bacteria 1106
577 Ga0213874_10091578 3300021377 Bacteria 999
578 Ga0213874_10128600 3300021377 Bacteria 868
579 Ga0213875_10362408 3300021388 Bacteria 689
580 Ga0224712_10013255 3300022467 Bacteria 2618
581 Ga0224712_10022816 3300022467 Bacteria 2163
582 Ga0224712_10146899 3300022467 Bacteria 1042
583 Ga0224572_1013087 3300024225 Bacteria 1582
584 Ga0209051_1000051 3300025303 Bacteria 283620
585 Ga0209051_1105290 3300025303 Bacteria 748
586 Ga0207653_10008146 3300025885 Bacteria 3266
587 Ga0207653_10013390 3300025885 Bacteria 2568
588 Ga0207653_10016473 3300025885 Bacteria 2321
589 Ga0207653_10020416 3300025885 Bacteria 2097
590 Ga0207653_10345061 3300025885 Bacteria 581
591 Ga0207692_10025272 3300025898 Bacteria 2771
592 Ga0207692_10245325 3300025898 Bacteria 1071
593 Ga0207642_11145419 3300025899 Bacteria 504
594 Ga0207710_10075611 3300025900 Bacteria 1552
595 Ga0207688_10403620 3300025901 Bacteria 848
596 Ga0207688_10429030 3300025901 Bacteria 822
597 Ga0207680_10049347 3300025903 Bacteria 2505
598 Ga0207680_10406411 3300025903 Bacteria 963
599 Ga0207680_10513262 3300025903 Bacteria 854
600 Ga0207699_10002419 3300025906 Bacteria 8817
601 Ga0207699_10065043 3300025906 Bacteria 2209
602 Ga0207699_10066682 3300025906 Bacteria 2186
603 Ga0207699_10469108 3300025906 Bacteria 905
604 Ga0207645_10394449 3300025907 Bacteria 930
605 Ga0207643_10000118 3300025908 Bacteria 53785
606 Ga0207643_10362335 3300025908 Bacteria 911
607 Ga0207705_10013204 3300025909 Bacteria 5962
608 Ga0207705_10092249 3300025909 Bacteria 2219
609 Ga0207684_10004838 3300025910 Bacteria 12602
610 Ga0207684_10007980 3300025910 Bacteria 9454
611 Ga0207684_10015502 3300025910 Bacteria 6557
612 Ga0207684_10041822 3300025910 Bacteria 3884
613 Ga0207684_10062736 3300025910 Bacteria 3155
614 Ga0207684_10105062 3300025910 Bacteria 2415
615 Ga0207684_10126285 3300025910 Bacteria 2195
616 Ga0207684_10189050 3300025910 Bacteria 1776
617 Ga0207684_10341736 3300025910 Bacteria 1289
618 Ga0207684_10449269 3300025910 Bacteria 1107
619 Ga0207684_10605097 3300025910 Bacteria 936
620 Ga0207684_11175200 3300025910 Bacteria 636
621 Ga0207654_10951762 3300025911 Bacteria 624
622 Ga0207707_10017467 3300025912 Bacteria 6255
623 Ga0207707_10017733 3300025912 Bacteria 6211
624 Ga0207707_10021948 3300025912 Bacteria 5579
625 Ga0207707_10043461 3300025912 Bacteria 3920
626 Ga0207707_10072756 3300025912 Bacteria 2996
627 Ga0207707_10108194 3300025912 Bacteria 2430
628 Ga0207707_10738365 3300025912 Bacteria 824
629 Ga0207695_10015477 3300025913 Bacteria 8978
630 Ga0207695_10060503 3300025913 Bacteria 3920
631 Ga0207695_10082885 3300025913 Bacteria 3241
632 Ga0207695_10119468 3300025913 Bacteria 2606
633 Ga0207695_10133510 3300025913 Bacteria 2438
634 Ga0207693_10031353 3300025915 Bacteria 4200
635 Ga0207693_10041576 3300025915 Bacteria 3619
636 Ga0207693_10067286 3300025915 Bacteria 2805
637 Ga0207693_10106443 3300025915 Bacteria 2200
638 Ga0207693_10161592 3300025915 Bacteria 1762
639 Ga0207693_10267619 3300025915 Bacteria 1339
640 Ga0207693_10437350 3300025915 Bacteria 1022
641 Ga0207663_10115612 3300025916 Bacteria 1828
642 Ga0207663_10149467 3300025916 Bacteria 1637
643 Ga0207660_10000465 3300025917 Bacteria 26806
644 Ga0207660_10001269 3300025917 Bacteria 16941
645 Ga0207660_10022611 3300025917 Bacteria 4237
646 Ga0207660_10025397 3300025917 Bacteria 4020
647 Ga0207660_10032960 3300025917 Bacteria 3579
648 Ga0207660_10095550 3300025917 Bacteria 2211
649 Ga0207660_10397415 3300025917 Bacteria 1110
650 Ga0207660_10513243 3300025917 Bacteria 973
651 Ga0207662_10393920 3300025918 Bacteria 938
652 Ga0207662_10448996 3300025918 Bacteria 881
653 Ga0207657_10305371 3300025919 Bacteria 1260
654 Ga0207657_11036532 3300025919 Unclassified 628
655 Ga0207649_10009225 3300025920 Bacteria 5394
656 Ga0207649_10012357 3300025920 Bacteria 4735
657 Ga0207649_10095759 3300025920 Bacteria 1954
658 Ga0207649_11125566 3300025920 Bacteria 620
659 Ga0207649_11520901 3300025920 Bacteria 530
660 Ga0207652_10000969 3300025921 Bacteria 26806
661 Ga0207652_10051472 3300025921 Bacteria 3531
662 Ga0207652_10055640 3300025921 Bacteria 3404
663 Ga0207652_10105433 3300025921 Bacteria 2494
664 Ga0207652_10155438 3300025921 Bacteria 2049
665 Ga0207652_10213891 3300025921 Bacteria 1736
666 Ga0207652_11308224 3300025921 Bacteria 628
667 Ga0207646_10015031 3300025922 Bacteria 7326
668 Ga0207646_10021741 3300025922 Bacteria 5922
669 Ga0207646_10040765 3300025922 Bacteria 4175
670 Ga0207646_10044065 3300025922 Bacteria 4005
671 Ga0207646_10063875 3300025922 Bacteria 3286
672 Ga0207646_10085941 3300025922 Bacteria 2813
673 Ga0207646_10115472 3300025922 Bacteria 2411
674 Ga0207646_10183048 3300025922 Bacteria 1892
675 Ga0207646_10414262 3300025922 Bacteria 1217
676 Ga0207646_10583285 3300025922 Bacteria 1004
677 Ga0207646_10940538 3300025922 Bacteria 765
678 Ga0207694_10040453 3300025924 Bacteria 3589
679 Ga0207694_10649472 3300025924 Bacteria 889
680 Ga0207650_10005281 3300025925 Bacteria 8811
681 Ga0207650_11623755 3300025925 Bacteria 549
682 Ga0207659_10101657 3300025926 Bacteria 2168
683 Ga0207687_10052341 3300025927 Bacteria 2849
684 Ga0207687_11115510 3300025927 Bacteria 678
685 Ga0207700_10005401 3300025928 Bacteria 7636
686 Ga0207700_10010134 3300025928 Bacteria 5927
687 Ga0207700_10143993 3300025928 Bacteria 1962
688 Ga0207700_10381332 3300025928 Bacteria 1233
689 Ga0207700_11086053 3300025928 Bacteria 715
690 Ga0207664_10062895 3300025929 Bacteria 2965
691 Ga0207664_10075920 3300025929 Bacteria 2719
692 Ga0207664_10079606 3300025929 Bacteria 2661
693 Ga0207664_10178376 3300025929 Bacteria 1823
694 Ga0207644_10864916 3300025931 Bacteria 757
695 Ga0207690_10138065 3300025932 Bacteria 1793
696 Ga0207690_11033110 3300025932 Bacteria 684
697 Ga0207706_10007064 3300025933 Bacteria 10382
698 Ga0207706_10219620 3300025933 Bacteria 1664
699 Ga0207686_10483869 3300025934 Bacteria 958
700 Ga0207686_10542111 3300025934 Bacteria 908
701 Ga0207686_11461894 3300025934 Bacteria 563
702 Ga0207709_10275014 3300025935 Bacteria 1241
703 Ga0207709_10366910 3300025935 Bacteria 1092
704 Ga0207709_10646360 3300025935 Bacteria 842
705 Ga0207709_10881773 3300025935 Bacteria 726
706 Ga0207709_11087214 3300025935 Bacteria 656
707 Ga0207670_10375870 3300025936 Bacteria 1131
708 Ga0207670_11293592 3300025936 Bacteria 618
709 Ga0207669_10227123 3300025937 Bacteria 1375
710 Ga0207669_10642099 3300025937 Bacteria 867
711 Ga0207704_10679105 3300025938 Bacteria 851
712 Ga0207704_10692725 3300025938 Bacteria 843
713 Ga0207665_10010264 3300025939 Bacteria 6150
714 Ga0207665_10124320 3300025939 Bacteria 1825
715 Ga0207691_10291574 3300025940 Bacteria 1403
716 Ga0207691_10588829 3300025940 Bacteria 942
717 Ga0207711_10235269 3300025941 Bacteria 1679
718 Ga0207711_10810526 3300025941 Bacteria 872
719 Ga0207661_10007979 3300025944 Bacteria 7548
720 Ga0207661_10022845 3300025944 Bacteria 4716
721 Ga0207661_10023269 3300025944 Bacteria 4679
722 Ga0207661_10235434 3300025944 Bacteria 1623
723 Ga0207661_10289327 3300025944 Bacteria 1466
724 Ga0207661_10336547 3300025944 Bacteria 1359
725 Ga0207661_10402217 3300025944 Bacteria 1242
726 Ga0207661_10795821 3300025944 Bacteria 870
727 Ga0207661_10822986 3300025944 Bacteria 855
728 Ga0207679_10028510 3300025945 Bacteria 3875
729 Ga0207679_10123849 3300025945 Bacteria 2062
730 Ga0207679_10125565 3300025945 Bacteria 2050
731 Ga0207667_10007096 3300025949 Bacteria 13524
732 Ga0207667_10050333 3300025949 Bacteria 4396
733 Ga0207667_10599410 3300025949 Bacteria 1111
734 Ga0207651_10912018 3300025960 Bacteria 783
735 Ga0207712_10088022 3300025961 Bacteria 2279
736 Ga0207712_11015864 3300025961 Bacteria 736
737 Ga0207712_12114502 3300025961 Bacteria 504
738 Ga0207668_10242873 3300025972 Bacteria 1458
739 Ga0207640_10004362 3300025981 Bacteria 7668
740 Ga0207640_10032157 3300025981 Bacteria 3251
741 Ga0207640_11330899 3300025981 Bacteria 642
742 Ga0207640_11535594 3300025981 Bacteria 599
743 Ga0207658_10003633 3300025986 Bacteria 10897
744 Ga0207658_10033451 3300025986 Bacteria 3668
745 Ga0207677_10077177 3300026023 Bacteria 2375
746 Ga0207703_11065567 3300026035 Bacteria 776
747 Ga0207703_11427929 3300026035 Bacteria 666
748 Ga0207639_10007985 3300026041 Bacteria 7229
749 Ga0207639_10263650 3300026041 Bacteria 1508
750 Ga0207639_10789286 3300026041 Bacteria 884
751 Ga0207678_10006698 3300026067 Bacteria 10217
752 Ga0207678_10134335 3300026067 Bacteria 2111
753 Ga0207678_10163290 3300026067 Bacteria 1902
754 Ga0207678_10313808 3300026067 Bacteria 1348
755 Ga0207678_10437016 3300026067 Bacteria 1136
756 Ga0207678_10677499 3300026067 Bacteria 907
757 Ga0207678_11435562 3300026067 Bacteria 610
758 Ga0207708_10003011 3300026075 Bacteria 12420
759 Ga0207708_10175453 3300026075 Bacteria 1700
760 Ga0207708_11198562 3300026075 Bacteria 664
761 Ga0207702_10261255 3300026078 Bacteria 1630
762 Ga0207702_10717919 3300026078 Bacteria 985
763 Ga0207702_12105828 3300026078 Bacteria 554
764 Ga0207641_10009660 3300026088 Bacteria 7947
765 Ga0207648_10266895 3300026089 Bacteria 1528
766 Ga0207676_10008250 3300026095 Bacteria 7409
767 Ga0207676_11065218 3300026095 Bacteria 798
768 Ga0207674_10026443 3300026116 Bacteria 6162
769 Ga0207675_100002284 3300026118 Bacteria 19045
770 Ga0207675_100992521 3300026118 Bacteria 858
771 Ga0207675_101110007 3300026118 Bacteria 811
772 Ga0207683_10280864 3300026121 Bacteria 1522
773 Ga0207683_10397144 3300026121 Bacteria 1268
774 Ga0207698_10131050 3300026142 Bacteria 2142
775 Ga0207698_10869910 3300026142 Bacteria 907
776 Ga0209588_1000886 3300027671 Bacteria 7615
777 Ga0209588_1004808 3300027671 Bacteria 3834
778 Ga0209588_1080989 3300027671 Bacteria 1049
779 Ga0207428_10001214 3300027907 Bacteria 27642
780 Ga0207428_10012763 3300027907 Bacteria 7368
781 Ga0207428_10077312 3300027907 Bacteria 2606
782 Ga0207428_10189298 3300027907 Bacteria 1552
783 Ga0207428_10282610 3300027907 Bacteria 1231
784 Ga0265356_1029748 3300028017 Bacteria 593
785 Ga0268265_10108431 3300028380 Bacteria 2261
786 Ga0268265_10203485 3300028380 Bacteria 1719
787 Ga0268265_12005852 3300028380 Bacteria 586
788 Ga0268264_10443022 3300028381 Bacteria 1257
789 Ga0268264_10648078 3300028381 Bacteria 1045
790 Ga0268264_11686178 3300028381 Bacteria 644
791 Ga0265326_10153647 3300028558 Bacteria 657
792 Ga0265318_10126170 3300028577 Bacteria 941
793 Ga0265338_10660510 3300028800 Bacteria 724
794 Ga0316177_1127819 3300030731 Bacteria 1087
795 Ga0316178_1142980 3300030735 Bacteria 895
796 Ga0265329_10190520 3300031242 Bacteria 673
797 Ga0265327_10039295 3300031251 Bacteria 2571
798 Ga0265327_10077994 3300031251 Bacteria 1642
799 Ga0265327_10151683 3300031251 Bacteria 1076
800 Ga0307408_100018340 3300031548 Bacteria 4696
801 Ga0307408_100129592 3300031548 Bacteria 1966
802 Ga0307408_100310521 3300031548 Bacteria 1325
803 Ga0307408_100754829 3300031548 Bacteria 879
804 Ga0307408_101256219 3300031548 Bacteria 693
805 Ga0307408_101559348 3300031548 Bacteria 626
806 Ga0307408_102056689 3300031548 Bacteria 550
807 Ga0316579_10014765 3300031691 Bacteria 3384
808 Ga0316579_10029849 3300031691 Bacteria 2489
809 Ga0316579_10072706 3300031691 Unclassified 1631
810 Ga0316576_10066851 3300031727 Bacteria 2645
811 Ga0316578_10075076 3300031728 Bacteria 2005
812 Ga0307405_10015410 3300031731 Bacteria 4141
813 Ga0307405_10077574 3300031731 Bacteria 2159
814 Ga0307405_10116031 3300031731 Bacteria 1823
815 Ga0307405_10243990 3300031731 Bacteria 1332
816 Ga0307405_10326077 3300031731 Bacteria 1175
817 Ga0307405_10448616 3300031731 Bacteria 1022
818 Ga0307405_11378222 3300031731 Bacteria 616
819 Ga0316577_10009141 3300031733 Bacteria 5326
820 Ga0307413_10031973 3300031824 Bacteria 2976
821 Ga0307413_10143794 3300031824 Bacteria 1652
822 Ga0307413_10286648 3300031824 Bacteria 1241
823 Ga0307413_10330698 3300031824 Bacteria 1168
824 Ga0307413_10822663 3300031824 Bacteria 782
825 Ga0307410_10020241 3300031852 Bacteria 4066
826 Ga0307410_10022751 3300031852 Bacteria 3881
827 Ga0307410_10030239 3300031852 Bacteria 3459
828 Ga0307410_10030534 3300031852 Bacteria 3445
829 Ga0307410_10073365 3300031852 Bacteria 2379
830 Ga0307410_10105203 3300031852 Bacteria 2031
831 Ga0307410_10162582 3300031852 Bacteria 1674
832 Ga0307410_10891437 3300031852 Bacteria 761
833 Ga0307410_11351666 3300031852 Bacteria 624
834 Ga0326468_10073619 3300031889 Bacteria 574
835 Ga0307406_10027895 3300031901 Bacteria 3407
836 Ga0307406_10037946 3300031901 Bacteria 2980
837 Ga0307406_10082561 3300031901 Bacteria 2140
838 Ga0307406_10142469 3300031901 Bacteria 1699
839 Ga0307406_10144734 3300031901 Bacteria 1687
840 Ga0307407_10002922 3300031903 Bacteria 6836
841 Ga0307407_10017934 3300031903 Bacteria 3566
842 Ga0307407_10032524 3300031903 Bacteria 2837
843 Ga0307407_10102636 3300031903 Bacteria 1778
844 Ga0307412_10017832 3300031911 Bacteria 4256
845 Ga0307412_10110574 3300031911 Bacteria 1961
846 Ga0307412_10464684 3300031911 Bacteria 1046
847 Ga0307412_10608936 3300031911 Bacteria 926
848 Ga0307409_100011628 3300031995 Bacteria 5562
849 Ga0307409_100016862 3300031995 Bacteria 4848
850 Ga0307409_100017410 3300031995 Bacteria 4789
851 Ga0307409_100059656 3300031995 Bacteria 2970
852 Ga0307409_100079698 3300031995 Bacteria 2640
853 Ga0307409_100103378 3300031995 Bacteria 2369
854 Ga0307409_100231768 3300031995 Bacteria 1674
855 Ga0307409_101230984 3300031995 Bacteria 772
856 Ga0307416_100006221 3300032002 Bacteria 7449
857 Ga0307416_100016342 3300032002 Bacteria 5155
858 Ga0307416_100028648 3300032002 Bacteria 4146
859 Ga0307416_100042342 3300032002 Bacteria 3554
860 Ga0307416_100042573 3300032002 Bacteria 3546
861 Ga0307416_100079241 3300032002 Bacteria 2767
862 Ga0307416_100102668 3300032002 Bacteria 2494
863 Ga0307416_100198442 3300032002 Bacteria 1901
864 Ga0307416_100570128 3300032002 Bacteria 1208
865 Ga0307416_101110166 3300032002 Bacteria 895
866 Ga0307416_101207766 3300032002 Bacteria 862
867 Ga0307416_103047990 3300032002 Bacteria 560
868 Ga0307414_10016142 3300032004 Bacteria 4531
869 Ga0307414_10044439 3300032004 Bacteria 3034
870 Ga0307414_10097343 3300032004 Bacteria 2204
871 Ga0307414_10203471 3300032004 Bacteria 1612
872 Ga0307414_10310847 3300032004 Bacteria 1337
873 Ga0307414_11065950 3300032004 Bacteria 745
874 Ga0307411_10051454 3300032005 Bacteria 2688
875 Ga0307411_10245184 3300032005 Bacteria 1405
876 Ga0307411_10251740 3300032005 Bacteria 1389
877 Ga0307411_10687854 3300032005 Bacteria 889
878 Ga0307415_100007685 3300032126 Bacteria 5917
879 Ga0307415_100008796 3300032126 Bacteria 5619
880 Ga0307415_100092567 3300032126 Bacteria 2192
881 Ga0307415_100125057 3300032126 Bacteria 1936
882 Ga0307415_100128835 3300032126 Bacteria 1912
883 Ga0307415_100128860 3300032126 Bacteria 1911
884 Ga0307415_100174879 3300032126 Bacteria 1678
885 Ga0307415_101304037 3300032126 Bacteria 688
886 Ga0316583_10062633 3300032133 Bacteria 1303
887 Ga0316593_10007076 3300032168 Bacteria 3064
888 Ga0316593_10022093 3300032168 Bacteria 1996
889 Ga0316593_10353465 3300032168 Bacteria 562
890 Ga0316593_10448036 3300032168 Unclassified 503
891 Ga0316592_1001311 3300033524 Bacteria 3965
892 Ga0316596_1019426 3300033541 Bacteria 1724
893 Ga0373938_0029034 3300034957 Bacteria 1173
894 Ga0373926_0004875 3300035083 Bacteria 4410
895 Ga0373928_0105584 3300035084 Bacteria 740
896 Ga0373934_0003191 3300035086 Bacteria 5993
897 Ga0373944_0040358 3300035089 Bacteria 1440
898 Ga0373951_0033685 3300035091 Bacteria 1215
899 Ga0373923_0017406 3300035111 Bacteria 2749
900 Ga0373936_0074292 3300035113 Bacteria 1406
901 Ga0373936_0237782 3300035113 Bacteria 811
902 Ga0373936_0403795 3300035113 Bacteria 628
903 Ga0373945_0008197 3300035116 Bacteria 3398
904 Ga0373953_0000508 3300035117 Bacteria 10822
905 Ga0373953_0282696 3300035117 Bacteria 723
906 Ga0373954_0036310 3300035118 Bacteria 2287
907 Ga0373956_0001913 3300035119 Bacteria 8599
908 Ga0373960_0089850 3300035121 Bacteria 980
909 Ga0373943_0002422 3300035170 Bacteria 8464
910 Ga0373943_0050963 3300035170 Bacteria 2036
911 Ga0373943_0349578 3300035170 Bacteria 847
912 Ga0373955_0001463 3300035172 Bacteria 10020
913 Ga0373961_0011559 3300035241 Bacteria 2193
914 Ga0316574_0410271 3300035398 Bacteria 852
915 Ga0373924_0007506 3300035410 Bacteria 3939
916 Ga0373924_0490894 3300035410 Bacteria 552
917 Ga0373931_0021484 3300035691 Bacteria 3239
918 Ga0373931_0781263 3300035691 Bacteria 636
919 Ga0373935_0001207 3300035692 Bacteria 14241
920 Ga0373935_0659779 3300035692 Bacteria 768
921 Ga0373935_0695694 3300035692 Bacteria 747
922 Ga0373927_0012867 3300035695 Bacteria 5563
923 Ga0373933_0000104 3300035724 Bacteria 53573
924 Ga0373933_0312077 3300035724 Bacteria 1019
925 Ga0373947_0000036 3300035725 Bacteria 64977
926 Ga0373947_0032749 3300035725 Bacteria 3065
927 Ga0373947_0150595 3300035725 Bacteria 1498
928 Ga0373947_0532797 3300035725 Bacteria 799
929 Ga0373937_0000161 3300036401 Bacteria 64761
930 Ga0373937_0064800 3300036401 Bacteria 3362
931 Ga0373937_0767119 3300036401 Bacteria 912
932 Ga0316582_0024225 3300036647 Bacteria 3630
933 Ga0316582_0028844 3300036647 Bacteria 3366
934 Ga0316582_0091566 3300036647 Bacteria 2002
935 Ga0316582_0097952 3300036647 Bacteria 1939
936 Ga0316582_0638498 3300036647 Bacteria 732
937 Ga0316584_0014998 3300036712 Bacteria 5534
938 Ga0316584_0177152 3300036712 Bacteria 1579
939 Ga0316584_0190762 3300036712 Bacteria 1515
940 Ga0316584_0532077 3300036712 Bacteria 822
941 Ga0373925_0000385 3300037068 Bacteria 45502
942 Ga0373925_0652817 3300037068 Bacteria 867
943 Ga0373925_1027307 3300037068 Bacteria 679
944 Ga0395899_0065854 3300037312 Bacteria 2662
945 Ga0395899_0096955 3300037312 Bacteria 2132
946 Ga0395899_0266996 3300037312 Bacteria 1168
947 Ga0395899_0280869 3300037312 Bacteria 1133
948 Ga0395899_0288370 3300037312 Bacteria 1114
949 Ga0395900_0050431 3300037418 Bacteria 4287
950 Ga0395900_0119149 3300037418 Bacteria 2709
951 Ga0395900_0150764 3300037418 Bacteria 2375
952 Ga0395900_0168044 3300037418 Bacteria 2234
953 Ga0395900_0336610 3300037418 Bacteria 1486
954 Ga0395900_0409006 3300037418 Bacteria 1319
955 Ga0395898_0047653 3300037466 Bacteria 4204
956 Ga0395898_0074326 3300037466 Bacteria 3283
957 Ga0395898_0149064 3300037466 Bacteria 2239
958 Ga0395898_0597414 3300037466 Bacteria 1046
959 Ga0395898_0690694 3300037466 Bacteria 962
960 Ga0395898_0937649 3300037466 Bacteria 803
961 Ga0395905_0020676 3300037471 Bacteria 6232
962 Ga0395905_0031562 3300037471 Bacteria 4987
963 Ga0395905_0169173 3300037471 Bacteria 2053
964 Ga0395905_0177309 3300037471 Bacteria 2000
965 Ga0395905_0192148 3300037471 Bacteria 1915
966 Ga0395905_0743894 3300037471 Bacteria 883
967 Ga0395905_0864496 3300037471 Bacteria 807
968 Ga0316581_0023281 3300037588 Bacteria 1831
969 Ga0316581_0030215 3300037588 Unclassified 1630
970 Ga0316581_0059648 3300037588 Unclassified 1170
971 Ga0436364_0050525 3300037853 Bacteria 1464
972 Ga0436364_0804097 3300037853 Bacteria 39998
973 Ga0436364_1057828 3300037853 Bacteria 904
974 Ga0395901_0008346 3300038443 Bacteria 10470
975 Ga0395901_0040860 3300038443 Bacteria 4804
976 Ga0395901_0048988 3300038443 Bacteria 4388
977 Ga0395901_0059119 3300038443 Bacteria 3988
978 Ga0395901_0068832 3300038443 Bacteria 3687
979 Ga0395901_0146976 3300038443 Bacteria 2477
980 Ga0395901_0170015 3300038443 Bacteria 2287
981 Ga0395901_0197940 3300038443 Bacteria 2106
982 Ga0395901_0200790 3300038443 Bacteria 2090
983 Ga0395901_0241882 3300038443 Bacteria 1882
984 Ga0395901_0305334 3300038443 Bacteria 1649
985 Ga0395901_0479317 3300038443 Bacteria 1269
986 Ga0395901_0890775 3300038443 Bacteria 872
987 Ga0395901_1278622 3300038443 Bacteria 696
988 Ga0400485_02889 3300038735 Bacteria 2957
989 Ga0400485_10207 3300038735 Bacteria 33642
990 Ga0242420_001741 3300038996 Bacteria 2981
991 Ga0400483_023072 3300039062 Bacteria 2119
992 Ga0400483_115887 3300039062 Bacteria 5393
993 Ga0400483_119646 3300039062 Bacteria 31679
994 Ga0400483_121060 3300039062 Bacteria 1427
995 Ga0400483_144468 3300039062 Bacteria 9002
996 Ga0400483_195692 3300039062 Bacteria 8747
997 Ga0400483_272214 3300039062 Bacteria 7945
998 Ga0436360_0293201 3300039438 Bacteria 621
999 Ga0436361_0165391 3300039447 Bacteria 4808
1000 Ga0436363_0282649 3300039450 Bacteria 1017
1001 Ga0436363_1494339 3300039450 Bacteria 613
1002 Ga0436362_0104946 3300039453 Bacteria 581
1003 Ga0436362_1118696 3300039453 Bacteria 1340
1004 Ga0439438_048477 3300041405 Bacteria 1087
1005 Ga0439438_107603 3300041405 Bacteria 674
1006 Ga0451800_1416039 3300041459 Bacteria 541
1007 Ga0451853_3305564 3300041512 Bacteria 1251
1008 Ga0439431_0070471 3300041997 Bacteria 931
1009 Ga0439441_149482 3300042001 Bacteria 550
1010 Ga0439442_161100 3300042002 Bacteria 502
1011 Ga0439443_011422 3300042003 Bacteria 1301
1012 Ga0439448_0008682 3300042005 Bacteria 2977
1013 Ga0439448_0012389 3300042005 Bacteria 2552
1014 Ga0439448_0047259 3300042005 Bacteria 1403
1015 Ga0439448_0173067 3300042005 Bacteria 753
1016 Ga0439450_001812 3300042008 Bacteria 3216
1017 Ga0439450_019148 3300042008 Bacteria 1446
1018 Ga0439451_009247 3300042009 Bacteria 1995
1019 Ga0439451_022652 3300042009 Bacteria 1266
1020 Ga0439452_019002 3300042010 Bacteria 1823
1021 Ga0439452_019558 3300042010 Bacteria 1789
1022 Ga0439454_001606 3300042011 Bacteria 2215
1023 Ga0439454_005732 3300042011 Bacteria 1496
1024 Ga0439455_0011795 3300042012 Bacteria 1951
1025 Ga0439455_0106410 3300042012 Bacteria 778
1026 Ga0439463_005224 3300042016 Bacteria 3229
1027 Ga0439463_062878 3300042016 Bacteria 948
1028 Ga0439463_122070 3300042016 Bacteria 673
1029 Ga0450914_000751 3300042118 Bacteria 1722
1030 Ga0450915_000008 3300042119 Bacteria 3455
1031 Ga0450917_004208 3300042120 Bacteria 1048
1032 Ga0450888_002932 3300042126 Bacteria 1705
1033 Ga0450890_015867 3300042127 Bacteria 994
1034 Ga0450900_003053 3300042136 Bacteria 1829
1035 Ga0450904_016776 3300042139 Bacteria 733
1036 Ga0450905_003023 3300042142 Bacteria 2195
1037 Ga0450905_014305 3300042142 Bacteria 1131
1038 Ga0450889_008228 3300042144 Bacteria 1058
1039 Ga0439446_0048935 3300042156 Bacteria 1260
1040 Ga0439458_0065758 3300042157 Bacteria 910
1041 Ga0439434_0043065 3300042435 Bacteria 1388
1042 Ga0439444_0004033 3300042437 Bacteria 2107
1043 Ga0439444_0023649 3300042437 Bacteria 1104
1044 Ga0439444_0080996 3300042437 Bacteria 710
1045 Ga0439464_0014637 3300042439 Bacteria 2110
1046 Ga0439464_0057136 3300042439 Bacteria 1137
1047 Ga0439464_0224051 3300042439 Bacteria 603
1048 Ga0439460_0009975 3300042461 Bacteria 2422
1049 Ga0439460_0010988 3300042461 Bacteria 2329
1050 Ga0439460_0109892 3300042461 Bacteria 893
1051 Ga0450916_002658 3300042530 Bacteria 1915
1052 Ga0451577_0000008 3300042876 Bacteria 692992
1053 Ga0451577_0103378 3300042876 Bacteria 2546
1054 Ga0451577_0173793 3300042876 Bacteria 1941
1055 Ga0451577_0339792 3300042876 Bacteria 1362
1056 Ga0439440_0007639 3300042993 Bacteria 2202
1057 Ga0439440_0031563 3300042993 Bacteria 1253
1058 Ga0439440_0067953 3300042993 Bacteria 922
1059 Ga0439440_0293521 3300042993 Bacteria 505
1060 Ga0466972_0057379 3300044658 Bacteria 1870
1061 Ga0453683_0009543 3300044673 Bacteria 6477
1062 Ga0453683_0034282 3300044673 Bacteria 3201
1063 Ga0453683_0044757 3300044673 Bacteria 2776
1064 Ga0453683_0145873 3300044673 Bacteria 1494
1065 Ga0453683_0222025 3300044673 Bacteria 1202
1066 Ga0453683_0673541 3300044673 Bacteria 677
1067 Ga0466965_0017677 3300044683 Bacteria 3411
1068 Ga0466965_0497436 3300044683 Bacteria 683
1069 Ga0466966_0263163 3300044684 Bacteria 1038
1070 Ga0466961_0895324 3300044693 Bacteria 528
1071 Ga0466963_0936880 3300044694 Bacteria 610
1072 Ga0453684_0000032 3300044712 Bacteria 745626
1073 Ga0453684_0000746 3300044712 Bacteria 113590
1074 Ga0453684_0006838 3300044712 Bacteria 21433
1075 Ga0453684_0007721 3300044712 Bacteria 19647
1076 Ga0453684_0180228 3300044712 Bacteria 2481
1077 Ga0466968_0097578 3300044735 Bacteria 1309
1078 Ga0466968_0269739 3300044735 Bacteria 812
1079 Ga0466970_0118125 3300044765 Bacteria 1451
1080 Ga0466957_0170951 3300044842 Bacteria 1416
1081 Ga0466957_0301145 3300044842 Bacteria 1077
1082 Ga0466957_0376710 3300044842 Bacteria 967
1083 Ga0466957_1134013 3300044842 Bacteria 564
1084 Ga0466959_0028253 3300045049 Bacteria 4159
1085 Ga0466959_0092346 3300045049 Bacteria 2173
1086 Ga0451576_0019145 3300045051 Bacteria 7478
1087 Ga0451576_0031109 3300045051 Bacteria 5693
1088 Ga0451576_0033178 3300045051 Bacteria 5488
1089 Ga0451576_0095299 3300045051 Bacteria 3095
1090 Ga0451576_0131023 3300045051 Bacteria 2614
1091 Ga0451576_0149398 3300045051 Bacteria 2436
1092 Ga0451576_0213835 3300045051 Bacteria 2013
1093 Ga0451576_0224496 3300045051 Bacteria 1961
1094 Ga0451576_0287758 3300045051 Bacteria 1718
1095 Ga0466958_0014083 3300045836 Bacteria 4562
1096 Ga0466958_0736427 3300045836 Bacteria 642
1097 Ga0466967_0038310 3300045976 Bacteria 4110
1098 Ga0466967_0113483 3300045976 Bacteria 2493
1099 Ga0466967_0516278 3300045976 Bacteria 1174
1100 Ga0466967_0533573 3300045976 Bacteria 1154
1101 Ga0495617_076749 3300046452 Bacteria 1096
1102 Ga0495627_127732 3300046453 Bacteria 716
1103 Ga0495592_0001510 3300046454 Bacteria 16209
1104 Ga0495603_0000774 3300046455 Bacteria 18264
1105 Ga0495603_0277838 3300046455 Bacteria 963
1106 Ga0495591_048589 3300046458 Bacteria 1169
1107 Ga0495591_067817 3300046458 Bacteria 933
1108 Ga0495591_161625 3300046458 Bacteria 536
1109 Ga0495629_0012987 3300046459 Bacteria 6023
1110 Ga0495629_0046147 3300046459 Bacteria 3056
1111 Ga0495629_0269380 3300046459 Bacteria 1170
1112 Ga0495638_0073512 3300046460 Bacteria 2086
1113 Ga0495651_0000077 3300046462 Bacteria 71891
1114 Ga0495653_0004046 3300046463 Bacteria 11847
1115 Ga0495580_0000048 3300046472 Bacteria 68571
1116 Ga0495580_0522566 3300046472 Bacteria 791
1117 Ga0495582_0000179 3300046473 Bacteria 34488
1118 Ga0495605_0036268 3300046474 Bacteria 2487
1119 Ga0495605_0087355 3300046474 Bacteria 1450
1120 Ga0495639_0000917 3300046475 Bacteria 13315
1121 Ga0495639_0750421 3300046475 Bacteria 505
1122 Ga0495584_0122972 3300046491 Bacteria 1314
1123 Ga0495584_0231884 3300046491 Bacteria 938
1124 Ga0495584_0409309 3300046491 Bacteria 689
1125 Ga0495585_0048729 3300046492 Bacteria 2355
1126 Ga0495585_0128927 3300046492 Bacteria 1333
1127 Ga0495594_0252948 3300046499 Bacteria 1004
1128 Ga0495594_0524069 3300046499 Bacteria 673
1129 Ga0495596_0023654 3300046500 Bacteria 2492
1130 Ga0495596_0026638 3300046500 Bacteria 2328
1131 Ga0495596_0143156 3300046500 Bacteria 929
1132 Ga0495596_0151129 3300046500 Bacteria 902
1133 Ga0495596_0286103 3300046500 Bacteria 641
1134 Ga0495607_0042801 3300046501 Bacteria 2682
1135 Ga0495607_0097459 3300046501 Bacteria 1581
1136 Ga0495607_0174949 3300046501 Bacteria 1081
1137 Ga0495583_0082919 3300046506 Bacteria 1391
1138 Ga0495583_0312142 3300046506 Bacteria 624
1139 Ga0495608_0001077 3300046511 Bacteria 19255
1140 Ga0495608_0173571 3300046511 Bacteria 1366
1141 Ga0495616_0130693 3300046513 Bacteria 1151
1142 Ga0495620_0156619 3300046515 Bacteria 886
1143 Ga0495620_0166140 3300046515 Bacteria 857
1144 Ga0495628_0000243 3300046516 Bacteria 48123
1145 Ga0495628_0401137 3300046516 Bacteria 1002
1146 Ga0495628_0569686 3300046516 Bacteria 811
1147 Ga0495630_0004558 3300046517 Bacteria 9711
1148 Ga0495630_0058372 3300046517 Bacteria 2893
1149 Ga0495630_0088607 3300046517 Bacteria 2337
1150 Ga0495630_0101279 3300046517 Bacteria 2179
1151 Ga0495630_0399443 3300046517 Bacteria 1053
1152 Ga0495630_0985566 3300046517 Bacteria 641
1153 Ga0495631_0143306 3300046518 Bacteria 1026
1154 Ga0495632_0340655 3300046519 Bacteria 660
1155 Ga0495637_0031749 3300046520 Bacteria 2333
1156 Ga0495637_0125664 3300046520 Bacteria 983
1157 Ga0495637_0153615 3300046520 Bacteria 867
1158 Ga0495644_0068577 3300046523 Bacteria 1332
1159 Ga0495644_0256142 3300046523 Bacteria 680
1160 Ga0495644_0317826 3300046523 Bacteria 611
1161 Ga0495644_0441777 3300046523 Bacteria 517
1162 Ga0495663_0014060 3300046525 Bacteria 2241
1163 Ga0495663_0018918 3300046525 Bacteria 1965
1164 Ga0495642_0013058 3300046528 Bacteria 3209
1165 Ga0495642_0024233 3300046528 Bacteria 2400
1166 Ga0495642_0129926 3300046528 Bacteria 1084
1167 Ga0495652_0002587 3300046529 Bacteria 18520
1168 Ga0495652_0382753 3300046529 Bacteria 1000
1169 Ga0495652_0396514 3300046529 Bacteria 978
1170 Ga0495654_0265295 3300046530 Bacteria 711
1171 Ga0495665_0000002 3300046531 Bacteria 128983
1172 Ga0495665_0055209 3300046531 Bacteria 2098
1173 Ga0495640_0097259 3300046533 Bacteria 1936
1174 Ga0495640_0098790 3300046533 Bacteria 1918
1175 Ga0495640_0276282 3300046533 Bacteria 1047
1176 Ga0495586_0030111 3300046535 Bacteria 2905
1177 Ga0495586_0254933 3300046535 Bacteria 1001
1178 Ga0495587_0000452 3300046536 Bacteria 28656
1179 Ga0495598_0020160 3300046537 Bacteria 1757
1180 Ga0495598_0046509 3300046537 Bacteria 1290
1181 Ga0495609_0134813 3300046538 Bacteria 1056
1182 Ga0495609_0302209 3300046538 Bacteria 651
1183 Ga0495609_0437674 3300046538 Bacteria 520
1184 Ga0495621_0188244 3300046539 Bacteria 826
1185 Ga0495645_0076947 3300046543 Bacteria 2399
1186 Ga0495645_0170033 3300046543 Bacteria 1501
1187 Ga0495633_0065162 3300046558 Bacteria 1703
1188 Ga0495633_0270764 3300046558 Bacteria 773
1189 Ga0495667_0001003 3300046559 Bacteria 18295
1190 Ga0495667_0592863 3300046559 Bacteria 691
1191 Ga0495656_0002926 3300046615 Bacteria 5725
1192 Ga0495656_0257237 3300046615 Bacteria 883
1193 Ga0495668_0090149 3300046616 Bacteria 1680
1194 Ga0495634_0025555 3300046642 Bacteria 4130
1195 Ga0495634_0041641 3300046642 Bacteria 3119
1196 Ga0495634_0079214 3300046642 Bacteria 2152
1197 Ga0495634_0233806 3300046642 Bacteria 1130
1198 Ga0495611_0040505 3300046648 Bacteria 2077
1199 Ga0495635_0000048 3300046663 Bacteria 79393
1200 Ga0495659_0012075 3300046664 Bacteria 2792
1201 Ga0495659_0017260 3300046664 Bacteria 2389
1202 Ga0495661_0189063 3300046665 Bacteria 1086
1203 Ga0495588_0000464 3300046674 Bacteria 20343
1204 Ga0495588_0027860 3300046674 Bacteria 2825
1205 Ga0495657_0001010 3300046675 Bacteria 24781
1206 Ga0495657_0361764 3300046675 Bacteria 857
1207 Ga0495599_0004988 3300046678 Bacteria 7895
1208 Ga0495599_0228123 3300046678 Bacteria 1138
1209 Ga0495623_0000961 3300046679 Bacteria 19433
1210 Ga0495646_0027300 3300046680 Bacteria 3581
1211 Ga0495646_0389156 3300046680 Bacteria 726
1212 Ga0495647_0092406 3300046681 Bacteria 1242
1213 Ga0495647_0233841 3300046681 Bacteria 814
1214 Ga0495658_0000017 3300046683 Bacteria 93346
1215 Ga0495658_0564017 3300046683 Bacteria 729
1216 Ga0495669_0068485 3300046684 Bacteria 1615
1217 Ga0495669_0070627 3300046684 Bacteria 1591
1218 Ga0495669_0458040 3300046684 Bacteria 619
1219 Ga0495613_0024110 3300046689 Bacteria 4534
1220 Ga0495613_0088123 3300046689 Bacteria 2249
1221 Ga0495613_0319453 3300046689 Bacteria 1072
1222 Ga0495624_0094611 3300046690 Bacteria 1842
1223 Ga0495624_0170535 3300046690 Bacteria 1328
1224 Ga0495589_0033549 3300046794 Bacteria 2577
1225 Ga0495600_0001723 3300046809 Bacteria 12240
1226 Ga0495660_0216722 3300046810 Bacteria 905
1227 Ga0495581_0000312 3300047315 Bacteria 23854
1228 Ga0495581_0293720 3300047315 Bacteria 950
1229 Ga0495604_0000017 3300047317 Bacteria 192029
1230 Ga0495604_0478703 3300047317 Bacteria 810
1231 Ga0495636_0192655 3300047318 Bacteria 928
1232 Ga0495674_0004269 3300047319 Bacteria 13758
1233 Ga0495674_0284414 3300047319 Bacteria 1354
1234 Ga0495674_0491687 3300047319 Bacteria 982
1235 Ga0495674_0793691 3300047319 Bacteria 737
1236 Ga0495672_0159674 3300047320 Bacteria 1160
1237 Ga0495672_0289337 3300047320 Bacteria 780
1238 Ga0495672_0346024 3300047320 Bacteria 692
1239 Ga0495676_0048910 3300047321 Bacteria 3405
1240 Ga0495676_0183628 3300047321 Bacteria 1464
1241 Ga0495676_0206502 3300047321 Bacteria 1362
1242 Ga0495676_0339368 3300047321 Bacteria 1006
1243 Ga0495680_0007740 3300047322 Bacteria 9814
1244 Ga0495680_0190067 3300047322 Bacteria 1478
1245 Ga0495680_0276999 3300047322 Bacteria 1183
1246 Ga0495680_0294859 3300047322 Bacteria 1140
1247 Ga0495680_0853592 3300047322 Bacteria 591
1248 Ga0495675_0002210 3300047444 Bacteria 11607
1249 Ga0495677_0018428 3300047445 Bacteria 2531
1250 Ga0495677_0096254 3300047445 Bacteria 1118
1251 Ga0495677_0167760 3300047445 Bacteria 849
1252 Ga0495677_0274420 3300047445 Bacteria 661
1253 Ga0495685_122019 3300047447 Bacteria 855
1254 Ga0495684_0000118 3300047471 Bacteria 57785
1255 Ga0495593_0000009 3300047673 Bacteria 85608
1256 Ga0495593_0150411 3300047673 Bacteria 1177
1257 Ga0495602_0000891 3300048088 Bacteria 28810
1258 Ga0495602_0501917 3300048088 Bacteria 848
1259 Ga0495614_0000005 3300048089 Bacteria 74692
1260 Ga0495614_0010194 3300048089 Bacteria 4144
1261 Ga0495614_0114069 3300048089 Bacteria 1188
1262 Ga0495615_0087364 3300048090 Bacteria 864
1263 Ga0496100_0003601 3300048903 Bacteria 8086
1264 Ga0496100_0060305 3300048903 Bacteria 2496
1265 Ga0496100_0323800 3300048903 Bacteria 1158
1266 Ga0496100_0392669 3300048903 Bacteria 1055
1267 Ga0496100_1225757 3300048903 Bacteria 592
1268 Ga0496101_0000020 3300048904 Bacteria 218859
1269 Ga0496101_0009982 3300048904 Bacteria 6256
1270 Ga0496101_0075234 3300048904 Bacteria 2485
1271 Ga0496101_0079646 3300048904 Bacteria 2418
1272 Ga0496101_0228242 3300048904 Bacteria 1447
1273 Ga0496101_0560090 3300048904 Bacteria 904
1274 Ga0496101_1218637 3300048904 Bacteria 589
1275 Ga0496102_0016044 3300048905 Bacteria 6537
1276 Ga0496102_0026908 3300048905 Bacteria 5134
1277 Ga0496102_0254094 3300048905 Bacteria 1657
1278 Ga0496102_0460052 3300048905 Bacteria 1193
1279 Ga0496102_0472850 3300048905 Bacteria 1174
1280 Ga0496102_0567361 3300048905 Bacteria 1058
1281 Ga0496102_0994721 3300048905 Bacteria 759
1282 Ga0496102_1584551 3300048905 Bacteria 573
1283 Ga0496103_0001090 3300048906 Bacteria 18900
1284 Ga0496103_0020130 3300048906 Bacteria 4006
1285 Ga0496104_0002157 3300048907 Bacteria 17083
1286 Ga0496104_0043997 3300048907 Bacteria 4195
1287 Ga0496104_0051315 3300048907 Bacteria 3893
1288 Ga0496104_0160103 3300048907 Bacteria 2159
1289 Ga0496104_0181428 3300048907 Bacteria 2015
1290 Ga0496104_0187871 3300048907 Bacteria 1977
1291 Ga0496104_0263311 3300048907 Bacteria 1637
1292 Ga0496105_0000376 3300048908 Bacteria 29483
1293 Ga0496105_0053016 3300048908 Bacteria 3350
1294 Ga0496105_0055255 3300048908 Bacteria 3278
1295 Ga0496105_0058470 3300048908 Bacteria 3182
1296 Ga0496105_0152731 3300048908 Bacteria 1897
1297 Ga0496106_0001002 3300048909 Bacteria 20648
1298 Ga0496106_0443451 3300048909 Bacteria 1043
1299 Ga0496106_0482980 3300048909 Bacteria 995
1300 Ga0496107_0004748 3300048910 Bacteria 9231
1301 Ga0496107_0070089 3300048910 Bacteria 2545
1302 Ga0496107_0519325 3300048910 Bacteria 883
1303 Ga0496108_0001494 3300048911 Bacteria 18490
1304 Ga0496108_0023343 3300048911 Bacteria 5088
1305 Ga0496108_0063701 3300048911 Bacteria 3105
1306 Ga0496108_0093551 3300048911 Bacteria 2557
1307 Ga0496108_0985610 3300048911 Bacteria 720
1308 Ga0496109_0000104 3300048912 Bacteria 87994
1309 Ga0496109_0000890 3300048912 Bacteria 24961
1310 Ga0496109_0004159 3300048912 Bacteria 12083
1311 Ga0496109_0099602 3300048912 Bacteria 2696
1312 Ga0496109_0110111 3300048912 Bacteria 2560
1313 Ga0496109_0157500 3300048912 Bacteria 2127
1314 Ga0496109_0190149 3300048912 Bacteria 1929
1315 Ga0496109_0844853 3300048912 Bacteria 853
1316 Ga0496110_0000535 3300048913 Bacteria 25840
1317 Ga0496110_0005263 3300048913 Bacteria 10126
1318 Ga0496110_0024077 3300048913 Bacteria 5187
1319 Ga0496110_0117605 3300048913 Bacteria 2394
1320 Ga0496110_0157946 3300048913 Bacteria 2055
1321 Ga0496110_0192584 3300048913 Bacteria 1851
1322 Ga0496110_0284344 3300048913 Bacteria 1506
1323 Ga0496110_0658388 3300048913 Bacteria 947
1324 Ga0496110_0734053 3300048913 Bacteria 890
1325 Ga0496111_0000253 3300048914 Bacteria 25837
1326 Ga0496111_0001198 3300048914 Bacteria 14472
1327 Ga0496111_0002457 3300048914 Bacteria 11179
1328 Ga0496111_0013288 3300048914 Bacteria 5598
1329 Ga0496111_0048415 3300048914 Bacteria 3062
1330 Ga0496111_0058453 3300048914 Bacteria 2792
1331 Ga0496111_0202512 3300048914 Bacteria 1475
1332 Ga0496111_0257702 3300048914 Bacteria 1294
1333 Ga0496111_0531005 3300048914 Bacteria 865
1334 Ga0496112_0251313 3300048915 Bacteria 1719
1335 Ga0496113_0035170 3300048916 Bacteria 3662
1336 Ga0496113_0113068 3300048916 Bacteria 2116
1337 Ga0496113_0330602 3300048916 Bacteria 1222
1338 Ga0496113_0346111 3300048916 Bacteria 1192
1339 Ga0496113_1298060 3300048916 Bacteria 566
1340 Ga0496114_0002964 3300048917 Bacteria 13017
1341 Ga0496114_0012079 3300048917 Bacteria 6911
1342 Ga0496114_0029892 3300048917 Bacteria 4480
1343 Ga0496114_0339872 3300048917 Bacteria 1327
1344 Ga0496114_0491052 3300048917 Bacteria 1086
1345 Ga0496115_0005604 3300048918 Bacteria 9139
1346 Ga0496115_0026439 3300048918 Bacteria 4530
1347 Ga0496115_0136732 3300048918 Bacteria 2021
1348 Ga0496116_0023586 3300048919 Bacteria 4578
1349 Ga0496117_0097260 3300048920 Bacteria 1875
1350 Ga0496118_0056160 3300048921 Bacteria 2962
1351 Ga0496119_0028537 3300048922 Bacteria 3805
1352 Ga0496120_0021008 3300048923 Bacteria 4133
1353 Ga0496121_0000002 3300048924 Bacteria 1494588
1354 Ga0496121_0207186 3300048924 Bacteria 1392
1355 Ga0496122_0000078 3300048925 Bacteria 214068
1356 Ga0496123_0010533 3300048926 Bacteria 8153
1357 Ga0496124_0000002 3300048927 Bacteria 1494588
1358 Ga0496124_0306729 3300048927 Bacteria 1144
1359 Ga0496125_0000002 3300048928 Bacteria 1480920
1360 Ga0496125_0182339 3300048928 Bacteria 1397
1361 Ga0496126_0000009 3300048929 Bacteria 750350
1362 Ga0496126_0023068 3300048929 Bacteria 6033
1363 Ga0501306_017286 3300049127 Bacteria 977
1364 Ga0501309_013405 3300049129 Bacteria 1090
1365 Ga0501309_025047 3300049129 Bacteria 856
1366 Ga0501309_028902 3300049129 Bacteria 810
1367 Ga0501309_054600 3300049129 Bacteria 633
1368 Ga0501305_047149 3300049161 Bacteria 715
1369 Ga0501307_038394 3300049162 Bacteria 688
1370 Ga0501291_009197 3300049514 Bacteria 1381
1371 Ga0501303_001909 3300049526 Bacteria 1579
1372 Ga0501311_024222 3300049527 Bacteria 844
1373 Ga0501311_069716 3300049527 Bacteria 582
1374 Ga0501311_102109 3300049527 Bacteria 509
1375 Ga0501316_034117 3300049532 Bacteria 691
1376 Ga0501316_041226 3300049532 Bacteria 644
1377 Ga0501316_074332 3300049532 Bacteria 519
1378 Ga0501318_078916 3300049534 Bacteria 531
1379 Ga0501321_051028 3300049537 Bacteria 605
1380 Ga0501336_019475 3300049552 Bacteria 608
1381 Ga0501031_0016949 3300049568 Bacteria 4732
1382 Ga0501031_0061151 3300049568 Bacteria 2454
1383 Ga0501031_0066123 3300049568 Bacteria 2355
1384 Ga0501031_0114079 3300049568 Bacteria 1765
1385 Ga0501031_0277550 3300049568 Bacteria 1087
1386 Ga0501032_0024261 3300049569 Bacteria 4189
1387 Ga0501032_0068894 3300049569 Bacteria 2361
1388 Ga0501032_0083119 3300049569 Bacteria 2130
1389 Ga0501032_0480364 3300049569 Unclassified 795
1390 Ga0501032_0881621 3300049569 Bacteria 564
1391 Ga0501033_0027043 3300049570 Bacteria 4315
1392 Ga0501033_0028569 3300049570 Bacteria 4190
1393 Ga0501033_0083691 3300049570 Bacteria 2338
1394 Ga0501033_0140536 3300049570 Bacteria 1746
1395 Ga0501033_0183735 3300049570 Bacteria 1498
1396 Ga0501033_0282560 3300049570 Bacteria 1171
1397 Ga0501034_0001825 3300049571 Bacteria 27031
1398 Ga0501034_0004435 3300049571 Bacteria 15613
1399 Ga0501034_0011458 3300049571 Bacteria 9188
1400 Ga0501034_0024059 3300049571 Bacteria 6197
1401 Ga0501034_0028192 3300049571 Bacteria 5713
1402 Ga0501034_0098282 3300049571 Bacteria 2923
1403 Ga0501034_0190200 3300049571 Unclassified 2015
1404 Ga0501034_0245211 3300049571 Bacteria 1737
1405 Ga0501034_0334869 3300049571 Bacteria 1444
1406 Ga0501034_0833795 3300049571 Bacteria 813
1407 Ga0501036_0008564 3300049572 Bacteria 8389
1408 Ga0501036_0012215 3300049572 Bacteria 7115
1409 Ga0501036_0046523 3300049572 Bacteria 3675
1410 Ga0501036_0052124 3300049572 Bacteria 3465
1411 Ga0501036_0344068 3300049572 Bacteria 1245
1412 Ga0501036_0371145 3300049572 Bacteria 1194
1413 Ga0501036_0375011 3300049572 Bacteria 1187
1414 Ga0501036_0384243 3300049572 Bacteria 1171
1415 Ga0501036_0424602 3300049572 Bacteria 1108
1416 Ga0501036_0964615 3300049572 Bacteria 698
1417 Ga0501036_0969532 3300049572 Bacteria 696
1418 Ga0501037_0024685 3300049573 Bacteria 4444
1419 Ga0501037_0094701 3300049573 Bacteria 2159
1420 Ga0501037_0153293 3300049573 Bacteria 1646
1421 Ga0501037_0180644 3300049573 Bacteria 1497
1422 Ga0501037_0288035 3300049573 Bacteria 1143
1423 Ga0501037_0398242 3300049573 Bacteria 944
1424 Ga0501038_0009257 3300049574 Bacteria 9035
1425 Ga0501038_0021581 3300049574 Bacteria 5778
1426 Ga0501038_0090056 3300049574 Bacteria 2572
1427 Ga0501038_0101489 3300049574 Bacteria 2395
1428 Ga0501038_0306554 3300049574 Bacteria 1245
1429 Ga0501038_0489062 3300049574 Bacteria 942
1430 Ga0501038_0695344 3300049574 Bacteria 762
1431 Ga0501038_0720260 3300049574 Bacteria 746
1432 Ga0501039_0005221 3300049575 Bacteria 9835
1433 Ga0501039_0009764 3300049575 Bacteria 7311
1434 Ga0501039_0060778 3300049575 Bacteria 2926
1435 Ga0501039_0060832 3300049575 Bacteria 2924
1436 Ga0501039_0125604 3300049575 Bacteria 2012
1437 Ga0501039_0160753 3300049575 Bacteria 1765
1438 Ga0501039_0191823 3300049575 Bacteria 1607
1439 Ga0501039_0212634 3300049575 Bacteria 1520
1440 Ga0501039_0421927 3300049575 Bacteria 1048
1441 Ga0501039_1452088 3300049575 Bacteria 528
1442 Ga0501039_1559121 3300049575 Bacteria 507
1443 Ga0501040_0003784 3300049576 Bacteria 9810
1444 Ga0501040_0009617 3300049576 Bacteria 6310
1445 Ga0501040_0021776 3300049576 Bacteria 4285
1446 Ga0501040_0028522 3300049576 Bacteria 3763
1447 Ga0501040_0088404 3300049576 Bacteria 2152
1448 Ga0501040_0089189 3300049576 Bacteria 2142
1449 Ga0501040_0120646 3300049576 Bacteria 1839
1450 Ga0501040_0200046 3300049576 Bacteria 1418
1451 Ga0501040_0232658 3300049576 Bacteria 1312
1452 Ga0501040_0597001 3300049576 Bacteria 797
1453 Ga0501040_0613587 3300049576 Bacteria 786
1454 Ga0501040_0724206 3300049576 Bacteria 719
1455 Ga0501041_0011476 3300049577 Bacteria 5237
1456 Ga0501041_0023634 3300049577 Bacteria 3685
1457 Ga0501041_0035788 3300049577 Bacteria 3009
1458 Ga0501041_0066278 3300049577 Bacteria 2212
1459 Ga0501041_0072088 3300049577 Bacteria 2121
1460 Ga0501041_0072451 3300049577 Bacteria 2116
1461 Ga0501041_0084784 3300049577 Bacteria 1953
1462 Ga0501041_0203311 3300049577 Bacteria 1242
1463 Ga0501042_0003469 3300049578 Bacteria 9902
1464 Ga0501042_0013489 3300049578 Bacteria 5563
1465 Ga0501042_0015092 3300049578 Bacteria 5283
1466 Ga0501042_0031148 3300049578 Bacteria 3774
1467 Ga0501042_0031630 3300049578 Bacteria 3743
1468 Ga0501042_0083523 3300049578 Bacteria 2289
1469 Ga0501042_0135236 3300049578 Bacteria 1777
1470 Ga0501042_0138397 3300049578 Bacteria 1755
1471 Ga0501042_0804999 3300049578 Bacteria 684
1472 Ga0501043_0038191 3300049579 Bacteria 3776
1473 Ga0501043_0052388 3300049579 Bacteria 3205
1474 Ga0501043_0058382 3300049579 Bacteria 3029
1475 Ga0501043_0447893 3300049579 Bacteria 970
1476 Ga0501046_0049684 3300049580 Bacteria 3317
1477 Ga0501046_0052130 3300049580 Bacteria 3225
1478 Ga0501046_0089286 3300049580 Bacteria 2372
1479 Ga0501046_0149437 3300049580 Bacteria 1763
1480 Ga0501046_0174048 3300049580 Bacteria 1613
1481 Ga0501046_0225394 3300049580 Bacteria 1387
1482 Ga0501046_0256390 3300049580 Bacteria 1286
1483 Ga0501047_0063124 3300049581 Bacteria 3573
1484 Ga0501047_0648714 3300049581 Bacteria 875
1485 Ga0501048_0003376 3300049582 Bacteria 12139
1486 Ga0501048_0037470 3300049582 Bacteria 3482
1487 Ga0501048_0059842 3300049582 Bacteria 2699
1488 Ga0501048_0087331 3300049582 Bacteria 2200
1489 Ga0501048_0314083 3300049582 Bacteria 1116
1490 Ga0501048_0345340 3300049582 Bacteria 1061
1491 Ga0501048_0514070 3300049582 Bacteria 859
1492 Ga0501048_1395335 3300049582 Bacteria 503
1493 Ga0501067_0036323 3300049583 Bacteria 2735
1494 Ga0501068_0006593 3300049584 Bacteria 6404
1495 Ga0501068_0008483 3300049584 Bacteria 5721
1496 Ga0501068_0065114 3300049584 Bacteria 2218
1497 Ga0501068_0072778 3300049584 Bacteria 2099
1498 Ga0501068_0104588 3300049584 Bacteria 1757
1499 Ga0501068_0280653 3300049584 Bacteria 1064
1500 Ga0501068_0668430 3300049584 Bacteria 678
1501 Ga0501069_0002477 3300049585 Bacteria 9427
1502 Ga0501069_0010347 3300049585 Bacteria 4936
1503 Ga0501069_0139895 3300049585 Bacteria 1388
1504 Ga0501069_0341877 3300049585 Bacteria 881
1505 Ga0501070_0001904 3300049586 Bacteria 18459
1506 Ga0501070_0002081 3300049586 Bacteria 17582
1507 Ga0501070_0011947 3300049586 Bacteria 7333
1508 Ga0501070_0236432 3300049586 Bacteria 1496
1509 Ga0501070_0259225 3300049586 Bacteria 1421
1510 Ga0501070_0379127 3300049586 Bacteria 1146
1511 Ga0501070_0404585 3300049586 Bacteria 1104
1512 Ga0501070_0574019 3300049586 Bacteria 901
1513 Ga0501070_0612446 3300049586 Bacteria 867
1514 Ga0501070_0685536 3300049586 Bacteria 811
1515 Ga0501070_0687074 3300049586 Bacteria 810
1516 Ga0501070_0962639 3300049586 Bacteria 663
1517 Ga0501070_1219759 3300049586 Bacteria 577
1518 Ga0501071_0004023 3300049587 Bacteria 9283
1519 Ga0501071_0014800 3300049587 Bacteria 5342
1520 Ga0501071_0020646 3300049587 Bacteria 4580
1521 Ga0501071_0024088 3300049587 Bacteria 4255
1522 Ga0501071_0043000 3300049587 Bacteria 3238
1523 Ga0501071_0061222 3300049587 Bacteria 2726
1524 Ga0501071_0061474 3300049587 Bacteria 2720
1525 Ga0501071_0114224 3300049587 Bacteria 1997
1526 Ga0501071_0149919 3300049587 Bacteria 1739
1527 Ga0501071_0165480 3300049587 Bacteria 1654
1528 Ga0501071_0185572 3300049587 Bacteria 1559
1529 Ga0501071_0208023 3300049587 Bacteria 1471
1530 Ga0501071_0378283 3300049587 Bacteria 1079
1531 Ga0501071_0478713 3300049587 Bacteria 954
1532 Ga0501071_0501929 3300049587 Bacteria 931
1533 Ga0501071_0510421 3300049587 Bacteria 922
1534 Ga0501071_0582403 3300049587 Bacteria 860
1535 Ga0501071_0881962 3300049587 Bacteria 690
1536 Ga0501072_0002349 3300049588 Bacteria 14189
1537 Ga0501072_0003175 3300049588 Bacteria 12358
1538 Ga0501072_0019683 3300049588 Bacteria 5222
1539 Ga0501072_0019717 3300049588 Bacteria 5216
1540 Ga0501072_0038014 3300049588 Bacteria 3777
1541 Ga0501072_0051493 3300049588 Bacteria 3241
1542 Ga0501072_0084371 3300049588 Bacteria 2518
1543 Ga0501072_0117785 3300049588 Bacteria 2116
1544 Ga0501072_0131936 3300049588 Bacteria 1991
1545 Ga0501072_0198763 3300049588 Bacteria 1598
1546 Ga0501072_0199727 3300049588 Bacteria 1594
1547 Ga0501072_0379532 3300049588 Bacteria 1122
1548 Ga0501072_0430505 3300049588 Bacteria 1045
1549 Ga0501072_0911664 3300049588 Bacteria 686
1550 Ga0501072_1021909 3300049588 Bacteria 644
1551 Ga0501073_0011047 3300049589 Bacteria 6605
1552 Ga0501073_0028613 3300049589 Bacteria 3981
1553 Ga0501073_0111878 3300049589 Bacteria 1894
1554 Ga0501073_0118279 3300049589 Bacteria 1837
1555 Ga0501073_0127352 3300049589 Bacteria 1765
1556 Ga0501073_0269393 3300049589 Bacteria 1175
1557 Ga0501073_1005308 3300049589 Bacteria 574
1558 Ga0501074_0006817 3300049590 Bacteria 8251
1559 Ga0501074_0009286 3300049590 Bacteria 7141
1560 Ga0501074_0010727 3300049590 Bacteria 6656
1561 Ga0501074_0017339 3300049590 Bacteria 5223
1562 Ga0501074_0066493 3300049590 Bacteria 2593
1563 Ga0501074_0092415 3300049590 Bacteria 2167
1564 Ga0501074_0109746 3300049590 Bacteria 1974
1565 Ga0501074_0285578 3300049590 Bacteria 1173
1566 Ga0501074_0402709 3300049590 Bacteria 970
1567 Ga0501075_0004184 3300049591 Bacteria 9743
1568 Ga0501075_0005970 3300049591 Bacteria 8338
1569 Ga0501075_0010315 3300049591 Bacteria 6564
1570 Ga0501075_0023308 3300049591 Bacteria 4531
1571 Ga0501075_0031632 3300049591 Bacteria 3929
1572 Ga0501075_0045343 3300049591 Bacteria 3300
1573 Ga0501075_0050053 3300049591 Bacteria 3140
1574 Ga0501075_0062426 3300049591 Bacteria 2808
1575 Ga0501075_0148711 3300049591 Bacteria 1785
1576 Ga0501075_0308386 3300049591 Bacteria 1206
1577 Ga0501075_0317128 3300049591 Bacteria 1188
1578 Ga0501075_0371085 3300049591 Bacteria 1091
1579 Ga0501075_0389350 3300049591 Bacteria 1062
1580 Ga0501075_0771086 3300049591 Bacteria 732
1581 Ga0501075_0971013 3300049591 Bacteria 645
1582 Ga0501075_1312171 3300049591 Bacteria 548
1583 Ga0501076_0002305 3300049592 Bacteria 13067
1584 Ga0501076_0013698 3300049592 Bacteria 6084
1585 Ga0501076_0016133 3300049592 Bacteria 5654
1586 Ga0501076_0020768 3300049592 Bacteria 5028
1587 Ga0501076_0052984 3300049592 Bacteria 3214
1588 Ga0501076_0058485 3300049592 Bacteria 3064
1589 Ga0501076_0060260 3300049592 Bacteria 3019
1590 Ga0501076_0126390 3300049592 Bacteria 2072
1591 Ga0501076_0173364 3300049592 Bacteria 1758
1592 Ga0501076_0343998 3300049592 Bacteria 1224
1593 Ga0501076_0409119 3300049592 Bacteria 1116
1594 Ga0501076_0609828 3300049592 Bacteria 900
1595 Ga0501076_1281663 3300049592 Bacteria 603
1596 Ga0501076_1391824 3300049592 Bacteria 576
1597 Ga0501077_0006476 3300049593 Bacteria 7187
1598 Ga0501077_0024807 3300049593 Bacteria 3807
1599 Ga0501077_0026395 3300049593 Bacteria 3686
1600 Ga0501077_0048103 3300049593 Bacteria 2709
1601 Ga0501077_0056234 3300049593 Bacteria 2497
1602 Ga0501077_0138650 3300049593 Bacteria 1542
1603 Ga0501077_0242348 3300049593 Bacteria 1146
1604 Ga0501077_0435766 3300049593 Bacteria 839
1605 Ga0501077_0743492 3300049593 Bacteria 630
1606 Ga0501077_0851495 3300049593 Bacteria 586
1607 Ga0501199_016585 3300049650 Bacteria 831
1608 Ga0501209_238709 3300049656 Bacteria 566
1609 Ga0501227_213616 3300049665 Bacteria 548
1610 Ga0501230_030982 3300049667 Bacteria 995
1611 Ga0501233_214728 3300049668 Bacteria 565
1612 Ga0501249_026472 3300049679 Bacteria 1282
1613 Ga0501257_144951 3300049686 Bacteria 651
1614 Ga0501261_130944 3300049690 Bacteria 506
1615 Ga0501219_014439 3300049703 Bacteria 630
1616 Ga0501225_0034056 3300049705 Bacteria 1402
1617 Ga0501079_0002888 3300049741 Bacteria 12548
1618 Ga0501079_0005094 3300049741 Bacteria 9762
1619 Ga0501079_0018979 3300049741 Bacteria 5254
1620 Ga0501079_0041579 3300049741 Bacteria 3549
1621 Ga0501079_0043465 3300049741 Bacteria 3468
1622 Ga0501079_0044369 3300049741 Bacteria 3431
1623 Ga0501079_0082058 3300049741 Bacteria 2493
1624 Ga0501079_0143216 3300049741 Bacteria 1862
1625 Ga0501079_0292267 3300049741 Bacteria 1274
1626 Ga0501079_0352118 3300049741 Bacteria 1154
1627 Ga0501079_0402511 3300049741 Bacteria 1073
1628 Ga0501079_0816173 3300049741 Bacteria 734
1629 Ga0501079_1336001 3300049741 Bacteria 564
1630 Ga0501079_1353608 3300049741 Bacteria 560
1631 Ga0501080_0007710 3300049742 Bacteria 9729
1632 Ga0501080_0018218 3300049742 Bacteria 6499
1633 Ga0501080_0027162 3300049742 Bacteria 5323
1634 Ga0501080_0110153 3300049742 Bacteria 2552
1635 Ga0501080_0124172 3300049742 Bacteria 2391
1636 Ga0501080_0178789 3300049742 Bacteria 1953
1637 Ga0501080_0206587 3300049742 Bacteria 1801
1638 Ga0501080_0250338 3300049742 Bacteria 1615
1639 Ga0501080_0394277 3300049742 Bacteria 1246
1640 Ga0501080_0510242 3300049742 Bacteria 1074
1641 Ga0501080_0546805 3300049742 Bacteria 1032
1642 Ga0501080_0666151 3300049742 Bacteria 920
1643 Ga0501080_0886675 3300049742 Bacteria 778
1644 Ga0501080_0912404 3300049742 Bacteria 765
1645 Ga0501080_1211230 3300049742 Bacteria 649
1646 Ga0501080_1373453 3300049742 Bacteria 603
1647 Ga0501081_0004119 3300049743 Bacteria 9317
1648 Ga0501081_0010385 3300049743 Bacteria 6073
1649 Ga0501081_0016046 3300049743 Bacteria 4947
1650 Ga0501081_0036210 3300049743 Bacteria 3364
1651 Ga0501081_0037558 3300049743 Bacteria 3305
1652 Ga0501081_0060364 3300049743 Bacteria 2627
1653 Ga0501081_0074251 3300049743 Bacteria 2372
1654 Ga0501081_0180039 3300049743 Bacteria 1529
1655 Ga0501081_0187411 3300049743 Bacteria 1497
1656 Ga0501081_0220085 3300049743 Bacteria 1380
1657 Ga0501081_0256158 3300049743 Bacteria 1278
1658 Ga0501081_0302907 3300049743 Bacteria 1172
1659 Ga0501081_0310373 3300049743 Bacteria 1158
1660 Ga0501081_0708328 3300049743 Bacteria 756
1661 Ga0501083_0002562 3300049744 Bacteria 12491
1662 Ga0501083_0027739 3300049744 Bacteria 3905
1663 Ga0501083_0055696 3300049744 Bacteria 2651
1664 Ga0501083_0056432 3300049744 Bacteria 2631
1665 Ga0501083_0072489 3300049744 Bacteria 2290
1666 Ga0501083_0074335 3300049744 Bacteria 2258
1667 Ga0501083_0151522 3300049744 Bacteria 1518
1668 Ga0501083_0165147 3300049744 Bacteria 1447
1669 Ga0501083_0747217 3300049744 Bacteria 636
1670 Ga0501268_114564 3300049765 Bacteria 592
1671 Ga0501035_0023765 3300049822 Bacteria 5623
1672 Ga0501035_0138158 3300049822 Bacteria 2120
1673 Ga0501035_0143156 3300049822 Bacteria 2077
1674 Ga0501035_0565227 3300049822 Bacteria 930
1675 Ga0501035_0566271 3300049822 Bacteria 929
1676 Ga0501035_0757723 3300049822 Bacteria 778
1677 Ga0501044_0061306 3300049823 Bacteria 3848
1678 Ga0501044_0229169 3300049823 Bacteria 1806
1679 Ga0501044_0252189 3300049823 Bacteria 1705
1680 Ga0501044_0265811 3300049823 Bacteria 1653
1681 Ga0501044_0276200 3300049823 Bacteria 1615
1682 Ga0501044_0293978 3300049823 Bacteria 1555
1683 Ga0501044_0395691 3300049823 Bacteria 1295
1684 Ga0501044_0839807 3300049823 Bacteria 796
1685 Ga0501045_0001378 3300049824 Bacteria 16195
1686 Ga0501045_0002554 3300049824 Bacteria 12403
1687 Ga0501045_0004985 3300049824 Bacteria 9200
1688 Ga0501045_0006193 3300049824 Bacteria 8282
1689 Ga0501045_0015682 3300049824 Bacteria 5375
1690 Ga0501045_0074504 3300049824 Bacteria 2499
1691 Ga0501045_0122649 3300049824 Bacteria 1929
1692 Ga0501045_0457910 3300049824 Bacteria 948
1693 Ga0501045_1280276 3300049824 Bacteria 534
1694 Ga0501204_036419 3300049850 Bacteria 704
1695 nmdc:mga05p37_1025064_c1 3300050507 Bacteria 874
1696 nmdc:mga05p37_1843080_c1 3300050507 Bacteria 581
1697 nmdc:mga05p37_234014_c1 3300050507 Bacteria 2212
1698 nmdc:mga05p37_266633_c1 3300050507 Bacteria 2048
1699 nmdc:mga05p37_274883_c1 3300050507 Bacteria 2012
1700 nmdc:mga05p37_31336_c1 3300050507 Bacteria 6495
1701 nmdc:mga05p37_442530_c1 3300050507 Bacteria 1507
1702 nmdc:mga05p37_44731_c1 3300050507 Bacteria 5447
1703 nmdc:mga05p37_45912_c1 3300050507 Bacteria 5373
1704 nmdc:mga05p37_46897_c1 3300050507 Bacteria 5314
1705 nmdc:mga05p37_470239_c1 3300050507 Bacteria 1451
1706 nmdc:mga05p37_48432_c1 3300050507 Bacteria 5227
1707 nmdc:mga05p37_494540_c1 3300050507 Bacteria 1405
1708 nmdc:mga05p37_610222_c1 3300050507 Bacteria 1230
1709 nmdc:mga05p37_715776_c1 3300050507 Bacteria 1110
1710 nmdc:mga09592_126161_c1 3300050508 Bacteria 2200
1711 nmdc:mga09592_22064_c1 3300050508 Bacteria 5253
1712 nmdc:mga09592_239782_c1 3300050508 Bacteria 1571
1713 nmdc:mga09592_346505_c1 3300050508 Bacteria 1286
1714 nmdc:mga09592_3737_c1 3300050508 Bacteria 12270
1715 nmdc:mga09592_529614_c1 3300050508 Bacteria 1013
1716 nmdc:mga09592_633323_c1 3300050508 Bacteria 914
1717 nmdc:mga09592_8476_c1 3300050508 Bacteria 8361
1718 nmdc:mga0qj67_10020_c1 3300050509 Bacteria 7069
1719 nmdc:mga0qj67_10423_c1 3300050509 Bacteria 3359
1720 nmdc:mga0qj67_105762_c1 3300050509 Bacteria 2271
1721 nmdc:mga0qj67_274494_c1 3300050509 Bacteria 1367
1722 nmdc:mga0qj67_404439_c1 3300050509 Bacteria 1102
1723 nmdc:mga0qj67_6046_c1 3300050509 Bacteria 8864
1724 nmdc:mga0qj67_76794_c1 3300050509 Bacteria 2672
1725 nmdc:mga06r32_1087718_c1 3300050510 Bacteria 749
1726 nmdc:mga06r32_1442060_c1 3300050510 Bacteria 630
1727 nmdc:mga06r32_1660298_c1 3300050510 Bacteria 577
1728 nmdc:mga06r32_1867181_c1 3300050510 Bacteria 536
1729 nmdc:mga06r32_1895581_c1 3300050510 Bacteria 531
1730 nmdc:mga06r32_217876_c1 3300050510 Bacteria 1897
1731 nmdc:mga06r32_219545_c1 3300050510 Bacteria 1889
1732 nmdc:mga06r32_305546_c1 3300050510 Bacteria 1576
1733 nmdc:mga06r32_31797_c1 3300050510 Bacteria 4960
1734 nmdc:mga06r32_55228_c1 3300050510 Bacteria 3810
1735 nmdc:mga06r32_89471_c1 3300050510 Bacteria 3006
1736 nmdc:mga06r32_960647_c1 3300050510 Bacteria 809
1737 nmdc:mga08y16_109076_c1 3300050511 Bacteria 2882
1738 nmdc:mga08y16_132269_c1 3300050511 Bacteria 2594
1739 nmdc:mga08y16_1403913_c1 3300050511 Bacteria 661
1740 nmdc:mga08y16_22322_c1 3300050511 Bacteria 6679
1741 nmdc:mga08y16_81047_c1 3300050511 Bacteria 3384
1742 nmdc:mga0n895_1114296_c1 3300050512 Bacteria 766
1743 nmdc:mga0n895_12828_c1 3300050512 Bacteria 7530
1744 nmdc:mga0n895_147262_c1 3300050512 Bacteria 2384
1745 nmdc:mga0n895_1479867_c1 3300050512 Bacteria 646
1746 nmdc:mga0n895_1494677_c1 3300050512 Bacteria 642
1747 nmdc:mga0n895_14961_c1 3300050512 Bacteria 7068
1748 nmdc:mga0n895_152356_c1 3300050512 Bacteria 2343
1749 nmdc:mga0n895_1627178_c1 3300050512 Bacteria 610
1750 nmdc:mga0n895_192299_c1 3300050512 Bacteria 2072
1751 nmdc:mga0n895_249714_c1 3300050512 Bacteria 1800
1752 nmdc:mga0n895_58300_c1 3300050512 Bacteria 3807
1753 nmdc:mga0n895_677263_c1 3300050512 Bacteria 1029
1754 nmdc:mga0n895_8378_c1 3300050512 Bacteria 8949
1755 nmdc:mga0n895_9528_c1 3300050512 Bacteria 8504
1756 nmdc:mga0rr50_10465_c1 3300050513 Bacteria 5887
1757 nmdc:mga0rr50_1067759_c1 3300050513 Bacteria 687
1758 nmdc:mga0rr50_138233_c1 3300050513 Bacteria 1957
1759 nmdc:mga0rr50_15279_c1 3300050513 Bacteria 5064
1760 nmdc:mga0rr50_170708_c1 3300050513 Bacteria 1772
1761 nmdc:mga0rr50_281522_c1 3300050513 Bacteria 1388
1762 nmdc:mga0rr50_32299_c1 3300050513 Bacteria 3729
1763 nmdc:mga0rr50_354826_c1 3300050513 Bacteria 1234
1764 nmdc:mga0rr50_449317_c1 3300050513 Bacteria 1093
1765 nmdc:mga0rr50_451761_c1 3300050513 Bacteria 1089
1766 nmdc:mga0rr50_52987_c1 3300050513 Bacteria 3017
1767 nmdc:mga0rr50_565950_c1 3300050513 Bacteria 968
1768 nmdc:mga0rr50_716631_c1 3300050513 Bacteria 854
1769 nmdc:mga0rr50_732909_c1 3300050513 Bacteria 844
1770 nmdc:mga08x19_1357833_c1 3300050514 Bacteria 503
1771 nmdc:mga08x19_19129_c1 3300050514 Bacteria 4201
1772 nmdc:mga08x19_19755_c1 3300050514 Bacteria 4139
1773 nmdc:mga08x19_212906_c1 3300050514 Bacteria 1327
1774 nmdc:mga08x19_3637_c1 3300050514 Bacteria 9173
1775 nmdc:mga08x19_37562_c1 3300050514 Bacteria 3074
1776 nmdc:mga08x19_48016_c1 3300050514 Bacteria 2734
1777 nmdc:mga08x19_597742_c1 3300050514 Bacteria 782
1778 nmdc:mga0a205_137400_c1 3300050515 Bacteria 2345
1779 nmdc:mga0a205_13792_c1 3300050515 Bacteria 7534
1780 nmdc:mga0a205_154946_c1 3300050515 Bacteria 2190
1781 nmdc:mga0a205_26588_c1 3300050515 Bacteria 2947
1782 nmdc:mga0a205_35256_c1 3300050515 Bacteria 4804
1783 nmdc:mga0a205_454932_c1 3300050515 Bacteria 1140
1784 nmdc:mga0a205_5197_c1 3300050515 Bacteria 11711
1785 nmdc:mga0a205_75368_c1 3300050515 Bacteria 3260
1786 nmdc:mga0a205_795721_c1 3300050515 Bacteria 793
1787 nmdc:mga0a205_835075_c1 3300050515 Bacteria 769
1788 nmdc:mga0a205_994920_c1 3300050515 Bacteria 685
1789 nmdc:mga0sz30_188368_c1 3300050516 Bacteria 916
1790 nmdc:mga0sz30_288005_c1 3300050516 Bacteria 732
1791 Ga0495601_0005535 3300053077 Bacteria 7368
1792 Ga0495601_0010480 3300053077 Bacteria 5518
1793 Ga0495601_0160426 3300053077 Bacteria 1469
1794 Ga0495601_0282131 3300053077 Bacteria 1083
1795 Ga0495601_0326856 3300053077 Bacteria 998
1796 Ga0495601_0473132 3300053077 Bacteria 810
1797 Ga0495612_0002431 3300053078 Bacteria 7674
1798 Ga0495612_0040570 3300053078 Bacteria 1897
1799 Ga0495612_0053247 3300053078 Bacteria 1666
1800 Ga0495655_0121314 3300053083 Bacteria 796
1801 Ga0495595_0013597 3300053084 Bacteria 3441
1802 Ga0495595_0021231 3300053084 Bacteria 2835
1803 Ga0495595_0051341 3300053084 Bacteria 1911
1804 Ga0495595_0454418 3300053084 Bacteria 651
1805 Ga0495619_0002005 3300053085 Bacteria 13547
1806 Ga0495619_0152126 3300053085 Bacteria 1596
1807 Ga0495619_0211018 3300053085 Bacteria 1345
1808 Ga0495619_0359888 3300053085 Bacteria 1006
1809 Ga0500643_002091 3300053087 Bacteria 10629
1810 Ga0500583_0204545 3300053092 Bacteria 981
1811 Ga0500650_0065980 3300053098 Bacteria 1691
1812 Ga0500650_0217502 3300053098 Bacteria 866
1813 Ga0500608_254793 3300053122 Bacteria 682
1814 Ga0500652_028766 3300053131 Bacteria 2162
1815 Ga0500655_039637 3300053133 Bacteria 922
1816 Ga0500658_0026465 3300053134 Bacteria 2235
1817 Ga0500627_0110725 3300053158 Bacteria 1236
1818 Ga0500633_0174392 3300053160 Bacteria 807
1819 Ga0500645_000070 3300053730 Bacteria 79917
1820 Ga0501084_0000009 3300054114 Bacteria 194961
1821 Ga0501084_0003886 3300054114 Bacteria 12158
1822 Ga0501084_0003942 3300054114 Bacteria 12089
1823 Ga0501084_0012777 3300054114 Bacteria 6958
1824 Ga0501084_0083291 3300054114 Bacteria 2684
1825 Ga0501084_0186706 3300054114 Bacteria 1749
1826 Ga0501084_0250453 3300054114 Bacteria 1495
1827 Ga0501084_0250987 3300054114 Bacteria 1493
1828 Ga0501084_0495240 3300054114 Bacteria 1033
1829 Ga0501084_1292704 3300054114 Bacteria 611
1830 Ga0501084_1293896 3300054114 Bacteria 611
1831 Ga0501084_1324584 3300054114 Bacteria 603
1832 Ga0590071_004749 3300059421 Bacteria 3280
1833 Ga0590075_003144 3300059424 Bacteria 3925
1834 Ga0590077_002501 3300059426 Bacteria 3907
1835 Ga0590077_022239 3300059426 Bacteria 1352
1836 Ga0587066_122310 3300059490 Bacteria 616
1837 Ga0587070_091756 3300059491 Bacteria 684
1838 Ga0587070_136859 3300059491 Bacteria 601
1839 Ga0587077_115603 3300059493 Bacteria 663
1840 Ga0587077_219018 3300059493 Bacteria 536
1841 Ga0587082_106057 3300059504 Bacteria 618
1842 Ga0587083_0079311 3300059505 Bacteria 779
1843 Ga0587085_132017 3300059506 Bacteria 559
1844 Ga0587088_137752 3300059508 Bacteria 580
1845 Ga0587090_070001 3300059510 Bacteria 683
1846 Ga0587091_071618 3300059511 Bacteria 760
1847 Ga0587091_181236 3300059511 Bacteria 554
1848 Ga0587098_064366 3300059604 Bacteria 582
1849 Ga0587098_094055 3300059604 Bacteria 515
1850 Ga0587101_050275 3300059623 Bacteria 716
1851 Ga0587101_071219 3300059623 Bacteria 641
1852 Ga0587101_076512 3300059623 Bacteria 626
1853 Ga0587113_010237 3300059625 Bacteria 862
1854 Ga0587122_014535 3300059628 Bacteria 795
1855 Ga0587122_033441 3300059628 Bacteria 614
1856 Ga0587062_035223 3300059639 Bacteria 787
1857 Ga0587062_059407 3300059639 Bacteria 667
1858 Ga0587062_060562 3300059639 Bacteria 663
1859 Ga0587067_012048 3300059640 Bacteria 1344
1860 Ga0587067_022101 3300059640 Bacteria 1104
1861 Ga0587067_101363 3300059640 Bacteria 667
1862 Ga0587079_115942 3300059647 Bacteria 657
1863 Ga0587107_042448 3300059652 Bacteria 741
1864 Ga0587107_104788 3300059652 Bacteria 564
1865 Ga0587114_005366 3300059655 Bacteria 1383
1866 Ga0587120_019482 3300059659 Bacteria 637
1867 Ga0587111_0014126 3300060346 Bacteria 1439
1868 Ga0587111_0073985 3300060346 Bacteria 801
1869 Ga0587111_0089905 3300060346 Bacteria 748
1870 Ga0501082_0006562 3300060353 Bacteria 10079
1871 Ga0501082_0010897 3300060353 Bacteria 7824
1872 Ga0501082_0069733 3300060353 Bacteria 3027
1873 Ga0501082_0086596 3300060353 Bacteria 2702
1874 Ga0501082_0101442 3300060353 Bacteria 2489
1875 Ga0501082_0105315 3300060353 Bacteria 2440
1876 Ga0501082_0193646 3300060353 Bacteria 1768
1877 Ga0501082_0226942 3300060353 Bacteria 1625
1878 Ga0501082_0505575 3300060353 Bacteria 1056
1879 Ga0501082_1036168 3300060353 Bacteria 717
1880 Ga0501082_1190962 3300060353 Bacteria 666
1881 Ga0466962_0393360 3300061719 Bacteria 693
1882 Ga0530510_0000341 3300061734 Bacteria 30065
1883 Ga0530510_0004004 3300061734 Bacteria 10175
1884 Ga0530510_0004196 3300061734 Bacteria 9958
1885 Ga0530510_0007767 3300061734 Bacteria 7474
1886 Ga0530510_0026128 3300061734 Bacteria 4176
1887 Ga0530510_0033355 3300061734 Bacteria 3707
1888 Ga0530510_0055814 3300061734 Bacteria 2853
1889 Ga0530510_0062342 3300061734 Bacteria 2699
1890 Ga0530510_0074871 3300061734 Bacteria 2458
1891 Ga0530510_0136437 3300061734 Bacteria 1806
1892 Ga0530510_0148544 3300061734 Bacteria 1729
1893 Ga0530510_0615371 3300061734 Bacteria 826
1894 Ga0530510_0927871 3300061734 Bacteria 665

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300039453 Ga0436362_1118696 Ga0436362_1118696_33_428 131
2 3300049568 Ga0501031_0066123 Ga0501031_0066123_988_1383 131
3 3300049568 Ga0501031_0277550 Ga0501031_0277550_458_853 131
4 3300049569 Ga0501032_0083119 Ga0501032_0083119_499_894 131
5 3300049570 Ga0501033_0282560 Ga0501033_0282560_210_605 131
6 3300049571 Ga0501034_0833795 Ga0501034_0833795_140_535 131
7 3300049572 Ga0501036_0046523 Ga0501036_0046523_185_580 131
8 3300049572 Ga0501036_0344068 Ga0501036_0344068_167_562 131
9 3300049574 Ga0501038_0695344 Ga0501038_0695344_162_557 131
10 3300049574 Ga0501038_0720260 Ga0501038_0720260_299_694 131
11 3300049575 Ga0501039_0060778 Ga0501039_0060778_367_762 131
12 3300049575 Ga0501039_0060832 Ga0501039_0060832_151_546 131
13 3300049575 Ga0501039_0125604 Ga0501039_0125604_1228_1623 131
14 3300049576 Ga0501040_0009617 Ga0501040_0009617_5166_5561 131
15 3300049576 Ga0501040_0120646 Ga0501040_0120646_1344_1739 131
16 3300049576 Ga0501040_0200046 Ga0501040_0200046_211_606 131
17 3300049577 Ga0501041_0023634 Ga0501041_0023634_823_1218 131
18 3300049577 Ga0501041_0035788 Ga0501041_0035788_1272_1667 131
19 3300049578 Ga0501042_0031630 Ga0501042_0031630_2311_2706 131
20 3300049578 Ga0501042_0138397 Ga0501042_0138397_405_800 131
21 3300049580 Ga0501046_0052130 Ga0501046_0052130_520_915 131
22 3300049580 Ga0501046_0225394 Ga0501046_0225394_578_973 131
23 3300049582 Ga0501048_0059842 Ga0501048_0059842_1621_2016 131
24 3300049582 Ga0501048_0087331 Ga0501048_0087331_1195_1590 131
25 3300049584 Ga0501068_0072778 Ga0501068_0072778_1339_1734 131
26 3300049584 Ga0501068_0280653 Ga0501068_0280653_171_566 131
27 3300049586 Ga0501070_0236432 Ga0501070_0236432_641_1036 131
28 3300049586 Ga0501070_0612446 Ga0501070_0612446_69_464 131
29 3300049586 Ga0501070_0687074 Ga0501070_0687074_392_787 131
30 3300049587 Ga0501071_0020646 Ga0501071_0020646_869_1264 131
31 3300049587 Ga0501071_0024088 Ga0501071_0024088_3748_4143 131
32 3300049587 Ga0501071_0378283 Ga0501071_0378283_120_515 131
33 3300049587 Ga0501071_0881962 Ga0501071_0881962_214_609 131
34 3300049588 Ga0501072_0019683 Ga0501072_0019683_181_576 131
35 3300049588 Ga0501072_0051493 Ga0501072_0051493_2618_3013 131
36 3300049588 Ga0501072_0199727 Ga0501072_0199727_1064_1459 131
37 3300049588 Ga0501072_0430505 Ga0501072_0430505_578_973 131
38 3300049589 Ga0501073_0127352 Ga0501073_0127352_1093_1488 131
39 3300049591 Ga0501075_0004184 Ga0501075_0004184_678_1073 131
40 3300049591 Ga0501075_0045343 Ga0501075_0045343_2865_3260 131
41 3300049591 Ga0501075_0389350 Ga0501075_0389350_600_995 131
42 3300049591 Ga0501075_0971013 Ga0501075_0971013_23_418 131
43 3300049591 Ga0501075_1312171 Ga0501075_1312171_28_423 131
44 3300049592 Ga0501076_0016133 Ga0501076_0016133_1205_1600 131
45 3300049592 Ga0501076_0173364 Ga0501076_0173364_1208_1603 131
46 3300049592 Ga0501076_0609828 Ga0501076_0609828_184_579 131
47 3300049593 Ga0501077_0056234 Ga0501077_0056234_972_1367 131
48 3300049593 Ga0501077_0743492 Ga0501077_0743492_174_569 131
49 3300049741 Ga0501079_0041579 Ga0501079_0041579_98_493 131
50 3300049741 Ga0501079_0043465 Ga0501079_0043465_2681_3076 131
51 3300049742 Ga0501080_0912404 Ga0501080_0912404_172_567 131
52 3300049743 Ga0501081_0060364 Ga0501081_0060364_1116_1511 131
53 3300049743 Ga0501081_0187411 Ga0501081_0187411_673_1068 131
54 3300049744 Ga0501083_0151522 Ga0501083_0151522_49_444 131
55 3300049822 Ga0501035_0023765 Ga0501035_0023765_1859_2254 131
56 3300049822 Ga0501035_0566271 Ga0501035_0566271_198_593 131
57 3300049823 Ga0501044_0276200 Ga0501044_0276200_820_1215 131
58 3300049824 Ga0501045_0004985 Ga0501045_0004985_103_498 131
59 3300049824 Ga0501045_0074504 Ga0501045_0074504_1226_1621 131
60 3300054114 Ga0501084_0186706 Ga0501084_0186706_1153_1548 131
61 3300054114 Ga0501084_0250453 Ga0501084_0250453_1005_1400 131
62 3300054114 Ga0501084_1292704 Ga0501084_1292704_147_542 131
63 3300060353 Ga0501082_0101442 Ga0501082_0101442_1020_1415 131
64 3300060353 Ga0501082_0226942 Ga0501082_0226942_451_846 131
65 3300061734 Ga0530510_0004196 Ga0530510_0004196_7939_8334 131
66 3300061734 Ga0530510_0062342 Ga0530510_0062342_984_1379 131
67 3300061734 Ga0530510_0136437 Ga0530510_0136437_447_842 131
68 3300061734 Ga0530510_0615371 Ga0530510_0615371_100_495 131
69 3300041405 Ga0439438_107603 Ga0439438_107603_159_560 133
70 3300048910 Ga0496107_0004748 Ga0496107_0004748_3793_4200 133
71 3300048911 Ga0496108_0985610 Ga0496108_0985610_140_541 133
72 3300049690 Ga0501261_130944 Ga0501261_130944_11_412 133
73 3300049703 Ga0501219_014439 Ga0501219_014439_215_616 133
74 3300005406 Ga0070703_10026932 Ga0070703_100269321 134
75 3300005444 Ga0070694_100132303 Ga0070694_1001323032 134
76 3300005445 Ga0070708_100349465 Ga0070708_1003494651 134
77 3300005468 Ga0070707_100165308 Ga0070707_1001653082 134
78 3300005471 Ga0070698_100026998 Ga0070698_1000269988 134
79 3300005471 Ga0070698_100286489 Ga0070698_1002864892 134
80 3300005545 Ga0070695_100032559 Ga0070695_1000325594 134
81 3300006852 Ga0075433_10094593 Ga0075433_100945933 134
82 3300006871 Ga0075434_100092666 Ga0075434_1000926664 134
83 3300006914 Ga0075436_100331600 Ga0075436_1003316002 134
84 3300007076 Ga0075435_100097713 Ga0075435_1000977135 134
85 3300009147 Ga0114129_10627820 Ga0114129_106278202 134
86 3300021377 Ga0213874_10091578 Ga0213874_100915782 134
87 3300025910 Ga0207684_10004838 Ga0207684_100048384 134
88 3300025922 Ga0207646_10015031 Ga0207646_100150315 134
89 3300042118 Ga0450914_000751 Ga0450914_000751_614_1018 134
90 3300042136 Ga0450900_003053 Ga0450900_003053_1281_1685 134
91 3300042142 Ga0450905_003023 Ga0450905_003023_325_729 134
92 3300042993 Ga0439440_0067953 Ga0439440_0067953_249_653 134
93 3300046475 Ga0495639_0750421 Ga0495639_0750421_83_487 134
94 3300046523 Ga0495644_0441777 Ga0495644_0441777_37_441 134
95 3300046529 Ga0495652_0382753 Ga0495652_0382753_309_713 134
96 3300053078 Ga0495612_0053247 Ga0495612_0053247_942_1346 134
97 3300049579 Ga0501043_0058382 Ga0501043_0058382_1743_2150 135
98 3300009147 Ga0114129_11768075 Ga0114129_117680751 136
99 3300042012 Ga0439455_0106410 Ga0439455_0106410_50_460 136
100 3300042139 Ga0450904_016776 Ga0450904_016776_286_696 136
101 3300042993 Ga0439440_0293521 Ga0439440_0293521_67_477 136
102 3300049129 Ga0501309_013405 Ga0501309_013405_613_1023 136
103 3300009094 Ga0111539_10096064 Ga0111539_100960642 137
104 3300009147 Ga0114129_11044798 Ga0114129_110447982 137
105 3300009553 Ga0105249_10013251 Ga0105249_100132516 137
106 3300013306 Ga0163162_10007855 Ga0163162_100078555 137
107 3300014497 Ga0182008_10065445 Ga0182008_100654452 137
108 3300036647 Ga0316582_0028844 Ga0316582_0028844_1454_1867 137
109 3300037312 Ga0395899_0280869 Ga0395899_0280869_52_465 137
110 3300037418 Ga0395900_0150764 Ga0395900_0150764_1848_2261 137
111 3300037466 Ga0395898_0690694 Ga0395898_0690694_88_501 137
112 3300037588 Ga0316581_0030215 Ga0316581_0030215_442_855 137
113 3300038443 Ga0395901_0200790 Ga0395901_0200790_1654_2067 137
114 3300042001 Ga0439441_149482 Ga0439441_149482_74_487 137
115 3300042002 Ga0439442_161100 Ga0439442_161100_62_475 137
116 3300042005 Ga0439448_0012389 Ga0439448_0012389_1005_1418 137
117 3300042005 Ga0439448_0173067 Ga0439448_0173067_85_498 137
118 3300042008 Ga0439450_019148 Ga0439450_019148_566_979 137
119 3300042009 Ga0439451_009247 Ga0439451_009247_576_989 137
120 3300042011 Ga0439454_005732 Ga0439454_005732_654_1067 137
121 3300042016 Ga0439463_122070 Ga0439463_122070_240_653 137
122 3300042119 Ga0450915_000008 Ga0450915_000008_3016_3429 137
123 3300042120 Ga0450917_004208 Ga0450917_004208_37_450 137
124 3300042126 Ga0450888_002932 Ga0450888_002932_958_1371 137
125 3300042144 Ga0450889_008228 Ga0450889_008228_592_1005 137
126 3300042157 Ga0439458_0065758 Ga0439458_0065758_395_808 137
127 3300042437 Ga0439444_0004033 Ga0439444_0004033_1500_1913 137
128 3300042437 Ga0439444_0023649 Ga0439444_0023649_537_950 137
129 3300042439 Ga0439464_0014637 Ga0439464_0014637_1605_2018 137
130 3300042439 Ga0439464_0224051 Ga0439464_0224051_75_488 137
131 3300042461 Ga0439460_0010988 Ga0439460_0010988_1563_1976 137
132 3300042530 Ga0450916_002658 Ga0450916_002658_255_668 137
133 3300046492 Ga0495585_0048729 Ga0495585_0048729_1418_1831 137
134 3300046501 Ga0495607_0174949 Ga0495607_0174949_468_881 137
135 3300046513 Ga0495616_0130693 Ga0495616_0130693_149_562 137
136 3300046515 Ga0495620_0156619 Ga0495620_0156619_125_538 137
137 3300046518 Ga0495631_0143306 Ga0495631_0143306_36_449 137
138 3300046519 Ga0495632_0340655 Ga0495632_0340655_86_499 137
139 3300046523 Ga0495644_0068577 Ga0495644_0068577_678_1091 137
140 3300046525 Ga0495663_0018918 Ga0495663_0018918_53_466 137
141 3300046528 Ga0495642_0129926 Ga0495642_0129926_57_470 137
142 3300046537 Ga0495598_0020160 Ga0495598_0020160_1219_1632 137
143 3300046538 Ga0495609_0302209 Ga0495609_0302209_224_637 137
144 3300046558 Ga0495633_0270764 Ga0495633_0270764_28_441 137
145 3300046615 Ga0495656_0002926 Ga0495656_0002926_3815_4228 137
146 3300046665 Ga0495661_0189063 Ga0495661_0189063_511_924 137
147 3300046684 Ga0495669_0070627 Ga0495669_0070627_435_848 137
148 3300046810 Ga0495660_0216722 Ga0495660_0216722_367_780 137
149 3300047318 Ga0495636_0192655 Ga0495636_0192655_248_661 137
150 3300047320 Ga0495672_0346024 Ga0495672_0346024_206_619 137
151 3300047445 Ga0495677_0274420 Ga0495677_0274420_68_481 137
152 3300047447 Ga0495685_122019 Ga0495685_122019_10_423 137
153 3300048914 Ga0496111_0531005 Ga0496111_0531005_442_855 137
154 3300049537 Ga0501321_051028 Ga0501321_051028_97_510 137
155 3300049568 Ga0501031_0061151 Ga0501031_0061151_1807_2220 137
156 3300049570 Ga0501033_0028569 Ga0501033_0028569_3221_3634 137
157 3300049571 Ga0501034_0245211 Ga0501034_0245211_333_746 137
158 3300049572 Ga0501036_0012215 Ga0501036_0012215_4899_5312 137
159 3300049572 Ga0501036_0375011 Ga0501036_0375011_154_567 137
160 3300049574 Ga0501038_0009257 Ga0501038_0009257_7335_7748 137
161 3300049576 Ga0501040_0003784 Ga0501040_0003784_7768_8181 137
162 3300049576 Ga0501040_0028522 Ga0501040_0028522_855_1268 137
163 3300049576 Ga0501040_0089189 Ga0501040_0089189_407_820 137
164 3300049577 Ga0501041_0011476 Ga0501041_0011476_336_749 137
165 3300049578 Ga0501042_0003469 Ga0501042_0003469_4524_4937 137
166 3300049578 Ga0501042_0013489 Ga0501042_0013489_137_550 137
167 3300049579 Ga0501043_0447893 Ga0501043_0447893_300_713 137
168 3300049582 Ga0501048_0003376 Ga0501048_0003376_4698_5111 137
169 3300049582 Ga0501048_0345340 Ga0501048_0345340_549_962 137
170 3300049586 Ga0501070_1219759 Ga0501070_1219759_123_536 137
171 3300049587 Ga0501071_0004023 Ga0501071_0004023_1163_1576 137
172 3300049587 Ga0501071_0165480 Ga0501071_0165480_411_824 137
173 3300049588 Ga0501072_0002349 Ga0501072_0002349_6012_6425 137
174 3300049589 Ga0501073_0111878 Ga0501073_0111878_791_1204 137
175 3300049590 Ga0501074_0009286 Ga0501074_0009286_1817_2230 137
176 3300049590 Ga0501074_0010727 Ga0501074_0010727_182_595 137
177 3300049591 Ga0501075_0010315 Ga0501075_0010315_1998_2411 137
178 3300049592 Ga0501076_0002305 Ga0501076_0002305_4883_5296 137
179 3300049592 Ga0501076_0013698 Ga0501076_0013698_5605_6018 137
180 3300049592 Ga0501076_0058485 Ga0501076_0058485_2104_2517 137
181 3300049593 Ga0501077_0006476 Ga0501077_0006476_1104_1517 137
182 3300049593 Ga0501077_0048103 Ga0501077_0048103_127_540 137
183 3300049741 Ga0501079_0002888 Ga0501079_0002888_1622_2035 137
184 3300049741 Ga0501079_0005094 Ga0501079_0005094_4987_5400 137
185 3300049741 Ga0501079_1336001 Ga0501079_1336001_118_531 137
186 3300049742 Ga0501080_0124172 Ga0501080_0124172_210_623 137
187 3300049743 Ga0501081_0004119 Ga0501081_0004119_7743_8156 137
188 3300049744 Ga0501083_0074335 Ga0501083_0074335_1233_1646 137
189 3300049822 Ga0501035_0143156 Ga0501035_0143156_996_1409 137
190 3300049822 Ga0501035_0565227 Ga0501035_0565227_210_623 137
191 3300049822 Ga0501035_0757723 Ga0501035_0757723_183_596 137
192 3300049823 Ga0501044_0229169 Ga0501044_0229169_1043_1456 137
193 3300049824 Ga0501045_0002554 Ga0501045_0002554_7007_7420 137
194 3300049824 Ga0501045_0006193 Ga0501045_0006193_89_502 137
195 3300050507 nmdc:mga05p37_45912_c1 nmdc:mga05p37_45912_c1_1611_2024 137
196 3300050508 nmdc:mga09592_3737_c1 nmdc:mga09592_3737_c1_1593_2006 137
197 3300050509 nmdc:mga0qj67_6046_c1 nmdc:mga0qj67_6046_c1_1805_2218 137
198 3300050510 nmdc:mga06r32_219545_c1 nmdc:mga06r32_219545_c1_25_438 137
199 3300050510 nmdc:mga06r32_55228_c1 nmdc:mga06r32_55228_c1_1593_2006 137
200 3300050511 nmdc:mga08y16_132269_c1 nmdc:mga08y16_132269_c1_347_760 137
201 3300050512 nmdc:mga0n895_14961_c1 nmdc:mga0n895_14961_c1_6230_6643 137
202 3300050515 nmdc:mga0a205_137400_c1 nmdc:mga0a205_137400_c1_1844_2257 137
203 3300050515 nmdc:mga0a205_26588_c1 nmdc:mga0a205_26588_c1_2060_2473 137
204 3300054114 Ga0501084_0003942 Ga0501084_0003942_7731_8144 137
205 3300054114 Ga0501084_0012777 Ga0501084_0012777_4058_4471 137
206 3300054114 Ga0501084_1293896 Ga0501084_1293896_13_426 137
207 3300060353 Ga0501082_0006562 Ga0501082_0006562_4710_5123 137
208 3300060353 Ga0501082_0010897 Ga0501082_0010897_7322_7735 137
209 3300061734 Ga0530510_0000341 Ga0530510_0000341_8359_8772 137
210 3300061734 Ga0530510_0055814 Ga0530510_0055814_1815_2228 137
211 iso_pu_bacteria 2684623219 2687236057 137
212 3300049568 Ga0501031_0114079 Ga0501031_0114079_871_1362 138
213 iso_pu_bacteria 2902799365 2902802902 138
214 iso_pu_bacteria 8053945823 8053948611 138
215 3300005468 Ga0070707_100028509 Ga0070707_1000285095 139
216 3300005471 Ga0070698_100225212 Ga0070698_1002252122 139
217 3300006871 Ga0075434_101271735 Ga0075434_1012717352 139
218 3300006914 Ga0075436_100456339 Ga0075436_1004563392 139
219 3300007076 Ga0075435_100583219 Ga0075435_1005832191 139
220 3300025922 Ga0207646_10021741 Ga0207646_100217415 139
221 3300025922 Ga0207646_10115472 Ga0207646_101154722 139
222 3300050512 nmdc:mga0n895_1494677_c1 nmdc:mga0n895_1494677_c1_160_585 139
223 3300050513 nmdc:mga0rr50_565950_c1 nmdc:mga0rr50_565950_c1_522_947 139
224 3300059493 Ga0587077_219018 Ga0587077_219018_95_520 139
225 iso_pu_bacteria 2622736626 2623585060 139
226 iso_pu_bacteria 2675903060 2676489966 139
227 iso_pu_bacteria 2738541264 2738664173 139
228 iso_pu_bacteria 2738541274 2738704674 139
229 iso_pu_bacteria 2738541356 2739143308 139
230 iso_pu_bacteria 2738543028 2739329838 139
231 iso_pu_bacteria 2873314349 2873314356 139
232 iso_pu_bacteria 3002998708 3003000693 139
233 iso_pu_bacteria 8055066027 8055071213 139
234 iso_pu_bacteria 8055172936 8055180842 139
235 3300005365 Ga0070688_100157639 Ga0070688_1001576393 140
236 3300005467 Ga0070706_100000384 Ga0070706_1000003846 140
237 3300005471 Ga0070698_100049234 Ga0070698_1000492345 140
238 3300005546 Ga0070696_101470010 Ga0070696_1014700101 140
239 3300005617 Ga0068859_100123839 Ga0068859_1001238396 140
240 3300005719 Ga0068861_100182233 Ga0068861_1001822332 140
241 3300006931 Ga0097620_100123841 Ga0097620_1001238416 140
242 3300007076 Ga0075435_100771644 Ga0075435_1007716442 140
243 3300009093 Ga0105240_10049596 Ga0105240_100495968 140
244 3300009148 Ga0105243_12598829 Ga0105243_125988291 140
245 3300009176 Ga0105242_10124771 Ga0105242_101247713 140
246 3300013104 Ga0157370_10791557 Ga0157370_107915571 140
247 3300013296 Ga0157374_11097351 Ga0157374_110973511 140
248 3300021358 Ga0213873_10049825 Ga0213873_100498252 140
249 3300025910 Ga0207684_10015502 Ga0207684_100155027 140
250 3300025928 Ga0207700_10381332 Ga0207700_103813322 140
251 3300025929 Ga0207664_10075920 Ga0207664_100759204 140
252 3300031691 Ga0316579_10072706 Ga0316579_100727062 140
253 3300031733 Ga0316577_10009141 Ga0316577_100091415 140
254 3300032168 Ga0316593_10007076 Ga0316593_100070762 140
255 3300032168 Ga0316593_10353465 Ga0316593_103534651 140
256 3300032168 Ga0316593_10448036 Ga0316593_104480361 140
257 3300039438 Ga0436360_0293201 Ga0436360_0293201_83_505 140
258 3300039450 Ga0436363_1494339 Ga0436363_1494339_169_591 140
259 3300042876 Ga0451577_0103378 Ga0451577_0103378_1700_2122 140
260 3300044673 Ga0453683_0009543 Ga0453683_0009543_1531_1953 140
261 3300044712 Ga0453684_0000746 Ga0453684_0000746_30741_31163 140
262 3300044712 Ga0453684_0006838 Ga0453684_0006838_12081_12503 140
263 3300044712 Ga0453684_0007721 Ga0453684_0007721_15114_15536 140
264 3300044735 Ga0466968_0269739 Ga0466968_0269739_63_485 140
265 3300046516 Ga0495628_0569686 Ga0495628_0569686_353_775 140
266 3300046517 Ga0495630_0985566 Ga0495630_0985566_204_626 140
267 3300046529 Ga0495652_0396514 Ga0495652_0396514_539_961 140
268 3300046680 Ga0495646_0389156 Ga0495646_0389156_167_589 140
269 3300047322 Ga0495680_0294859 Ga0495680_0294859_638_1060 140
270 3300048088 Ga0495602_0501917 Ga0495602_0501917_61_483 140
271 3300050513 nmdc:mga0rr50_451761_c1 nmdc:mga0rr50_451761_c1_497_979 140
272 3300059604 Ga0587098_064366 Ga0587098_064366_101_529 140
273 3300059623 Ga0587101_071219 Ga0587101_071219_57_482 140
274 iso_pu_bacteria 2547132424 2548699210 140
275 iso_pu_bacteria 2919713450 2919717158 140
276 3300003316 rootH1_10143336 rootH1_101433362 141
277 3300003373 JGI25407J50210_10017081 JGI25407J50210_100170812 141
278 3300003792 Ga0055540_1000243 Ga0055540_100024332 141
279 3300003911 JGI25405J52794_10019214 JGI25405J52794_100192142 141
280 3300004798 Ga0058859_10014036 Ga0058859_100140361 141
281 3300004799 Ga0058863_11935938 Ga0058863_119359381 141
282 3300004799 Ga0058863_11950030 Ga0058863_119500302 141
283 3300004800 Ga0058861_10023301 Ga0058861_100233013 141
284 3300004800 Ga0058861_12021382 Ga0058861_120213822 141
285 3300004801 Ga0058860_10073518 Ga0058860_100735185 141
286 3300004801 Ga0058860_12135301 Ga0058860_121353011 141
287 3300004803 Ga0058862_10101869 Ga0058862_101018695 141
288 3300004803 Ga0058862_10126566 Ga0058862_101265664 141
289 3300004803 Ga0058862_12490756 Ga0058862_124907563 141
290 3300005289 Ga0065704_10071230 Ga0065704_100712303 141
291 3300005295 Ga0065707_10409817 Ga0065707_104098172 141
292 3300005329 Ga0070683_100011704 Ga0070683_1000117045 141
293 3300005329 Ga0070683_100026360 Ga0070683_1000263605 141
294 3300005329 Ga0070683_100198608 Ga0070683_1001986083 141
295 3300005329 Ga0070683_100293815 Ga0070683_1002938152 141
296 3300005329 Ga0070683_100791674 Ga0070683_1007916741 141
297 3300005330 Ga0070690_100034485 Ga0070690_1000344856 141
298 3300005333 Ga0070677_10492967 Ga0070677_104929672 141
299 3300005334 Ga0068869_101239048 Ga0068869_1012390481 141
300 3300005335 Ga0070666_10013777 Ga0070666_100137772 141
301 3300005335 Ga0070666_10387561 Ga0070666_103875612 141
302 3300005336 Ga0070680_100015218 Ga0070680_1000152185 141
303 3300005336 Ga0070680_100042259 Ga0070680_1000422594 141
304 3300005336 Ga0070680_100047518 Ga0070680_1000475183 141
305 3300005336 Ga0070680_100076658 Ga0070680_1000766582 141
306 3300005336 Ga0070680_100116264 Ga0070680_1001162642 141
307 3300005336 Ga0070680_100315205 Ga0070680_1003152052 141
308 3300005336 Ga0070680_100580707 Ga0070680_1005807072 141
309 3300005336 Ga0070680_101670268 Ga0070680_1016702681 141
310 3300005337 Ga0070682_100083447 Ga0070682_1000834472 141
311 3300005337 Ga0070682_100249664 Ga0070682_1002496642 141
312 3300005337 Ga0070682_100300196 Ga0070682_1003001962 141
313 3300005337 Ga0070682_100645906 Ga0070682_1006459062 141
314 3300005338 Ga0068868_100251446 Ga0068868_1002514462 141
315 3300005339 Ga0070660_100152796 Ga0070660_1001527961 141
316 3300005339 Ga0070660_100154658 Ga0070660_1001546581 141
317 3300005340 Ga0070689_101134405 Ga0070689_1011344052 141
318 3300005341 Ga0070691_10122346 Ga0070691_101223462 141
319 3300005343 Ga0070687_100467198 Ga0070687_1004671982 141
320 3300005344 Ga0070661_100015324 Ga0070661_1000153245 141
321 3300005344 Ga0070661_100021563 Ga0070661_1000215634 141
322 3300005344 Ga0070661_100570075 Ga0070661_1005700752 141
323 3300005344 Ga0070661_100752750 Ga0070661_1007527502 141
324 3300005345 Ga0070692_10264294 Ga0070692_102642942 141
325 3300005345 Ga0070692_10550806 Ga0070692_105508062 141
326 3300005355 Ga0070671_100756732 Ga0070671_1007567322 141
327 3300005365 Ga0070688_101222746 Ga0070688_1012227461 141
328 3300005366 Ga0070659_100271280 Ga0070659_1002712802 141
329 3300005366 Ga0070659_100360731 Ga0070659_1003607312 141
330 3300005366 Ga0070659_100582553 Ga0070659_1005825532 141
331 3300005367 Ga0070667_100000544 Ga0070667_1000005442 141
332 3300005406 Ga0070703_10000983 Ga0070703_100009834 141
333 3300005406 Ga0070703_10007641 Ga0070703_100076413 141
334 3300005406 Ga0070703_10168997 Ga0070703_101689971 141
335 3300005434 Ga0070709_10043405 Ga0070709_100434053 141
336 3300005434 Ga0070709_10069991 Ga0070709_100699914 141
337 3300005434 Ga0070709_10071663 Ga0070709_100716633 141
338 3300005434 Ga0070709_10094749 Ga0070709_100947492 141
339 3300005435 Ga0070714_100022383 Ga0070714_1000223832 141
340 3300005435 Ga0070714_100075107 Ga0070714_1000751074 141
341 3300005435 Ga0070714_100120880 Ga0070714_1001208804 141
342 3300005435 Ga0070714_100185204 Ga0070714_1001852043 141
343 3300005436 Ga0070713_100005886 Ga0070713_1000058865 141
344 3300005436 Ga0070713_100053385 Ga0070713_1000533855 141
345 3300005436 Ga0070713_100136965 Ga0070713_1001369652 141
346 3300005436 Ga0070713_100190131 Ga0070713_1001901312 141
347 3300005438 Ga0070701_10003620 Ga0070701_100036205 141
348 3300005439 Ga0070711_100000917 Ga0070711_1000009179 141
349 3300005439 Ga0070711_100016949 Ga0070711_1000169495 141
350 3300005439 Ga0070711_100212888 Ga0070711_1002128882 141
351 3300005439 Ga0070711_100254630 Ga0070711_1002546302 141
352 3300005440 Ga0070705_100011364 Ga0070705_1000113645 141
353 3300005440 Ga0070705_100056282 Ga0070705_1000562822 141
354 3300005440 Ga0070705_100286614 Ga0070705_1002866142 141
355 3300005440 Ga0070705_100436821 Ga0070705_1004368212 141
356 3300005440 Ga0070705_101040521 Ga0070705_1010405212 141
357 3300005441 Ga0070700_100178251 Ga0070700_1001782513 141
358 3300005441 Ga0070700_100520580 Ga0070700_1005205802 141
359 3300005441 Ga0070700_101035486 Ga0070700_1010354861 141
360 3300005444 Ga0070694_100015237 Ga0070694_1000152375 141
361 3300005444 Ga0070694_100038193 Ga0070694_1000381934 141
362 3300005444 Ga0070694_100046524 Ga0070694_1000465243 141
363 3300005444 Ga0070694_100058269 Ga0070694_1000582692 141
364 3300005444 Ga0070694_100137976 Ga0070694_1001379762 141
365 3300005444 Ga0070694_100225175 Ga0070694_1002251752 141
366 3300005444 Ga0070694_100252121 Ga0070694_1002521212 141
367 3300005444 Ga0070694_100667555 Ga0070694_1006675551 141
368 3300005444 Ga0070694_100983382 Ga0070694_1009833821 141
369 3300005445 Ga0070708_100000449 Ga0070708_10000044912 141
370 3300005445 Ga0070708_100010715 Ga0070708_1000107155 141
371 3300005445 Ga0070708_100051089 Ga0070708_1000510896 141
372 3300005445 Ga0070708_100051683 Ga0070708_1000516832 141
373 3300005445 Ga0070708_100052256 Ga0070708_1000522565 141
374 3300005445 Ga0070708_100530943 Ga0070708_1005309432 141
375 3300005445 Ga0070708_100590627 Ga0070708_1005906272 141
376 3300005445 Ga0070708_100647704 Ga0070708_1006477042 141
377 3300005445 Ga0070708_100693880 Ga0070708_1006938802 141
378 3300005455 Ga0070663_100115078 Ga0070663_1001150782 141
379 3300005455 Ga0070663_100147031 Ga0070663_1001470313 141
380 3300005458 Ga0070681_10001680 Ga0070681_1000168022 141
381 3300005458 Ga0070681_10041150 Ga0070681_100411506 141
382 3300005458 Ga0070681_10135397 Ga0070681_101353972 141
383 3300005458 Ga0070681_10144387 Ga0070681_101443874 141
384 3300005458 Ga0070681_10264322 Ga0070681_102643223 141
385 3300005458 Ga0070681_11473456 Ga0070681_114734562 141
386 3300005459 Ga0068867_100236889 Ga0068867_1002368893 141
387 3300005466 Ga0070685_10185335 Ga0070685_101853351 141
388 3300005467 Ga0070706_100030317 Ga0070706_1000303175 141
389 3300005467 Ga0070706_100117955 Ga0070706_1001179554 141
390 3300005467 Ga0070706_100173963 Ga0070706_1001739631 141
391 3300005467 Ga0070706_100199255 Ga0070706_1001992553 141
392 3300005467 Ga0070706_100228118 Ga0070706_1002281185 141
393 3300005467 Ga0070706_100293089 Ga0070706_1002930891 141
394 3300005467 Ga0070706_100437885 Ga0070706_1004378852 141
395 3300005467 Ga0070706_100863136 Ga0070706_1008631361 141
396 3300005467 Ga0070706_101013581 Ga0070706_1010135811 141
397 3300005467 Ga0070706_101136300 Ga0070706_1011363001 141
398 3300005468 Ga0070707_100054063 Ga0070707_1000540635 141
399 3300005468 Ga0070707_100094854 Ga0070707_1000948545 141
400 3300005471 Ga0070698_100027177 Ga0070698_1000271772 141
401 3300005471 Ga0070698_100040356 Ga0070698_1000403565 141
402 3300005471 Ga0070698_100057554 Ga0070698_1000575545 141
403 3300005471 Ga0070698_100094795 Ga0070698_1000947955 141
404 3300005471 Ga0070698_100235028 Ga0070698_1002350282 141
405 3300005471 Ga0070698_100349738 Ga0070698_1003497382 141
406 3300005471 Ga0070698_100758318 Ga0070698_1007583181 141
407 3300005471 Ga0070698_100895945 Ga0070698_1008959451 141
408 3300005471 Ga0070698_101212669 Ga0070698_1012126691 141
409 3300005518 Ga0070699_100019723 Ga0070699_1000197235 141
410 3300005518 Ga0070699_100023042 Ga0070699_1000230425 141
411 3300005518 Ga0070699_100027338 Ga0070699_1000273385 141
412 3300005518 Ga0070699_100134042 Ga0070699_1001340422 141
413 3300005518 Ga0070699_100179263 Ga0070699_1001792632 141
414 3300005518 Ga0070699_100350035 Ga0070699_1003500352 141
415 3300005518 Ga0070699_100350131 Ga0070699_1003501312 141
416 3300005518 Ga0070699_100514661 Ga0070699_1005146612 141
417 3300005518 Ga0070699_100552240 Ga0070699_1005522402 141
418 3300005518 Ga0070699_100717750 Ga0070699_1007177502 141
419 3300005530 Ga0070679_100019462 Ga0070679_1000194623 141
420 3300005530 Ga0070679_100039848 Ga0070679_1000398483 141
421 3300005530 Ga0070679_100088718 Ga0070679_1000887182 141
422 3300005530 Ga0070679_100091370 Ga0070679_1000913702 141
423 3300005530 Ga0070679_100103099 Ga0070679_1001030992 141
424 3300005530 Ga0070679_100152956 Ga0070679_1001529563 141
425 3300005530 Ga0070679_100969612 Ga0070679_1009696121 141
426 3300005530 Ga0070679_101149856 Ga0070679_1011498562 141
427 3300005535 Ga0070684_100016520 Ga0070684_1000165205 141
428 3300005535 Ga0070684_100037015 Ga0070684_1000370155 141
429 3300005535 Ga0070684_100422388 Ga0070684_1004223882 141
430 3300005535 Ga0070684_101226261 Ga0070684_1012262611 141
431 3300005536 Ga0070697_100040377 Ga0070697_1000403775 141
432 3300005536 Ga0070697_100061382 Ga0070697_1000613825 141
433 3300005536 Ga0070697_100132720 Ga0070697_1001327202 141
434 3300005536 Ga0070697_100155598 Ga0070697_1001555982 141
435 3300005536 Ga0070697_100161103 Ga0070697_1001611031 141
436 3300005536 Ga0070697_100196691 Ga0070697_1001966912 141
437 3300005536 Ga0070697_100649992 Ga0070697_1006499922 141
438 3300005536 Ga0070697_101055613 Ga0070697_1010556131 141
439 3300005536 Ga0070697_101503881 Ga0070697_1015038812 141
440 3300005539 Ga0068853_100340975 Ga0068853_1003409751 141
441 3300005544 Ga0070686_100032929 Ga0070686_1000329295 141
442 3300005544 Ga0070686_100105943 Ga0070686_1001059432 141
443 3300005545 Ga0070695_100018705 Ga0070695_1000187055 141
444 3300005545 Ga0070695_100026513 Ga0070695_1000265135 141
445 3300005545 Ga0070695_100538508 Ga0070695_1005385082 141
446 3300005546 Ga0070696_100000705 Ga0070696_1000007059 141
447 3300005546 Ga0070696_100009190 Ga0070696_1000091904 141
448 3300005546 Ga0070696_100027226 Ga0070696_1000272265 141
449 3300005546 Ga0070696_100032039 Ga0070696_1000320395 141
450 3300005546 Ga0070696_100107603 Ga0070696_1001076034 141
451 3300005546 Ga0070696_100172942 Ga0070696_1001729421 141
452 3300005546 Ga0070696_100236030 Ga0070696_1002360302 141
453 3300005546 Ga0070696_100477081 Ga0070696_1004770812 141
454 3300005546 Ga0070696_100503715 Ga0070696_1005037152 141
455 3300005546 Ga0070696_100940237 Ga0070696_1009402371 141
456 3300005546 Ga0070696_101330320 Ga0070696_1013303201 141
457 3300005547 Ga0070693_100070064 Ga0070693_1000700643 141
458 3300005548 Ga0070665_100596180 Ga0070665_1005961802 141
459 3300005549 Ga0070704_100004759 Ga0070704_1000047595 141
460 3300005549 Ga0070704_100006224 Ga0070704_1000062245 141
461 3300005549 Ga0070704_100047974 Ga0070704_10004797410 141
462 3300005549 Ga0070704_100079084 Ga0070704_1000790842 141
463 3300005549 Ga0070704_100289918 Ga0070704_1002899182 141
464 3300005549 Ga0070704_100389989 Ga0070704_1003899891 141
465 3300005549 Ga0070704_100609218 Ga0070704_1006092182 141
466 3300005549 Ga0070704_101096926 Ga0070704_1010969262 141
467 3300005549 Ga0070704_101248973 Ga0070704_1012489731 141
468 3300005563 Ga0068855_100411958 Ga0068855_1004119582 141
469 3300005564 Ga0070664_100092346 Ga0070664_1000923463 141
470 3300005564 Ga0070664_100182955 Ga0070664_1001829553 141
471 3300005577 Ga0068857_102364720 Ga0068857_1023647202 141
472 3300005578 Ga0068854_100014129 Ga0068854_1000141295 141
473 3300005578 Ga0068854_100092185 Ga0068854_1000921854 141
474 3300005578 Ga0068854_101174050 Ga0068854_1011740501 141
475 3300005614 Ga0068856_100033862 Ga0068856_1000338625 141
476 3300005615 Ga0070702_100007522 Ga0070702_1000075222 141
477 3300005615 Ga0070702_101511613 Ga0070702_1015116131 141
478 3300005616 Ga0068852_100044214 Ga0068852_1000442145 141
479 3300005616 Ga0068852_100427538 Ga0068852_1004275382 141
480 3300005617 Ga0068859_100000840 Ga0068859_1000008406 141
481 3300005617 Ga0068859_101318581 Ga0068859_1013185812 141
482 3300005719 Ga0068861_100436007 Ga0068861_1004360072 141
483 3300005719 Ga0068861_100863875 Ga0068861_1008638752 141
484 3300005719 Ga0068861_101203318 Ga0068861_1012033181 141
485 3300005843 Ga0068860_100486737 Ga0068860_1004867372 141
486 3300005843 Ga0068860_101154077 Ga0068860_1011540772 141
487 3300005843 Ga0068860_101373537 Ga0068860_1013735371 141
488 3300005937 Ga0081455_10007316 Ga0081455_1000731610 141
489 3300005937 Ga0081455_10024251 Ga0081455_100242515 141
490 3300005937 Ga0081455_10054317 Ga0081455_100543173 141
491 3300005937 Ga0081455_10241249 Ga0081455_102412492 141
492 3300005937 Ga0081455_10497736 Ga0081455_104977361 141
493 3300005937 Ga0081455_10499439 Ga0081455_104994392 141
494 3300005937 Ga0081455_10625587 Ga0081455_106255872 141
495 3300005981 Ga0081538_10001047 Ga0081538_1000104732 141
496 3300005981 Ga0081538_10028727 Ga0081538_100287275 141
497 3300005985 Ga0081539_10005702 Ga0081539_1000570216 141
498 3300005985 Ga0081539_10410951 Ga0081539_104109511 141
499 3300006028 Ga0070717_10007434 Ga0070717_100074345 141
500 3300006038 Ga0075365_10351828 Ga0075365_103518282 141
501 3300006048 Ga0075363_100184664 Ga0075363_1001846642 141
502 3300006051 Ga0075364_10643831 Ga0075364_106438311 141
503 3300006163 Ga0070715_10203574 Ga0070715_102035742 141
504 3300006173 Ga0070716_100060728 Ga0070716_1000607281 141
505 3300006175 Ga0070712_100004359 Ga0070712_1000043595 141
506 3300006175 Ga0070712_100099934 Ga0070712_1000999342 141
507 3300006175 Ga0070712_100604318 Ga0070712_1006043182 141
508 3300006186 Ga0075369_10067338 Ga0075369_100673383 141
509 3300006186 Ga0075369_10172165 Ga0075369_101721652 141
510 3300006237 Ga0097621_100853940 Ga0097621_1008539402 141
511 3300006237 Ga0097621_100976122 Ga0097621_1009761222 141
512 3300006844 Ga0075428_100004546 Ga0075428_1000045465 141
513 3300006844 Ga0075428_100006433 Ga0075428_1000064337 141
514 3300006844 Ga0075428_100033498 Ga0075428_1000334986 141
515 3300006844 Ga0075428_100230334 Ga0075428_1002303342 141
516 3300006844 Ga0075428_100247837 Ga0075428_1002478372 141
517 3300006844 Ga0075428_100461323 Ga0075428_1004613232 141
518 3300006844 Ga0075428_100463640 Ga0075428_1004636401 141
519 3300006844 Ga0075428_100471747 Ga0075428_1004717472 141
520 3300006846 Ga0075430_100062640 Ga0075430_1000626405 141
521 3300006846 Ga0075430_100222262 Ga0075430_1002222622 141
522 3300006846 Ga0075430_100364831 Ga0075430_1003648312 141
523 3300006846 Ga0075430_100462684 Ga0075430_1004626842 141
524 3300006847 Ga0075431_100193165 Ga0075431_1001931652 141
525 3300006847 Ga0075431_100224550 Ga0075431_1002245502 141
526 3300006847 Ga0075431_100240589 Ga0075431_1002405894 141
527 3300006847 Ga0075431_100691601 Ga0075431_1006916011 141
528 3300006847 Ga0075431_100701838 Ga0075431_1007018382 141
529 3300006852 Ga0075433_10008588 Ga0075433_100085886 141
530 3300006852 Ga0075433_10042950 Ga0075433_100429502 141
531 3300006852 Ga0075433_10065623 Ga0075433_100656235 141
532 3300006852 Ga0075433_10110719 Ga0075433_101107193 141
533 3300006871 Ga0075434_100011885 Ga0075434_1000118852 141
534 3300006871 Ga0075434_100125284 Ga0075434_1001252842 141
535 3300006871 Ga0075434_100169509 Ga0075434_1001695094 141
536 3300006871 Ga0075434_100372571 Ga0075434_1003725712 141
537 3300006871 Ga0075434_100588458 Ga0075434_1005884582 141
538 3300006871 Ga0075434_100712675 Ga0075434_1007126752 141
539 3300006871 Ga0075434_100719353 Ga0075434_1007193532 141
540 3300006871 Ga0075434_101756077 Ga0075434_1017560771 141
541 3300006880 Ga0075429_100167367 Ga0075429_1001673672 141
542 3300006880 Ga0075429_100336178 Ga0075429_1003361782 141
543 3300006880 Ga0075429_100344337 Ga0075429_1003443373 141
544 3300006880 Ga0075429_100390565 Ga0075429_1003905652 141
545 3300006880 Ga0075429_100432853 Ga0075429_1004328532 141
546 3300006880 Ga0075429_100507320 Ga0075429_1005073201 141
547 3300006914 Ga0075436_100010583 Ga0075436_1000105835 141
548 3300006914 Ga0075436_100019936 Ga0075436_1000199365 141
549 3300006914 Ga0075436_100030981 Ga0075436_1000309815 141
550 3300006914 Ga0075436_100043508 Ga0075436_1000435085 141
551 3300006914 Ga0075436_100078807 Ga0075436_1000788074 141
552 3300006914 Ga0075436_100244236 Ga0075436_1002442363 141
553 3300006914 Ga0075436_100403620 Ga0075436_1004036202 141
554 3300006914 Ga0075436_100712578 Ga0075436_1007125782 141
555 3300006914 Ga0075436_100945418 Ga0075436_1009454181 141
556 3300006931 Ga0097620_100000840 Ga0097620_1000008406 141
557 3300006931 Ga0097620_101318520 Ga0097620_1013185201 141
558 3300007076 Ga0075435_100035742 Ga0075435_1000357425 141
559 3300007076 Ga0075435_100068471 Ga0075435_1000684715 141
560 3300007076 Ga0075435_100075322 Ga0075435_1000753224 141
561 3300007076 Ga0075435_100185323 Ga0075435_1001853232 141
562 3300007076 Ga0075435_100228174 Ga0075435_1002281743 141
563 3300007076 Ga0075435_100248516 Ga0075435_1002485162 141
564 3300007076 Ga0075435_100638109 Ga0075435_1006381092 141
565 3300007076 Ga0075435_100804228 Ga0075435_1008042282 141
566 3300007076 Ga0075435_101365037 Ga0075435_1013650372 141
567 3300007076 Ga0075435_101366288 Ga0075435_1013662882 141
568 3300007265 Ga0099794_10005304 Ga0099794_100053045 141
569 3300007265 Ga0099794_10034141 Ga0099794_100341415 141
570 3300007265 Ga0099794_10523414 Ga0099794_105234141 141
571 3300007788 Ga0099795_10139469 Ga0099795_101394692 141
572 3300009093 Ga0105240_10085708 Ga0105240_100857085 141
573 3300009093 Ga0105240_10101067 Ga0105240_101010675 141
574 3300009093 Ga0105240_10125404 Ga0105240_101254043 141
575 3300009094 Ga0111539_10017154 Ga0111539_1001715411 141
576 3300009094 Ga0111539_10380703 Ga0111539_103807035 141
577 3300009094 Ga0111539_10489628 Ga0111539_104896282 141
578 3300009094 Ga0111539_10588752 Ga0111539_105887522 141
579 3300009094 Ga0111539_11467576 Ga0111539_114675761 141
580 3300009094 Ga0111539_12230289 Ga0111539_122302891 141
581 3300009098 Ga0105245_10102151 Ga0105245_101021515 141
582 3300009098 Ga0105245_10260746 Ga0105245_102607465 141
583 3300009098 Ga0105245_11876593 Ga0105245_118765931 141
584 3300009101 Ga0105247_10029826 Ga0105247_1002982611 141
585 3300009147 Ga0114129_10002329 Ga0114129_1000232923 141
586 3300009147 Ga0114129_10017272 Ga0114129_100172725 141
587 3300009147 Ga0114129_10037539 Ga0114129_100375395 141
588 3300009147 Ga0114129_10261996 Ga0114129_102619964 141
589 3300009147 Ga0114129_10330687 Ga0114129_103306872 141
590 3300009147 Ga0114129_10380158 Ga0114129_103801582 141
591 3300009147 Ga0114129_10408213 Ga0114129_104082134 141
592 3300009147 Ga0114129_10426199 Ga0114129_104261992 141
593 3300009147 Ga0114129_10577293 Ga0114129_105772932 141
594 3300009147 Ga0114129_10647386 Ga0114129_106473862 141
595 3300009147 Ga0114129_12223874 Ga0114129_122238741 141
596 3300009148 Ga0105243_10236231 Ga0105243_102362313 141
597 3300009148 Ga0105243_11332632 Ga0105243_113326322 141
598 3300009148 Ga0105243_11743164 Ga0105243_117431642 141
599 3300009174 Ga0105241_10497246 Ga0105241_104972462 141
600 3300009174 Ga0105241_10815188 Ga0105241_108151881 141
601 3300009177 Ga0105248_11812304 Ga0105248_118123041 141
602 3300009177 Ga0105248_13058998 Ga0105248_130589981 141
603 3300009545 Ga0105237_10935363 Ga0105237_109353632 141
604 3300009551 Ga0105238_10142307 Ga0105238_101423072 141
605 3300009551 Ga0105238_10284884 Ga0105238_102848842 141
606 3300009553 Ga0105249_11690130 Ga0105249_116901302 141
607 3300009553 Ga0105249_12763804 Ga0105249_127638042 141
608 3300010375 Ga0105239_10235285 Ga0105239_102352852 141
609 3300011119 Ga0105246_10456146 Ga0105246_104561462 141
610 3300012497 Ga0157319_1044966 Ga0157319_10449662 141
611 3300012508 Ga0157315_1036177 Ga0157315_10361772 141
612 3300013100 Ga0157373_10011804 Ga0157373_100118045 141
613 3300013100 Ga0157373_10116480 Ga0157373_101164805 141
614 3300013100 Ga0157373_10411127 Ga0157373_104111272 141
615 3300013104 Ga0157370_10046409 Ga0157370_100464094 141
616 3300013104 Ga0157370_10081133 Ga0157370_100811332 141
617 3300013104 Ga0157370_10240088 Ga0157370_102400883 141
618 3300013105 Ga0157369_10128360 Ga0157369_101283603 141
619 3300013296 Ga0157374_10143989 Ga0157374_101439892 141
620 3300013296 Ga0157374_10188956 Ga0157374_101889565 141
621 3300013297 Ga0157378_10046089 Ga0157378_100460895 141
622 3300013297 Ga0157378_11687820 Ga0157378_116878202 141
623 3300013307 Ga0157372_10046943 Ga0157372_100469435 141
624 3300013307 Ga0157372_10047091 Ga0157372_100470915 141
625 3300013307 Ga0157372_10099273 Ga0157372_100992735 141
626 3300013307 Ga0157372_10454914 Ga0157372_104549142 141
627 3300013307 Ga0157372_10710278 Ga0157372_107102782 141
628 3300013307 Ga0157372_11485200 Ga0157372_114852001 141
629 3300013308 Ga0157375_11071772 Ga0157375_110717722 141
630 3300013308 Ga0157375_11124174 Ga0157375_111241742 141
631 3300014497 Ga0182008_10128751 Ga0182008_101287512 141
632 3300014968 Ga0157379_10405622 Ga0157379_104056222 141
633 3300014969 Ga0157376_10137652 Ga0157376_101376523 141
634 3300014969 Ga0157376_11228898 Ga0157376_112288982 141
635 3300020070 Ga0206356_10020515 Ga0206356_100205152 141
636 3300020070 Ga0206356_10585457 Ga0206356_105854573 141
637 3300020070 Ga0206356_11018801 Ga0206356_110188011 141
638 3300020078 Ga0206352_10121810 Ga0206352_101218102 141
639 3300020081 Ga0206354_10369424 Ga0206354_103694243 141
640 3300021388 Ga0213875_10362408 Ga0213875_103624081 141
641 3300022467 Ga0224712_10013255 Ga0224712_100132554 141
642 3300024225 Ga0224572_1013087 Ga0224572_10130872 141
643 3300025303 Ga0209051_1000051 Ga0209051_1000051225 141
644 3300025303 Ga0209051_1105290 Ga0209051_11052902 141
645 3300025885 Ga0207653_10008146 Ga0207653_100081464 141
646 3300025885 Ga0207653_10016473 Ga0207653_100164733 141
647 3300025885 Ga0207653_10020416 Ga0207653_100204162 141
648 3300025885 Ga0207653_10345061 Ga0207653_103450612 141
649 3300025898 Ga0207692_10025272 Ga0207692_100252725 141
650 3300025898 Ga0207692_10245325 Ga0207692_102453251 141
651 3300025900 Ga0207710_10075611 Ga0207710_100756112 141
652 3300025901 Ga0207688_10403620 Ga0207688_104036202 141
653 3300025901 Ga0207688_10429030 Ga0207688_104290301 141
654 3300025903 Ga0207680_10049347 Ga0207680_100493473 141
655 3300025903 Ga0207680_10406411 Ga0207680_104064112 141
656 3300025903 Ga0207680_10513262 Ga0207680_105132622 141
657 3300025906 Ga0207699_10002419 Ga0207699_100024195 141
658 3300025906 Ga0207699_10065043 Ga0207699_100650432 141
659 3300025906 Ga0207699_10066682 Ga0207699_100666822 141
660 3300025906 Ga0207699_10469108 Ga0207699_104691082 141
661 3300025910 Ga0207684_10041822 Ga0207684_100418224 141
662 3300025910 Ga0207684_10105062 Ga0207684_101050625 141
663 3300025910 Ga0207684_10126285 Ga0207684_101262852 141
664 3300025910 Ga0207684_10189050 Ga0207684_101890502 141
665 3300025910 Ga0207684_10341736 Ga0207684_103417361 141
666 3300025910 Ga0207684_10449269 Ga0207684_104492692 141
667 3300025910 Ga0207684_11175200 Ga0207684_111752001 141
668 3300025911 Ga0207654_10951762 Ga0207654_109517621 141
669 3300025912 Ga0207707_10017467 Ga0207707_100174679 141
670 3300025912 Ga0207707_10017733 Ga0207707_100177335 141
671 3300025912 Ga0207707_10021948 Ga0207707_100219485 141
672 3300025912 Ga0207707_10043461 Ga0207707_100434615 141
673 3300025912 Ga0207707_10072756 Ga0207707_100727564 141
674 3300025913 Ga0207695_10015477 Ga0207695_100154776 141
675 3300025913 Ga0207695_10060503 Ga0207695_100605035 141
676 3300025913 Ga0207695_10082885 Ga0207695_100828854 141
677 3300025913 Ga0207695_10119468 Ga0207695_101194684 141
678 3300025913 Ga0207695_10133510 Ga0207695_101335105 141
679 3300025915 Ga0207693_10041576 Ga0207693_100415762 141
680 3300025915 Ga0207693_10067286 Ga0207693_100672863 141
681 3300025915 Ga0207693_10106443 Ga0207693_101064433 141
682 3300025915 Ga0207693_10267619 Ga0207693_102676193 141
683 3300025916 Ga0207663_10115612 Ga0207663_101156123 141
684 3300025917 Ga0207660_10000465 Ga0207660_1000046519 141
685 3300025917 Ga0207660_10001269 Ga0207660_100012695 141
686 3300025917 Ga0207660_10022611 Ga0207660_100226117 141
687 3300025917 Ga0207660_10025397 Ga0207660_100253975 141
688 3300025917 Ga0207660_10032960 Ga0207660_100329605 141
689 3300025917 Ga0207660_10095550 Ga0207660_100955505 141
690 3300025917 Ga0207660_10397415 Ga0207660_103974152 141
691 3300025917 Ga0207660_10513243 Ga0207660_105132432 141
692 3300025918 Ga0207662_10393920 Ga0207662_103939202 141
693 3300025918 Ga0207662_10448996 Ga0207662_104489962 141
694 3300025919 Ga0207657_10305371 Ga0207657_103053712 141
695 3300025919 Ga0207657_11036532 Ga0207657_110365321 141
696 3300025920 Ga0207649_10012357 Ga0207649_100123575 141
697 3300025920 Ga0207649_10095759 Ga0207649_100957592 141
698 3300025920 Ga0207649_11125566 Ga0207649_111255661 141
699 3300025920 Ga0207649_11520901 Ga0207649_115209011 141
700 3300025921 Ga0207652_10000969 Ga0207652_1000096919 141
701 3300025921 Ga0207652_10051472 Ga0207652_100514724 141
702 3300025921 Ga0207652_10055640 Ga0207652_100556405 141
703 3300025921 Ga0207652_10105433 Ga0207652_101054332 141
704 3300025921 Ga0207652_10155438 Ga0207652_101554384 141
705 3300025921 Ga0207652_10213891 Ga0207652_102138913 141
706 3300025921 Ga0207652_11308224 Ga0207652_113082242 141
707 3300025922 Ga0207646_10040765 Ga0207646_100407655 141
708 3300025922 Ga0207646_10044065 Ga0207646_100440655 141
709 3300025922 Ga0207646_10063875 Ga0207646_100638754 141
710 3300025922 Ga0207646_10085941 Ga0207646_100859415 141
711 3300025922 Ga0207646_10183048 Ga0207646_101830485 141
712 3300025922 Ga0207646_10583285 Ga0207646_105832852 141
713 3300025924 Ga0207694_10040453 Ga0207694_100404532 141
714 3300025924 Ga0207694_10649472 Ga0207694_106494722 141
715 3300025927 Ga0207687_10052341 Ga0207687_100523415 141
716 3300025928 Ga0207700_10005401 Ga0207700_100054015 141
717 3300025928 Ga0207700_10010134 Ga0207700_100101346 141
718 3300025928 Ga0207700_10143993 Ga0207700_101439936 141
719 3300025929 Ga0207664_10062895 Ga0207664_100628953 141
720 3300025929 Ga0207664_10079606 Ga0207664_100796063 141
721 3300025929 Ga0207664_10178376 Ga0207664_101783762 141
722 3300025931 Ga0207644_10864916 Ga0207644_108649162 141
723 3300025932 Ga0207690_10138065 Ga0207690_101380652 141
724 3300025932 Ga0207690_11033110 Ga0207690_110331102 141
725 3300025933 Ga0207706_10219620 Ga0207706_102196205 141
726 3300025934 Ga0207686_10542111 Ga0207686_105421112 141
727 3300025934 Ga0207686_11461894 Ga0207686_114618941 141
728 3300025935 Ga0207709_10275014 Ga0207709_102750142 141
729 3300025935 Ga0207709_10366910 Ga0207709_103669102 141
730 3300025935 Ga0207709_10646360 Ga0207709_106463602 141
731 3300025935 Ga0207709_10881773 Ga0207709_108817732 141
732 3300025936 Ga0207670_11293592 Ga0207670_112935921 141
733 3300025937 Ga0207669_10642099 Ga0207669_106420992 141
734 3300025939 Ga0207665_10010264 Ga0207665_100102645 141
735 3300025939 Ga0207665_10124320 Ga0207665_101243203 141
736 3300025941 Ga0207711_10235269 Ga0207711_102352692 141
737 3300025941 Ga0207711_10810526 Ga0207711_108105262 141
738 3300025944 Ga0207661_10007979 Ga0207661_1000797910 141
739 3300025944 Ga0207661_10022845 Ga0207661_100228455 141
740 3300025944 Ga0207661_10023269 Ga0207661_100232695 141
741 3300025944 Ga0207661_10235434 Ga0207661_102354342 141
742 3300025944 Ga0207661_10289327 Ga0207661_102893272 141
743 3300025944 Ga0207661_10795821 Ga0207661_107958211 141
744 3300025945 Ga0207679_10123849 Ga0207679_101238493 141
745 3300025945 Ga0207679_10125565 Ga0207679_101255653 141
746 3300025949 Ga0207667_10007096 Ga0207667_100070966 141
747 3300025961 Ga0207712_11015864 Ga0207712_110158642 141
748 3300025981 Ga0207640_10004362 Ga0207640_100043625 141
749 3300025981 Ga0207640_10032157 Ga0207640_100321574 141
750 3300025981 Ga0207640_11535594 Ga0207640_115355941 141
751 3300025986 Ga0207658_10003633 Ga0207658_1000363315 141
752 3300025986 Ga0207658_10033451 Ga0207658_100334511 141
753 3300026023 Ga0207677_10077177 Ga0207677_100771772 141
754 3300026035 Ga0207703_11427929 Ga0207703_114279291 141
755 3300026041 Ga0207639_10263650 Ga0207639_102636502 141
756 3300026067 Ga0207678_10134335 Ga0207678_101343353 141
757 3300026067 Ga0207678_10163290 Ga0207678_101632902 141
758 3300026075 Ga0207708_10175453 Ga0207708_101754534 141
759 3300026078 Ga0207702_10261255 Ga0207702_102612552 141
760 3300026078 Ga0207702_10717919 Ga0207702_107179191 141
761 3300026078 Ga0207702_12105828 Ga0207702_121058282 141
762 3300026089 Ga0207648_10266895 Ga0207648_102668954 141
763 3300026118 Ga0207675_100992521 Ga0207675_1009925212 141
764 3300026142 Ga0207698_10131050 Ga0207698_101310502 141
765 3300026142 Ga0207698_10869910 Ga0207698_108699102 141
766 3300027671 Ga0209588_1000886 Ga0209588_10008864 141
767 3300027671 Ga0209588_1004808 Ga0209588_10048085 141
768 3300027671 Ga0209588_1080989 Ga0209588_10809891 141
769 3300027907 Ga0207428_10012763 Ga0207428_100127636 141
770 3300027907 Ga0207428_10077312 Ga0207428_100773122 141
771 3300027907 Ga0207428_10189298 Ga0207428_101892982 141
772 3300028017 Ga0265356_1029748 Ga0265356_10297481 141
773 3300028381 Ga0268264_10443022 Ga0268264_104430222 141
774 3300028381 Ga0268264_10648078 Ga0268264_106480782 141
775 3300028558 Ga0265326_10153647 Ga0265326_101536471 141
776 3300028577 Ga0265318_10126170 Ga0265318_101261702 141
777 3300030731 Ga0316177_1127819 Ga0316177_11278192 141
778 3300031548 Ga0307408_100754829 Ga0307408_1007548292 141
779 3300031548 Ga0307408_102056689 Ga0307408_1020566891 141
780 3300031691 Ga0316579_10014765 Ga0316579_100147652 141
781 3300031727 Ga0316576_10066851 Ga0316576_100668512 141
782 3300031731 Ga0307405_10116031 Ga0307405_101160313 141
783 3300031731 Ga0307405_10448616 Ga0307405_104486162 141
784 3300031731 Ga0307405_11378222 Ga0307405_113782222 141
785 3300031824 Ga0307413_10330698 Ga0307413_103306982 141
786 3300031852 Ga0307410_10020241 Ga0307410_100202415 141
787 3300031852 Ga0307410_10891437 Ga0307410_108914371 141
788 3300031889 Ga0326468_10073619 Ga0326468_100736191 141
789 3300031901 Ga0307406_10142469 Ga0307406_101424693 141
790 3300031903 Ga0307407_10017934 Ga0307407_100179343 141
791 3300031911 Ga0307412_10110574 Ga0307412_101105741 141
792 3300031995 Ga0307409_100079698 Ga0307409_1000796984 141
793 3300031995 Ga0307409_100103378 Ga0307409_1001033782 141
794 3300032002 Ga0307416_100102668 Ga0307416_1001026682 141
795 3300032002 Ga0307416_100570128 Ga0307416_1005701282 141
796 3300032002 Ga0307416_103047990 Ga0307416_1030479901 141
797 3300032005 Ga0307411_10245184 Ga0307411_102451842 141
798 3300032126 Ga0307415_100125057 Ga0307415_1001250572 141
799 3300032126 Ga0307415_100128835 Ga0307415_1001288352 141
800 3300033524 Ga0316592_1001311 Ga0316592_10013113 141
801 3300033541 Ga0316596_1019426 Ga0316596_10194264 141
802 3300035083 Ga0373926_0004875 Ga0373926_0004875_389_814 141
803 3300035084 Ga0373928_0105584 Ga0373928_0105584_215_640 141
804 3300035086 Ga0373934_0003191 Ga0373934_0003191_567_992 141
805 3300035089 Ga0373944_0040358 Ga0373944_0040358_900_1325 141
806 3300035111 Ga0373923_0017406 Ga0373923_0017406_1941_2366 141
807 3300035113 Ga0373936_0074292 Ga0373936_0074292_155_580 141
808 3300035113 Ga0373936_0237782 Ga0373936_0237782_99_524 141
809 3300035116 Ga0373945_0008197 Ga0373945_0008197_981_1406 141
810 3300035117 Ga0373953_0000508 Ga0373953_0000508_5464_5889 141
811 3300035118 Ga0373954_0036310 Ga0373954_0036310_133_558 141
812 3300035119 Ga0373956_0001913 Ga0373956_0001913_763_1188 141
813 3300035170 Ga0373943_0002422 Ga0373943_0002422_1257_1682 141
814 3300035170 Ga0373943_0349578 Ga0373943_0349578_219_644 141
815 3300035172 Ga0373955_0001463 Ga0373955_0001463_1566_1991 141
816 3300035410 Ga0373924_0007506 Ga0373924_0007506_2403_2828 141
817 3300035691 Ga0373931_0781263 Ga0373931_0781263_41_466 141
818 3300035692 Ga0373935_0001207 Ga0373935_0001207_8454_8879 141
819 3300035692 Ga0373935_0659779 Ga0373935_0659779_26_451 141
820 3300035692 Ga0373935_0695694 Ga0373935_0695694_16_441 141
821 3300035695 Ga0373927_0012867 Ga0373927_0012867_2577_3002 141
822 3300035724 Ga0373933_0000104 Ga0373933_0000104_43829_44254 141
823 3300035725 Ga0373947_0000036 Ga0373947_0000036_63257_63682 141
824 3300035725 Ga0373947_0150595 Ga0373947_0150595_133_558 141
825 3300035725 Ga0373947_0532797 Ga0373947_0532797_307_738 141
826 3300036401 Ga0373937_0000161 Ga0373937_0000161_27955_28380 141
827 3300036401 Ga0373937_0064800 Ga0373937_0064800_2832_3257 141
828 3300036647 Ga0316582_0091566 Ga0316582_0091566_1420_1845 141
829 3300036712 Ga0316584_0014998 Ga0316584_0014998_4832_5260 141
830 3300036712 Ga0316584_0177152 Ga0316584_0177152_419_844 141
831 3300036712 Ga0316584_0190762 Ga0316584_0190762_880_1305 141
832 3300037068 Ga0373925_0000385 Ga0373925_0000385_44379_44804 141
833 3300037312 Ga0395899_0096955 Ga0395899_0096955_1197_1622 141
834 3300037312 Ga0395899_0266996 Ga0395899_0266996_351_776 141
835 3300037418 Ga0395900_0050431 Ga0395900_0050431_3348_3773 141
836 3300037418 Ga0395900_0336610 Ga0395900_0336610_259_684 141
837 3300037418 Ga0395900_0409006 Ga0395900_0409006_398_823 141
838 3300037466 Ga0395898_0047653 Ga0395898_0047653_3739_4164 141
839 3300037466 Ga0395898_0074326 Ga0395898_0074326_1119_1544 141
840 3300037466 Ga0395898_0149064 Ga0395898_0149064_1307_1732 141
841 3300037466 Ga0395898_0937649 Ga0395898_0937649_169_600 141
842 3300037471 Ga0395905_0031562 Ga0395905_0031562_290_715 141
843 3300037471 Ga0395905_0743894 Ga0395905_0743894_289_714 141
844 3300037588 Ga0316581_0023281 Ga0316581_0023281_170_595 141
845 3300037588 Ga0316581_0059648 Ga0316581_0059648_730_1155 141
846 3300037853 Ga0436364_0050525 Ga0436364_0050525_25_450 141
847 3300037853 Ga0436364_1057828 Ga0436364_1057828_52_477 141
848 3300038443 Ga0395901_0008346 Ga0395901_0008346_9271_9696 141
849 3300038443 Ga0395901_0059119 Ga0395901_0059119_3531_3956 141
850 3300038443 Ga0395901_0068832 Ga0395901_0068832_2384_2809 141
851 3300038443 Ga0395901_0241882 Ga0395901_0241882_801_1226 141
852 3300038443 Ga0395901_0305334 Ga0395901_0305334_281_706 141
853 3300038443 Ga0395901_0890775 Ga0395901_0890775_219_644 141
854 3300038735 Ga0400485_02889 Ga0400485_02889_1388_1816 141
855 3300038996 Ga0242420_001741 Ga0242420_001741_1163_1594 141
856 3300041512 Ga0451853_3305564 Ga0451853_3305564_713_1138 141
857 3300042003 Ga0439443_011422 Ga0439443_011422_158_583 141
858 3300042005 Ga0439448_0008682 Ga0439448_0008682_580_1011 141
859 3300042005 Ga0439448_0047259 Ga0439448_0047259_763_1188 141
860 3300042008 Ga0439450_001812 Ga0439450_001812_816_1241 141
861 3300042009 Ga0439451_022652 Ga0439451_022652_770_1195 141
862 3300042010 Ga0439452_019002 Ga0439452_019002_371_796 141
863 3300042011 Ga0439454_001606 Ga0439454_001606_1082_1507 141
864 3300042012 Ga0439455_0011795 Ga0439455_0011795_712_1137 141
865 3300042016 Ga0439463_005224 Ga0439463_005224_775_1200 141
866 3300042142 Ga0450905_014305 Ga0450905_014305_14_439 141
867 3300042435 Ga0439434_0043065 Ga0439434_0043065_256_681 141
868 3300042437 Ga0439444_0080996 Ga0439444_0080996_262_687 141
869 3300042439 Ga0439464_0057136 Ga0439464_0057136_107_532 141
870 3300042461 Ga0439460_0009975 Ga0439460_0009975_696_1121 141
871 3300042876 Ga0451577_0173793 Ga0451577_0173793_198_623 141
872 3300042876 Ga0451577_0339792 Ga0451577_0339792_749_1180 141
873 3300042993 Ga0439440_0031563 Ga0439440_0031563_750_1175 141
874 3300044658 Ga0466972_0057379 Ga0466972_0057379_1398_1829 141
875 3300044673 Ga0453683_0034282 Ga0453683_0034282_2078_2503 141
876 3300044673 Ga0453683_0044757 Ga0453683_0044757_2147_2578 141
877 3300044673 Ga0453683_0145873 Ga0453683_0145873_67_492 141
878 3300044673 Ga0453683_0222025 Ga0453683_0222025_597_1022 141
879 3300044673 Ga0453683_0673541 Ga0453683_0673541_206_631 141
880 3300044683 Ga0466965_0017677 Ga0466965_0017677_421_852 141
881 3300044684 Ga0466966_0263163 Ga0466966_0263163_207_632 141
882 3300044693 Ga0466961_0895324 Ga0466961_0895324_53_478 141
883 3300044694 Ga0466963_0936880 Ga0466963_0936880_73_498 141
884 3300044712 Ga0453684_0180228 Ga0453684_0180228_884_1309 141
885 3300044765 Ga0466970_0118125 Ga0466970_0118125_611_1039 141
886 3300044842 Ga0466957_0170951 Ga0466957_0170951_724_1149 141
887 3300044842 Ga0466957_0301145 Ga0466957_0301145_129_554 141
888 3300044842 Ga0466957_0376710 Ga0466957_0376710_462_887 141
889 3300045049 Ga0466959_0028253 Ga0466959_0028253_3603_4028 141
890 3300045051 Ga0451576_0019145 Ga0451576_0019145_1250_1675 141
891 3300045051 Ga0451576_0031109 Ga0451576_0031109_3138_3563 141
892 3300045051 Ga0451576_0033178 Ga0451576_0033178_1418_1843 141
893 3300045051 Ga0451576_0095299 Ga0451576_0095299_816_1241 141
894 3300045051 Ga0451576_0131023 Ga0451576_0131023_1608_2033 141
895 3300045051 Ga0451576_0149398 Ga0451576_0149398_170_595 141
896 3300045051 Ga0451576_0213835 Ga0451576_0213835_1206_1637 141
897 3300045051 Ga0451576_0224496 Ga0451576_0224496_1399_1824 141
898 3300045051 Ga0451576_0287758 Ga0451576_0287758_964_1389 141
899 3300045836 Ga0466958_0014083 Ga0466958_0014083_1005_1430 141
900 3300045976 Ga0466967_0038310 Ga0466967_0038310_2293_2724 141
901 3300045976 Ga0466967_0113483 Ga0466967_0113483_239_664 141
902 3300045976 Ga0466967_0516278 Ga0466967_0516278_37_462 141
903 3300046454 Ga0495592_0001510 Ga0495592_0001510_7955_8380 141
904 3300046455 Ga0495603_0000774 Ga0495603_0000774_4049_4474 141
905 3300046459 Ga0495629_0012987 Ga0495629_0012987_1259_1684 141
906 3300046459 Ga0495629_0046147 Ga0495629_0046147_1728_2153 141
907 3300046459 Ga0495629_0269380 Ga0495629_0269380_210_635 141
908 3300046460 Ga0495638_0073512 Ga0495638_0073512_1620_2051 141
909 3300046462 Ga0495651_0000077 Ga0495651_0000077_18234_18659 141
910 3300046463 Ga0495653_0004046 Ga0495653_0004046_10882_11307 141
911 3300046472 Ga0495580_0000048 Ga0495580_0000048_15493_15918 141
912 3300046473 Ga0495582_0000179 Ga0495582_0000179_4144_4569 141
913 3300046474 Ga0495605_0036268 Ga0495605_0036268_1988_2413 141
914 3300046475 Ga0495639_0000917 Ga0495639_0000917_7415_7840 141
915 3300046491 Ga0495584_0231884 Ga0495584_0231884_211_636 141
916 3300046492 Ga0495585_0128927 Ga0495585_0128927_496_921 141
917 3300046499 Ga0495594_0252948 Ga0495594_0252948_25_450 141
918 3300046500 Ga0495596_0023654 Ga0495596_0023654_229_654 141
919 3300046500 Ga0495596_0026638 Ga0495596_0026638_1383_1808 141
920 3300046500 Ga0495596_0286103 Ga0495596_0286103_42_470 141
921 3300046506 Ga0495583_0082919 Ga0495583_0082919_336_761 141
922 3300046511 Ga0495608_0001077 Ga0495608_0001077_7948_8373 141
923 3300046515 Ga0495620_0166140 Ga0495620_0166140_217_642 141
924 3300046516 Ga0495628_0000243 Ga0495628_0000243_36851_37276 141
925 3300046517 Ga0495630_0004558 Ga0495630_0004558_2960_3385 141
926 3300046517 Ga0495630_0088607 Ga0495630_0088607_537_962 141
927 3300046520 Ga0495637_0125664 Ga0495637_0125664_516_941 141
928 3300046523 Ga0495644_0256142 Ga0495644_0256142_190_618 141
929 3300046523 Ga0495644_0317826 Ga0495644_0317826_159_584 141
930 3300046525 Ga0495663_0014060 Ga0495663_0014060_962_1387 141
931 3300046528 Ga0495642_0013058 Ga0495642_0013058_1769_2194 141
932 3300046528 Ga0495642_0024233 Ga0495642_0024233_1415_1840 141
933 3300046529 Ga0495652_0002587 Ga0495652_0002587_10140_10565 141
934 3300046530 Ga0495654_0265295 Ga0495654_0265295_240_665 141
935 3300046531 Ga0495665_0000002 Ga0495665_0000002_60193_60618 141
936 3300046531 Ga0495665_0055209 Ga0495665_0055209_618_1043 141
937 3300046533 Ga0495640_0097259 Ga0495640_0097259_1439_1864 141
938 3300046533 Ga0495640_0276282 Ga0495640_0276282_59_484 141
939 3300046535 Ga0495586_0030111 Ga0495586_0030111_1849_2274 141
940 3300046536 Ga0495587_0000452 Ga0495587_0000452_26805_27230 141
941 3300046538 Ga0495609_0134813 Ga0495609_0134813_69_494 141
942 3300046539 Ga0495621_0188244 Ga0495621_0188244_174_599 141
943 3300046543 Ga0495645_0076947 Ga0495645_0076947_136_561 141
944 3300046559 Ga0495667_0001003 Ga0495667_0001003_7017_7442 141
945 3300046616 Ga0495668_0090149 Ga0495668_0090149_695_1120 141
946 3300046642 Ga0495634_0025555 Ga0495634_0025555_1112_1537 141
947 3300046642 Ga0495634_0041641 Ga0495634_0041641_1256_1681 141
948 3300046642 Ga0495634_0233806 Ga0495634_0233806_557_982 141
949 3300046663 Ga0495635_0000048 Ga0495635_0000048_10873_11298 141
950 3300046664 Ga0495659_0012075 Ga0495659_0012075_806_1231 141
951 3300046674 Ga0495588_0000464 Ga0495588_0000464_8434_8859 141
952 3300046675 Ga0495657_0001010 Ga0495657_0001010_10886_11311 141
953 3300046678 Ga0495599_0004988 Ga0495599_0004988_6343_6768 141
954 3300046679 Ga0495623_0000961 Ga0495623_0000961_10844_11269 141
955 3300046680 Ga0495646_0027300 Ga0495646_0027300_1422_1847 141
956 3300046681 Ga0495647_0092406 Ga0495647_0092406_373_798 141
957 3300046681 Ga0495647_0233841 Ga0495647_0233841_225_650 141
958 3300046683 Ga0495658_0000017 Ga0495658_0000017_44330_44755 141
959 3300046684 Ga0495669_0458040 Ga0495669_0458040_13_438 141
960 3300046689 Ga0495613_0024110 Ga0495613_0024110_1262_1687 141
961 3300046689 Ga0495613_0088123 Ga0495613_0088123_686_1111 141
962 3300046690 Ga0495624_0094611 Ga0495624_0094611_1217_1642 141
963 3300046794 Ga0495589_0033549 Ga0495589_0033549_1647_2072 141
964 3300046809 Ga0495600_0001723 Ga0495600_0001723_1026_1451 141
965 3300047315 Ga0495581_0000312 Ga0495581_0000312_4016_4441 141
966 3300047315 Ga0495581_0293720 Ga0495581_0293720_482_907 141
967 3300047317 Ga0495604_0000017 Ga0495604_0000017_69075_69500 141
968 3300047319 Ga0495674_0004269 Ga0495674_0004269_7426_7851 141
969 3300047319 Ga0495674_0491687 Ga0495674_0491687_501_926 141
970 3300047319 Ga0495674_0793691 Ga0495674_0793691_50_475 141
971 3300047320 Ga0495672_0159674 Ga0495672_0159674_705_1136 141
972 3300047321 Ga0495676_0048910 Ga0495676_0048910_55_480 141
973 3300047321 Ga0495676_0183628 Ga0495676_0183628_802_1227 141
974 3300047322 Ga0495680_0007740 Ga0495680_0007740_3020_3445 141
975 3300047444 Ga0495675_0002210 Ga0495675_0002210_7462_7887 141
976 3300047445 Ga0495677_0018428 Ga0495677_0018428_1214_1639 141
977 3300047445 Ga0495677_0096254 Ga0495677_0096254_88_513 141
978 3300047445 Ga0495677_0167760 Ga0495677_0167760_133_558 141
979 3300047471 Ga0495684_0000118 Ga0495684_0000118_14899_15324 141
980 3300047673 Ga0495593_0000009 Ga0495593_0000009_24072_24497 141
981 3300047673 Ga0495593_0150411 Ga0495593_0150411_84_509 141
982 3300048088 Ga0495602_0000891 Ga0495602_0000891_26946_27371 141
983 3300048089 Ga0495614_0000005 Ga0495614_0000005_44348_44773 141
984 3300048089 Ga0495614_0010194 Ga0495614_0010194_1676_2101 141
985 3300048903 Ga0496100_0003601 Ga0496100_0003601_5034_5465 141
986 3300048903 Ga0496100_0323800 Ga0496100_0323800_586_1011 141
987 3300048903 Ga0496100_0392669 Ga0496100_0392669_309_734 141
988 3300048904 Ga0496101_0000020 Ga0496101_0000020_38355_38786 141
989 3300048904 Ga0496101_0009982 Ga0496101_0009982_4859_5284 141
990 3300048904 Ga0496101_0075234 Ga0496101_0075234_889_1314 141
991 3300048905 Ga0496102_0016044 Ga0496102_0016044_1192_1617 141
992 3300048905 Ga0496102_0026908 Ga0496102_0026908_1396_1827 141
993 3300048905 Ga0496102_0254094 Ga0496102_0254094_163_588 141
994 3300048905 Ga0496102_0460052 Ga0496102_0460052_540_965 141
995 3300048905 Ga0496102_0472850 Ga0496102_0472850_693_1118 141
996 3300048905 Ga0496102_0567361 Ga0496102_0567361_417_842 141
997 3300048905 Ga0496102_1584551 Ga0496102_1584551_100_525 141
998 3300048906 Ga0496103_0001090 Ga0496103_0001090_3307_3738 141
999 3300048906 Ga0496103_0020130 Ga0496103_0020130_1783_2208 141
1000 3300048907 Ga0496104_0002157 Ga0496104_0002157_6554_6979 141
1001 3300048907 Ga0496104_0043997 Ga0496104_0043997_3022_3447 141
1002 3300048907 Ga0496104_0160103 Ga0496104_0160103_426_851 141
1003 3300048907 Ga0496104_0181428 Ga0496104_0181428_1078_1503 141
1004 3300048908 Ga0496105_0000376 Ga0496105_0000376_19472_19897 141
1005 3300048908 Ga0496105_0055255 Ga0496105_0055255_2771_3196 141
1006 3300048908 Ga0496105_0152731 Ga0496105_0152731_505_930 141
1007 3300048909 Ga0496106_0001002 Ga0496106_0001002_3704_4135 141
1008 3300048909 Ga0496106_0443451 Ga0496106_0443451_582_1007 141
1009 3300048909 Ga0496106_0482980 Ga0496106_0482980_165_590 141
1010 3300048910 Ga0496107_0070089 Ga0496107_0070089_290_715 141
1011 3300048910 Ga0496107_0519325 Ga0496107_0519325_270_695 141
1012 3300048911 Ga0496108_0001494 Ga0496108_0001494_225_650 141
1013 3300048911 Ga0496108_0023343 Ga0496108_0023343_3313_3744 141
1014 3300048911 Ga0496108_0093551 Ga0496108_0093551_1730_2155 141
1015 3300048912 Ga0496109_0000104 Ga0496109_0000104_82491_82922 141
1016 3300048912 Ga0496109_0000890 Ga0496109_0000890_17684_18109 141
1017 3300048912 Ga0496109_0004159 Ga0496109_0004159_2735_3160 141
1018 3300048912 Ga0496109_0110111 Ga0496109_0110111_1707_2132 141
1019 3300048912 Ga0496109_0190149 Ga0496109_0190149_1145_1570 141
1020 3300048912 Ga0496109_0844853 Ga0496109_0844853_295_720 141
1021 3300048913 Ga0496110_0000535 Ga0496110_0000535_2546_2971 141
1022 3300048913 Ga0496110_0005263 Ga0496110_0005263_136_561 141
1023 3300048913 Ga0496110_0024077 Ga0496110_0024077_959_1390 141
1024 3300048913 Ga0496110_0157946 Ga0496110_0157946_160_585 141
1025 3300048913 Ga0496110_0192584 Ga0496110_0192584_230_655 141
1026 3300048913 Ga0496110_0284344 Ga0496110_0284344_597_1022 141
1027 3300048913 Ga0496110_0658388 Ga0496110_0658388_138_563 141
1028 3300048914 Ga0496111_0000253 Ga0496111_0000253_21094_21519 141
1029 3300048914 Ga0496111_0001198 Ga0496111_0001198_6025_6450 141
1030 3300048914 Ga0496111_0002457 Ga0496111_0002457_2579_3004 141
1031 3300048914 Ga0496111_0013288 Ga0496111_0013288_1748_2179 141
1032 3300048914 Ga0496111_0058453 Ga0496111_0058453_2035_2460 141
1033 3300048914 Ga0496111_0202512 Ga0496111_0202512_743_1168 141
1034 3300048914 Ga0496111_0257702 Ga0496111_0257702_642_1067 141
1035 3300048916 Ga0496113_0035170 Ga0496113_0035170_2626_3051 141
1036 3300048916 Ga0496113_0346111 Ga0496113_0346111_93_518 141
1037 3300048916 Ga0496113_1298060 Ga0496113_1298060_121_546 141
1038 3300048917 Ga0496114_0002964 Ga0496114_0002964_10228_10653 141
1039 3300048917 Ga0496114_0012079 Ga0496114_0012079_1414_1845 141
1040 3300048917 Ga0496114_0491052 Ga0496114_0491052_529_960 141
1041 3300048918 Ga0496115_0026439 Ga0496115_0026439_3183_3614 141
1042 3300048919 Ga0496116_0023586 Ga0496116_0023586_841_1272 141
1043 3300048920 Ga0496117_0097260 Ga0496117_0097260_969_1400 141
1044 3300048921 Ga0496118_0056160 Ga0496118_0056160_1264_1695 141
1045 3300048922 Ga0496119_0028537 Ga0496119_0028537_1018_1449 141
1046 3300048923 Ga0496120_0021008 Ga0496120_0021008_3614_4045 141
1047 3300048924 Ga0496121_0000002 Ga0496121_0000002_744879_745310 141
1048 3300048924 Ga0496121_0207186 Ga0496121_0207186_621_1052 141
1049 3300048925 Ga0496122_0000078 Ga0496122_0000078_73075_73506 141
1050 3300048926 Ga0496123_0010533 Ga0496123_0010533_3822_4253 141
1051 3300048927 Ga0496124_0000002 Ga0496124_0000002_749279_749710 141
1052 3300048927 Ga0496124_0306729 Ga0496124_0306729_110_541 141
1053 3300048928 Ga0496125_0000002 Ga0496125_0000002_744879_745310 141
1054 3300048928 Ga0496125_0182339 Ga0496125_0182339_244_675 141
1055 3300048929 Ga0496126_0000009 Ga0496126_0000009_5041_5472 141
1056 3300048929 Ga0496126_0023068 Ga0496126_0023068_142_573 141
1057 3300049127 Ga0501306_017286 Ga0501306_017286_304_729 141
1058 3300049129 Ga0501309_025047 Ga0501309_025047_264_689 141
1059 3300049129 Ga0501309_028902 Ga0501309_028902_242_667 141
1060 3300049129 Ga0501309_054600 Ga0501309_054600_155_580 141
1061 3300049161 Ga0501305_047149 Ga0501305_047149_118_543 141
1062 3300049162 Ga0501307_038394 Ga0501307_038394_15_440 141
1063 3300049514 Ga0501291_009197 Ga0501291_009197_869_1294 141
1064 3300049526 Ga0501303_001909 Ga0501303_001909_119_544 141
1065 3300049527 Ga0501311_024222 Ga0501311_024222_57_482 141
1066 3300049527 Ga0501311_069716 Ga0501311_069716_116_541 141
1067 3300049527 Ga0501311_102109 Ga0501311_102109_61_486 141
1068 3300049532 Ga0501316_034117 Ga0501316_034117_77_505 141
1069 3300049532 Ga0501316_041226 Ga0501316_041226_67_492 141
1070 3300049532 Ga0501316_074332 Ga0501316_074332_44_469 141
1071 3300049534 Ga0501318_078916 Ga0501318_078916_79_504 141
1072 3300049552 Ga0501336_019475 Ga0501336_019475_169_594 141
1073 3300049568 Ga0501031_0016949 Ga0501031_0016949_2952_3380 141
1074 3300049569 Ga0501032_0024261 Ga0501032_0024261_3171_3599 141
1075 3300049569 Ga0501032_0068894 Ga0501032_0068894_585_1010 141
1076 3300049570 Ga0501033_0027043 Ga0501033_0027043_1486_1914 141
1077 3300049570 Ga0501033_0083691 Ga0501033_0083691_1039_1464 141
1078 3300049570 Ga0501033_0183735 Ga0501033_0183735_796_1221 141
1079 3300049571 Ga0501034_0001825 Ga0501034_0001825_20992_21417 141
1080 3300049571 Ga0501034_0004435 Ga0501034_0004435_2711_3136 141
1081 3300049571 Ga0501034_0011458 Ga0501034_0011458_3299_3724 141
1082 3300049571 Ga0501034_0028192 Ga0501034_0028192_3453_3878 141
1083 3300049571 Ga0501034_0098282 Ga0501034_0098282_525_953 141
1084 3300049571 Ga0501034_0190200 Ga0501034_0190200_1112_1537 141
1085 3300049571 Ga0501034_0334869 Ga0501034_0334869_840_1268 141
1086 3300049572 Ga0501036_0008564 Ga0501036_0008564_6115_6540 141
1087 3300049572 Ga0501036_0052124 Ga0501036_0052124_1889_2314 141
1088 3300049572 Ga0501036_0371145 Ga0501036_0371145_216_644 141
1089 3300049572 Ga0501036_0384243 Ga0501036_0384243_602_1030 141
1090 3300049572 Ga0501036_0424602 Ga0501036_0424602_539_967 141
1091 3300049572 Ga0501036_0964615 Ga0501036_0964615_103_528 141
1092 3300049573 Ga0501037_0024685 Ga0501037_0024685_717_1145 141
1093 3300049573 Ga0501037_0094701 Ga0501037_0094701_877_1302 141
1094 3300049573 Ga0501037_0180644 Ga0501037_0180644_838_1266 141
1095 3300049573 Ga0501037_0288035 Ga0501037_0288035_187_612 141
1096 3300049573 Ga0501037_0398242 Ga0501037_0398242_142_567 141
1097 3300049574 Ga0501038_0021581 Ga0501038_0021581_4730_5158 141
1098 3300049574 Ga0501038_0090056 Ga0501038_0090056_799_1224 141
1099 3300049574 Ga0501038_0101489 Ga0501038_0101489_1116_1541 141
1100 3300049574 Ga0501038_0489062 Ga0501038_0489062_213_641 141
1101 3300049575 Ga0501039_0005221 Ga0501039_0005221_3099_3524 141
1102 3300049575 Ga0501039_0009764 Ga0501039_0009764_3317_3742 141
1103 3300049575 Ga0501039_0191823 Ga0501039_0191823_435_863 141
1104 3300049575 Ga0501039_0212634 Ga0501039_0212634_372_800 141
1105 3300049575 Ga0501039_1559121 Ga0501039_1559121_69_494 141
1106 3300049576 Ga0501040_0021776 Ga0501040_0021776_250_675 141
1107 3300049576 Ga0501040_0088404 Ga0501040_0088404_1365_1793 141
1108 3300049576 Ga0501040_0597001 Ga0501040_0597001_238_666 141
1109 3300049576 Ga0501040_0613587 Ga0501040_0613587_93_518 141
1110 3300049576 Ga0501040_0724206 Ga0501040_0724206_198_626 141
1111 3300049577 Ga0501041_0066278 Ga0501041_0066278_793_1218 141
1112 3300049577 Ga0501041_0072088 Ga0501041_0072088_862_1287 141
1113 3300049577 Ga0501041_0072451 Ga0501041_0072451_1116_1544 141
1114 3300049577 Ga0501041_0084784 Ga0501041_0084784_179_607 141
1115 3300049577 Ga0501041_0203311 Ga0501041_0203311_537_962 141
1116 3300049578 Ga0501042_0015092 Ga0501042_0015092_853_1278 141
1117 3300049578 Ga0501042_0031148 Ga0501042_0031148_608_1033 141
1118 3300049578 Ga0501042_0083523 Ga0501042_0083523_1781_2209 141
1119 3300049578 Ga0501042_0135236 Ga0501042_0135236_189_617 141
1120 3300049578 Ga0501042_0804999 Ga0501042_0804999_66_494 141
1121 3300049579 Ga0501043_0038191 Ga0501043_0038191_761_1186 141
1122 3300049579 Ga0501043_0052388 Ga0501043_0052388_627_1055 141
1123 3300049580 Ga0501046_0089286 Ga0501046_0089286_707_1132 141
1124 3300049580 Ga0501046_0149437 Ga0501046_0149437_507_935 141
1125 3300049580 Ga0501046_0174048 Ga0501046_0174048_191_619 141
1126 3300049580 Ga0501046_0256390 Ga0501046_0256390_750_1175 141
1127 3300049581 Ga0501047_0648714 Ga0501047_0648714_417_845 141
1128 3300049582 Ga0501048_0037470 Ga0501048_0037470_1078_1503 141
1129 3300049582 Ga0501048_1395335 Ga0501048_1395335_32_460 141
1130 3300049583 Ga0501067_0036323 Ga0501067_0036323_1472_1897 141
1131 3300049584 Ga0501068_0006593 Ga0501068_0006593_2735_3163 141
1132 3300049584 Ga0501068_0008483 Ga0501068_0008483_1306_1731 141
1133 3300049584 Ga0501068_0668430 Ga0501068_0668430_181_606 141
1134 3300049585 Ga0501069_0002477 Ga0501069_0002477_2927_3352 141
1135 3300049585 Ga0501069_0010347 Ga0501069_0010347_1300_1728 141
1136 3300049585 Ga0501069_0139895 Ga0501069_0139895_457_882 141
1137 3300049585 Ga0501069_0341877 Ga0501069_0341877_393_821 141
1138 3300049586 Ga0501070_0001904 Ga0501070_0001904_15096_15521 141
1139 3300049586 Ga0501070_0002081 Ga0501070_0002081_2802_3227 141
1140 3300049586 Ga0501070_0259225 Ga0501070_0259225_950_1378 141
1141 3300049586 Ga0501070_0379127 Ga0501070_0379127_275_700 141
1142 3300049586 Ga0501070_0574019 Ga0501070_0574019_413_838 141
1143 3300049586 Ga0501070_0962639 Ga0501070_0962639_102_527 141
1144 3300049587 Ga0501071_0043000 Ga0501071_0043000_784_1209 141
1145 3300049587 Ga0501071_0061222 Ga0501071_0061222_57_482 141
1146 3300049587 Ga0501071_0061474 Ga0501071_0061474_1669_2094 141
1147 3300049587 Ga0501071_0114224 Ga0501071_0114224_530_955 141
1148 3300049587 Ga0501071_0149919 Ga0501071_0149919_140_568 141
1149 3300049587 Ga0501071_0185572 Ga0501071_0185572_630_1055 141
1150 3300049587 Ga0501071_0208023 Ga0501071_0208023_839_1264 141
1151 3300049587 Ga0501071_0478713 Ga0501071_0478713_259_684 141
1152 3300049587 Ga0501071_0501929 Ga0501071_0501929_471_896 141
1153 3300049587 Ga0501071_0510421 Ga0501071_0510421_392_817 141
1154 3300049588 Ga0501072_0003175 Ga0501072_0003175_7932_8357 141
1155 3300049588 Ga0501072_0019717 Ga0501072_0019717_3483_3908 141
1156 3300049588 Ga0501072_0038014 Ga0501072_0038014_2435_2860 141
1157 3300049588 Ga0501072_0084371 Ga0501072_0084371_1353_1781 141
1158 3300049588 Ga0501072_0131936 Ga0501072_0131936_882_1310 141
1159 3300049588 Ga0501072_0911664 Ga0501072_0911664_43_468 141
1160 3300049588 Ga0501072_1021909 Ga0501072_1021909_29_454 141
1161 3300049589 Ga0501073_0011047 Ga0501073_0011047_1755_2180 141
1162 3300049589 Ga0501073_0028613 Ga0501073_0028613_3006_3431 141
1163 3300049590 Ga0501074_0006817 Ga0501074_0006817_1890_2315 141
1164 3300049590 Ga0501074_0017339 Ga0501074_0017339_3086_3514 141
1165 3300049590 Ga0501074_0066493 Ga0501074_0066493_826_1251 141
1166 3300049590 Ga0501074_0092415 Ga0501074_0092415_133_558 141
1167 3300049590 Ga0501074_0109746 Ga0501074_0109746_1068_1493 141
1168 3300049590 Ga0501074_0285578 Ga0501074_0285578_594_1022 141
1169 3300049590 Ga0501074_0402709 Ga0501074_0402709_80_505 141
1170 3300049591 Ga0501075_0005970 Ga0501075_0005970_3580_4005 141
1171 3300049591 Ga0501075_0023308 Ga0501075_0023308_1950_2375 141
1172 3300049591 Ga0501075_0031632 Ga0501075_0031632_2036_2464 141
1173 3300049591 Ga0501075_0050053 Ga0501075_0050053_845_1273 141
1174 3300049591 Ga0501075_0062426 Ga0501075_0062426_1322_1747 141
1175 3300049591 Ga0501075_0148711 Ga0501075_0148711_132_560 141
1176 3300049591 Ga0501075_0308386 Ga0501075_0308386_324_749 141
1177 3300049591 Ga0501075_0371085 Ga0501075_0371085_140_565 141
1178 3300049592 Ga0501076_0020768 Ga0501076_0020768_4007_4432 141
1179 3300049592 Ga0501076_0052984 Ga0501076_0052984_1050_1478 141
1180 3300049592 Ga0501076_0060260 Ga0501076_0060260_459_884 141
1181 3300049592 Ga0501076_0126390 Ga0501076_0126390_702_1130 141
1182 3300049592 Ga0501076_0343998 Ga0501076_0343998_628_1053 141
1183 3300049592 Ga0501076_0409119 Ga0501076_0409119_417_842 141
1184 3300049592 Ga0501076_1391824 Ga0501076_1391824_68_493 141
1185 3300049593 Ga0501077_0024807 Ga0501077_0024807_544_969 141
1186 3300049593 Ga0501077_0026395 Ga0501077_0026395_2371_2796 141
1187 3300049593 Ga0501077_0242348 Ga0501077_0242348_631_1059 141
1188 3300049593 Ga0501077_0435766 Ga0501077_0435766_118_546 141
1189 3300049593 Ga0501077_0851495 Ga0501077_0851495_133_558 141
1190 3300049650 Ga0501199_016585 Ga0501199_016585_44_469 141
1191 3300049656 Ga0501209_238709 Ga0501209_238709_23_448 141
1192 3300049665 Ga0501227_213616 Ga0501227_213616_97_522 141
1193 3300049667 Ga0501230_030982 Ga0501230_030982_113_538 141
1194 3300049668 Ga0501233_214728 Ga0501233_214728_69_494 141
1195 3300049679 Ga0501249_026472 Ga0501249_026472_781_1206 141
1196 3300049686 Ga0501257_144951 Ga0501257_144951_31_456 141
1197 3300049705 Ga0501225_0034056 Ga0501225_0034056_915_1340 141
1198 3300049741 Ga0501079_0018979 Ga0501079_0018979_4274_4699 141
1199 3300049741 Ga0501079_0044369 Ga0501079_0044369_756_1181 141
1200 3300049741 Ga0501079_0082058 Ga0501079_0082058_1208_1633 141
1201 3300049741 Ga0501079_0143216 Ga0501079_0143216_1174_1599 141
1202 3300049741 Ga0501079_0292267 Ga0501079_0292267_136_561 141
1203 3300049741 Ga0501079_0402511 Ga0501079_0402511_602_1030 141
1204 3300049741 Ga0501079_0816173 Ga0501079_0816173_93_521 141
1205 3300049742 Ga0501080_0007710 Ga0501080_0007710_7107_7532 141
1206 3300049742 Ga0501080_0018218 Ga0501080_0018218_4363_4788 141
1207 3300049742 Ga0501080_0110153 Ga0501080_0110153_1362_1787 141
1208 3300049742 Ga0501080_0178789 Ga0501080_0178789_1482_1910 141
1209 3300049742 Ga0501080_0206587 Ga0501080_0206587_875_1300 141
1210 3300049742 Ga0501080_0250338 Ga0501080_0250338_165_590 141
1211 3300049742 Ga0501080_0394277 Ga0501080_0394277_155_583 141
1212 3300049742 Ga0501080_0510242 Ga0501080_0510242_492_917 141
1213 3300049742 Ga0501080_0546805 Ga0501080_0546805_506_931 141
1214 3300049742 Ga0501080_0666151 Ga0501080_0666151_35_460 141
1215 3300049742 Ga0501080_1373453 Ga0501080_1373453_10_438 141
1216 3300049743 Ga0501081_0010385 Ga0501081_0010385_2232_2657 141
1217 3300049743 Ga0501081_0016046 Ga0501081_0016046_1817_2242 141
1218 3300049743 Ga0501081_0036210 Ga0501081_0036210_338_763 141
1219 3300049743 Ga0501081_0037558 Ga0501081_0037558_1180_1605 141
1220 3300049743 Ga0501081_0074251 Ga0501081_0074251_190_618 141
1221 3300049743 Ga0501081_0256158 Ga0501081_0256158_775_1203 141
1222 3300049743 Ga0501081_0302907 Ga0501081_0302907_123_551 141
1223 3300049744 Ga0501083_0002562 Ga0501083_0002562_9137_9562 141
1224 3300049744 Ga0501083_0027739 Ga0501083_0027739_2887_3315 141
1225 3300049744 Ga0501083_0055696 Ga0501083_0055696_1958_2383 141
1226 3300049744 Ga0501083_0056432 Ga0501083_0056432_1778_2203 141
1227 3300049744 Ga0501083_0165147 Ga0501083_0165147_242_667 141
1228 3300049744 Ga0501083_0747217 Ga0501083_0747217_57_521 141
1229 3300049765 Ga0501268_114564 Ga0501268_114564_156_581 141
1230 3300049822 Ga0501035_0138158 Ga0501035_0138158_762_1187 141
1231 3300049823 Ga0501044_0061306 Ga0501044_0061306_2698_3126 141
1232 3300049823 Ga0501044_0265811 Ga0501044_0265811_1064_1489 141
1233 3300049823 Ga0501044_0839807 Ga0501044_0839807_78_506 141
1234 3300049824 Ga0501045_0001378 Ga0501045_0001378_8775_9200 141
1235 3300049824 Ga0501045_0015682 Ga0501045_0015682_159_584 141
1236 3300049824 Ga0501045_0122649 Ga0501045_0122649_191_619 141
1237 3300049824 Ga0501045_1280276 Ga0501045_1280276_59_487 141
1238 3300049850 Ga0501204_036419 Ga0501204_036419_155_580 141
1239 3300050507 nmdc:mga05p37_1843080_c1 nmdc:mga05p37_1843080_c1_100_525 141
1240 3300050507 nmdc:mga05p37_234014_c1 nmdc:mga05p37_234014_c1_1083_1508 141
1241 3300050507 nmdc:mga05p37_266633_c1 nmdc:mga05p37_266633_c1_1443_1868 141
1242 3300050507 nmdc:mga05p37_274883_c1 nmdc:mga05p37_274883_c1_1458_1883 141
1243 3300050507 nmdc:mga05p37_31336_c1 nmdc:mga05p37_31336_c1_3756_4181 141
1244 3300050507 nmdc:mga05p37_442530_c1 nmdc:mga05p37_442530_c1_677_1102 141
1245 3300050507 nmdc:mga05p37_44731_c1 nmdc:mga05p37_44731_c1_1044_1469 141
1246 3300050507 nmdc:mga05p37_470239_c1 nmdc:mga05p37_470239_c1_79_504 141
1247 3300050507 nmdc:mga05p37_48432_c1 nmdc:mga05p37_48432_c1_3566_3991 141
1248 3300050507 nmdc:mga05p37_494540_c1 nmdc:mga05p37_494540_c1_298_723 141
1249 3300050507 nmdc:mga05p37_715776_c1 nmdc:mga05p37_715776_c1_521_946 141
1250 3300050508 nmdc:mga09592_126161_c1 nmdc:mga09592_126161_c1_253_678 141
1251 3300050508 nmdc:mga09592_22064_c1 nmdc:mga09592_22064_c1_3592_4017 141
1252 3300050508 nmdc:mga09592_239782_c1 nmdc:mga09592_239782_c1_1082_1507 141
1253 3300050508 nmdc:mga09592_346505_c1 nmdc:mga09592_346505_c1_207_632 141
1254 3300050508 nmdc:mga09592_529614_c1 nmdc:mga09592_529614_c1_167_592 141
1255 3300050509 nmdc:mga0qj67_10020_c1 nmdc:mga0qj67_10020_c1_1992_2417 141
1256 3300050509 nmdc:mga0qj67_105762_c1 nmdc:mga0qj67_105762_c1_597_1022 141
1257 3300050509 nmdc:mga0qj67_404439_c1 nmdc:mga0qj67_404439_c1_571_996 141
1258 3300050510 nmdc:mga06r32_1442060_c1 nmdc:mga06r32_1442060_c1_17_442 141
1259 3300050510 nmdc:mga06r32_1867181_c1 nmdc:mga06r32_1867181_c1_87_512 141
1260 3300050510 nmdc:mga06r32_1895581_c1 nmdc:mga06r32_1895581_c1_64_489 141
1261 3300050510 nmdc:mga06r32_217876_c1 nmdc:mga06r32_217876_c1_412_837 141
1262 3300050510 nmdc:mga06r32_305546_c1 nmdc:mga06r32_305546_c1_287_712 141
1263 3300050510 nmdc:mga06r32_31797_c1 nmdc:mga06r32_31797_c1_744_1169 141
1264 3300050510 nmdc:mga06r32_960647_c1 nmdc:mga06r32_960647_c1_58_483 141
1265 3300050511 nmdc:mga08y16_1403913_c1 nmdc:mga08y16_1403913_c1_13_438 141
1266 3300050511 nmdc:mga08y16_22322_c1 nmdc:mga08y16_22322_c1_2776_3201 141
1267 3300050511 nmdc:mga08y16_81047_c1 nmdc:mga08y16_81047_c1_2615_3040 141
1268 3300050512 nmdc:mga0n895_1114296_c1 nmdc:mga0n895_1114296_c1_51_476 141
1269 3300050512 nmdc:mga0n895_12828_c1 nmdc:mga0n895_12828_c1_6264_6689 141
1270 3300050512 nmdc:mga0n895_147262_c1 nmdc:mga0n895_147262_c1_1557_1982 141
1271 3300050512 nmdc:mga0n895_1479867_c1 nmdc:mga0n895_1479867_c1_179_604 141
1272 3300050512 nmdc:mga0n895_152356_c1 nmdc:mga0n895_152356_c1_1724_2149 141
1273 3300050512 nmdc:mga0n895_1627178_c1 nmdc:mga0n895_1627178_c1_99_524 141
1274 3300050512 nmdc:mga0n895_192299_c1 nmdc:mga0n895_192299_c1_112_537 141
1275 3300050512 nmdc:mga0n895_249714_c1 nmdc:mga0n895_249714_c1_1177_1602 141
1276 3300050512 nmdc:mga0n895_58300_c1 nmdc:mga0n895_58300_c1_1494_1919 141
1277 3300050512 nmdc:mga0n895_677263_c1 nmdc:mga0n895_677263_c1_415_840 141
1278 3300050512 nmdc:mga0n895_8378_c1 nmdc:mga0n895_8378_c1_5182_5607 141
1279 3300050513 nmdc:mga0rr50_1067759_c1 nmdc:mga0rr50_1067759_c1_198_623 141
1280 3300050513 nmdc:mga0rr50_138233_c1 nmdc:mga0rr50_138233_c1_942_1367 141
1281 3300050513 nmdc:mga0rr50_15279_c1 nmdc:mga0rr50_15279_c1_210_641 141
1282 3300050513 nmdc:mga0rr50_170708_c1 nmdc:mga0rr50_170708_c1_624_1049 141
1283 3300050513 nmdc:mga0rr50_281522_c1 nmdc:mga0rr50_281522_c1_119_544 141
1284 3300050513 nmdc:mga0rr50_32299_c1 nmdc:mga0rr50_32299_c1_1512_1937 141
1285 3300050513 nmdc:mga0rr50_449317_c1 nmdc:mga0rr50_449317_c1_124_549 141
1286 3300050513 nmdc:mga0rr50_52987_c1 nmdc:mga0rr50_52987_c1_82_507 141
1287 3300050513 nmdc:mga0rr50_716631_c1 nmdc:mga0rr50_716631_c1_133_558 141
1288 3300050513 nmdc:mga0rr50_732909_c1 nmdc:mga0rr50_732909_c1_263_688 141
1289 3300050514 nmdc:mga08x19_1357833_c1 nmdc:mga08x19_1357833_c1_37_462 141
1290 3300050514 nmdc:mga08x19_19129_c1 nmdc:mga08x19_19129_c1_2442_2867 141
1291 3300050514 nmdc:mga08x19_19755_c1 nmdc:mga08x19_19755_c1_1437_1862 141
1292 3300050514 nmdc:mga08x19_3637_c1 nmdc:mga08x19_3637_c1_488_913 141
1293 3300050514 nmdc:mga08x19_37562_c1 nmdc:mga08x19_37562_c1_1961_2386 141
1294 3300050514 nmdc:mga08x19_48016_c1 nmdc:mga08x19_48016_c1_1700_2125 141
1295 3300050514 nmdc:mga08x19_597742_c1 nmdc:mga08x19_597742_c1_237_662 141
1296 3300050515 nmdc:mga0a205_13792_c1 nmdc:mga0a205_13792_c1_926_1351 141
1297 3300050515 nmdc:mga0a205_154946_c1 nmdc:mga0a205_154946_c1_1516_1941 141
1298 3300050515 nmdc:mga0a205_35256_c1 nmdc:mga0a205_35256_c1_469_894 141
1299 3300050515 nmdc:mga0a205_454932_c1 nmdc:mga0a205_454932_c1_350_775 141
1300 3300050515 nmdc:mga0a205_75368_c1 nmdc:mga0a205_75368_c1_1129_1554 141
1301 3300050515 nmdc:mga0a205_795721_c1 nmdc:mga0a205_795721_c1_306_731 141
1302 3300050515 nmdc:mga0a205_835075_c1 nmdc:mga0a205_835075_c1_156_581 141
1303 3300050516 nmdc:mga0sz30_188368_c1 nmdc:mga0sz30_188368_c1_280_708 141
1304 3300050516 nmdc:mga0sz30_288005_c1 nmdc:mga0sz30_288005_c1_217_648 141
1305 3300053077 Ga0495601_0005535 Ga0495601_0005535_5913_6338 141
1306 3300053077 Ga0495601_0473132 Ga0495601_0473132_52_477 141
1307 3300053078 Ga0495612_0002431 Ga0495612_0002431_2188_2613 141
1308 3300053085 Ga0495619_0002005 Ga0495619_0002005_7922_8347 141
1309 3300053087 Ga0500643_002091 Ga0500643_002091_8902_9333 141
1310 3300053092 Ga0500583_0204545 Ga0500583_0204545_535_966 141
1311 3300053098 Ga0500650_0065980 Ga0500650_0065980_699_1130 141
1312 3300053098 Ga0500650_0217502 Ga0500650_0217502_30_455 141
1313 3300053122 Ga0500608_254793 Ga0500608_254793_202_633 141
1314 3300053131 Ga0500652_028766 Ga0500652_028766_1603_2034 141
1315 3300053133 Ga0500655_039637 Ga0500655_039637_449_880 141
1316 3300053134 Ga0500658_0026465 Ga0500658_0026465_1175_1606 141
1317 3300053158 Ga0500627_0110725 Ga0500627_0110725_722_1153 141
1318 3300053160 Ga0500633_0174392 Ga0500633_0174392_166_597 141
1319 3300053730 Ga0500645_000070 Ga0500645_000070_27589_28020 141
1320 3300054114 Ga0501084_0003886 Ga0501084_0003886_6917_7342 141
1321 3300054114 Ga0501084_0083291 Ga0501084_0083291_564_989 141
1322 3300054114 Ga0501084_0250987 Ga0501084_0250987_49_477 141
1323 3300054114 Ga0501084_1324584 Ga0501084_1324584_57_485 141
1324 3300059490 Ga0587066_122310 Ga0587066_122310_107_532 141
1325 3300059491 Ga0587070_091756 Ga0587070_091756_12_467 141
1326 3300059491 Ga0587070_136859 Ga0587070_136859_17_442 141
1327 3300059493 Ga0587077_115603 Ga0587077_115603_139_594 141
1328 3300059504 Ga0587082_106057 Ga0587082_106057_138_563 141
1329 3300059506 Ga0587085_132017 Ga0587085_132017_34_459 141
1330 3300059508 Ga0587088_137752 Ga0587088_137752_66_491 141
1331 3300059511 Ga0587091_071618 Ga0587091_071618_232_687 141
1332 3300059511 Ga0587091_181236 Ga0587091_181236_28_453 141
1333 3300059623 Ga0587101_076512 Ga0587101_076512_32_457 141
1334 3300059625 Ga0587113_010237 Ga0587113_010237_112_567 141
1335 3300059628 Ga0587122_033441 Ga0587122_033441_139_594 141
1336 3300059639 Ga0587062_059407 Ga0587062_059407_109_534 141
1337 3300059639 Ga0587062_060562 Ga0587062_060562_59_484 141
1338 3300059640 Ga0587067_012048 Ga0587067_012048_84_512 141
1339 3300059640 Ga0587067_101363 Ga0587067_101363_128_553 141
1340 3300059647 Ga0587079_115942 Ga0587079_115942_192_617 141
1341 3300059652 Ga0587107_042448 Ga0587107_042448_59_484 141
1342 3300059652 Ga0587107_104788 Ga0587107_104788_54_479 141
1343 3300059655 Ga0587114_005366 Ga0587114_005366_843_1283 141
1344 3300059659 Ga0587120_019482 Ga0587120_019482_150_575 141
1345 3300060346 Ga0587111_0073985 Ga0587111_0073985_233_658 141
1346 3300060346 Ga0587111_0089905 Ga0587111_0089905_271_696 141
1347 3300060353 Ga0501082_0069733 Ga0501082_0069733_1037_1462 141
1348 3300060353 Ga0501082_0086596 Ga0501082_0086596_1235_1660 141
1349 3300060353 Ga0501082_0105315 Ga0501082_0105315_162_587 141
1350 3300060353 Ga0501082_0193646 Ga0501082_0193646_675_1100 141
1351 3300060353 Ga0501082_0505575 Ga0501082_0505575_360_788 141
1352 3300060353 Ga0501082_1036168 Ga0501082_1036168_165_593 141
1353 3300060353 Ga0501082_1190962 Ga0501082_1190962_226_651 141
1354 3300061734 Ga0530510_0004004 Ga0530510_0004004_2916_3344 141
1355 3300061734 Ga0530510_0026128 Ga0530510_0026128_3037_3465 141
1356 3300061734 Ga0530510_0033355 Ga0530510_0033355_941_1366 141
1357 3300061734 Ga0530510_0074871 Ga0530510_0074871_997_1425 141
1358 3300061734 Ga0530510_0148544 Ga0530510_0148544_791_1216 141
1359 3300061734 Ga0530510_0927871 Ga0530510_0927871_99_527 141
1360 3300003203 JGI25406J46586_10093540 JGI25406J46586_100935402 142
1361 3300003373 JGI25407J50210_10026065 JGI25407J50210_100260652 142
1362 3300003373 JGI25407J50210_10031389 JGI25407J50210_100313891 142
1363 3300003373 JGI25407J50210_10079880 JGI25407J50210_100798802 142
1364 3300003373 JGI25407J50210_10124971 JGI25407J50210_101249711 142
1365 3300005327 Ga0070658_10014764 Ga0070658_100147641 142
1366 3300005327 Ga0070658_10035033 Ga0070658_100350335 142
1367 3300005329 Ga0070683_100797981 Ga0070683_1007979812 142
1368 3300005335 Ga0070666_11281072 Ga0070666_112810721 142
1369 3300005335 Ga0070666_11407830 Ga0070666_114078301 142
1370 3300005337 Ga0070682_101374425 Ga0070682_1013744251 142
1371 3300005338 Ga0068868_100294601 Ga0068868_1002946011 142
1372 3300005347 Ga0070668_100218565 Ga0070668_1002185652 142
1373 3300005356 Ga0070674_100502480 Ga0070674_1005024801 142
1374 3300005367 Ga0070667_100588452 Ga0070667_1005884522 142
1375 3300005434 Ga0070709_10194527 Ga0070709_101945272 142
1376 3300005439 Ga0070711_100101320 Ga0070711_1001013202 142
1377 3300005439 Ga0070711_100295565 Ga0070711_1002955652 142
1378 3300005445 Ga0070708_100001875 Ga0070708_10000187510 142
1379 3300005445 Ga0070708_100009872 Ga0070708_1000098725 142
1380 3300005445 Ga0070708_100026021 Ga0070708_1000260214 142
1381 3300005445 Ga0070708_100038311 Ga0070708_1000383114 142
1382 3300005445 Ga0070708_100113806 Ga0070708_1001138062 142
1383 3300005445 Ga0070708_100530437 Ga0070708_1005304372 142
1384 3300005445 Ga0070708_100647765 Ga0070708_1006477652 142
1385 3300005455 Ga0070663_100856075 Ga0070663_1008560752 142
1386 3300005456 Ga0070678_100237683 Ga0070678_1002376832 142
1387 3300005456 Ga0070678_101332872 Ga0070678_1013328721 142
1388 3300005457 Ga0070662_100118743 Ga0070662_1001187432 142
1389 3300005458 Ga0070681_10030203 Ga0070681_100302032 142
1390 3300005458 Ga0070681_10242250 Ga0070681_102422502 142
1391 3300005467 Ga0070706_100037613 Ga0070706_1000376133 142
1392 3300005467 Ga0070706_100102019 Ga0070706_1001020193 142
1393 3300005467 Ga0070706_100155616 Ga0070706_1001556163 142
1394 3300005467 Ga0070706_100247090 Ga0070706_1002470903 142
1395 3300005468 Ga0070707_100616431 Ga0070707_1006164311 142
1396 3300005468 Ga0070707_100683975 Ga0070707_1006839752 142
1397 3300005471 Ga0070698_100145799 Ga0070698_1001457992 142
1398 3300005471 Ga0070698_100215775 Ga0070698_1002157752 142
1399 3300005471 Ga0070698_100601583 Ga0070698_1006015832 142
1400 3300005518 Ga0070699_101024870 Ga0070699_1010248701 142
1401 3300005535 Ga0070684_100296257 Ga0070684_1002962572 142
1402 3300005536 Ga0070697_100165774 Ga0070697_1001657742 142
1403 3300005536 Ga0070697_100232385 Ga0070697_1002323851 142
1404 3300005543 Ga0070672_100330601 Ga0070672_1003306012 142
1405 3300005545 Ga0070695_100487002 Ga0070695_1004870021 142
1406 3300005545 Ga0070695_100609289 Ga0070695_1006092891 142
1407 3300005548 Ga0070665_101538031 Ga0070665_1015380311 142
1408 3300005549 Ga0070704_100295050 Ga0070704_1002950502 142
1409 3300005563 Ga0068855_100008080 Ga0068855_10000808017 142
1410 3300005563 Ga0068855_100487608 Ga0068855_1004876082 142
1411 3300005577 Ga0068857_100921128 Ga0068857_1009211282 142
1412 3300005615 Ga0070702_101752067 Ga0070702_1017520671 142
1413 3300005616 Ga0068852_100350283 Ga0068852_1003502832 142
1414 3300005617 Ga0068859_100312537 Ga0068859_1003125372 142
1415 3300005719 Ga0068861_100021820 Ga0068861_1000218205 142
1416 3300005842 Ga0068858_101223083 Ga0068858_1012230831 142
1417 3300005843 Ga0068860_100624425 Ga0068860_1006244252 142
1418 3300005844 Ga0068862_100739256 Ga0068862_1007392561 142
1419 3300005937 Ga0081455_10069173 Ga0081455_100691733 142
1420 3300005937 Ga0081455_10195605 Ga0081455_101956052 142
1421 3300005937 Ga0081455_10245518 Ga0081455_102455181 142
1422 3300005937 Ga0081455_10466592 Ga0081455_104665921 142
1423 3300005981 Ga0081538_10006583 Ga0081538_100065839 142
1424 3300005981 Ga0081538_10015184 Ga0081538_100151848 142
1425 3300005981 Ga0081538_10015781 Ga0081538_100157816 142
1426 3300005981 Ga0081538_10022340 Ga0081538_100223405 142
1427 3300005981 Ga0081538_10032288 Ga0081538_100322882 142
1428 3300005985 Ga0081539_10016636 Ga0081539_1001663613 142
1429 3300005985 Ga0081539_10050718 Ga0081539_100507182 142
1430 3300005985 Ga0081539_10144729 Ga0081539_101447292 142
1431 3300005985 Ga0081539_10281444 Ga0081539_102814442 142
1432 3300005985 Ga0081539_10388515 Ga0081539_103885151 142
1433 3300005985 Ga0081539_10412960 Ga0081539_104129601 142
1434 3300006048 Ga0075363_100652925 Ga0075363_1006529251 142
1435 3300006058 Ga0075432_10009313 Ga0075432_100093135 142
1436 3300006173 Ga0070716_100407425 Ga0070716_1004074252 142
1437 3300006173 Ga0070716_100408267 Ga0070716_1004082672 142
1438 3300006175 Ga0070712_100032442 Ga0070712_1000324424 142
1439 3300006175 Ga0070712_100045807 Ga0070712_1000458076 142
1440 3300006358 Ga0068871_100921738 Ga0068871_1009217381 142
1441 3300006844 Ga0075428_100037031 Ga0075428_1000370313 142
1442 3300006844 Ga0075428_100062749 Ga0075428_1000627492 142
1443 3300006844 Ga0075428_100779765 Ga0075428_1007797652 142
1444 3300006844 Ga0075428_101640271 Ga0075428_1016402712 142
1445 3300006846 Ga0075430_100008456 Ga0075430_1000084567 142
1446 3300006846 Ga0075430_100210180 Ga0075430_1002101802 142
1447 3300006847 Ga0075431_100011289 Ga0075431_1000112896 142
1448 3300006852 Ga0075433_10614945 Ga0075433_106149452 142
1449 3300006852 Ga0075433_10617269 Ga0075433_106172692 142
1450 3300006871 Ga0075434_100221168 Ga0075434_1002211682 142
1451 3300006880 Ga0075429_100032360 Ga0075429_1000323605 142
1452 3300006880 Ga0075429_100573817 Ga0075429_1005738172 142
1453 3300006881 Ga0068865_100223348 Ga0068865_1002233483 142
1454 3300006931 Ga0097620_100312532 Ga0097620_1003125322 142
1455 3300007076 Ga0075435_100202213 Ga0075435_1002022132 142
1456 3300007076 Ga0075435_101766853 Ga0075435_1017668531 142
1457 3300009093 Ga0105240_11523412 Ga0105240_115234122 142
1458 3300009094 Ga0111539_10135693 Ga0111539_101356936 142
1459 3300009098 Ga0105245_10702623 Ga0105245_107026231 142
1460 3300009147 Ga0114129_12345368 Ga0114129_123453681 142
1461 3300009148 Ga0105243_10800184 Ga0105243_108001842 142
1462 3300009174 Ga0105241_11863835 Ga0105241_118638351 142
1463 3300009176 Ga0105242_10732385 Ga0105242_107323852 142
1464 3300009177 Ga0105248_11186509 Ga0105248_111865092 142
1465 3300009545 Ga0105237_10835571 Ga0105237_108355711 142
1466 3300010375 Ga0105239_10714784 Ga0105239_107147842 142
1467 3300011119 Ga0105246_10150916 Ga0105246_101509162 142
1468 3300012492 Ga0157335_1013376 Ga0157335_10133762 142
1469 3300013104 Ga0157370_12114585 Ga0157370_121145851 142
1470 3300013296 Ga0157374_10723714 Ga0157374_107237142 142
1471 3300013308 Ga0157375_10351657 Ga0157375_103516572 142
1472 3300014326 Ga0157380_10383492 Ga0157380_103834923 142
1473 3300014326 Ga0157380_10561762 Ga0157380_105617622 142
1474 3300014326 Ga0157380_10807157 Ga0157380_108071572 142
1475 3300014968 Ga0157379_10685741 Ga0157379_106857412 142
1476 3300017792 Ga0163161_10062558 Ga0163161_100625585 142
1477 3300020069 Ga0197907_10289603 Ga0197907_102896032 142
1478 3300020069 Ga0197907_10826265 Ga0197907_108262651 142
1479 3300020069 Ga0197907_11255837 Ga0197907_112558372 142
1480 3300020075 Ga0206349_1398502 Ga0206349_13985021 142
1481 3300020075 Ga0206349_1772263 Ga0206349_17722632 142
1482 3300020076 Ga0206355_1329627 Ga0206355_13296272 142
1483 3300020076 Ga0206355_1413872 Ga0206355_14138722 142
1484 3300020077 Ga0206351_10081284 Ga0206351_100812842 142
1485 3300020077 Ga0206351_10450698 Ga0206351_104506981 142
1486 3300020078 Ga0206352_10445022 Ga0206352_104450222 142
1487 3300020080 Ga0206350_10488094 Ga0206350_104880942 142
1488 3300020080 Ga0206350_11131134 Ga0206350_111311342 142
1489 3300020081 Ga0206354_11623678 Ga0206354_116236782 142
1490 3300020610 Ga0154015_1148597 Ga0154015_11485974 142
1491 3300021377 Ga0213874_10128600 Ga0213874_101286001 142
1492 3300022467 Ga0224712_10022816 Ga0224712_100228162 142
1493 3300022467 Ga0224712_10146899 Ga0224712_101468992 142
1494 3300025899 Ga0207642_11145419 Ga0207642_111454191 142
1495 3300025907 Ga0207645_10394449 Ga0207645_103944492 142
1496 3300025908 Ga0207643_10362335 Ga0207643_103623352 142
1497 3300025909 Ga0207705_10013204 Ga0207705_100132044 142
1498 3300025909 Ga0207705_10092249 Ga0207705_100922491 142
1499 3300025910 Ga0207684_10062736 Ga0207684_100627364 142
1500 3300025910 Ga0207684_10605097 Ga0207684_106050972 142
1501 3300025912 Ga0207707_10108194 Ga0207707_101081944 142
1502 3300025912 Ga0207707_10738365 Ga0207707_107383651 142
1503 3300025915 Ga0207693_10031353 Ga0207693_100313535 142
1504 3300025915 Ga0207693_10161592 Ga0207693_101615921 142
1505 3300025915 Ga0207693_10437350 Ga0207693_104373501 142
1506 3300025916 Ga0207663_10149467 Ga0207663_101494671 142
1507 3300025922 Ga0207646_10414262 Ga0207646_104142622 142
1508 3300025922 Ga0207646_10940538 Ga0207646_109405381 142
1509 3300025925 Ga0207650_11623755 Ga0207650_116237551 142
1510 3300025927 Ga0207687_11115510 Ga0207687_111155101 142
1511 3300025933 Ga0207706_10007064 Ga0207706_100070647 142
1512 3300025934 Ga0207686_10483869 Ga0207686_104838691 142
1513 3300025935 Ga0207709_11087214 Ga0207709_110872141 142
1514 3300025936 Ga0207670_10375870 Ga0207670_103758702 142
1515 3300025937 Ga0207669_10227123 Ga0207669_102271232 142
1516 3300025938 Ga0207704_10679105 Ga0207704_106791052 142
1517 3300025938 Ga0207704_10692725 Ga0207704_106927252 142
1518 3300025940 Ga0207691_10291574 Ga0207691_102915741 142
1519 3300025940 Ga0207691_10588829 Ga0207691_105888291 142
1520 3300025944 Ga0207661_10402217 Ga0207661_104022172 142
1521 3300025944 Ga0207661_10822986 Ga0207661_108229862 142
1522 3300025949 Ga0207667_10050333 Ga0207667_100503335 142
1523 3300025949 Ga0207667_10599410 Ga0207667_105994102 142
1524 3300025960 Ga0207651_10912018 Ga0207651_109120181 142
1525 3300025961 Ga0207712_10088022 Ga0207712_100880223 142
1526 3300025972 Ga0207668_10242873 Ga0207668_102428733 142
1527 3300025981 Ga0207640_11330899 Ga0207640_113308991 142
1528 3300026035 Ga0207703_11065567 Ga0207703_110655672 142
1529 3300026041 Ga0207639_10007985 Ga0207639_100079856 142
1530 3300026041 Ga0207639_10789286 Ga0207639_107892862 142
1531 3300026067 Ga0207678_10313808 Ga0207678_103138082 142
1532 3300026067 Ga0207678_10437016 Ga0207678_104370162 142
1533 3300026067 Ga0207678_10677499 Ga0207678_106774991 142
1534 3300026067 Ga0207678_11435562 Ga0207678_114355622 142
1535 3300026075 Ga0207708_11198562 Ga0207708_111985621 142
1536 3300026095 Ga0207676_11065218 Ga0207676_110652181 142
1537 3300026118 Ga0207675_100002284 Ga0207675_1000022849 142
1538 3300026121 Ga0207683_10280864 Ga0207683_102808641 142
1539 3300026121 Ga0207683_10397144 Ga0207683_103971442 142
1540 3300027907 Ga0207428_10001214 Ga0207428_1000121413 142
1541 3300027907 Ga0207428_10282610 Ga0207428_102826102 142
1542 3300028380 Ga0268265_10108431 Ga0268265_101084312 142
1543 3300028380 Ga0268265_12005852 Ga0268265_120058521 142
1544 3300028381 Ga0268264_11686178 Ga0268264_116861781 142
1545 3300028800 Ga0265338_10660510 Ga0265338_106605102 142
1546 3300030735 Ga0316178_1142980 Ga0316178_11429802 142
1547 3300031242 Ga0265329_10190520 Ga0265329_101905201 142
1548 3300031251 Ga0265327_10039295 Ga0265327_100392955 142
1549 3300031251 Ga0265327_10077994 Ga0265327_100779942 142
1550 3300031251 Ga0265327_10151683 Ga0265327_101516832 142
1551 3300031548 Ga0307408_100018340 Ga0307408_1000183408 142
1552 3300031548 Ga0307408_100129592 Ga0307408_1001295924 142
1553 3300031548 Ga0307408_100310521 Ga0307408_1003105211 142
1554 3300031548 Ga0307408_101256219 Ga0307408_1012562192 142
1555 3300031548 Ga0307408_101559348 Ga0307408_1015593481 142
1556 3300031691 Ga0316579_10029849 Ga0316579_100298493 142
1557 3300031728 Ga0316578_10075076 Ga0316578_100750762 142
1558 3300031731 Ga0307405_10015410 Ga0307405_100154104 142
1559 3300031731 Ga0307405_10077574 Ga0307405_100775742 142
1560 3300031731 Ga0307405_10243990 Ga0307405_102439902 142
1561 3300031731 Ga0307405_10326077 Ga0307405_103260772 142
1562 3300031824 Ga0307413_10031973 Ga0307413_100319734 142
1563 3300031824 Ga0307413_10143794 Ga0307413_101437943 142
1564 3300031824 Ga0307413_10286648 Ga0307413_102866482 142
1565 3300031824 Ga0307413_10822663 Ga0307413_108226631 142
1566 3300031852 Ga0307410_10022751 Ga0307410_100227514 142
1567 3300031852 Ga0307410_10030239 Ga0307410_100302393 142
1568 3300031852 Ga0307410_10030534 Ga0307410_100305341 142
1569 3300031852 Ga0307410_10073365 Ga0307410_100733653 142
1570 3300031852 Ga0307410_10105203 Ga0307410_101052033 142
1571 3300031852 Ga0307410_10162582 Ga0307410_101625822 142
1572 3300031852 Ga0307410_11351666 Ga0307410_113516661 142
1573 3300031901 Ga0307406_10027895 Ga0307406_100278952 142
1574 3300031901 Ga0307406_10037946 Ga0307406_100379464 142
1575 3300031901 Ga0307406_10082561 Ga0307406_100825614 142
1576 3300031901 Ga0307406_10144734 Ga0307406_101447344 142
1577 3300031903 Ga0307407_10002922 Ga0307407_100029221 142
1578 3300031903 Ga0307407_10032524 Ga0307407_100325245 142
1579 3300031903 Ga0307407_10102636 Ga0307407_101026362 142
1580 3300031911 Ga0307412_10017832 Ga0307412_100178326 142
1581 3300031911 Ga0307412_10464684 Ga0307412_104646842 142
1582 3300031911 Ga0307412_10608936 Ga0307412_106089362 142
1583 3300031995 Ga0307409_100011628 Ga0307409_1000116284 142
1584 3300031995 Ga0307409_100016862 Ga0307409_1000168626 142
1585 3300031995 Ga0307409_100017410 Ga0307409_1000174102 142
1586 3300031995 Ga0307409_100059656 Ga0307409_1000596564 142
1587 3300031995 Ga0307409_100231768 Ga0307409_1002317682 142
1588 3300031995 Ga0307409_101230984 Ga0307409_1012309842 142
1589 3300032002 Ga0307416_100006221 Ga0307416_1000062213 142
1590 3300032002 Ga0307416_100016342 Ga0307416_1000163424 142
1591 3300032002 Ga0307416_100028648 Ga0307416_10002864810 142
1592 3300032002 Ga0307416_100042342 Ga0307416_1000423425 142
1593 3300032002 Ga0307416_100042573 Ga0307416_1000425735 142
1594 3300032002 Ga0307416_100079241 Ga0307416_1000792411 142
1595 3300032002 Ga0307416_100198442 Ga0307416_1001984423 142
1596 3300032002 Ga0307416_101110166 Ga0307416_1011101662 142
1597 3300032002 Ga0307416_101207766 Ga0307416_1012077661 142
1598 3300032004 Ga0307414_10016142 Ga0307414_100161425 142
1599 3300032004 Ga0307414_10044439 Ga0307414_100444395 142
1600 3300032004 Ga0307414_10097343 Ga0307414_100973433 142
1601 3300032004 Ga0307414_10203471 Ga0307414_102034713 142
1602 3300032004 Ga0307414_10310847 Ga0307414_103108472 142
1603 3300032004 Ga0307414_11065950 Ga0307414_110659501 142
1604 3300032005 Ga0307411_10051454 Ga0307411_100514544 142
1605 3300032005 Ga0307411_10251740 Ga0307411_102517402 142
1606 3300032005 Ga0307411_10687854 Ga0307411_106878542 142
1607 3300032126 Ga0307415_100007685 Ga0307415_1000076857 142
1608 3300032126 Ga0307415_100008796 Ga0307415_1000087967 142
1609 3300032126 Ga0307415_100092567 Ga0307415_1000925673 142
1610 3300032126 Ga0307415_100128860 Ga0307415_1001288602 142
1611 3300032126 Ga0307415_100174879 Ga0307415_1001748792 142
1612 3300032126 Ga0307415_101304037 Ga0307415_1013040372 142
1613 3300032133 Ga0316583_10062633 Ga0316583_100626332 142
1614 3300032168 Ga0316593_10022093 Ga0316593_100220932 142
1615 3300035113 Ga0373936_0403795 Ga0373936_0403795_68_496 142
1616 3300035117 Ga0373953_0282696 Ga0373953_0282696_114_542 142
1617 3300035398 Ga0316574_0410271 Ga0316574_0410271_296_730 142
1618 3300035410 Ga0373924_0490894 Ga0373924_0490894_78_506 142
1619 3300035724 Ga0373933_0312077 Ga0373933_0312077_497_925 142
1620 3300036401 Ga0373937_0767119 Ga0373937_0767119_181_609 142
1621 3300036647 Ga0316582_0024225 Ga0316582_0024225_1635_2069 142
1622 3300036647 Ga0316582_0097952 Ga0316582_0097952_1040_1468 142
1623 3300036647 Ga0316582_0638498 Ga0316582_0638498_211_645 142
1624 3300036712 Ga0316584_0532077 Ga0316584_0532077_101_535 142
1625 3300037068 Ga0373925_0652817 Ga0373925_0652817_35_463 142
1626 3300037068 Ga0373925_1027307 Ga0373925_1027307_67_495 142
1627 3300037312 Ga0395899_0065854 Ga0395899_0065854_71_499 142
1628 3300037312 Ga0395899_0288370 Ga0395899_0288370_426_869 142
1629 3300037418 Ga0395900_0119149 Ga0395900_0119149_1424_1852 142
1630 3300037418 Ga0395900_0168044 Ga0395900_0168044_280_723 142
1631 3300037466 Ga0395898_0597414 Ga0395898_0597414_446_874 142
1632 3300037471 Ga0395905_0020676 Ga0395905_0020676_336_764 142
1633 3300037471 Ga0395905_0169173 Ga0395905_0169173_1234_1677 142
1634 3300037471 Ga0395905_0177309 Ga0395905_0177309_548_976 142
1635 3300037471 Ga0395905_0192148 Ga0395905_0192148_1357_1803 142
1636 3300037471 Ga0395905_0864496 Ga0395905_0864496_303_746 142
1637 3300037853 Ga0436364_0804097 Ga0436364_0804097_19252_19686 142
1638 3300038443 Ga0395901_0040860 Ga0395901_0040860_3046_3474 142
1639 3300038443 Ga0395901_0048988 Ga0395901_0048988_3754_4197 142
1640 3300038443 Ga0395901_0146976 Ga0395901_0146976_656_1084 142
1641 3300038443 Ga0395901_0170015 Ga0395901_0170015_1230_1673 142
1642 3300038443 Ga0395901_0197940 Ga0395901_0197940_1094_1537 142
1643 3300038443 Ga0395901_0479317 Ga0395901_0479317_658_1104 142
1644 3300038443 Ga0395901_1278622 Ga0395901_1278622_53_505 142
1645 3300038735 Ga0400485_10207 Ga0400485_10207_23298_23726 142
1646 3300039062 Ga0400483_023072 Ga0400483_023072_917_1345 142
1647 3300039062 Ga0400483_115887 Ga0400483_115887_138_566 142
1648 3300039062 Ga0400483_119646 Ga0400483_119646_5103_5531 142
1649 3300039062 Ga0400483_121060 Ga0400483_121060_493_921 142
1650 3300039062 Ga0400483_144468 Ga0400483_144468_5760_6188 142
1651 3300039062 Ga0400483_195692 Ga0400483_195692_5222_5650 142
1652 3300039062 Ga0400483_272214 Ga0400483_272214_7086_7514 142
1653 3300039450 Ga0436363_0282649 Ga0436363_0282649_451_879 142
1654 3300039453 Ga0436362_0104946 Ga0436362_0104946_28_462 142
1655 3300041405 Ga0439438_048477 Ga0439438_048477_257_685 142
1656 3300041459 Ga0451800_1416039 Ga0451800_1416039_51_479 142
1657 3300041997 Ga0439431_0070471 Ga0439431_0070471_200_628 142
1658 3300042010 Ga0439452_019558 Ga0439452_019558_1300_1728 142
1659 3300042016 Ga0439463_062878 Ga0439463_062878_95_538 142
1660 3300042127 Ga0450890_015867 Ga0450890_015867_435_878 142
1661 3300042156 Ga0439446_0048935 Ga0439446_0048935_543_971 142
1662 3300042876 Ga0451577_0000008 Ga0451577_0000008_334_762 142
1663 3300044683 Ga0466965_0497436 Ga0466965_0497436_56_484 142
1664 3300044712 Ga0453684_0000032 Ga0453684_0000032_49488_49916 142
1665 3300044735 Ga0466968_0097578 Ga0466968_0097578_48_476 142
1666 3300044842 Ga0466957_1134013 Ga0466957_1134013_96_524 142
1667 3300045049 Ga0466959_0092346 Ga0466959_0092346_298_726 142
1668 3300045836 Ga0466958_0736427 Ga0466958_0736427_58_492 142
1669 3300045976 Ga0466967_0533573 Ga0466967_0533573_668_1096 142
1670 3300046499 Ga0495594_0524069 Ga0495594_0524069_32_460 142
1671 3300046511 Ga0495608_0173571 Ga0495608_0173571_367_795 142
1672 3300046516 Ga0495628_0401137 Ga0495628_0401137_256_684 142
1673 3300046517 Ga0495630_0058372 Ga0495630_0058372_440_868 142
1674 3300046517 Ga0495630_0399443 Ga0495630_0399443_52_480 142
1675 3300046533 Ga0495640_0098790 Ga0495640_0098790_1256_1684 142
1676 3300046535 Ga0495586_0254933 Ga0495586_0254933_557_985 142
1677 3300046543 Ga0495645_0170033 Ga0495645_0170033_968_1396 142
1678 3300046559 Ga0495667_0592863 Ga0495667_0592863_125_553 142
1679 3300046642 Ga0495634_0079214 Ga0495634_0079214_1682_2110 142
1680 3300046674 Ga0495588_0027860 Ga0495588_0027860_2299_2733 142
1681 3300046675 Ga0495657_0361764 Ga0495657_0361764_374_802 142
1682 3300046678 Ga0495599_0228123 Ga0495599_0228123_27_455 142
1683 3300046683 Ga0495658_0564017 Ga0495658_0564017_197_625 142
1684 3300046689 Ga0495613_0319453 Ga0495613_0319453_410_844 142
1685 3300046690 Ga0495624_0170535 Ga0495624_0170535_371_799 142
1686 3300047317 Ga0495604_0478703 Ga0495604_0478703_289_717 142
1687 3300047319 Ga0495674_0284414 Ga0495674_0284414_544_972 142
1688 3300047320 Ga0495672_0289337 Ga0495672_0289337_99_527 142
1689 3300047321 Ga0495676_0206502 Ga0495676_0206502_487_918 142
1690 3300047322 Ga0495680_0190067 Ga0495680_0190067_818_1246 142
1691 3300047322 Ga0495680_0276999 Ga0495680_0276999_373_801 142
1692 3300047322 Ga0495680_0853592 Ga0495680_0853592_131_559 142
1693 3300048090 Ga0495615_0087364 Ga0495615_0087364_27_455 142
1694 3300048903 Ga0496100_0060305 Ga0496100_0060305_1519_1947 142
1695 3300048903 Ga0496100_1225757 Ga0496100_1225757_41_487 142
1696 3300048904 Ga0496101_0079646 Ga0496101_0079646_1549_1977 142
1697 3300048904 Ga0496101_0228242 Ga0496101_0228242_144_572 142
1698 3300048904 Ga0496101_0560090 Ga0496101_0560090_59_487 142
1699 3300048904 Ga0496101_1218637 Ga0496101_1218637_44_490 142
1700 3300048905 Ga0496102_0994721 Ga0496102_0994721_288_716 142
1701 3300048907 Ga0496104_0051315 Ga0496104_0051315_1492_1938 142
1702 3300048907 Ga0496104_0187871 Ga0496104_0187871_376_804 142
1703 3300048907 Ga0496104_0263311 Ga0496104_0263311_848_1276 142
1704 3300048908 Ga0496105_0053016 Ga0496105_0053016_1313_1741 142
1705 3300048908 Ga0496105_0058470 Ga0496105_0058470_203_631 142
1706 3300048912 Ga0496109_0099602 Ga0496109_0099602_313_741 142
1707 3300048913 Ga0496110_0117605 Ga0496110_0117605_1005_1433 142
1708 3300048913 Ga0496110_0734053 Ga0496110_0734053_438_866 142
1709 3300048914 Ga0496111_0048415 Ga0496111_0048415_2443_2889 142
1710 3300048915 Ga0496112_0251313 Ga0496112_0251313_381_809 142
1711 3300048916 Ga0496113_0113068 Ga0496113_0113068_952_1380 142
1712 3300048916 Ga0496113_0330602 Ga0496113_0330602_745_1191 142
1713 3300048917 Ga0496114_0029892 Ga0496114_0029892_567_995 142
1714 3300048917 Ga0496114_0339872 Ga0496114_0339872_784_1230 142
1715 3300048918 Ga0496115_0005604 Ga0496115_0005604_6147_6575 142
1716 3300048918 Ga0496115_0136732 Ga0496115_0136732_1184_1612 142
1717 3300049569 Ga0501032_0480364 Ga0501032_0480364_261_689 142
1718 3300049569 Ga0501032_0881621 Ga0501032_0881621_50_478 142
1719 3300049570 Ga0501033_0140536 Ga0501033_0140536_990_1418 142
1720 3300049571 Ga0501034_0024059 Ga0501034_0024059_3300_3728 142
1721 3300049572 Ga0501036_0969532 Ga0501036_0969532_227_655 142
1722 3300049573 Ga0501037_0153293 Ga0501037_0153293_611_1039 142
1723 3300049574 Ga0501038_0306554 Ga0501038_0306554_462_890 142
1724 3300049575 Ga0501039_0160753 Ga0501039_0160753_75_506 142
1725 3300049575 Ga0501039_0421927 Ga0501039_0421927_404_832 142
1726 3300049575 Ga0501039_1452088 Ga0501039_1452088_33_461 142
1727 3300049576 Ga0501040_0232658 Ga0501040_0232658_862_1293 142
1728 3300049580 Ga0501046_0049684 Ga0501046_0049684_888_1316 142
1729 3300049581 Ga0501047_0063124 Ga0501047_0063124_1577_2005 142
1730 3300049582 Ga0501048_0314083 Ga0501048_0314083_15_443 142
1731 3300049582 Ga0501048_0514070 Ga0501048_0514070_246_674 142
1732 3300049584 Ga0501068_0065114 Ga0501068_0065114_706_1134 142
1733 3300049584 Ga0501068_0104588 Ga0501068_0104588_839_1267 142
1734 3300049586 Ga0501070_0011947 Ga0501070_0011947_1433_1861 142
1735 3300049586 Ga0501070_0404585 Ga0501070_0404585_112_540 142
1736 3300049586 Ga0501070_0685536 Ga0501070_0685536_134_562 142
1737 3300049587 Ga0501071_0014800 Ga0501071_0014800_2036_2467 142
1738 3300049587 Ga0501071_0582403 Ga0501071_0582403_63_491 142
1739 3300049588 Ga0501072_0117785 Ga0501072_0117785_318_746 142
1740 3300049588 Ga0501072_0198763 Ga0501072_0198763_442_873 142
1741 3300049588 Ga0501072_0379532 Ga0501072_0379532_12_440 142
1742 3300049589 Ga0501073_0118279 Ga0501073_0118279_1382_1810 142
1743 3300049589 Ga0501073_0269393 Ga0501073_0269393_547_975 142
1744 3300049589 Ga0501073_1005308 Ga0501073_1005308_43_471 142
1745 3300049591 Ga0501075_0317128 Ga0501075_0317128_409_837 142
1746 3300049591 Ga0501075_0771086 Ga0501075_0771086_235_663 142
1747 3300049592 Ga0501076_1281663 Ga0501076_1281663_76_504 142
1748 3300049593 Ga0501077_0138650 Ga0501077_0138650_908_1336 142
1749 3300049741 Ga0501079_0352118 Ga0501079_0352118_681_1109 142
1750 3300049741 Ga0501079_1353608 Ga0501079_1353608_44_472 142
1751 3300049742 Ga0501080_0027162 Ga0501080_0027162_1343_1771 142
1752 3300049742 Ga0501080_0886675 Ga0501080_0886675_331_759 142
1753 3300049742 Ga0501080_1211230 Ga0501080_1211230_129_557 142
1754 3300049743 Ga0501081_0180039 Ga0501081_0180039_262_690 142
1755 3300049743 Ga0501081_0220085 Ga0501081_0220085_512_943 142
1756 3300049743 Ga0501081_0310373 Ga0501081_0310373_50_478 142
1757 3300049743 Ga0501081_0708328 Ga0501081_0708328_311_739 142
1758 3300049744 Ga0501083_0072489 Ga0501083_0072489_1449_1877 142
1759 3300049823 Ga0501044_0252189 Ga0501044_0252189_836_1264 142
1760 3300049823 Ga0501044_0293978 Ga0501044_0293978_906_1337 142
1761 3300049823 Ga0501044_0395691 Ga0501044_0395691_519_968 142
1762 3300049824 Ga0501045_0457910 Ga0501045_0457910_172_600 142
1763 3300050507 nmdc:mga05p37_46897_c1 nmdc:mga05p37_46897_c1_4206_4637 142
1764 3300050509 nmdc:mga0qj67_274494_c1 nmdc:mga0qj67_274494_c1_659_1090 142
1765 3300050510 nmdc:mga06r32_1087718_c1 nmdc:mga06r32_1087718_c1_279_710 142
1766 3300050511 nmdc:mga08y16_109076_c1 nmdc:mga08y16_109076_c1_1652_2080 142
1767 3300050513 nmdc:mga0rr50_354826_c1 nmdc:mga0rr50_354826_c1_616_1047 142
1768 3300050515 nmdc:mga0a205_994920_c1 nmdc:mga0a205_994920_c1_198_626 142
1769 3300053077 Ga0495601_0010480 Ga0495601_0010480_2230_2658 142
1770 3300053077 Ga0495601_0160426 Ga0495601_0160426_154_582 142
1771 3300053077 Ga0495601_0282131 Ga0495601_0282131_556_984 142
1772 3300053077 Ga0495601_0326856 Ga0495601_0326856_88_516 142
1773 3300053078 Ga0495612_0040570 Ga0495612_0040570_483_911 142
1774 3300053083 Ga0495655_0121314 Ga0495655_0121314_29_457 142
1775 3300053084 Ga0495595_0013597 Ga0495595_0013597_2826_3254 142
1776 3300053084 Ga0495595_0021231 Ga0495595_0021231_973_1401 142
1777 3300053084 Ga0495595_0051341 Ga0495595_0051341_1458_1886 142
1778 3300053084 Ga0495595_0454418 Ga0495595_0454418_104_532 142
1779 3300053085 Ga0495619_0152126 Ga0495619_0152126_266_694 142
1780 3300053085 Ga0495619_0211018 Ga0495619_0211018_191_619 142
1781 3300053085 Ga0495619_0359888 Ga0495619_0359888_10_438 142
1782 3300054114 Ga0501084_0000009 Ga0501084_0000009_51359_51787 142
1783 3300054114 Ga0501084_0495240 Ga0501084_0495240_323_751 142
1784 3300059421 Ga0590071_004749 Ga0590071_004749_2518_2961 142
1785 3300059424 Ga0590075_003144 Ga0590075_003144_1098_1541 142
1786 3300059426 Ga0590077_002501 Ga0590077_002501_1935_2378 142
1787 3300059426 Ga0590077_022239 Ga0590077_022239_886_1329 142
1788 3300059505 Ga0587083_0079311 Ga0587083_0079311_140_568 142
1789 3300059510 Ga0587090_070001 Ga0587090_070001_180_608 142
1790 3300059604 Ga0587098_094055 Ga0587098_094055_67_495 142
1791 3300059623 Ga0587101_050275 Ga0587101_050275_216_644 142
1792 3300059628 Ga0587122_014535 Ga0587122_014535_167_595 142
1793 3300059639 Ga0587062_035223 Ga0587062_035223_227_670 142
1794 3300059640 Ga0587067_022101 Ga0587067_022101_168_611 142
1795 3300060346 Ga0587111_0014126 Ga0587111_0014126_163_606 142
1796 3300061719 Ga0466962_0393360 Ga0466962_0393360_98_526 142
1797 3300061734 Ga0530510_0007767 Ga0530510_0007767_6230_6658 142
1798 3300001976 JGI24752J21851_1003622 JGI24752J21851_10036222 143
1799 3300002155 JGI24033J26618_1005831 JGI24033J26618_10058312 143
1800 3300002459 JGI24751J29686_10008254 JGI24751J29686_100082543 143
1801 3300003203 JGI25406J46586_10019070 JGI25406J46586_100190706 143
1802 3300005329 Ga0070683_100317032 Ga0070683_1003170322 143
1803 3300005344 Ga0070661_100020569 Ga0070661_1000205692 143
1804 3300005354 Ga0070675_100147487 Ga0070675_1001474873 143
1805 3300005365 Ga0070688_100384845 Ga0070688_1003848452 143
1806 3300005444 Ga0070694_100200138 Ga0070694_1002001382 143
1807 3300005455 Ga0070663_100021709 Ga0070663_1000217093 143
1808 3300005467 Ga0070706_100150532 Ga0070706_1001505322 143
1809 3300005518 Ga0070699_100065718 Ga0070699_1000657182 143
1810 3300005535 Ga0070684_100018918 Ga0070684_1000189184 143
1811 3300005536 Ga0070697_100463401 Ga0070697_1004634012 143
1812 3300005564 Ga0070664_100007420 Ga0070664_1000074204 143
1813 3300005577 Ga0068857_100370052 Ga0068857_1003700522 143
1814 3300005618 Ga0068864_100035591 Ga0068864_1000355913 143
1815 3300005719 Ga0068861_100263519 Ga0068861_1002635192 143
1816 3300005840 Ga0068870_10000596 Ga0068870_100005963 143
1817 3300005841 Ga0068863_100014900 Ga0068863_1000149004 143
1818 3300005844 Ga0068862_101624863 Ga0068862_1016248631 143
1819 3300005937 Ga0081455_10154898 Ga0081455_101548982 143
1820 3300005985 Ga0081539_10070455 Ga0081539_100704552 143
1821 3300006844 Ga0075428_100092808 Ga0075428_1000928083 143
1822 3300006844 Ga0075428_100448665 Ga0075428_1004486652 143
1823 3300006844 Ga0075428_100453423 Ga0075428_1004534232 143
1824 3300006844 Ga0075428_101026126 Ga0075428_1010261261 143
1825 3300006846 Ga0075430_100045729 Ga0075430_1000457292 143
1826 3300006847 Ga0075431_100015177 Ga0075431_1000151776 143
1827 3300006847 Ga0075431_100699339 Ga0075431_1006993392 143
1828 3300006852 Ga0075433_10001327 Ga0075433_1000132721 143
1829 3300006871 Ga0075434_100034497 Ga0075434_1000344972 143
1830 3300006880 Ga0075429_100040192 Ga0075429_1000401926 143
1831 3300006880 Ga0075429_100205731 Ga0075429_1002057312 143
1832 3300006880 Ga0075429_101182442 Ga0075429_1011824422 143
1833 3300006914 Ga0075436_100091533 Ga0075436_1000915333 143
1834 3300007076 Ga0075435_100005327 Ga0075435_1000053276 143
1835 3300007788 Ga0099795_10492754 Ga0099795_104927541 143
1836 3300009011 Ga0105251_10028969 Ga0105251_100289692 143
1837 3300009098 Ga0105245_11662823 Ga0105245_116628232 143
1838 3300009147 Ga0114129_10052046 Ga0114129_100520466 143
1839 3300009147 Ga0114129_11011488 Ga0114129_110114882 143
1840 3300010159 Ga0099796_10352435 Ga0099796_103524352 143
1841 3300014325 Ga0163163_10050508 Ga0163163_100505082 143
1842 3300025885 Ga0207653_10013390 Ga0207653_100133903 143
1843 3300025908 Ga0207643_10000118 Ga0207643_1000011835 143
1844 3300025910 Ga0207684_10007980 Ga0207684_100079802 143
1845 3300025920 Ga0207649_10009225 Ga0207649_100092253 143
1846 3300025925 Ga0207650_10005281 Ga0207650_1000528116 143
1847 3300025926 Ga0207659_10101657 Ga0207659_101016572 143
1848 3300025928 Ga0207700_11086053 Ga0207700_110860532 143
1849 3300025944 Ga0207661_10336547 Ga0207661_103365472 143
1850 3300025945 Ga0207679_10028510 Ga0207679_100285105 143
1851 3300025961 Ga0207712_12114502 Ga0207712_121145021 143
1852 3300026067 Ga0207678_10006698 Ga0207678_100066984 143
1853 3300026075 Ga0207708_10003011 Ga0207708_100030117 143
1854 3300026088 Ga0207641_10009660 Ga0207641_100096603 143
1855 3300026095 Ga0207676_10008250 Ga0207676_1000825013 143
1856 3300026116 Ga0207674_10026443 Ga0207674_100264434 143
1857 3300026118 Ga0207675_101110007 Ga0207675_1011100072 143
1858 3300028380 Ga0268265_10203485 Ga0268265_102034852 143
1859 3300034957 Ga0373938_0029034 Ga0373938_0029034_290_721 143
1860 3300035091 Ga0373951_0033685 Ga0373951_0033685_81_512 143
1861 3300035121 Ga0373960_0089850 Ga0373960_0089850_159_590 143
1862 3300035170 Ga0373943_0050963 Ga0373943_0050963_1089_1520 143
1863 3300035241 Ga0373961_0011559 Ga0373961_0011559_612_1043 143
1864 3300035691 Ga0373931_0021484 Ga0373931_0021484_2019_2450 143
1865 3300035725 Ga0373947_0032749 Ga0373947_0032749_1045_1476 143
1866 3300039447 Ga0436361_0165391 Ga0436361_0165391_2794_3225 143
1867 3300042461 Ga0439460_0109892 Ga0439460_0109892_297_728 143
1868 3300042993 Ga0439440_0007639 Ga0439440_0007639_28_459 143
1869 3300046452 Ga0495617_076749 Ga0495617_076749_198_629 143
1870 3300046453 Ga0495627_127732 Ga0495627_127732_230_661 143
1871 3300046455 Ga0495603_0277838 Ga0495603_0277838_322_753 143
1872 3300046458 Ga0495591_048589 Ga0495591_048589_426_857 143
1873 3300046458 Ga0495591_067817 Ga0495591_067817_392_823 143
1874 3300046458 Ga0495591_161625 Ga0495591_161625_24_455 143
1875 3300046472 Ga0495580_0522566 Ga0495580_0522566_142_573 143
1876 3300046474 Ga0495605_0087355 Ga0495605_0087355_678_1109 143
1877 3300046491 Ga0495584_0122972 Ga0495584_0122972_653_1084 143
1878 3300046491 Ga0495584_0409309 Ga0495584_0409309_51_482 143
1879 3300046500 Ga0495596_0143156 Ga0495596_0143156_178_612 143
1880 3300046500 Ga0495596_0151129 Ga0495596_0151129_366_797 143
1881 3300046501 Ga0495607_0042801 Ga0495607_0042801_877_1308 143
1882 3300046501 Ga0495607_0097459 Ga0495607_0097459_197_628 143
1883 3300046506 Ga0495583_0312142 Ga0495583_0312142_181_612 143
1884 3300046517 Ga0495630_0101279 Ga0495630_0101279_356_787 143
1885 3300046520 Ga0495637_0031749 Ga0495637_0031749_1395_1826 143
1886 3300046520 Ga0495637_0153615 Ga0495637_0153615_369_800 143
1887 3300046537 Ga0495598_0046509 Ga0495598_0046509_56_487 143
1888 3300046538 Ga0495609_0437674 Ga0495609_0437674_77_508 143
1889 3300046558 Ga0495633_0065162 Ga0495633_0065162_282_713 143
1890 3300046615 Ga0495656_0257237 Ga0495656_0257237_426_857 143
1891 3300046648 Ga0495611_0040505 Ga0495611_0040505_259_690 143
1892 3300046664 Ga0495659_0017260 Ga0495659_0017260_1305_1736 143
1893 3300046684 Ga0495669_0068485 Ga0495669_0068485_492_923 143
1894 3300047321 Ga0495676_0339368 Ga0495676_0339368_21_452 143
1895 3300048089 Ga0495614_0114069 Ga0495614_0114069_192_623 143
1896 3300048911 Ga0496108_0063701 Ga0496108_0063701_819_1250 143
1897 3300048912 Ga0496109_0157500 Ga0496109_0157500_1428_1859 143
1898 3300050507 nmdc:mga05p37_1025064_c1 nmdc:mga05p37_1025064_c1_374_805 143
1899 3300050507 nmdc:mga05p37_610222_c1 nmdc:mga05p37_610222_c1_477_908 143
1900 3300050508 nmdc:mga09592_633323_c1 nmdc:mga09592_633323_c1_382_813 143
1901 3300050508 nmdc:mga09592_8476_c1 nmdc:mga09592_8476_c1_3897_4328 143
1902 3300050509 nmdc:mga0qj67_10423_c1 nmdc:mga0qj67_10423_c1_660_1091 143
1903 3300050509 nmdc:mga0qj67_76794_c1 nmdc:mga0qj67_76794_c1_185_616 143
1904 3300050510 nmdc:mga06r32_1660298_c1 nmdc:mga06r32_1660298_c1_95_526 143
1905 3300050510 nmdc:mga06r32_89471_c1 nmdc:mga06r32_89471_c1_68_499 143
1906 3300050512 nmdc:mga0n895_9528_c1 nmdc:mga0n895_9528_c1_4108_4539 143
1907 3300050513 nmdc:mga0rr50_10465_c1 nmdc:mga0rr50_10465_c1_3753_4184 143
1908 3300050514 nmdc:mga08x19_212906_c1 nmdc:mga08x19_212906_c1_120_551 143
1909 3300050515 nmdc:mga0a205_5197_c1 nmdc:mga0a205_5197_c1_4538_4969 143

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00298

Ribosomal_L11

Ribosomal protein L11, RNA binding domain

67

135

0.99

PF03946

Ribosomal_L11_N

Ribosomal protein L11, N-terminal domain

5

62

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
3cjt-assembly4.cif.gz_H ribosomal protein l11 methyltransferase (prma) in complex with dimethylated ribosomal protein l11 0.99 4 73
3egv-assembly1.cif.gz_B ribosomal protein l11 methyltransferase (prma) in complex with trimethylated ribosomal protein l11 0.9889 4 79
1y39-assembly2.cif.gz_B co-evolution of protein and rna structures within a highly conserved ribosomal domain 0.9849 72 141
1mms-assembly2.cif.gz_B crystal structure of the ribosomal protein l11-rna complex 0.9845 72 140
1hc8-assembly2.cif.gz_B crystal structure of a conserved ribosomal protein-rna complex 0.9826 72 139
ID Description Score Start End Superfamily
af_I1J9L7_135_215_1.10.10.250 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Ribosomal protein L11/L12, C-terminal domain 0.9905 73 139 1.10.10.250
3egvB00 Alpha Beta;2-Layer Sandwich;Ribosomal protein L11, N-terminal domain;Ribosomal protein L11/L12, N-terminal domain 0.9889 4 79 3.30.1550.10
af_A0A0R4J4M9_4_71_3.30.1550.10 Alpha Beta;2-Layer Sandwich;Ribosomal protein L11, N-terminal domain;Ribosomal protein L11/L12, N-terminal domain 0.9846 4 69 3.30.1550.10
1vq4I00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Ribosomal protein L11/L12, C-terminal domain 0.9722 74 139 1.10.10.250
3egvB00 Alpha Beta;2-Layer Sandwich;Ribosomal protein L11, N-terminal domain;Ribosomal protein L11/L12, N-terminal domain 0.9639 4 79 3.30.1550.10
ID Description Score Start End GO Terms
AF-A0A810KZ93-F1-model_v4 Large ribosomal subunit protein uL11 1.001 37 141 GO:0003735
GO:0006412
GO:0022625
GO:0070180
AF-A0A151C1I8-F1-model_v4 Large ribosomal subunit protein uL11 1.001 37 139 GO:0003735
GO:0006412
GO:0022625
GO:0070180
AF-A0A3C1P6L7-F1-model_v4 50S ribosomal protein L11 0.999 57 141 GO:0003735
GO:0006412
GO:0022625
GO:0070180
AF-A0A348UTG4-F1-model_v4 50S ribosomal protein L11 0.9987 30 140 GO:0003735
GO:0006412
GO:0022625
GO:0070180
AF-X1DEG0-F1-model_v4 Ribosomal protein L11 C-terminal domain-containing protein 0.998 25 139 GO:0003735
GO:0006412
GO:0022625
GO:0070180

Feature Viewer

pLDDT pTM Quality
92.41 0.78 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map